(data stored in ACNUC7421 zone)

EMBL: CP001750

ID   CP001750; SV 1; circular; genomic DNA; STD; PRO; 2636367 BP.
XX
AC   CP001750;
XX
PR   Project:PRJNA17583;
XX
DT   07-JAN-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bifidobacterium dentium Bd1, complete genome.
XX
KW   .
XX
OS   Bifidobacterium dentium Bd1
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Bifidobacterium.
XX
RN   [1]
RP   1-2636367
RX   DOI; 10.1371/journal.pgen.1000785.
RX   PUBMED; 20041198.
RA   Ventura M., Turroni F., Zomer A., Foroni E., Giubellini V., Bottacini F.,
RA   Canchaya C., Claesson M.J., He F., Mantzourani M., Mulas L., Ferrarini A.,
RA   Gao B., Delledonne M., Henrissat B., Coutinho P., Oggioni M., Gupta R.S.,
RA   Zhang Z., Beighton D., Fitzgerald G.F., O'Toole P.W., van Sinderen D.;
RT   "The Bifidobacterium dentium Bd1 genome sequence reflects its genetic
RT   adaptation to the human oral cavity";
RL   PloS Genet. 5(12):E1000785-E1000785(2009).
XX
RN   [2]
RP   1-2636367
RA   van Sinderen D., Fitzgerald G.F., O'Toole P.W.;
RT   ;
RL   Submitted (30-JUL-2009) to the INSDC.
RL   Alimentary Pharmabiotic Centre and Department of Microbiology, Bioscience
RL   Institute, National University of Ireland, Cork, Ireland
XX
RN   [3]
RP   1-2636367
RA   Ventura M., Turroni F., Foroni E., Giubellini V., Bottacini F.;
RT   ;
RL   Submitted (30-JUL-2009) to the INSDC.
RL   Department of Genetics, Biology of Microorganisms, Anthropology and
RL   Evolution, University of Parma, Parma, Italy
XX
DR   MD5; 48e880c7f37696907e3906083f43aafe.
DR   BioSample; SAMN02603177.
DR   EnsemblGenomes-Gn; BDP_1rRNA5S.
DR   EnsemblGenomes-Gn; BDP_2rRNA16S.
DR   EnsemblGenomes-Gn; BDP_2rRNA23S.
DR   EnsemblGenomes-Gn; BDP_2rRNA5S.
DR   EnsemblGenomes-Gn; BDP_3rRNA16S.
DR   EnsemblGenomes-Gn; BDP_3rRNA23S.
DR   EnsemblGenomes-Gn; BDP_3rRNA5S.
DR   EnsemblGenomes-Gn; BDP_4rRNA16S.
DR   EnsemblGenomes-Gn; BDP_4rRNA23S.
DR   EnsemblGenomes-Gn; BDP_4rRNA5S.
DR   EnsemblGenomes-Gn; BDP_5rRNA16S.
DR   EnsemblGenomes-Gn; BDP_5rRNA23S.
DR   EnsemblGenomes-Gn; BDP_5rRNA5S.
DR   EnsemblGenomes-Gn; BDP_tRNA1.
DR   EnsemblGenomes-Gn; BDP_tRNA10.
DR   EnsemblGenomes-Gn; BDP_tRNA11.
DR   EnsemblGenomes-Gn; BDP_tRNA12.
DR   EnsemblGenomes-Gn; BDP_tRNA13.
DR   EnsemblGenomes-Gn; BDP_tRNA14.
DR   EnsemblGenomes-Gn; BDP_tRNA15.
DR   EnsemblGenomes-Gn; BDP_tRNA16.
DR   EnsemblGenomes-Gn; BDP_tRNA17.
DR   EnsemblGenomes-Gn; BDP_tRNA18.
DR   EnsemblGenomes-Gn; BDP_tRNA19.
DR   EnsemblGenomes-Gn; BDP_tRNA2.
DR   EnsemblGenomes-Gn; BDP_tRNA20.
DR   EnsemblGenomes-Gn; BDP_tRNA21.
DR   EnsemblGenomes-Gn; BDP_tRNA22.
DR   EnsemblGenomes-Gn; BDP_tRNA23.
DR   EnsemblGenomes-Gn; BDP_tRNA24.
DR   EnsemblGenomes-Gn; BDP_tRNA25.
DR   EnsemblGenomes-Gn; BDP_tRNA26.
DR   EnsemblGenomes-Gn; BDP_tRNA27.
DR   EnsemblGenomes-Gn; BDP_tRNA28.
DR   EnsemblGenomes-Gn; BDP_tRNA29.
DR   EnsemblGenomes-Gn; BDP_tRNA3.
DR   EnsemblGenomes-Gn; BDP_tRNA30.
DR   EnsemblGenomes-Gn; BDP_tRNA31.
DR   EnsemblGenomes-Gn; BDP_tRNA32.
DR   EnsemblGenomes-Gn; BDP_tRNA33.
DR   EnsemblGenomes-Gn; BDP_tRNA34.
DR   EnsemblGenomes-Gn; BDP_tRNA35.
DR   EnsemblGenomes-Gn; BDP_tRNA36.
DR   EnsemblGenomes-Gn; BDP_tRNA37.
DR   EnsemblGenomes-Gn; BDP_tRNA38.
DR   EnsemblGenomes-Gn; BDP_tRNA39.
DR   EnsemblGenomes-Gn; BDP_tRNA4.
DR   EnsemblGenomes-Gn; BDP_tRNA40.
DR   EnsemblGenomes-Gn; BDP_tRNA41.
DR   EnsemblGenomes-Gn; BDP_tRNA42.
DR   EnsemblGenomes-Gn; BDP_tRNA43.
DR   EnsemblGenomes-Gn; BDP_tRNA44.
DR   EnsemblGenomes-Gn; BDP_tRNA45.
DR   EnsemblGenomes-Gn; BDP_tRNA46.
DR   EnsemblGenomes-Gn; BDP_tRNA47.
DR   EnsemblGenomes-Gn; BDP_tRNA48.
DR   EnsemblGenomes-Gn; BDP_tRNA49.
DR   EnsemblGenomes-Gn; BDP_tRNA5.
DR   EnsemblGenomes-Gn; BDP_tRNA50.
DR   EnsemblGenomes-Gn; BDP_tRNA51.
DR   EnsemblGenomes-Gn; BDP_tRNA52.
DR   EnsemblGenomes-Gn; BDP_tRNA53.
DR   EnsemblGenomes-Gn; BDP_tRNA54.
DR   EnsemblGenomes-Gn; BDP_tRNA55.
DR   EnsemblGenomes-Gn; BDP_tRNA6.
DR   EnsemblGenomes-Gn; BDP_tRNA7.
DR   EnsemblGenomes-Gn; BDP_tRNA8.
DR   EnsemblGenomes-Gn; BDP_tRNA9.
DR   EnsemblGenomes-Gn; EBG00001090408.
DR   EnsemblGenomes-Gn; EBG00001090409.
DR   EnsemblGenomes-Gn; EBG00001090410.
DR   EnsemblGenomes-Gn; EBG00001090411.
DR   EnsemblGenomes-Gn; EBG00001090412.
DR   EnsemblGenomes-Gn; EBG00001090413.
DR   EnsemblGenomes-Gn; EBG00001090414.
DR   EnsemblGenomes-Gn; EBG00001090415.
DR   EnsemblGenomes-Gn; EBG00001090416.
DR   EnsemblGenomes-Gn; EBG00001090417.
DR   EnsemblGenomes-Gn; EBG00001090418.
DR   EnsemblGenomes-Gn; EBG00001090419.
DR   EnsemblGenomes-Gn; EBG00001090420.
DR   EnsemblGenomes-Gn; EBG00001090421.
DR   EnsemblGenomes-Gn; EBG00001090422.
DR   EnsemblGenomes-Gn; EBG00001090423.
DR   EnsemblGenomes-Gn; EBG00001090424.
DR   EnsemblGenomes-Gn; EBG00001090425.
DR   EnsemblGenomes-Gn; EBG00001090426.
DR   EnsemblGenomes-Gn; EBG00001090427.
DR   EnsemblGenomes-Gn; EBG00001090428.
DR   EnsemblGenomes-Gn; EBG00001090429.
DR   EnsemblGenomes-Gn; EBG00001090430.
DR   EnsemblGenomes-Gn; EBG00001090431.
DR   EnsemblGenomes-Gn; EBG00001090432.
DR   EnsemblGenomes-Gn; EBG00001090433.
DR   EnsemblGenomes-Gn; EBG00001090434.
DR   EnsemblGenomes-Gn; EBG00001090435.
DR   EnsemblGenomes-Gn; EBG00001090436.
DR   EnsemblGenomes-Gn; EBG00001090437.
DR   EnsemblGenomes-Gn; EBG00001090438.
DR   EnsemblGenomes-Gn; EBG00001090439.
DR   EnsemblGenomes-Gn; EBG00001090440.
DR   EnsemblGenomes-Gn; EBG00001090441.
DR   EnsemblGenomes-Gn; EBG00001090442.
DR   EnsemblGenomes-Gn; EBG00001090443.
DR   EnsemblGenomes-Gn; EBG00001090444.
DR   EnsemblGenomes-Gn; EBG00001090445.
DR   EnsemblGenomes-Gn; EBG00001090446.
DR   EnsemblGenomes-Gn; EBG00001090447.
DR   EnsemblGenomes-Gn; EBG00001090448.
DR   EnsemblGenomes-Gn; EBG00001090449.
DR   EnsemblGenomes-Gn; EBG00001090450.
DR   EnsemblGenomes-Gn; EBG00001090451.
DR   EnsemblGenomes-Gn; EBG00001090452.
DR   EnsemblGenomes-Gn; EBG00001090453.
DR   EnsemblGenomes-Gn; EBG00001090454.
DR   EnsemblGenomes-Gn; EBG00001090455.
DR   EnsemblGenomes-Gn; EBG00001090456.
DR   EnsemblGenomes-Gn; EBG00001090457.
DR   EnsemblGenomes-Gn; EBG00001090458.
DR   EnsemblGenomes-Gn; EBG00001090459.
DR   EnsemblGenomes-Gn; EBG00001090460.
DR   EnsemblGenomes-Gn; EBG00001090461.
DR   EnsemblGenomes-Gn; EBG00001090462.
DR   EnsemblGenomes-Gn; EBG00001090463.
DR   EnsemblGenomes-Gn; EBG00001090464.
DR   EnsemblGenomes-Gn; EBG00001090465.
DR   EnsemblGenomes-Gn; EBG00001090466.
DR   EnsemblGenomes-Gn; EBG00001090467.
DR   EnsemblGenomes-Gn; EBG00001090468.
DR   EnsemblGenomes-Gn; EBG00001090469.
DR   EnsemblGenomes-Gn; EBG00001090470.
DR   EnsemblGenomes-Gn; EBG00001090471.
DR   EnsemblGenomes-Gn; EBG00001090472.
DR   EnsemblGenomes-Gn; EBG00001090473.
DR   EnsemblGenomes-Gn; EBG00001090474.
DR   EnsemblGenomes-Gn; EBG00001090475.
DR   EnsemblGenomes-Gn; EBG00001090476.
DR   EnsemblGenomes-Gn; EBG00001090477.
DR   EnsemblGenomes-Gn; EBG00001090478.
DR   EnsemblGenomes-Gn; EBG00001090479.
DR   EnsemblGenomes-Gn; EBG00001090480.
DR   EnsemblGenomes-Gn; EBG00001090481.
DR   EnsemblGenomes-Gn; EBG00001090482.
DR   EnsemblGenomes-Gn; EBG00001090483.
DR   EnsemblGenomes-Tr; BDP_1rRNA5S-1.
DR   EnsemblGenomes-Tr; BDP_2rRNA16S-1.
DR   EnsemblGenomes-Tr; BDP_2rRNA23S-1.
DR   EnsemblGenomes-Tr; BDP_2rRNA5S-1.
DR   EnsemblGenomes-Tr; BDP_3rRNA16S-1.
DR   EnsemblGenomes-Tr; BDP_3rRNA23S-1.
DR   EnsemblGenomes-Tr; BDP_3rRNA5S-1.
DR   EnsemblGenomes-Tr; BDP_4rRNA16S-1.
DR   EnsemblGenomes-Tr; BDP_4rRNA23S-1.
DR   EnsemblGenomes-Tr; BDP_4rRNA5S-1.
DR   EnsemblGenomes-Tr; BDP_5rRNA16S-1.
DR   EnsemblGenomes-Tr; BDP_5rRNA23S-1.
DR   EnsemblGenomes-Tr; BDP_5rRNA5S-1.
DR   EnsemblGenomes-Tr; BDP_tRNA1-1.
DR   EnsemblGenomes-Tr; BDP_tRNA10-1.
DR   EnsemblGenomes-Tr; BDP_tRNA11-1.
DR   EnsemblGenomes-Tr; BDP_tRNA12-1.
DR   EnsemblGenomes-Tr; BDP_tRNA13-1.
DR   EnsemblGenomes-Tr; BDP_tRNA14-1.
DR   EnsemblGenomes-Tr; BDP_tRNA15-1.
DR   EnsemblGenomes-Tr; BDP_tRNA16-1.
DR   EnsemblGenomes-Tr; BDP_tRNA17-1.
DR   EnsemblGenomes-Tr; BDP_tRNA18-1.
DR   EnsemblGenomes-Tr; BDP_tRNA19-1.
DR   EnsemblGenomes-Tr; BDP_tRNA2-1.
DR   EnsemblGenomes-Tr; BDP_tRNA20-1.
DR   EnsemblGenomes-Tr; BDP_tRNA21-1.
DR   EnsemblGenomes-Tr; BDP_tRNA22-1.
DR   EnsemblGenomes-Tr; BDP_tRNA23-1.
DR   EnsemblGenomes-Tr; BDP_tRNA24-1.
DR   EnsemblGenomes-Tr; BDP_tRNA25-1.
DR   EnsemblGenomes-Tr; BDP_tRNA26-1.
DR   EnsemblGenomes-Tr; BDP_tRNA27-1.
DR   EnsemblGenomes-Tr; BDP_tRNA28-1.
DR   EnsemblGenomes-Tr; BDP_tRNA29-1.
DR   EnsemblGenomes-Tr; BDP_tRNA3-1.
DR   EnsemblGenomes-Tr; BDP_tRNA30-1.
DR   EnsemblGenomes-Tr; BDP_tRNA31-1.
DR   EnsemblGenomes-Tr; BDP_tRNA32-1.
DR   EnsemblGenomes-Tr; BDP_tRNA33-1.
DR   EnsemblGenomes-Tr; BDP_tRNA34-1.
DR   EnsemblGenomes-Tr; BDP_tRNA35-1.
DR   EnsemblGenomes-Tr; BDP_tRNA36-1.
DR   EnsemblGenomes-Tr; BDP_tRNA37-1.
DR   EnsemblGenomes-Tr; BDP_tRNA38-1.
DR   EnsemblGenomes-Tr; BDP_tRNA39-1.
DR   EnsemblGenomes-Tr; BDP_tRNA4-1.
DR   EnsemblGenomes-Tr; BDP_tRNA40-1.
DR   EnsemblGenomes-Tr; BDP_tRNA41-1.
DR   EnsemblGenomes-Tr; BDP_tRNA42-1.
DR   EnsemblGenomes-Tr; BDP_tRNA43-1.
DR   EnsemblGenomes-Tr; BDP_tRNA44-1.
DR   EnsemblGenomes-Tr; BDP_tRNA45-1.
DR   EnsemblGenomes-Tr; BDP_tRNA46-1.
DR   EnsemblGenomes-Tr; BDP_tRNA47-1.
DR   EnsemblGenomes-Tr; BDP_tRNA48-1.
DR   EnsemblGenomes-Tr; BDP_tRNA49-1.
DR   EnsemblGenomes-Tr; BDP_tRNA5-1.
DR   EnsemblGenomes-Tr; BDP_tRNA50-1.
DR   EnsemblGenomes-Tr; BDP_tRNA51-1.
DR   EnsemblGenomes-Tr; BDP_tRNA52-1.
DR   EnsemblGenomes-Tr; BDP_tRNA53-1.
DR   EnsemblGenomes-Tr; BDP_tRNA54-1.
DR   EnsemblGenomes-Tr; BDP_tRNA55-1.
DR   EnsemblGenomes-Tr; BDP_tRNA6-1.
DR   EnsemblGenomes-Tr; BDP_tRNA7-1.
DR   EnsemblGenomes-Tr; BDP_tRNA8-1.
DR   EnsemblGenomes-Tr; BDP_tRNA9-1.
DR   EnsemblGenomes-Tr; EBT00001544833.
DR   EnsemblGenomes-Tr; EBT00001544834.
DR   EnsemblGenomes-Tr; EBT00001544836.
DR   EnsemblGenomes-Tr; EBT00001544837.
DR   EnsemblGenomes-Tr; EBT00001544838.
DR   EnsemblGenomes-Tr; EBT00001544840.
DR   EnsemblGenomes-Tr; EBT00001544841.
DR   EnsemblGenomes-Tr; EBT00001544842.
DR   EnsemblGenomes-Tr; EBT00001544844.
DR   EnsemblGenomes-Tr; EBT00001544846.
DR   EnsemblGenomes-Tr; EBT00001544848.
DR   EnsemblGenomes-Tr; EBT00001544849.
DR   EnsemblGenomes-Tr; EBT00001544850.
DR   EnsemblGenomes-Tr; EBT00001544852.
DR   EnsemblGenomes-Tr; EBT00001544853.
DR   EnsemblGenomes-Tr; EBT00001544855.
DR   EnsemblGenomes-Tr; EBT00001544856.
DR   EnsemblGenomes-Tr; EBT00001544857.
DR   EnsemblGenomes-Tr; EBT00001544859.
DR   EnsemblGenomes-Tr; EBT00001544860.
DR   EnsemblGenomes-Tr; EBT00001544862.
DR   EnsemblGenomes-Tr; EBT00001544864.
DR   EnsemblGenomes-Tr; EBT00001544865.
DR   EnsemblGenomes-Tr; EBT00001544866.
DR   EnsemblGenomes-Tr; EBT00001544868.
DR   EnsemblGenomes-Tr; EBT00001544869.
DR   EnsemblGenomes-Tr; EBT00001544871.
DR   EnsemblGenomes-Tr; EBT00001544872.
DR   EnsemblGenomes-Tr; EBT00001544874.
DR   EnsemblGenomes-Tr; EBT00001544876.
DR   EnsemblGenomes-Tr; EBT00001544877.
DR   EnsemblGenomes-Tr; EBT00001544879.
DR   EnsemblGenomes-Tr; EBT00001544880.
DR   EnsemblGenomes-Tr; EBT00001544882.
DR   EnsemblGenomes-Tr; EBT00001544883.
DR   EnsemblGenomes-Tr; EBT00001544885.
DR   EnsemblGenomes-Tr; EBT00001544886.
DR   EnsemblGenomes-Tr; EBT00001544888.
DR   EnsemblGenomes-Tr; EBT00001544889.
DR   EnsemblGenomes-Tr; EBT00001544891.
DR   EnsemblGenomes-Tr; EBT00001544892.
DR   EnsemblGenomes-Tr; EBT00001544894.
DR   EnsemblGenomes-Tr; EBT00001544896.
DR   EnsemblGenomes-Tr; EBT00001544897.
DR   EnsemblGenomes-Tr; EBT00001544899.
DR   EnsemblGenomes-Tr; EBT00001544901.
DR   EnsemblGenomes-Tr; EBT00001544902.
DR   EnsemblGenomes-Tr; EBT00001544903.
DR   EnsemblGenomes-Tr; EBT00001544905.
DR   EnsemblGenomes-Tr; EBT00001544906.
DR   EnsemblGenomes-Tr; EBT00001544908.
DR   EnsemblGenomes-Tr; EBT00001544909.
DR   EnsemblGenomes-Tr; EBT00001544911.
DR   EnsemblGenomes-Tr; EBT00001544912.
DR   EnsemblGenomes-Tr; EBT00001544913.
DR   EnsemblGenomes-Tr; EBT00001544915.
DR   EnsemblGenomes-Tr; EBT00001544916.
DR   EnsemblGenomes-Tr; EBT00001544917.
DR   EnsemblGenomes-Tr; EBT00001544919.
DR   EnsemblGenomes-Tr; EBT00001544921.
DR   EnsemblGenomes-Tr; EBT00001544922.
DR   EnsemblGenomes-Tr; EBT00001544924.
DR   EnsemblGenomes-Tr; EBT00001544926.
DR   EnsemblGenomes-Tr; EBT00001544927.
DR   EnsemblGenomes-Tr; EBT00001544929.
DR   EnsemblGenomes-Tr; EBT00001544931.
DR   EnsemblGenomes-Tr; EBT00001544933.
DR   EnsemblGenomes-Tr; EBT00001544935.
DR   EnsemblGenomes-Tr; EBT00001544936.
DR   EnsemblGenomes-Tr; EBT00001544938.
DR   EnsemblGenomes-Tr; EBT00001544939.
DR   EnsemblGenomes-Tr; EBT00001544941.
DR   EnsemblGenomes-Tr; EBT00001544943.
DR   EnsemblGenomes-Tr; EBT00001544945.
DR   EnsemblGenomes-Tr; EBT00001544947.
DR   EnsemblGenomes-Tr; EBT00001544949.
DR   EuropePMC; PMC2788695; 20041198.
DR   EuropePMC; PMC2869134; 20348296.
DR   EuropePMC; PMC2937518; 20805404.
DR   EuropePMC; PMC4178631; 25107967.
DR   EuropePMC; PMC4178644; 25085493.
DR   EuropePMC; PMC4472781; 26086721.
DR   EuropePMC; PMC4908950; 27379055.
DR   EuropePMC; PMC4965825; 27468806.
DR   EuropePMC; PMC5540593; 28764658.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001750.
DR   SILVA-SSU; CP001750.
XX
CC   Bacteria is available from Dr. Marco Ventura, Probiogenomics Lab,
CC   Department of  Genetics, Biology of Microorganisms, Anthropology,
CC   Evolution, University of Parma, Phone: +390521905666, Fax:
CC   +390521905604, E-mail: marco.ventura@unipr.it.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2636367
FT                   /organism="Bifidobacterium dentium Bd1"
FT                   /strain="Bd1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:401473"
FT   gene            1..1503
FT                   /gene="dnaA"
FT                   /locus_tag="BDP_0001"
FT   CDS_pept        1..1503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BDP_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08700"
FT                   /db_xref="GOA:D2Q6H8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6H8"
FT                   /protein_id="ADB08700.1"
FT                   /translation="MVDTPHNPLDQARGVWSDALALLRQNPKLSARDKGWLENVVPEGM
FT                   WGPTIVLCVPSAATQQALQTELNQPLMEALKDSAEQDIFPAFKIVPMQQTVEPDIEEYP
FT                   HFDRKPRTQREESTQGQLPIPASMPEQPFRPTEQGTFTSGQNRPLLDPQTHLNKNATFD
FT                   TFVPGDSNRFARTVALAVAEGSGHDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPNLKV
FT                   RYVTSEEFTNEFIEALGDTNQNSGQIKEFNRRYREVDVLLIDDIQFLSGKEATLEQFFH
FT                   TFNTLHQANKRIVIASDVPPKDLKGFQARLISRFESGLTVDVKPPDLETRIAILRMMAT
FT                   MNGSNIPNDVLNLIAERFTENIRELEGALNRVTAMASLSNQPVTRALAEHTLQDFFTSD
FT                   VEIKPADIISQVAKYFHLTFDDIVGRSRTKNIALARQVAMYLVRELTSMSLNDIGLVFG
FT                   GKDHTTVMHAYTRISDEMQEKQEIYNYVMELTVRLKQHSSEK"
FT   gene            1978..3102
FT                   /locus_tag="BDP_0002"
FT   CDS_pept        1978..3102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08701"
FT                   /db_xref="GOA:D2Q6H9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6H9"
FT                   /protein_id="ADB08701.1"
FT                   /translation="MKVEINSQALADAVAWTTRVIDARPATPILAGIRLEAIDGTLQLS
FT                   AFNYAISARHHIEAGIDEAGTALVLGKLLADITKSLPSEKTYLSTDGSTMTITSGKSTF
FT                   TMQLMPDNEYPDLPVVPAKLGQVDSPTFMQAVNQASVAVSREENRPVLTGIRVQFQGDK
FT                   VIMSSTDRFRLSRSSFTWTPENPDINTTALVRGALLRDVARSLDEHQNIVLDFDPESPS
FT                   LLGFENAGRVSTSQLIDGEFPAVDRLYADEYPIHAIIDKQSLIGAIKRVSLVAERNAPI
FT                   RMAFAGQELTLSAGTADEAQAKEIIDIDMDGDDITVAFNPSYLIEGLSAISEPFVRMKM
FT                   TTAVKPVEFNGQQEADSDESMDYRYLLVPMRFNS"
FT   gene            3187..4377
FT                   /gene="recF"
FT                   /locus_tag="BDP_0003"
FT   CDS_pept        3187..4377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BDP_0003"
FT                   /product="Recombinational DNA repair ATPase RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08702"
FT                   /db_xref="GOA:D2Q6I0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I0"
FT                   /protein_id="ADB08702.1"
FT                   /translation="MYISRLALDHYRSWERCVLDFEPGVNILQGANGLGKTNIVEAVEV
FT                   LSTGSSHRTSSSLPLIERGCASATIRANVEDDRNRHSYEVTIAARGANRARIDGGNSLY
FT                   MRDVIGKIPSVSFTPEDQRLVSGDPATRRNFINQAGALLIPHYMERLQQFTHVAKQRTA
FT                   LLKQLGDRGDFDPQYGRQAALSGLEIWTGQFIDIGMALTHDRATLIERLSEPFSRVYAS
FT                   LAGIDQQALLHYEPSFDEVMLYDDPAAEISRHFQRIYPGEVARGQNLIGPHRDDLTLTL
FT                   HGMPAREFASNGEMWTMALALKMALYETVCADQQTKPIVILDDVFAQLDESRREQILDF
FT                   ARRQDQVLITVAAASDIPATQAHVIDVAALRDHADDDDALGALMATLAAGRKAEER"
FT   gene            4377..4862
FT                   /locus_tag="BDP_0004"
FT   CDS_pept        4377..4862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0004"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08703"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I1"
FT                   /protein_id="ADB08703.1"
FT                   /translation="MTNPPVCDILKLDQRKLPAEVFERVSHRAGLLKERERKARLAWEN
FT                   FGKPGRDPQKVGNIFGLIATQGKWTPHLKIAQMQNHWDQVVGRENAMHTYPVSLRDGIL
FT                   TIRCDSPAWTTTMNYMIPELTRIIREKLEGLTINEVRVTGPQQQSFSRGRISRRTRY"
FT   gene            5076..7190
FT                   /gene="gyrB"
FT                   /locus_tag="BDP_0005"
FT   CDS_pept        5076..7190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BDP_0005"
FT                   /product="DNA gyrase"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08704"
FT                   /db_xref="GOA:D2Q6I2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I2"
FT                   /protein_id="ADB08704.1"
FT                   /translation="MQEGISVADLDADSLNESAENTQEDQIQNDQLEDAQLDDSLSPEH
FT                   YDASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYASHIEVTIL
FT                   PDGGVRVVDDGRGIPVDEVPGEGVSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVV
FT                   NALSTRVDIEVRRQGFHWTQTYVDQKPTARLAKGEPMAEGESTGTSVTFWADGKIFETT
FT                   TYDFETLRNRFQQMAFLNKGLKLSLTDLREPDQAGDEVAGELDETETKHQTVTYQYNEG
FT                   IKDYVDYLVKSRKATPVEEDVIDFEAEDLKIGISAEIAMQWTTAYSEAVHTFANTISTT
FT                   EGGTHEEGFRAALTSLINRYAREKNILKDKDENLSGDDVREGLTAVVSVKLTTPQFEGQ
FT                   TKTKLGNSEAKTFVQRVMTDKLGDWFDAHPSEAKNIIQKAIEASRARIAAKKARENTRR
FT                   KSIFESAGMPDKLKDCQSNNPEECELFIVEGDSAGGSAIQGRNPITQAILPLRGKILNT
FT                   ERASLDRMMKSETIESLITAVGGGYGEDFDLSKVRYHKVIIMADADVDGAHIATLNLTL
FT                   FFRYMRPMITAGYVYVAMPPLYRLKWTKGAHDFVYTDAERDRVLAEGKAAGRQLPKGEG
FT                   IQRYKGLGEMSYQELWETTMDPEHRILKQVQIEDAAAADETFSMLMGDEVEPRRLFIQR
FT                   NANKVSWIDA"
FT   gene            7216..9885
FT                   /gene="gyrA"
FT                   /locus_tag="BDP_0006"
FT   CDS_pept        7216..9885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BDP_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08705"
FT                   /db_xref="GOA:D2Q6I3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I3"
FT                   /protein_id="ADB08705.1"
FT                   /translation="MADENNNNEEGQFVPDGSMEPLSPQEADNTDYGLMTGERIQKKDL
FT                   RQEMRDSYLSYAMSVIVDRALPDVRDGLKPVHRRVIYAMYDGGYRPDRGYSKCARVVGE
FT                   VMGKYHPHGDSAIYDTLVRMAQSWSMRYMLVDGQGNFGSPGDDPAAAMRYTECRMAPLA
FT                   MEMVRDIDKDTVDFLPNYDGKTQEPTVLPARFPNLLCNGSSGIAVGMATNIPPHNMREV
FT                   AEGVHWALDHPEASREELLDNLIRIIKGPDFPTGATILGHKGIEQAYRTGRGLITMRAV
FT                   VNTEEIKGRMCLVITELPYQVNPDRLVVSIREAVRDGKIQGIADMRDETSGRTGQRLVL
FT                   VLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHWVSHQLDVIAR
FT                   RTAYLKREAEERDHILQGYLKALDMIDEVIALIRASESAETARTGLMDLLDVDEVQADA
FT                   ILAMQLRRLAALERQKILDEHNELMRKIADYNDILAKPERQRKIVGDELDEIVAKYGDE
FT                   RRTRILPYSGEMNVEDLIAEENVVVTVTHSGFIKRTKADEYRAQHRGGKGIKGAKLRED
FT                   DVVDHFFLTSTHNWLLFFTNKGRVYRLKAYELPEGSRDSKGQHVANLLQFGPDEAIQTV
FT                   LSIPNYEVAKYLVLATRSGKVKKTALAEYDSPRQGGLIAVRLMTDENGENADELIGAAL
FT                   CNAEDDIILVSKLGMSLKFQADDEQLRPMGRQTAGVQGMKFREGDELLAMDVVWGDSDK
FT                   DLLVVTNEGFAKRTAISEYRLQGRNGYGVKAVQLAEGRGSLVGAVIVEEDDQVMAIMKS
FT                   GKVIRSNVAEVKRTGRNTQGVTLAKPDKNDEIISIARNEEKENEDDEPAEGAPAEAVDG
FT                   QAVTTQSGENVEASAKTE"
FT   gene            9948..10499
FT                   /locus_tag="BDP_0007"
FT   CDS_pept        9948..10499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0007"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08706"
FT                   /db_xref="GOA:D2Q6I4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I4"
FT                   /protein_id="ADB08706.1"
FT                   /translation="MSENMEEQEPSAQSPASEAQETENHAPRVARSASSQPLIGAEQVR
FT                   AHEGAVKSVQGKSRRGAPRARRMSLSLTRIDAWSAAKVAFMLSIAGGIIQIVAAALLWM
FT                   MLNVVGVFDQVTQIVSSTGLDAGGFDLANVLSLSTVLSAVTIFSIIEVILITVLVTIVT
FT                   LLYNVVSTLVGGIHVTLGDD"
FT   gene            complement(10814..12160)
FT                   /locus_tag="BDP_0008"
FT   CDS_pept        complement(10814..12160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0008"
FT                   /product="Glutamate dehydrogenase"
FT                   /EC_number="1.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08707"
FT                   /db_xref="GOA:D2Q6I5"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I5"
FT                   /protein_id="ADB08707.1"
FT                   /translation="MLTDEYVKRVYTQVEQRDGDQPEFLQAVLEVFESLEPVVAKHPEY
FT                   EKAGVLERLVEPERVVKFRVAWTDDEGKVQVNRGYRVQFNSAIGPYKGGLRFHPSVNEG
FT                   VIKFLGFEQILKNSLTTLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMTELCRHIGQFTD
FT                   VPAGDINVGGREIGYLFGQYKRIRDEYSGVLTGKGLEFGGSLARTEATGYGLCYYTAEA
FT                   LRVLKNDSFEGKIVAISGSGNVAIFATEKAQALGAKVVTASDSNGYIYDPNGIQLDVVK
FT                   DIKLGHRGRIKEYAERVPGSEYHEGCKGVWTVPCDIALPCATQNEIDEESAKTLVANGC
FT                   TVVCEGANMPSTPEAIAVYQANNVLYGPAKAANAGGVAVSGLEMSQNSYRLSWSFEEVD
FT                   DKLKSIMENIVASSLAAAKEYGHEGDLMLGANAAGFVKVANAMVAQGVL"
FT   gene            12421..13440
FT                   /locus_tag="BDP_0009"
FT   CDS_pept        12421..13440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0009"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08708"
FT                   /db_xref="GOA:D2Q6I6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I6"
FT                   /protein_id="ADB08708.1"
FT                   /translation="MSANKAGRKASMGDVAAAAGVSKTTISRYLHGEFGYMSEQTKAKI
FT                   EGVIKELGYRPNKMAQSLKATVSHMVGVSIADMGNPFSSLLIKGIQEECRARDVQLLVS
FT                   DSNNQPTLERANIESLLDAQVDGLIVNTVGNNDDWLVRFHDRANRKPVVMLDRIVLPLI
FT                   YDSVTNNNDAAVREMLEYLKGQGFAYVVFVMRPGEGISTRTARRQAVERYCDDLGLGGE
FT                   VLVYDDGIDGLRSRIANLLELCGNRKTCLFANNDESMRDILEATSAGLRRHVGVCSFAD
FT                   EHWAKYSGPGITCLDQEPMLMGRRAAQKLFARIYDGSEEPCSLDEVPARLCIFASTEI"
FT   gene            13630..14955
FT                   /locus_tag="BDP_0010"
FT   CDS_pept        13630..14955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0010"
FT                   /product="Hypothetical membrane spanning protein,
FT                   H+/gluconate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08709"
FT                   /db_xref="GOA:D2Q6I7"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I7"
FT                   /protein_id="ADB08709.1"
FT                   /translation="MIIWIMGILLIASFICFVIYAMKGGNLTIGFFILTIVWTLVYFLG
FT                   IPFGIGKPFDVIEETFAQPALTYGSTIIQIICGAWFGRVLVDTGIAASISYRTAKVGEK
FT                   SPVLATICMALVTCLIFTSAYGVGSAIAIGVILFPILGRLGVPKRIAVPVFTLSIGAAM
FT                   WINSVLFVQFAAFYQDYKSPDGQIVEWGNHYLRFGISAMVVQMIGVIIFILINTKSIKN
FT                   GKPYEVGDPADQAAEIPQVPIWTYVLPIVPVALSIIFEWDAVPALFLASIAAFLGTGHM
FT                   KTYRGFVRILNSTAKTAIGDIGSLIIMLLVLRFFQHAAVTVMADFGPALTSVVPNNELI
FT                   LAVTVCILAPLALFRGPLELYGAGSAVISILMGMGIFNAWFLFALLVVPSMTCISSCVT
FT                   QSWNMWAVEYNELEPKTFLKNGVPVYWLCTFPIMGLASLLLF"
FT   gene            15037..15792
FT                   /locus_tag="BDP_0011"
FT   CDS_pept        15037..15792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0011"
FT                   /product="sugar isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08710"
FT                   /db_xref="GOA:D2Q6I8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I8"
FT                   /protein_id="ADB08710.1"
FT                   /translation="MNIIGINTLVYMDALRDGATQSELLGSIAELGVTLAEVRREYIAG
FT                   DDEFNAIANAARINGLRLFYSIPESITVNGDVNPRFEEFLDEAQRMGASNVKFNQGDIN
FT                   NVDLEVLRRIDESSAAHGVTLTIENDQTPENGTFACTSASLDHIVANGGKVGYTFDLGN
FT                   WYWRDEDAVRAFDRLLPYITVFHLKNVNGASDKTQLATTMLEDGVIDWKKMLQRLPETV
FT                   PVFLEFPIPSDRLAEQLSIVRNAVNQASH"
FT   gene            15850..16821
FT                   /locus_tag="BDP_0012"
FT   CDS_pept        15850..16821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0012"
FT                   /product="sugar kinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08711"
FT                   /db_xref="GOA:D2Q6I9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6I9"
FT                   /protein_id="ADB08711.1"
FT                   /translation="MSEVMTIGEPMVNLIVDSQETYLEARTLPREMAGAEFNVAIGVTR
FT                   QGHSIRYVTTLGNDWQGDLILDYMNGIGIDTRNIRRVSESATGYQLKVRSSDGEPKVIY
FT                   FRSGSAASRTTPDIVDDIDFDGIKILHITGIFSALAPNTYDTVTRLVDTAKQHGVTVLF
FT                   DPNPRPTLWPSEEAMIDATNKLAAKSDVFMPGLEEGRLFSGKTGPRDIAEWYLDMGIGK
FT                   VIIKLGDVGSVLFERTSDGDLSETVVPSFVVNVVDTVGAGDGFASGVITALLEGLDNER
FT                   LLERANAVGAIQVTSVSDSEGLPTSEELREFIALTPRKEISL"
FT   gene            16883..17503
FT                   /locus_tag="BDP_0013"
FT   CDS_pept        16883..17503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0013"
FT                   /product="sugar decarboxylase or lyase/synthase"
FT                   /EC_number="4.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08712"
FT                   /db_xref="GOA:D2Q6J0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J0"
FT                   /protein_id="ADB08712.1"
FT                   /translation="MKLQVAIDRVPVERAMEIVKNITSEANIIEIGTSLTKEFGMRALR
FT                   PVIEAAEGVAVLGDIKTCDEGKYEFDLGYRCGFSYLTVMGSASMGTLEACARSAAEHDG
FT                   LMMIDLLECDEARIERISGFTDAIYCLHTSTDEGSTADPVAQVRAFKARFPQIQHLAIA
FT                   GGIKKHHLAALSQENIDIVIMGSAITKADDIAMACRACRKEMK"
FT   gene            17500..18051
FT                   /locus_tag="BDP_0014"
FT   CDS_pept        17500..18051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0014"
FT                   /product="sugar isomerase or sugar amino transferase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08713"
FT                   /db_xref="GOA:D2Q6J1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J1"
FT                   /protein_id="ADB08713.1"
FT                   /translation="MIDNNRVLERIVEEIQGVIARMDENDLERAMALITKGSRIYAAGE
FT                   GRSGFQARSFAMRMMHIGYTSYMMGETICPSMREGDVLLAISGSGKTRRTVEDAEAAKN
FT                   LGVRVIAVTSKSDSPLASVADAVIVVPGRVKGESSGSIQLLSSLFDQSVHIALDALCLM
FT                   LSRRDDVSDADANANHANVE"
FT   gene            18352..18795
FT                   /locus_tag="BDP_0015"
FT   CDS_pept        18352..18795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0015"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08714"
FT                   /db_xref="GOA:D2Q6J2"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J2"
FT                   /protein_id="ADB08714.1"
FT                   /translation="MIEGFKKFIARGNMIDMAVGVVMGGAVTTVVNAIVDSVINPFIAM
FT                   IFGKPNMDGLLAITFNGATVSFGAVLGAILNFLIIAVAVYFCILVPINKFRDVTEALLA
FT                   KTKLAEDKKAEEEAAAETTAEEQTVQLLQQIRDELAKQNAAHI"
FT   gene            complement(18992..19064)
FT                   /locus_tag="BDP_tRNA1"
FT   tRNA            complement(18992..19064)
FT                   /locus_tag="BDP_tRNA1"
FT                   /product="tRNA-Ala"
FT   gene            complement(19066..19138)
FT                   /locus_tag="BDP_tRNA2"
FT   tRNA            complement(19066..19138)
FT                   /locus_tag="BDP_tRNA2"
FT                   /product="tRNA-Ala"
FT   gene            complement(19181..19254)
FT                   /locus_tag="BDP_tRNA3"
FT   tRNA            complement(19181..19254)
FT                   /locus_tag="BDP_tRNA3"
FT                   /product="tRNA-Ile"
FT   gene            19436..20131
FT                   /locus_tag="BDP_0017"
FT   CDS_pept        19436..20131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0017"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08715"
FT                   /db_xref="GOA:D2Q6J3"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J3"
FT                   /protein_id="ADB08715.1"
FT                   /translation="MSYSRQPHARSDSGRVRNRNRILSEKNAEIAGMTVHIIRKPIKNM
FT                   YLRIKPPNADVEISAPQRMSADTIERFVIERRSWIERARQKMLLAREMEIRRGKALSEQ
FT                   RGLSDGNPGGPLTFVWNDENKAQARRNIDARLPALLAIWGPIIGREPTHITLRIMTSRW
FT                   GSCTPRTGRIRLNLQLGLMNSKFLEYVLVHEMTHLWENGHGAGFQRRMDAYLPQWRQLR
FT                   RDINRHVVL"
FT   gene            complement(20240..20719)
FT                   /locus_tag="BDP_0018"
FT   CDS_pept        complement(20240..20719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08716"
FT                   /db_xref="GOA:D2Q6J4"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J4"
FT                   /protein_id="ADB08716.1"
FT                   /translation="MALTFIVPGLDEAASEKIIGILQNRLSQEQEAALVLKHAHWNVTG
FT                   ENFIAVHEMIDPQVEAVLNMADETAERIATLGGSPDGRADAITRFRTWPKFELEGRVNT
FT                   LDYLKALDAYYSEFIKASRTAITELDELDVISSNIMQDHVQELEKFQWFMRSHLA"
FT   gene            complement(20830..22131)
FT                   /locus_tag="BDP_0019"
FT   CDS_pept        complement(20830..22131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0019"
FT                   /product="hemolysin-like protein containing CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08717"
FT                   /db_xref="GOA:D2Q6J5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J5"
FT                   /protein_id="ADB08717.1"
FT                   /translation="MSLGLNILLIFIFLLLGSVFAGTELALVSLRGSQIDQMEQEDARG
FT                   KRVAQIARDPNTFLSTVQIGVTLSGFLSASFGESSIAPYIVPVVEGWGVPKSVAAPLTT
FT                   IVLTLIISYCSIVISELVPKRIAMQRNEQIARAVVPAIHVFAKVCKPIIWLIGKNTNGI
FT                   VRLLGFDPNETDSEVSDEELRVLVNTNTNLSKDERTILDDVFDASETIVAEVMRPRADV
FT                   VFLDGSMPIGEAAAYVREMPYSRYPVTGKDFDDVLGFVHVRDLLDIRDPEAKTVADVTR
FT                   EGISLPGTSKLLPSLELLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLP
FT                   EEKGGERTERTAFVNGVATIEGGMTIEDFADLTGIELEDGPYETVAGYFLAHTGKMGEV
FT                   GDVLTSDDGYDMTITNVDGRRIETIEVRRHTDNE"
FT   gene            complement(22169..22867)
FT                   /locus_tag="BDP_0020"
FT   CDS_pept        complement(22169..22867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0020"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08718"
FT                   /db_xref="GOA:D2Q6J6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J6"
FT                   /protein_id="ADB08718.1"
FT                   /translation="MADDELFVDQNDVEGTASGVWSRMLAGNRRFAEGRPEHPNRSAEA
FT                   REALIDTHEPDAAVLCCSDARVSPDIIFDAGIGDLFTVRTAGQVIDNAVIASLDYAVDV
FT                   LGVRLLVVLGHQNCGAIKQAVKEYDALLHNLTASAEDSLMAADSVADLDERIMNADSIM
FT                   LRTVGFSIWQAHESELESNEDFERVHIARTIEQLVEHSESIQQALASDRLMIVGARYQL
FT                   DSGKVEVLSF"
FT   gene            complement(22938..23663)
FT                   /locus_tag="BDP_0021"
FT   CDS_pept        complement(22938..23663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08719"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J7"
FT                   /protein_id="ADB08719.1"
FT                   /translation="MKRVHPAAQAGKRTTTIIAIILISALAVTGAAITHGLGMWGTKPA
FT                   TVATSASTKTKTPQPQAKQSSQSQEQTNKQATPSETESPSPEPALHVEAQSYEFDMPEY
FT                   WRDRVTAHVDGDTVTLLSKAYPDMDHPICNIRVANGEKPIAMGDIGSSAIGWVPMTSAQ
FT                   HIEVWAYRYPVIAASPGSDISPQTDAKYADLTDLQSGGTVDYASVKDRLVSTDMRDVEG
FT                   LFPIDTWLTNNLVDVIKVK"
FT   gene            complement(23780..26536)
FT                   /locus_tag="BDP_0023"
FT   CDS_pept        complement(23780..26536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0023"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08720"
FT                   /db_xref="GOA:D2Q6J8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J8"
FT                   /protein_id="ADB08720.1"
FT                   /translation="MTTNDQQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQIL
FT                   REVLGEFDEQLLASFDEVRGYALNASAERFAGILTDTNPDQDDLQNVVNTVDKLDMHDA
FT                   QLLARAFATYFHLANLCEENYRVSVLHKRETAVDENQAVDPVNEMTGAYHQLINELGPA
FT                   KARDLLDKLEFHPVFTAHPTEARRKAVEGKIRRISRLLEAHKLLGGSDKKENSRRLFNE
FT                   IDALFRTSPIALKKPTPVEEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPMC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLGALEIETRTVGKNLTMEAGTTP
FT                   PSDELKSLWNHQKEMSERLTDKAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCD
FT                   EFLEDLKIVQRSLAAANAKRSAYGPVQDLIWQTETFGFHMVEMEFRQHSVVHSRALEDI
FT                   REHGLHGERGPLQPMTHEVLDTFRALGAIQKRNGIKAARRYIISFTKSAQNIKDVYELN
FT                   RLAFSHPEDVPTIDVIPLFEQLEDLQNSVDVLEDMIKIPEVQARLKATGGKLEVMLGYS
FT                   DSSKDAGPTSATLALHSAQERIAKWAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPV
FT                   GSVKCRFKLTEQGEVIFARYGNPALAIRHVESVAAATLLQSAPSVEKRNTDMTEKYADM
FT                   ANKLDEAAHNRFLDLLNTPDFAPWFSTVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWIFSWAQARINLAAWYGLGTACEQFGDLKTLRQAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IAKMYLALGDREDLNKKVLDEMELTREWVLKIVGDEWPLQHRHVLGQAIRIRSPYVDAL
FT                   SVTQVLALGSLRKQVDKEELTHGQQENYTYLILCTVSGVAAGLQNTG"
FT   gene            26765..28576
FT                   /locus_tag="BDP_0024"
FT   CDS_pept        26765..28576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08721"
FT                   /db_xref="GOA:D2Q6J9"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6J9"
FT                   /protein_id="ADB08721.1"
FT                   /translation="MRPVPALDLNGVSSEHQHDENAENSAKAVSKFHTHSIPLDMEDIE
FT                   RDWDKPVTEAGIAAKASVIVRVGMLDLGAGTGSFRVREMMHRIAYPLGVHVRADVNLTD
FT                   IEASCTDGKDRITEVIDLPTTGVNTERIWLLEHFADWFNVNLGKGSMYHSQSGVSEGLM
FT                   QHLDKKDASQVSAELSKKLKEQQKAEQNQEGSDDPVLDALEMVTERAKDEESLAHPLHL
FT                   RDIEEAEYRSDHANSAQWQDTAHGRFKDRHHKPPKGQYAQHFDHVGKAEDDQAGITVRQ
FT                   AHERLDMIEHRKPLYSPAFAGFASACACASFVFLLGGGPFDMVGAFIGAGLGHWLRRRL
FT                   FAHHLNQFFVTFVCVAVAALACTGTLRLIGLFNPIALQHDTAYIGAMLFVIPGFPLITG
FT                   GLDMAKIDFPSGVQRITYVFCIILMATLAGWMVASIVHLNPQGFEPLGLDPIINCLLRM
FT                   VFAFIGVWGFSVMFNSPQRMCLVAATIGMITDTLRLEIVDMGIPAEAGAFIGALLAGLL
FT                   ASAWRSAVHHGLLAPHLGYPRICLTVPSIVIMVPGLYMYQAMFHLGQFDTLNALDWAFR
FT                   AFMVILCLPIGLAMARVITDKSWRYDI"
FT   gene            28695..30323
FT                   /locus_tag="BDP_0025"
FT   CDS_pept        28695..30323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0025"
FT                   /product="predicted sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08722"
FT                   /db_xref="GOA:D2Q6K0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6K0"
FT                   /protein_id="ADB08722.1"
FT                   /translation="MVSKDFWVLLAMVIYFVAMLIIGFVYSKRSNSSTRQYFAGGRGVG
FT                   PWLTALSAEASDMSGWLLMGLPGVAYFTGAADPLWTALGLAIGTYLNWKLVARRLRRYS
FT                   VVAGDAITIPDFFSKRFHDRKNIVSTISALIILVFFCVYVGSCFVTVGKLFSTLFGWDY
FT                   HLTMVIGAAVVFAYTVIGGYLSVVVTDFIQGLLMFFALAVVFVGSVASAGGVDNTVAFL
FT                   KAIPGFLDGTQMATPVLNDAGEQIVKAGQAMFGAPTDYGVITMISMLAWGLGYFGMPQV
FT                   LVRFLSIRSSEEIKKSRIIATTWCVISLACGVCIGLVGRAMMPTQFATQAAAENIFIVV
FT                   AQALLPSFMCGVVVSGIFAASMSSSSSYMIIGASAVGENIFRGLLHRKATDRQVMMVAR
FT                   ITLLVMFLFGIVVAFDQNSSIFQVVSYAWAGLGASFGPLMLTALYWRRTNKYGAIAGMI
FT                   SGTAMVLIWHNLIKPIGGVFAIYELLPAFIVSLLCIVVVSLLTPAPSAEVLYEFDHYLD
FT                   DPNDRKVDDDLVAAEIAAGERRAQM"
FT   gene            complement(30501..31604)
FT                   /locus_tag="BDP_0026"
FT   CDS_pept        complement(30501..31604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0026"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08723"
FT                   /db_xref="GOA:D2Q6K1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6K1"
FT                   /protein_id="ADB08723.1"
FT                   /translation="MMTDDTQEQQITAAGNEMSASFLAAKKRSDATLAKLEENPGKFTM
FT                   LTGDRPTGRLHLGHYFGSIRERVAMQNRGVNSNIIIADYQVITDRDTTEHIEDNVLNLV
FT                   LDYMAAGIDPNKTMIFTHSAVPSENQLMLPFLSLVTEAELHRNPTVKSEMEASGHALTG
FT                   LLLTYPVHQACDILFCKANVVPIGKDNLPHVEITRTIARRFNERYAKKHPVFPEPAAIL
FT                   SEAPEIPGLDGRKMSKSYGNSIMLGATAEETTKLIKKSPTDSERRITFDPIARPQVSAL
FT                   LTTAGLVTGRDPKEIAEEIGDSGAGALKQYVIESVNEFLAPHRERRAELAKDMDSIRDI
FT                   LHDGNKRANEIADETLEQVREAMGMRY"
FT   gene            31730..32104
FT                   /locus_tag="BDP_0027"
FT   CDS_pept        31730..32104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08724"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6X8"
FT                   /protein_id="ADB08724.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYLTTDTDYDELAKELGAQEPGSGSFDP
FT                   FADIETKYAQHADGEHESADDEQRSSEPADDLDEYAKWAAEAAAKATSGEIPVTKAAAP
FT                   KPHKPIPMPVPSALKPKKQD"
FT   gene            complement(32199..32636)
FT                   /locus_tag="BDP_0028"
FT   CDS_pept        complement(32199..32636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08725"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6X9"
FT                   /protein_id="ADB08725.1"
FT                   /translation="MAVIREQDLNKGHEAFANWLQTARRIITDQMPADDMEAFDFKLNL
FT                   SPKLPRQTWAMAVRYSLHLLENKAPGEGVEVRVAPWGAIKILDGPASDPHNLTPPDVIE
FT                   LEPDVWMRLATGITSWAEEKEAGRITAVGERDDLSDLLPLV"
FT   gene            32946..35390
FT                   /locus_tag="BDP_0029"
FT   CDS_pept        32946..35390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0029"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08726"
FT                   /db_xref="GOA:D2Q6Y0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y0"
FT                   /protein_id="ADB08726.1"
FT                   /translation="MTEITAPKSPVTAAEFADEIREQLKYTQGVTPEQAKPADVYIAAS
FT                   AAIRRHLVDSWMKTQADMVNGNTKAVGYLSAEFLMGKQLRNALLNAGLTEQFNEAVEAL
FT                   GFSVQDVVDAEYEPGLGNGGLGRLAACFIDSLASLGVPAFGYGIQYKYGIFKQEFDETG
FT                   KQIETPDYWLANEEPWGHIDYNRDQKVSFGGEVVEENGKKVWKPAWSVRAVPVDYMVPG
FT                   YASGRVNTLRLWTAKSYDEFDLLTFNKSEYLDAVKPQVEAENISKILYPEDSTPQGKAL
FT                   RLEQQYFFVSASIHDAIRVFYPGQDKPDLTTFADKITFQLNDTHPVIGIPELMRVLMDE
FT                   YGYDWGTAWTITNKTFNYTCHTLLPEALEVWPSKLIGELLPRHLEIIEKINAQFEAELK
FT                   AKGIADETIKDMAIYTGDSVRMAYLATYGGSHVNGVAELHSQLLKDVTLKNFSDAYPDK
FT                   FTNVTNGVTPRRFIKLANPRLSDLITEGLGTDKWLSDLELLKGLEPLAADDEFVKKFAA
FT                   VKQANKVDFANYAKREYGFDIDPNTMINTMVKRLHEYKRQALKILALIARYADIKSGKL
FT                   SADDVMPRTVVFGAKAAPGYYLAKQTIQLINNVARVVNNDPEVKGKLNVYFPWNYNVRL
FT                   AQHLIPATDLDEQISQAGKEASGTGNMKFALNGAMTVGTLDGANVEIRERVGAENFFLF
FT                   GMTVDEVDALYAAGYDPKKYYDANPRLKAAIDMVADGTFSNGDKTVFEDLVHDWLTKDW
FT                   FMTLADFGAYTDIQAEIEALYAQPLEWNRKALINVANSGYFSSDRSIEDYLERIWKTGP
FT                   LK"
FT   gene            36218..37000
FT                   /locus_tag="BDP_0032"
FT   CDS_pept        36218..37000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0032"
FT                   /product="rhomboid family protein"
FT                   /EC_number="3.4.21.105"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08727"
FT                   /db_xref="GOA:D2Q6Y1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y1"
FT                   /protein_id="ADB08727.1"
FT                   /translation="MAYQRFSLFPDSPSFKDLFSARSLRYRWRNGDPLITTGIMAVCIV
FT                   VWIVEAVLNLVWQGGLNAMLNAGMLMPATAVHKPWTFITSMFLHQPNSLWHILFNMLTL
FT                   WCVGPVLERMMGHWSFLALYAVSGLAGGTGMMLWAVLSGASGWSTPVYGASGALFGLFA
FT                   AILVVYRRIGLDIRSMMIWMLINFLMPVIMPNIAWQAHLGGFLFGGMFTWLLVSGLRVL
FT                   RGKSLLRRTLIYGTVMVIVIIAIDLLCNAVNPVNMALF"
FT   gene            37452..38819
FT                   /locus_tag="BDP_0033"
FT   CDS_pept        37452..38819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0033"
FT                   /product="possible N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08728"
FT                   /db_xref="GOA:D2Q6Y2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041497"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y2"
FT                   /protein_id="ADB08728.1"
FT                   /translation="MITGMEHEAMISPETRAFVVVHRNEDVRELALKSKHVDGLDLPQA
FT                   LNQIAGWQIARNKLSEWADCDDIIYPPHISMEQCSSQFTAQYKAEIVNRLLCTDDGADN
FT                   ARDSAHSDDIGKTDIAGITEAEHAEEWDSVTTSAGNADLSMVDLTGGFGVDFSYLARGF
FT                   TRAAYVERQPHLCDLAAHNMIVLGLHQTEIICGDGVEYLRSMQPVSLIYIDPARRDEHG
FT                   TRTYAIEDCMPNVLALRDLLLAKARFAMIKLSPMLDWRKAIADFGGAVSEVHIVSTGNE
FT                   CKELLMVLDGAVETRHPTDDVRAPHVYCVNDGQRIDYDSAVYARGLRIGTAPLPEMEYL
FT                   YELNASIMKAGCFDLLEERYGVTQIGPNSHLFVAAEPVTDFPGRGFAIEAVGGMGKKDV
FT                   RRLLSGVGRANVAVRNFPLTAPQLRKKLKLADGGDTYLFGTTIQGGGHILLRTVKV"
FT   gene            complement(39199..39651)
FT                   /locus_tag="BDP_0034"
FT   CDS_pept        complement(39199..39651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0034"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08729"
FT                   /db_xref="GOA:D2Q6Y3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y3"
FT                   /protein_id="ADB08729.1"
FT                   /translation="MLMADEELHETTADTQEDWQSEAAESTEETTDNDAVAESAEDDDD
FT                   LDIPMDRVEAVLNATVDKDSLTPQMQRMMNRQAENTRRVEETINGTKSNPRWFVPLFCA
FT                   LMIIGLIWAVTYYLSGSYPIPNIGAWNLAIAVAIIMVGFLMTMWWR"
FT   gene            39770..40567
FT                   /locus_tag="BDP_0035"
FT   CDS_pept        39770..40567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08730"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y4"
FT                   /protein_id="ADB08730.1"
FT                   /translation="MAKRTGRHTAKRSKVAGIAVFLVLMLSGFLLATNLRVNRSVVVSN
FT                   DTADLVEQRVKRVNSLRKEVDGLSSKVDDLSKTLNSESDDDSQDGEDAGVGTMLPAVEG
FT                   PGLVVTLDDSPLWKNMVDSSGSTSNINDYVIHQQDVEAVVNALWAGGAESMMIMDQRVL
FT                   FSSAVRCSGNVLLLQGKKYSPPFKISAIGPVDSMQQALDDSKEITIYRQYVNAFGLGWK
FT                   VEKKDKLHFDATDALQQPLKYAKVIENDDSSGDAEQKTEEGNQ"
FT   gene            40567..41661
FT                   /locus_tag="BDP_0036"
FT   CDS_pept        40567..41661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0036"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08731"
FT                   /db_xref="GOA:D2Q6Y5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y5"
FT                   /protein_id="ADB08731.1"
FT                   /translation="MKHVRPVVARQRSVIWILLGVLAEIMLTAAAVCALYIAWQMWWTG
FT                   VQSEHTQIETRQAVSWSDPGKAENVTIAQAQEGDPPVQPQNAQEGELIAQVYIPRFGSQ
FT                   WQRNLVEGTTLTELNKHGLGHYTNSQRPGQIGNFAFAGHRNGYGQPLGDVDKLQEGDPI
FT                   IIRTQDYWYVYHYTKSEIVLPTDVEVVSSNPEEPGATPTKRMLTMTTCEPKYSTPTHRW
FT                   ISYGEFSYWAKVSDGIPQELATTDTNGKVKFINNGKASFASGITTLEPWIFGALAAYVV
FT                   IFAAAAVAWRWPVLAAIHAGEREKPDFSIYGGLLRLQPGVLPIRLLLLLLLLFAAAAST
FT                   FEWLFPWAASNIPMLQEMSNYTAV"
FT   gene            41729..42373
FT                   /locus_tag="BDP_0037"
FT   CDS_pept        41729..42373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0037"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08732"
FT                   /db_xref="GOA:D2Q6Y6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y6"
FT                   /protein_id="ADB08732.1"
FT                   /translation="MTDSARILVVDNYDSFVYTIVGYLKTLGATVTVVRNDAIDPATSG
FT                   VIDEYDGVLISPGPGTPAESGASEGMIRLCAVQGKPMFGVCLGMQALAEVFGATVSHAP
FT                   TIMHGKTSQVEHIDDAIFEGVANPMTATRYHSLAVEPDSVPDELVVTAWTQGDHIVQGI
FT                   KHRDLPMYAVQFHPESVMTQDGYRLLANWLKVCGQDSAVARSMGLQPKVVG"
FT   gene            complement(42528..44597)
FT                   /locus_tag="BDP_0038"
FT   CDS_pept        complement(42528..44597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0038"
FT                   /product="serine-threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08733"
FT                   /db_xref="GOA:D2Q6Y7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y7"
FT                   /protein_id="ADB08733.1"
FT                   /translation="MSNNMPTSLANGRYQLGQLVGRGGMAEVHVALDTRLGRTVAVKIM
FT                   RADFANDQIFLARFRREAHSVAQMNNPNIVNIYDSGEEVVTTETGQTEHLPYLVMEYVK
FT                   GQTLRDIIKVNGALSQRDAEQVMMGVLNALEYSHRMGVIHRDIKPGNIMISEQGVVKVM
FT                   DFGIARALDDSAATMTQSQGVVGTAQYLSPEQARGETVDMRSDLYSAGCVLYEMLTGKP
FT                   PFTGDSAVAIAYQHVSEVATPPSSVVPGLPKMWDSICAKAMAKDRQNRYATASEFKNDL
FT                   LTFMNGGVPVAAAFNPLTDLTNVKARKQAEQEAATVAMNPTSGESAATQAFNPVTGQFE
FT                   QVLAGPNGGVATKTRAEQRAAAAKSKKKKQIIIGSVVGVLVALLAILGIVYMLNHGDSS
FT                   TDTVEVPDFTEMSNISQTTVEEKLNALGLKLDARDDTESDQTKGTVTKQNPKGGSKVEK
FT                   GSTVSVWFSTGPQTVSVPDVANKSQEEAKSILESAGFKVGSVKTVDSGTVEKDKVVSTD
FT                   PAANSKQTKGTIITLYISSGMTKIPDNLVGQSKDSVIEQLNKAGIGTVNVENEYSDSVD
FT                   SGSVTRLDPGSGSTVELGTSVTIWVSLGKQQVSVPSVLHMTLSSAKSVLTNNGFQVTVN
FT                   GSTDDDAIVTGMSPEGGSQADSGATITLTTESASSPSPSPSSSTSSSTASPTAH"
FT   gene            complement(44594..45538)
FT                   /locus_tag="BDP_0039"
FT   CDS_pept        complement(44594..45538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0039"
FT                   /product="serine-threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08734"
FT                   /db_xref="GOA:D2Q6Y8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y8"
FT                   /protein_id="ADB08734.1"
FT                   /translation="MKLIEGQLIHRRYRLDSRLAQGGMGEVWKGYDIQLGRPVAIKALR
FT                   GDLGSSQEAKLLRLRAEAHNSANLAHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLFH
FT                   EIDGPMEPTQLLPILIQTARGLFVAHSHGVIHRDVKPANIMVSDSGEVKITDFGVSYST
FT                   NQEQITQDGMVVGTAQYISPEQAQGQQATPQSDIYSLGVVAYEGLCGHRPFTGTTPVDI
FT                   AAAHVNNPVPPLPDSVDVQLREFVMSMLAKDPLDRPKDALAVSRVLTRIERRLLDQQTQ
FT                   LADTMIVPTGGRIPRRVASKPHISPSSDWKEQG"
FT   gene            complement(45535..47001)
FT                   /locus_tag="BDP_0040"
FT   CDS_pept        complement(45535..47001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0040"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08735"
FT                   /db_xref="GOA:D2Q6Y9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Y9"
FT                   /protein_id="ADB08735.1"
FT                   /translation="MNKSLRQLFTIVIILFVILGMSTTIITAIRANQLNQDPRNTRALY
FT                   HEYGAPRGSILASDGSVIAKSDPSNDAFSYQRSYSDGPLYAPVTGFFSISQRGWSGIEA
FT                   SRSSLLSGQSDQLFWQRFKALFTGQENKGATIETSIDPKIQQVAYNALGSLDGAAVAIE
FT                   PKTGRILAMVSTPSYDPNQLASHTTSEVNENYNTLSSDQANPMLNRATSQLYPPGSTFK
FT                   TVVAAAALETGQYQTDTQIPAGASYTLPGTTVQLTNATSQGNGSDGKISLEDAMAYSSN
FT                   TAFAQLGVSLGDDKVSSMAKKLGFDSSITVDGTDSSGTPWMTVASKFPTDVSDDKLALA
FT                   SIGQGDTVVTPLQNALIAAAVANDGKLMQPTLVDRVRSSDLSVVSQTKSEVMSRPFSAD
FT                   TADKLTQMMEAVVTKEDPELAIDGVQVAVKTGTAQIGENNGSVDAWVIGFAPADDPKIA
FT                   VSVVVHNVDSYGALAAGPIMKAMMQEALAE"
FT   gene            complement(46994..48418)
FT                   /locus_tag="BDP_0041"
FT   CDS_pept        complement(46994..48418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0041"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08736"
FT                   /db_xref="GOA:D2Q6Z0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z0"
FT                   /protein_id="ADB08736.1"
FT                   /translation="MITTRLRQFGLLMLSMLTCAVAFFQMFERTTGGFPSNYMGMLVFI
FT                   AVLFLAAWGLLLRFQPYASQTILCCVMLLTGIGVTMIARIDQETKTSVAFKQLMWLAIA
FT                   LVLSALLVIFLKDYRVLRRFSYVSMVVGLVLLLSPMLPVIGSEQYGARIWVKIPGLGSF
FT                   QPSEFAKLFLAFFFASYLFDHRDQLAVGGKKVLGLQLPRIKDMGPIIVVWIVAMGVLVI
FT                   QHDLGTSLMFFAMFVSMLYVATGRKSWIIIGFIAFAAGAFLAANIFSHVGARVDAWLHP
FT                   FSTEQYGKEYGGSYQLVTGIFGLASGGMMGTGLGQGHPSLTPIANSDYIYAAAGEELGL
FT                   TGLLATLMLYLLIIAAGMITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTG
FT                   LTLPYMAAGGSSLIANYLLATLLVIISNAANKPEDDLNSDTFQYEAMQALRNRDMKHRT
FT                   QPTEPIARTVTGGSNE"
FT   gene            complement(48415..50004)
FT                   /locus_tag="BDP_0042"
FT   CDS_pept        complement(48415..50004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0042"
FT                   /product="Phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08737"
FT                   /db_xref="GOA:D2Q6Z1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z1"
FT                   /protein_id="ADB08737.1"
FT                   /translation="MTTSATSQPLFLYSTTVSDVGTVRSNNQDSAFAGEHLIAICDGMG
FT                   GHAGGDTASTIAIRSLAHIEQDNEQGDVKTVAHMMETSVMAAHDAIVGKAKRERRLAGM
FT                   GTTVTAVALVSGYWVLAHIGDSRAYLLHDGHLIRMTSDHSYVQHLLDTGRINESEARNH
FT                   PQRNVVMRVLGDFDIDPRPDIAVRKAHPADRWLLCSDGLCGVLEDSTLQEMLATCSDQE
FT                   ECAQRLVSMALRAGSTDNVTAVIADATLALNADAFDLPHQTPLVAGAASASLEPIADII
FT                   NAPVATAPLLREGKQSPAARAAALRHGRNPDETDNEPQPEQRVAQPSTVREETGDRTNP
FT                   DTGEIPVVQKNDGRVSADPNDPEVARAIRNEQIQQRKTKRAHSKRNRIIGIVVTILVLL
FT                   GLAGAAVGTYRWSQTKYYLGDDNGSVTIFQGVPTSIFGLKLSHAVSDTGMKTSELPPSW
FT                   QEQLMQGISFDSYGEAKNHTTLIKKQLKQQQAENKKSGGGSSPSASSSASPSSSASASS
FT                   SSSSSPRGGDKS"
FT   gene            complement(50007..50534)
FT                   /locus_tag="BDP_0043"
FT   CDS_pept        complement(50007..50534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0043"
FT                   /product="FHA domain containing protein"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08738"
FT                   /db_xref="GOA:D2Q6Z2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z2"
FT                   /protein_id="ADB08738.1"
FT                   /translation="MLTELTFAILKYGFLILLWIFVACTVRSLYKDIETFSPRKSRAHR
FT                   RKERRARKAVEAPAPVASAAPVIPTNEMPISNAKPTLLVVIDGPLAGSSVPLTGNTITL
FT                   GRAASNTVVLDDEFVSSHHARVYTDPATGQWAIEDLGSTNGTVVNQQRLDAPMILGSRV
FT                   PVRIGATTFELR"
FT   gene            complement(50561..51262)
FT                   /locus_tag="BDP_0044"
FT   CDS_pept        complement(50561..51262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08739"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z3"
FT                   /protein_id="ADB08739.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDKEAM
FT                   PVTRDRTVAPNEYRFKLSTPDFNNIVEWGAETLANELADNLTQYAKSQHYAFVGPVVVI
FT                   FEEDLDLSKSDFKLTSESVQGNAVPVTTEAQTEDCPMLEIGEKQYLLTKDKTIIGRGSN
FT                   CDIVIDDPGISRKHLEIDINDGNVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASSQDQE"
FT   gene            51560..54046
FT                   /locus_tag="BDP_0045"
FT   CDS_pept        51560..54046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0045"
FT                   /product="dipeptidyl peptidase IV"
FT                   /EC_number="3.4.19.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08740"
FT                   /db_xref="GOA:D2Q6Z4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z4"
FT                   /protein_id="ADB08740.1"
FT                   /translation="MNDAIDVFPRLKARTVRFTCGAPRSARTIGDGSRALFLRSDGSED
FT                   TVTSLWMSVIDTTGTGDDREVLLADPRELLADADAENVPAEERARRERAREGGSGIVSY
FT                   SVDQAGRRVVFTINGQLFLTEIREDGTGIRTRQLAFEDLTLTTGGYGPVLNPRISPDGR
FT                   HVMYTTGEHLNLIDIADWPAPGQAARESITTVYGVCDGNGDDQAPHTVKIGLAEFVAGE
FT                   EMDRYDGFWWSPDSRYVLFETFDASPEPIWHICDPANPTMGAAARRYPQALTSNADVHL
FT                   TLLELGFDADGCCYGEVSHAVEWDRERYEYLASVNWAEGHDPIIEVQDRLQRNDQVLTV
FT                   RVGDPIMPVIAPEAEFTDENGDEVETFSFAIPEYAPGEEPGTTRVLEERHNDCWLDLVH
FT                   GTPAYTPDGRLVCAVNDMEADTNRLSVDGCAFTPIGLQVREVLDVTDDDVLCVVQRTPE
FT                   LLPESDLPYLWQANAADHDARSFDVVSIRFDGSWEPLTHTPGQWTMSRAGNGCVMTGRG
FT                   MDDARVQMQHCMNVVTVGEDGVETLSMVVAPIENHAAEPGFVPNARFVRLGERSLYTAI
FT                   VLPSEGSGYAHADRLPVLMKPYGGPGFQQVVESQSFYWDAQWWADQGYIVVIADGRGTT
FT                   GRGPKWDRAIYESMKAVTLEDQVDAVHALPGILSELRAEQADSETAVTIPEPDLERVAI
FT                   IGWSYGGFLSALAVLEAPDVFAAACAGAPPTDWTLYDTHYTERYLGLDPVVYERNGIIA
FT                   DAPNLKRPLMLIHGFADDNVTIAHSLRLSQALMAAGRKHTFLPLTGITHMTNDETVAEN
FT                   LLILQRDFLADALRKV"
FT   gene            54247..56724
FT                   /gene="pip1"
FT                   /locus_tag="BDP_0046"
FT   CDS_pept        54247..56724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip1"
FT                   /locus_tag="BDP_0046"
FT                   /product="hypothetical membrane spanning protein Pip"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08741"
FT                   /db_xref="GOA:D2Q6Z5"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z5"
FT                   /protein_id="ADB08741.1"
FT                   /translation="MRTILAIFARDVRRIVKSPVALVVTCGVALIPSLYAWCNILANWD
FT                   PYANTGNIQVAVANEDLGTDSTLVGHLDAGAQTVRKLRTNHQLGWRFVSKSDALNGVKS
FT                   GEYYAAIVLPDDFSATLIGSVTGTTERPHITYYVNEKENAIAPKITDTGATEIDEQINS
FT                   TFVTAVADAVATEVKRSAQATTQSLDGAQSDVIADLNTTIDQLNSVRDELTHMSTSLSD
FT                   AETTIAKAQDTNKQISADLATATGTANTTIGLLADAQTASQRFSTTLAKALDNGSVQLS
FT                   SLHIGVNTATGQIVSGLNTTQSAVNAVSQAMQKTCDKTDEFIGGLDRVLASSGLDHNSK
FT                   EYQALAQQIADARTQLKQEQQLLDTFGNNADALIGDGTTTAITLGNTVAGLTADGANKL
FT                   IDARDKLTGTIMPSLDSSFTSLSATSGSLIGTLDALGSLIGQSDGLLNQLDDTLRQTRT
FT                   TLDSTVRALDDLEGNLDATRTDVAALSSSQTYEQITKLLGLNAASIGDFMGNPVHLSEI
FT                   VVYPTDNYGSAVTPFYTNLALWVGGFVLVAIYKLEVDRDERIRNYTPTQGYLGRWLLFM
FT                   TVGFMQAIIATVGDIALGIQCAHPMLFILAGLLESFIYVNIIYALAATFRHIGKAVAVV
FT                   LVIVQIPGASGLYPIEMMPEFFQRLKPFLPFTYGIQAMRGPIAGLYKMHYWNDMFHLLW
FT                   YLPVALFIGLVVRRLAMNLNALFDERLADTDLMITERNAGVDSQLRFVGMAREFAERYP
FT                   EIAHARAERFLAVYPKLVRWGFLTLAVLPFVLLILLFIIQQKTVMLTLWIVSIIVIDTY
FT                   LIVVEYLKERYAR"
FT   gene            56721..58994
FT                   /locus_tag="BDP_0048"
FT   CDS_pept        56721..58994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0048"
FT                   /product="hypothetical membrane protein pip"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08742"
FT                   /db_xref="GOA:D2Q6Z6"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z6"
FT                   /protein_id="ADB08742.1"
FT                   /translation="MKYLWGIFRRDMRHATSNVIALIVSMGLVIVPALYAWFNIAASWD
FT                   PYGNTKALKVAVANVDSGYKSELIPVRINVGETVLSALRANHQLDWQFVDSAKAVDGVK
FT                   SGKYYAAIVIPKSFSADMMTLFSPTVKHATLKYYLNEKINPIAPHITDEGASTVANTID
FT                   KTFAKTMAQVGLDLAANMLQYSQSPQMAQYMTNLTSNIDGMVSTISGAQAQVNAYSTLS
FT                   GSADSVITSTDKLLASTRKAGKQARKTLKQSGTSTSTLTDACTNVTDAVNQALQQAVSA
FT                   LDDIADKVGTAFDQLDKDATGAAKTLQDLSSQVSSSANVYGNYIAQLEKMRSAAEGLPD
FT                   GDSKQALLNAIDKQIAALQAAQQDTQDLATALAAASKQVAADSGDIQRDRQQILNRITT
FT                   AKRSITTVQSDYEQNVKPKLDDLSASVQTLVTQTGTVISGLDAVTGDVGSMAGGIGANV
FT                   AAVRKTLGSVSASLGESAGKLSDLSAKFKQAVQAGDSSAIASLTSSDTDAVATLLSAPV
FT                   ALDRVPIYPIANYGSAMAPFYTVLSIWVGAIILVAIMKVAVSDREKAHVLGLGDSLPLR
FT                   ARNREIPGNAATFGLRLHHEYFGRLGIFALLALLQGTIVCLGDMYFLGVQAEQPLQFLA
FT                   VGWLCAVVFSNIVYTLTVSFGDIGKALAVVLLVMQVAGSGGTFPIQTLPKFFQICYPFL
FT                   PFPHAIDAMHAAMAGSYGLEYWIDLGALALFLLPSLLLGLVLRRPVIRLNNWVLRRLES
FT                   THVM"
FT   gene            59078..60142
FT                   /gene="pldB"
FT                   /locus_tag="BDP_0049"
FT   CDS_pept        59078..60142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="BDP_0049"
FT                   /product="lysophospholipase PldB"
FT                   /EC_number="3.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08743"
FT                   /db_xref="GOA:D2Q6Z7"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z7"
FT                   /protein_id="ADB08743.1"
FT                   /translation="MTITLIDEAHYDAEMDAKVLPALQACLTEGRMKPATHDSDGKALP
FT                   TLDNPGTLHYCCYDVRKFNESRGGRSAGPFRGAVVISHGFTEFGRKYSEMVWYFLLAGY
FT                   SVCVFEHRGHGHSAHDMSNPSLVWIDDWRRYVADFATFASTVGREYAMGRPLDLYCHSM
FT                   GGGIGAAVLERYPSLFDKAVLSAPMIAPAVGMPTWVARIVVGGICALGFGKSRVFGHAD
FT                   FSDNLNLDDYRGASEARIRWFHKQRLADECCWTNAATFEWANQAMALSRAVLKPDMCGA
FT                   IETPTLLFQAGLDVWVLNGPQDEFIERVREGGGSIEKVRYDQSLHEIFSMPNDVVGPYL
FT                   KRILDFLGAHDVGL"
FT   gene            complement(60291..61499)
FT                   /locus_tag="BDP_0050"
FT   CDS_pept        complement(60291..61499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0050"
FT                   /product="aminotransferase"
FT                   /EC_number="4.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08744"
FT                   /db_xref="GOA:D2Q6Z8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z8"
FT                   /protein_id="ADB08744.1"
FT                   /translation="MTYDFTSIMDRHGKDSIAVDGLGQLGFSPDPPKEGFDVIPMWIAD
FT                   MNFPTVPTVPEAIIERAKHPAYGYFSPTDEYFDAIIRWQSTRNGVTGLTREAIGYENGV
FT                   LGGVISALTAFAAPGDAVLLHSPTYIGFTMSIENNGYRIVHSPLTRDADGVWRMDFDDM
FT                   DRKIKENNIHVAVFCSPHNPCGRVWERWEIEQAMEVYRRNDCLVISDEIWSDLTLGNHQ
FT                   HIPTQSVSEDARNRTAAFYAPSKTFNLAGLIGSYHIIYNKYLRDRIGAKSSKSHYNEMN
FT                   VLSMHALIGAYQPEGYAWLDELREVLTGNVDYACDFIANHFDGVSCAKPEGTYMLFLDC
FT                   SEWCQAHGVSLQELEKRGWDVGVCWQDGVMFKQPYSIRVNLALPLSRVREAFDRLDRYV
FT                   FNA"
FT   gene            61639..62541
FT                   /locus_tag="BDP_0051"
FT   CDS_pept        61639..62541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0051"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08745"
FT                   /db_xref="GOA:D2Q6Z9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6Z9"
FT                   /protein_id="ADB08745.1"
FT                   /translation="MSERTFELTPRKLAIGTIMTVTGAVLWGVNGTVSKILMDSYRVDP
FT                   TWVACVREIVAGLLFLACAGVATPKLLGGMLRERKNYPMLVIVALSSVLVIQVGYLQAI
FT                   HWTNAGTATVLQSLSLLFVLLYVCVHGRRLPTVIETIGVILAVIGTVLIATGGNLSSIS
FT                   LPLPGLAWGLANALGNAAMAIIPLALIARWGAFSVNGVAFLISGFVLVPFVRPWAHMPQ
FT                   LDARGWLMLGFLVVIGTFAACGLYMGGVAIIGSMRGILIGTIEPVVATVTAVTWTGAAF
FT                   SPADLVGLVLIILMVFLVR"
FT   gene            complement(62898..63527)
FT                   /locus_tag="BDP_0054"
FT   CDS_pept        complement(62898..63527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08746"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q700"
FT                   /protein_id="ADB08746.1"
FT                   /translation="MKIAVVAANGKAGRLIVKEAMRRGHDVTAVVRGENRTTAPNAIIK
FT                   DVFNLTMADLAGFDVVIDAFGTWSPDTLPQIAQAAGHLADLLSGTDIRLIVVGGAGSLF
FT                   VNKEHTKALEDTPEFLDAYKPVSAAHVAALNLLRNRDDVKWTYVSPAADFQAEGERTGS
FT                   YGLAGEEFTTNAEGKSFISYADYAIAMVDEAESGKHVGERISVYTK"
FT   gene            63765..64088
FT                   /locus_tag="BDP_0055"
FT   CDS_pept        63765..64088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0055"
FT                   /product="MarR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08747"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q701"
FT                   /protein_id="ADB08747.1"
FT                   /translation="MERELPACPVETTLLMISDKWKVLILRDLLDGTKRFSELRRSVGN
FT                   VSQKVLTANLRQMERDGLVHREVYPEVPPRVEYSLTETGVSLKPVIKAMKDWGIHYKAT
FT                   CEA"
FT   gene            64415..64500
FT                   /locus_tag="BDP_tRNA4"
FT   tRNA            64415..64500
FT                   /locus_tag="BDP_tRNA4"
FT                   /product="tRNA-Leu"
FT   gene            complement(64754..66070)
FT                   /locus_tag="BDP_0056"
FT   CDS_pept        complement(64754..66070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0056"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08748"
FT                   /db_xref="GOA:D2Q702"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q702"
FT                   /protein_id="ADB08748.1"
FT                   /translation="MTSLTESNLVEHPRGAEPGKPGDRRAFSFEQITRLPDTADGKGRG
FT                   GARYGRTGIIHTPHGDIHTPAFVPVATQAAMKAVLPETMKDLGAQCLLSNAFHLYERPG
FT                   EQVLDEAGGLAKFMNWNGPTFTDSGGFQVLSLGAGFKKTLAMDVTGMKSDEVIAEGKER
FT                   LAFVDEDGVTFKSPLNGSLHRFSAEISMGIQHKIGADIMFAFDELTTLMNTRGYQERSV
FT                   ERTYRWAQRCVAEHQRLTEERLGKPYQALYGVVQGANYEDLRRHAAEQIASLDFDGVGI
FT                   GGAIEKRIIGDTCAWICDAMPESRPRHVLGIAAVDDIFACVENGGDTFDCVAPARCGRN
FT                   GAIFTRSGRYNIKRAQFKHDFGPLEEGCTCYTCTHYSRAYVDHALRAREFNGFTLATIH
FT                   NEHFFVKLLDDIRASIDGGYFDEFRDETLARFYANGSRG"
FT   gene            66370..68208
FT                   /locus_tag="BDP_0057"
FT   CDS_pept        66370..68208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0057"
FT                   /product="Serine protease"
FT                   /EC_number="3.4.21.108"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08749"
FT                   /db_xref="GOA:D2Q703"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q703"
FT                   /protein_id="ADB08749.1"
FT                   /translation="MAEDNNDQNVVQPQNNAQQAVPTQPADAATDNAETSVTEPIAVHD
FT                   AGEQPTTTLPSVNAADSEIAPDYASAAGESTVVSGGSSTGGQSTAGASAQSQYRPAPEY
FT                   GAYGTVPPQPTNGTNAAQPQYGQPAHSAQTSQMPPQNNRNPFFGNPYVNPQNEQHDSRG
FT                   SNPFTAPQGGANVPPNTPNNGNPFNPFGNAGNPQNPVVKTRPKTAGNVVVAVVAALVAA
FT                   VLCLGVGYAAITNGWVHVPTSSSMTSISSNQSGSGSAKAKSGEAVDWTAVAKEVSNSVV
FT                   SIQTVTSEGTAKGSGAIVSDKGYIVTNNHVISGAQQIQVTLANGTIYSAQVVGTDTTTD
FT                   LAVIKLDNPPSDLKAVEFADSDDLAVGEAVMAIGNPLGYDDTATTGIVSALNRPVTVTD
FT                   DNNNAIVTNAVQIDAAINPGNSGGPTFNAAGQVIGINSSIASTASSSSSAGSIGIGFAI
FT                   PSNLVKRVANEIIENGSVQHVALGITIKSSTVEADGVTRGCAQVQSVVDGGPASKAGVK
FT                   AGDSIVAFNGKAVNNNYSLLGYVRASAMNDKVTLTIVRDGHTMDLEVTLNQEESSSSSS
FT                   NKQEQNEQNNGGNGQDQQGNGQNGDGGGFTDPFGLW"
FT   gene            68555..70990
FT                   /locus_tag="BDP_0058"
FT   CDS_pept        68555..70990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0058"
FT                   /product="cation-transporting ATPase"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08750"
FT                   /db_xref="GOA:D2Q704"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q704"
FT                   /protein_id="ADB08750.1"
FT                   /translation="MRRVINLCKQVPLLPITILAAIPLAMLGTWRPWGTRSVFAMLFGW
FT                   DSVNPGVGQWLVIALVLYTIIVTVLGMIDDVRHGHVGVDLLAVIAIASTLAVQEYWAAW
FT                   AVVLMISSGEAIEEFAQSKAESNLTALIEAAPRTAHVVRLPGMRGHMHASGTEHASDIS
FT                   EDGFRRAVTMSDSAESDMQAVRFTSQMSDSAESDTGAPKAYDASGEHFTTISVDDVKLG
FT                   DVLLVLPGETVPVDGELLSGAATLDLSNINGEPLPREIYAGARVMSGAVNGSTTLTMRA
FT                   TQLAHDSQYQKILELVSSAQDSRPAVVKTADVLAVPFTVLSLAIAVLAWIIAGTPLRFA
FT                   QVLVLATPCPLLIAAPVAYVAGTGRLAKAGILIKAQDVLENLGRVTHIFFDKTGTLTVK
FT                   QPQVVRVEKPFDVRSPFNDDHILMMAGVVEGYSVHILSKGIAAAGQRAMHDLYARYAAG
FT                   QRLCAERNLPGHGRDYPVVNNIVEDAGKGVSGEVNGHKVRVGRYAYATADEFGFSPVVH
FT                   VSDSGESDKRGTSTTLQMSDSPESDNMKPGTSVQVSDSPESDMQRVRNAGVLSDSPESD
FT                   KRAVKGRLDVNSRFAPLEPDEMAAYVALDGQLAARIVLRDVPRKNAKNALARLRELGVG
FT                   KLSMLTGDKAASARIIAEEVGIDDVHSELFPEDKVRAVKDASEATRRHRTWRDGFTGES
FT                   RIHQVTMMVGDGVNDAPVLAAADIGMAMTDGTSTAASESAQVVIMNDDIASVPRAIAIA
FT                   RRTKKVMLQAVLVGLGLAVIGMIAAAFNLIPVVVGAFMQEGIDVVSILWALTALWDRE"
FT   gene            complement(71285..72295)
FT                   /locus_tag="BDP_0059"
FT   CDS_pept        complement(71285..72295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0059"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08751"
FT                   /db_xref="GOA:D2Q705"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q705"
FT                   /protein_id="ADB08751.1"
FT                   /translation="MRIHITYTGGTIGMIDSPNGLIPGADTRGWLFRLLEDAHMDSGLF
FT                   SFTELDPLIDSSNATPDNWQTMIDDLRTHAADADAFVVLHGTDTMSYSSAALSYALTEF
FT                   GKPVIFTGSQHPLGKIESDATANVTGALNAAMSGRFHGVGLFFGHHLFAGNRVSKSSSW
FT                   AFEGFSAPSTGPLARTGTPWHWYADDSAAVGCGWRSPKPYERHDVAVIDMVPGISAARL
FT                   DAMLTPRPEAVLLRAYGVGNVPSDEPGLTDVIADVLHDGVPVIIASQCQQAEVLLGHYE
FT                   TGDAIARAGAIGSGDMTLEAAYAKIMFLLSQGVTGSDFGKWMKRPIAGEISPSSL"
FT   gene            complement(72388..73866)
FT                   /locus_tag="BDP_0060"
FT   CDS_pept        complement(72388..73866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0060"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08752"
FT                   /db_xref="GOA:D2Q706"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q706"
FT                   /protein_id="ADB08752.1"
FT                   /translation="MSDATSHSAVKQDKSDAGYAKDLKPRHIQMIAIGGSIGTGLFLGA
FT                   GGRLSQGGAGLAIAYAVCGIFAFLMVRALGELAIRRPSSGAFVSYAREFLGEKGAYVTG
FT                   WLFFLDWSVTVMADITAVAVYFHYWKAFQGVPQWLLALIALALVFVLNMLSVKMFGEAE
FT                   FWFAAIKVATIVAFMLIAIWAIVTGAPVGDAHAGIANITDNGGLFPMGIAPVFALTLGV
FT                   VFAFGGTEMVGVAAGEAKDAEKVLPKAINSMIIRIFVFYVGSVVLMALVLPYTAYSSNE
FT                   SPFVTFFSGIGIPHAGDVIQVVVLTAALSSLNAGLYSTGRTLRSLAVAGSGPKFAARMN
FT                   KHHVPYGGIIITSTLGLVGVALNAVLPSDAFEIVMNLAGIGIAGTWACILVTHLAFLKK
FT                   AKTGEETRPEYRMPGAPYTNYISLLFFAVVVLSNLTSAAGRWTLAMFVVVIIAMVAGWF
FT                   YVRGRINGDLMDEMLDDNGNGVADVLETTQTPGK"
FT   gene            74150..75871
FT                   /locus_tag="BDP_0061"
FT   CDS_pept        74150..75871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0061"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08753"
FT                   /db_xref="GOA:D2Q707"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q707"
FT                   /protein_id="ADB08753.1"
FT                   /translation="MGNEMLAGAVGEARPGETKRFGTGMRGWIRRRWRPITFIAYVVVI
FT                   VCVMAFHEPWFDEAQSWLIARDASFRDILLLRPHYEGHPPLWWLMLAIPAKFGVSYEIG
FT                   LKGVQLVCAAVMAWLLVFRSPFPPLVAVLLPFTYFPCFQYGVTSRPYALMCAAIFLVAD
FT                   CWKGRDRHPWRLTLSLLLLCCTSSYGIVLACAVALVWVARVLLQARSLRALIADSGRFV
FT                   AWLTLMAVGLMLAACILPYPDTFGVTPGTNGNSPILQFLMFWLVLPSESMFTSFAGDVS
FT                   LHGMRMDVLPIAVCVVLSALIWAALVRLARRRGDLDILLLPYALFALCAAKYFSLHHLG
FT                   IMFALFVADWWMLVRDRPLDVDDAPERLRRFVKTRFEKTAETRRWSPSVVRDCVIVALL
FT                   LPSLLWNVAAVTCDLRYDYSGARAMAAFVKRNGLEHDRWVSFWRYYPETTWPDGSHTPR
FT                   QEDTHRYSWAAIAADPYFDHGLLDCTYRGRSYEPNQVPTALRMNREIAACAANGEPEFV
FT                   IGDTDFPDYYFKRLGYRMRDYRKITIATKRTPWKNWTTTADITAYVRVDVLRDLRS"
FT   gene            75991..77445
FT                   /locus_tag="BDP_0062"
FT   CDS_pept        75991..77445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0062"
FT                   /product="ferredoxin/ferredoxin-NADP reductase"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08754"
FT                   /db_xref="GOA:D2Q708"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q708"
FT                   /protein_id="ADB08754.1"
FT                   /translation="MTETNELRIAVIGAGPAGVYSSDIFLRQLGKLGDELGLGTKARID
FT                   LFEKLPVPFGLVRYGVAPDHPSIKFIASALEKTLDNPDIHLYCDVEFGKDVTLDELLER
FT                   YDAVLFATGAVEDKPLGLPGADLDGVYGAAKFVEWYDGYPTGAREWPLEAEEVAVIGGG
FT                   NVAMDVARELMRNADDLKERTDIPDNVYEGIKGNKAKVLHLFIRRGVAQAKFSVQELRE
FT                   MEKLPGVQLIINEDDFDLDDDTIEEAGKDKLTRQMVEELFTIREMAEDMEDDGDTDFEG
FT                   NPADRKYYVHFNSAPVEVLGEDGKVVGIRVEKTETSADGRMSRTGEFEEYPVQAVYHAI
FT                   GYKPATAPGIAYDERRAHLANAHGDGRITTAAEAGEDVEVRERLYATGWAKRGPVGLIG
FT                   STKSDALLIVTNMLEDLSKAAEGGRVAADRDPESIDRLLAERGVKPIDFAGWKKVDAFE
FT                   RAEGAKEGREHKKVIEPEQMRALAHA"
FT   gene            77627..78676
FT                   /locus_tag="BDP_0063"
FT   CDS_pept        77627..78676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08755"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q709"
FT                   /protein_id="ADB08755.1"
FT                   /translation="MGFGDRRNHVWKTGRMYMRRRVTVAMTGIAAAAALAVAFGTGAAG
FT                   LQGLGSSASEGGGKSASSSGQASSTSQTDASDSPTQSAMTGIDALDGSATISTSGFTLD
FT                   TDSQLAIESQITNFESAGYTASFVLVDINTGRAISYNADAQVYSASAIKAPFIMALAST
FT                   GTIDLNAVYQAGDTQNATTKQNIDQVLTVSDNTAYSWLVDTYGTGAFDSWAAQAGTAVQ
FT                   MAGYGYVTTCARDMAKLWTQGYGFLFAQQTSGAADVSDEALQWLSGDMTDSLNSNIHRA
FT                   LGDSTTVYTKAGWISGEGDLYALNDGGIVASSSGAYVLSVMTDACGRNDLLTELVDVLD
FT                   SVHSGAMLA"
FT   gene            78761..79813
FT                   /locus_tag="BDP_0064"
FT   CDS_pept        78761..79813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0064"
FT                   /product="Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08756"
FT                   /db_xref="GOA:D2Q710"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q710"
FT                   /protein_id="ADB08756.1"
FT                   /translation="MYPAKYQTASLRLGPMNGKLRVHGHCNGLKTTLLFALMWGVIMLI
FT                   WWATGGSQRTLGVYILIGLGSTFVSYWFSDKLAIASMGARAVSEQEAPMLYKIVRELSA
FT                   KAGKPMPRIYIAPTMSPNAFATGRNERHAAVCCTQGILQMLNEREIRGVLGHELMHVYN
FT                   HDILTSAIASAMATVISYLGYSLMYFGGGSSRDDRNGSSSSGLGLLGVLLSAILAPIAA
FT                   SLIQMAISRTREYDADEDGSMLTGDPEALASALNKISYGAEAAPMRKTAGTQSVAAMMI
FT                   ANPFSTEGFSRLFSTHPPTADRISRLMQMSQEMKAQGVQSGYTSDGYVQGGYSQSGYVQ
FT                   GGYSQGPFRS"
FT   misc_feature    complement(79674..82039)
FT                   /note="Similar to ISSde12 12bp perfect TIRs"
FT   gene            80023..80096
FT                   /locus_tag="BDP_tRNA5"
FT   tRNA            80023..80096
FT                   /locus_tag="BDP_tRNA5"
FT                   /product="tRNA-Gly"
FT   gene            complement(80235..81338)
FT                   /locus_tag="BDP_0065"
FT   CDS_pept        complement(80235..81338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0065"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08757"
FT                   /db_xref="GOA:D2Q711"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q711"
FT                   /protein_id="ADB08757.1"
FT                   /translation="MPIYSYNTKSGDKRYRVTYRDPDHSQRTKRGFRRRKDAQDYLARM
FT                   TTYIADNDYIDPNAGKTLVCQFADTWLKGKKNVVKPKYYADLECSWRVHVCNAWGNREI
FT                   ASIRHSEIQTWVSELAKKRSATITIRAHGVLKGVLDLAVRDGSIRRNPADGCQLPRKQR
FT                   KERTYLTPAQVIDLAHAAGTYQALILTLGFCGLRWGEAAALRVKHVDTQNNRLRVRLSW
FT                   VRSGKKHFEGAPKTWEVRDVPVPDQVMSAIKEQCEGKGPEDLVFTAPSGGHLREQSAKN
FT                   HGWYARALRDSGVPTLTCHDLRHTAASIAISSGANVKAVQRMLGHKNAAMTLDTYADLF
FT                   DTDLDDVATSISSKIAAAKTSNSGNVR"
FT   gene            complement(81382..82074)
FT                   /locus_tag="BDP_0066"
FT   CDS_pept        complement(81382..82074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08758"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q712"
FT                   /protein_id="ADB08758.1"
FT                   /translation="MSMEEANPLYEDATYALAIDKWKFIVFTDFDRMDRTAFVSIAPGI
FT                   AVRADYCIRAMEDRIGKYDIRLHMGYSEEEQRIVLRNCEIGTTRELKIRDIARLPIEQI
FT                   IRSYHPPLWSYEITENGTDIFGPLPSWEDEVLRKVNFPALRKQGPTPDTLKWASRVYSV
FT                   TQLNKGPATKRLTEVFDIPLRTASHWLTLMKERVPESVSAKLPSPITVHDETEIDTTPD
FT                   ISLKKLLE"
FT   gene            82529..83974
FT                   /locus_tag="BDP_0067"
FT   CDS_pept        82529..83974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0067"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08759"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q713"
FT                   /protein_id="ADB08759.1"
FT                   /translation="MLHYSDLRPEKGEFIGDGIARTAGGIPYNPEADVNASFPDDAFWN
FT                   SRTSLCEIKDYAVSRLVSPIAVLAVTIARIMVAAPPHMVLPPFVGADYGSLNFGMVILG
FT                   KPGSGKDAAFGAARKLVPDIRDAPVTSVASGQAISALFGQRVQEGNRFKLECKSPRAMI
FT                   RYSEASNFKALSSAKESNLQAEVLSLFSGQQIGDYTKNKELAVTIPEHGYRAVVVISAQ
FT                   PSMMGMFEAGVGVGFQQRFLYVSAYDDRLSVRPIGEEPVELSSLTKFPYDTKALPADYP
FT                   IEQMNRLYECGSYVKANEATPESSHLRMYPMRMPPIVRNEIIADKQRVNRERGGDPRRA
FT                   HSMFLREKLAVGLRLLEDPRSSETTQEDWELAGRMMQYSRACYEENLREFEDENLTRRA
FT                   DFKEQDELARERVDIRSRCATEERIVDILSASSQPSVSKGELSRALSKRQKVYMDDALE
FT                   NLMTSGKIKHRKGVKGGHWYSLI"
FT   gene            84379..85320
FT                   /locus_tag="BDP_0068"
FT   CDS_pept        84379..85320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0068"
FT                   /product="abi-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08760"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q714"
FT                   /protein_id="ADB08760.1"
FT                   /translation="MHKPFMPVADQVKLLASRDLATDSRTSWVLEREGYYSVVNGYKTP
FT                   FLDKEKTEAAGDDRYRDDASFNDIYKLYVFDRNLRFLFFRMTTLAEAILKTVCSHEFTK
FT                   LNPNEKNPYLNIANYASSGTAHEKAIKLIPRLEKILHLNMQSGYADKKGYLRHCLERHD
FT                   GEVPMWVLANDLTLGQMYWFFQSQKTEARANIARSFTALYADSHKHEIEITSQRLDKIY
FT                   RRIKDYRNICAHDERLYCAHPHDSNITVFQLAKDLQFVTDKQRYLEFLQGFDSLLMHLR
FT                   EDIPHYLDAVCVEIGLHYPDELHLFMQQIREK"
FT   gene            complement(85762..87666)
FT                   /locus_tag="BDP_0069"
FT   CDS_pept        complement(85762..87666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0069"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08761"
FT                   /db_xref="GOA:D2Q715"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q715"
FT                   /protein_id="ADB08761.1"
FT                   /translation="MLFFTQRLRDSITPTARTWTPRTITWRLWAAIILIPVFMLSLGLF
FT                   AFHGTSNHPATAKAAVVNNDEPVELNGQTLPLGRQLASELLHNNDSDYDWTLTDADDAR
FT                   NGLDNGSYAITVTIPNDFSKRIVDTMQASLTGDTSSVSNGLVHMETSNTTGVNDPQFAR
FT                   AAAERAKNNLDQLIIRTYLGSVYDGSNTMHESLSTAADGANQLGSGINTLHDGANQLHD
FT                   ATKQLVDGTTTLKQGGSQLESGAQQVAQGAEQVAQGNEQLASTVSPIAQQASSLLEQAP
FT                   SAVAALQQMQELVGQCAANNTPQAYCDKLDQALSQATEPAERIDAAKAQAIAQIQHTQS
FT                   SINQLAQGSRQVADGAKSVADGASQLNQGIVQLSDGATAINDGAAQLSDGTKKLQEGAD
FT                   TLSSGLTNGVKQVPTFSKEARERLASTIAQPTRSIISSIPSGLLAATLLLALALWGLSL
FT                   AVYVIARPISADILTSKESTWKLVATGMFLGTAAASIGALLASAIAWAGLRLDNQHGAF
FT                   LMIMALVCAMAFNAINQALIGSFGSLGRLLSMMLMALTLLTGIVSTIPAPLASLASMLP
FT                   THAANMMLRTAITGSGSITQPLLTLLTWWVVGFLACVALTARRRTLNPNQLRLPSQTF"
FT   gene            complement(87681..90491)
FT                   /locus_tag="BDP_0070"
FT   CDS_pept        complement(87681..90491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0070"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08762"
FT                   /db_xref="GOA:D2Q716"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q716"
FT                   /protein_id="ADB08762.1"
FT                   /translation="MSFSLYKLGQLMVRRRGRVLMAWLLASVLAVAGMATLAHGTNDEF
FT                   SIPGSQSQDALDHLGHVFPEVSGTSAQIVAVAPESQRIDTTESRNAIGVVAKRIGGYRQ
FT                   VALAADPFSETVQDAVSEDGRAAIIAIQFEVPFNELDSQVKSKIASDAKALQDALMDGA
FT                   VTYCGGAAYSNAIPSLSPTEALGLAFALIVLLMMFGSLVAAVLPLFTAVVGVGVGVATI
FT                   YTMTSWFTISSTAPMLAVMIGLAVGIDYALFLISRHRDQLSDGLEVEESIARSVATAGS
FT                   AVIFAGLTVIIALLGLFVAGIPFLTTMGVAAAFGVLVAVTVAETLVPALLGFAGKRLIP
FT                   RKRANVKTSRRSLTNRKSHDHRIARTWVRLVTAKPLAVVVVITVALSALALPAANLRLA
FT                   LPDNSVEEVGTPARDAYDAVAEHFGPGFNGPLILTADIIQSTDPIGLVNRIADDIRRLP
FT                   GVKAVPLATPNPKGDTGIIQIVPETGPSDAATEQLVRELRGKYQYFLDTYDTETAVTGI
FT                   TAVAIDVSSKLGAALLPFGLLVVGLSLILLAMVFRSIWVPLKATAGYLLSVLAAFGVTT
FT                   WVFQLGHGAELIRVQRVGPVISFLPIILMGVLFGLAMDYEVFLVSRIREHYAHHGDAKA
FT                   AVEEGFASASTVVVAAATIMLSVFAAFIPEGSATIKPIAFSLAVGVFVDAFVVRLTLVP
FT                   AVLALLGKRVWHLPAWVDRRLPVFDAEGDGLERELRLRDWPTPDSTEVLSAHDLTLDDM
FT                   NGNALYEHIDLHIKPGEVLVVEDSGVSGKSALLYTLAVRVTTFRGDLKVIGCTLPQHMR
FT                   EIRSNVALISCANAADPLEDMRQATNDGTRLIMLNDADMVLQPDARAQLRDAISKRGET
FT                   TYVLSCRNLSTLGDILHGMPLTILRLSSRTRDSERTDQFDRPESHITRFARFINSPITT
FT                   STHVEQ"
FT   gene            complement(90622..91902)
FT                   /locus_tag="BDP_0071"
FT   CDS_pept        complement(90622..91902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0071"
FT                   /product="FMN oxidoreductase"
FT                   /EC_number="1.5.8.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08763"
FT                   /db_xref="GOA:D2Q717"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q717"
FT                   /protein_id="ADB08763.1"
FT                   /translation="MDKQNTTRPTHLAQPIELRCGVHIKNRFFKSAMHEAMADRDHAPT
FT                   ERFAALYRQWAEGGAGVLMTGNVMVDHTQLGEPGNVALEDDSNLAPFRSWAEAGTVNGM
FT                   QCWMQLNHPGRQSPATINPHPWAPSAGKLEGEYGKFFAEPRELDRAQIHDIQQRFATAA
FT                   RLAKQAGFTGVQLHGAHGYLINQFLSPLDNQRTDEYGGSLDNRMRFLVETYQAVREAVG
FT                   SDFPVAVKLNSSDGQEGGFSEDESLTVIQRLADLGVDLVEISGGTLEKPTFSTNTGDKE
FT                   DSARGVYFSDFATRVKQLDLHGTVVCLTGGFRTPADMEDALEQGITDMIGIARPLVLQP
FT                   DMPQHILDGDIEPTNRFKLPWITTGVKSLDKAFNGVLVISWFELQMNRIGTGKNPDPNI
FT                   GGMRALLFALKQHGPAVLSPRRRKNRN"
FT   gene            92181..92948
FT                   /locus_tag="BDP_0072"
FT   CDS_pept        92181..92948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0072"
FT                   /product="dehydrogenase"
FT                   /EC_number="1.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08764"
FT                   /db_xref="GOA:D2Q718"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q718"
FT                   /protein_id="ADB08764.1"
FT                   /translation="MTVAVISGTTSGLGREFVDAVMGECPEIDEIWMIARRQDRLESIA
FT                   AEYPRMRFVCLPFDLSQDDGYAGLEKELEARKPDIGVVVANAGVASAGLVEESEPDALE
FT                   RMIRLNAIGSTMLIRLCLPYMRRGSFVIQVSSVSAFAPNPNLTVYSATKAYASFFAAGL
FT                   REELKPRGINVLRLNPGNMRTGMQSGVASHPDAAHGSTAAKLPFVDMARFARIALRKAR
FT                   AGCASYTMHPVYKAYRVLAKLVPMRLLTLFSWG"
FT   gene            93009..93611
FT                   /locus_tag="BDP_0073"
FT   CDS_pept        93009..93611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0073"
FT                   /product="TetR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08765"
FT                   /db_xref="GOA:D2Q719"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q719"
FT                   /protein_id="ADB08765.1"
FT                   /translation="MKADEQRAGTRAGRRILNGMADALLELVGEQSFEQVRVNAICERA
FT                   DYPRATFYNYFADKYDLLNHCWARFAASMEPRDFEGTRDGFHTLFDRFADLFDRNAELM
FT                   RKIFAHNGLDGALMRSLTAYFIARIRESFRANHCYHLEVAGGLPQDLLADFCANTMLLI
FT                   VRWTFLSATPISRDQAHALIDQLIINTETSGTATTKQ"
FT   gene            complement(93613..94032)
FT                   /locus_tag="BDP_0074"
FT   CDS_pept        complement(93613..94032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08766"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q720"
FT                   /protein_id="ADB08766.1"
FT                   /translation="MYELNGIMIVGEITPELKVVNARATNDWMMLVTFSNGETRVFDGT
FT                   NLFGKPVYEPLRDQTVFDDFAIDHAILTWDSSIDIDTNNLYNLTYPYDTITDTSSANTP
FT                   IQLRPCNANSFTDQQHSKDPAIACITGLTLPIAAA"
FT   gene            complement(94689..95066)
FT                   /locus_tag="BDP_0078"
FT   CDS_pept        complement(94689..95066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08767"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q721"
FT                   /protein_id="ADB08767.1"
FT                   /translation="MLRLRLSRQPTGHLHTRSEAHRFSSRESGPEAPPTKGNGSPVKPP
FT                   RPRGASKCGHTCVACYSHIRIHELGAIVHGLEQTLGGVVHVPVLSCFIRHDDCDADPLR
FT                   AWREAGSHRTIDAKAIWRKLI"
FT   gene            95080..95424
FT                   /locus_tag="BDP_0077"
FT   CDS_pept        95080..95424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08768"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q722"
FT                   /protein_id="ADB08768.1"
FT                   /translation="MFTPEEWEQARRVHERWSRNIPVYRRWGDFARQTLMHGGLMNVSV
FT                   TLASDPEAFKAELHRIGVNVNQVARIANLTGTVDAEQVRELQDLLASIDGRVAEMEREK
FT                   ARIDAAQGLY"
FT   gene            95424..97313
FT                   /locus_tag="BDP_0079"
FT   CDS_pept        95424..97313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0079"
FT                   /product="mobilisation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08769"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q723"
FT                   /protein_id="ADB08769.1"
FT                   /translation="MAVVKLGSKVKTNLPATIRYVINPAKNDDGRLVYASYSGEKRDAD
FT                   MLAEPMIHDLERCANGLRRDGVLALHLKHSFSPDERVTAGQVHELGVMLAEAITGGDYK
FT                   YVVCTHVDRHHLHNHIVICAANRRTGRKMRLTRRSIDRWRAISDELCRREGLGILENPN
FT                   VETAMKHAELVAAMRHTPGQDDSPLPGTGARTVASNGLGVGMNELYAAAKGGGVKERMR
FT                   ILIDLDAARAGNIAELSRLLDSHGISLAMRGGEATFMDQATGRRFRGSRLGPAYSLDQI
FT                   GARLSNGGSMLHLTFNNKLVATENERTVSVWLPGSKRQRKVNLPVNMLHRDGGTWHLLV
FT                   PETFTGMLTDRSNRYAARFTATTLADAFGRPERRIEPLTATPRTRIVRYASSEAQRRYY
FT                   QSQARKLDELAMMVEGLNAACRIQRAGGCDLAKGLRDLNNRADWARGELRAAVIALNDA
FT                   IDNNDTDLIVETREEIERREQALLECQRELDKIRIAARLAGITPPEQTNKEQHHEPDSK
FT                   EHQYGNRSDGRHVLPNVRPDETTGTSEHDPDHGNRHDPAGSGEQGTRTADRGAAGREFD
FT                   ALIRESRASINESEALVSESDAQETTLRTQRDEQAARRNQTEGTRLRRKGRAL"
FT   gene            96985..98016
FT                   /locus_tag="BDP_0080"
FT   CDS_pept        96985..98016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0080"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08770"
FT                   /db_xref="GOA:D2Q724"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q724"
FT                   /protein_id="ADB08770.1"
FT                   /translation="METDPMGDMFSQMFDRMKPQEPANTTPTMGTDMIRLEAENRELER
FT                   QIAELRDGNSTLSSENRELRSTNQRLLSANRTLRKQLSELNETSRLLEETKRREHDCAE
FT                   KEEHCRRILNREATLKQDEARLESDRAKLDGERKRLRENIAEQVRQQAEQEQERLRNDA
FT                   DRQRGKDRRVLFALCVGVCASVIPLLVIIMQGRWHALMASLPEWVHARGQQLSAIGKWF
FT                   NSTGTWIGGIIPQGWWNGPLTLLVMLVIFVIVCGIPLLVVIVYAAASKAAVMYWWREQT
FT                   MGVHIILWTLLMLICLVVADRLATIPDSPMRWPTWWILLAAITHPVYLLAIAPRISQFI
FT                   KGD"
FT   gene            98284..98961
FT                   /locus_tag="BDP_0081"
FT   CDS_pept        98284..98961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0081"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08771"
FT                   /db_xref="GOA:D2Q725"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q725"
FT                   /protein_id="ADB08771.1"
FT                   /translation="MDMLEAMRSRHTVRAYTNKPIPDDIVSLLTRRVAHDNQKYGTAIT
FT                   LRTEDTTAFGPIFKLIRAKGVRNFLIMSANLREGEDPRELDERLGYAGADLMLYAQTLG
FT                   LNTWWAGGTYSRKIVDKMAEGNRTIAVIAIGYGAEQGEPHQSKSVSEVCKYDGKAPAWF
FT                   TDGVKAALLAPTAFNKQDFFIEGHGRIVSVRLTNETSYSGADLGLVKYHFSLGAGADNF
FT                   GWA"
FT   gene            99404..100630
FT                   /locus_tag="BDP_0083"
FT   CDS_pept        99404..100630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0083"
FT                   /product="Xre-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08772"
FT                   /db_xref="GOA:D2Q726"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q726"
FT                   /protein_id="ADB08772.1"
FT                   /translation="MSFRENLQYLRGTRNMTQEQLAMLLGVSRQAISKWESEKAYPEMD
FT                   KLLMICDLFGVTLDDLVMGDVRRPNSGIRESTADTSTNSGSVGVVAAIAQPVGFAAASS
FT                   SLRNQAESSASTQDAPTALKADHPAAAPRSAAASRSAMPQDMVGYDRHMKIRAWLTALG
FT                   VAAMILGVAAGMLFDSENSIIGHSPMNEFLTAAPIILGVIVGCALLIPAGALHGDFQRR
FT                   HPYIQDFYTDDDRSRAVIENGIGKAVGVGLIMVGVCVMVYCNEVLGINNGWPVSIMLAL
FT                   VAIAVFCFIFTGMRLDRTKLGKYNRESEERNAEGDSAEDDFESLSQPMSVTDKYYNKLT
FT                   GAVCGIIMLIATVMALLMLFVGVNANAALGGDPSFWGAVFWIPWPIGGILCGVAGAVIQ
FT                   LLKYRNGRR"
FT   gene            100899..101846
FT                   /locus_tag="BDP_0084"
FT   CDS_pept        100899..101846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0084"
FT                   /product="permease of the DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08773"
FT                   /db_xref="GOA:D2Q727"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q727"
FT                   /protein_id="ADB08773.1"
FT                   /translation="MVRVKADERKTPRNPLLGHAISHRGTIIGLCAIVLWGFMAGLVRL
FT                   VADAFGATLGSALIYTVGGMMLMIVRRPAPIRKAPRKYLIIGGAMFIAYEASISLSIGL
FT                   ASTAAQSVEVSLVNYLWPTLLVLMTAAVSHKRGAVWKALPGAIVATIGVAMAVGGESLD
FT                   VYEAMRNIASNPLPYALALAGAFIWAVYATVTPVMSDGYDGTTIFFCCVAAVLWVIHFA
FT                   SGQGWPTSTPSISGYVTLAACALSIADGYACWGYGMLYGNMETLAVGSYATPVFSTASS
FT                   TVLLGVALGVPFWIGVVLVVAGSLINLWFARRAS"
FT   gene            102250..103224
FT                   /locus_tag="BDP_0086"
FT   CDS_pept        102250..103224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08774"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q728"
FT                   /protein_id="ADB08774.1"
FT                   /translation="MLRQAYAHRRLAVPEQPKDRRACQRRVHTGMIIMPKKGYYISAQQ
FT                   WNALSYADRIKWTLRTVCHEHPDWVLCGPSAAGAYGYSTTLQLQRYVHIAVTERSKAGR
FT                   HGFVIAHFYKDPPPTKVVDGMQVTAEIQTMADCARMLDFENAMIVCCTGLRKGNLTKTQ
FT                   LQEFVGNKRKIGGIIRARYVAEHAEPACENGGEVAALAAMLELGFAQPQAQVTYVSPLD
FT                   GRNIRADFSWERDDGSIVVGELDGRQKYVDPSMTVDGDTVDVILREKDRESELNMLKIN
FT                   VVRFQMEHVRFREPLRRRLDAARVPRDPCAYASPFAGFRSTAY"
FT   gene            complement(103569..104657)
FT                   /gene="fba"
FT                   /locus_tag="BDP_0087"
FT   CDS_pept        complement(103569..104657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="BDP_0087"
FT                   /product="fructose-biphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08775"
FT                   /db_xref="GOA:D2Q729"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q729"
FT                   /protein_id="ADB08775.1"
FT                   /translation="MTIATPERYAEMLDAARRGGYAYPAINVTSTQTLNAALQGFAEAE
FT                   SDGIIQVSVGGSAYFSGQSVNNRVVGSLAFAAFAHEVAAHYPNITVALHTDHCAKQYLD
FT                   EWVRPLLAHEAEQVKHGEEPTFQSHMWDGSTVPLEENLDIAEELLEKSVKAHTVLEIEI
FT                   GAVGGEEDGHSAEINDKLYSTPADGVRVAERLGLGEHGRYMAAFTFGNVHGAYKPGVVQ
FT                   LRPRLLHDIQSEVWAAAHDGRLGSVDAAHVSTCALPDMPEGKPFPLVFHGGSGSSAAEI
FT                   AEAVSYGVVKMNIDTDTQYAFSRAIAGHMFRNYDSVLKIDGEVGNKKFYDPRSWGREAE
FT                   SSMAARVVEACKQLGSAGRALR"
FT   gene            104811..106007
FT                   /locus_tag="BDP_0088"
FT   CDS_pept        104811..106007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0088"
FT                   /product="polysaccharide deacetylase"
FT                   /EC_number="3.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08776"
FT                   /db_xref="GOA:D2Q730"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q730"
FT                   /protein_id="ADB08776.1"
FT                   /translation="MTLEDDIEELSFEDSVRPPRKHHTWLRVILAMLLTVLVAGGATGG
FT                   WYLWNYHLRRIPVTVNRVDRLVRIDSTIATLLHDNDDFNAKPGRLLDITGKVLDKRGGG
FT                   AIIVKRNGAAVATAQLGSTRMADNDVITVESGKDQTEAHTVRYDTVKYGTDINLNNGPL
FT                   QEVKQLGKDGMKEIWVGRRSKKEVDKGFKKEPQNLVVQSRSPRPAGRKVIALTFDDGPS
FT                   QYSDAVLDILKEKGVKATFFDVGESSAQYPKQEKRMLAEGHQVASHSNTHPYMPKMGRD
FT                   ELRAEITAGFDNLKKASGLETKVMRAPYGAFGVEQWKQCADLLDMNVLWDIDTEDWKMP
FT                   GAQAIHDAVLNNAHNGAVVLMHDGGGDRSQDVEALPGIIDDLKKQGYEFVTIEQLSEM"
FT   gene            106272..107558
FT                   /locus_tag="BDP_0089"
FT   CDS_pept        106272..107558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0089"
FT                   /product="adenylsuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08777"
FT                   /db_xref="GOA:D2Q731"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q731"
FT                   /protein_id="ADB08777.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGTKVDYVARFNGGNNAGHTVVV
FT                   GDESYALHLLPSGIISPTATPVIGNGVVVDPEVLFEEIDGLESRGVDCSRLLVSESAHI
FT                   IAPYHRVLDKVTERFLGKHKIGTTGRGIGPAYADKINRVGIRVHDLFNAEHLHDKVEAS
FT                   LHQKNQMLVKLYNRRPIDVDQTTDELLKLGERLKPYVANTSLVLNKALDEGKTVLFEGG
FT                   QATMLDVDHGTYPFVTSSNPTAGGACTGTGVGPTKITRVIGVSKAYVTRVGEGPFPTEL
FT                   FGEDGDWLRAQGHEYGVTTGRPRRCGWFDAVVNRYASQVNGLTDIVLTKLDVLTGLQEI
FT                   PICVAYDVNGERHDDMPTDQAEFAVAKPIYETMPGWTEDISQVHDFNDLPQTCQDYVKR
FT                   LEELSGCRISVIGTGPQRDHIIQINSLVD"
FT   gene            107863..109434
FT                   /locus_tag="BDP_0091"
FT   CDS_pept        107863..109434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0091"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08778"
FT                   /db_xref="GOA:D2Q732"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q732"
FT                   /protein_id="ADB08778.1"
FT                   /translation="MSSIPTIDRLIPRFDHLKWKMAAAGVAVGLISGLLVVVYRLGIEY
FT                   GTDCARWMYAQIRNQPWLLVPWMAAATGSALLIAWMVGKEPMAGGSGIPQTNGVVIDGL
FT                   KMRWQSILPVRFVGGLLGSLFGLSLGREGPSIQIGASGAQFLSHRLRGRRREDAQEHYL
FT                   VSAGAAAGLSAAFSAPLSGMMFALEGIHRSFSPTILMGATAASLTADFVSKYCFGLRPV
FT                   LDFGAVGQLPLAEYIWLIPLGIVAGLVGSLVNRSLLGLQTLYGKLPAWIRPMVAIAIAL
FT                   PVGIWLPDVLGGGSNLIALSEKAESGIGMLCILFAAKMIFTSTSFGSGTPGGIFMPILA
FT                   IGSLAGGICGEAARQFCGLQSQSVAVFAVCVMTGTLAASVKTPITSILLAVEMSGTLTH
FT                   MLPIAASAFIALLVSDLLRTRPIYGELLARYMKARDMESTVVSQVGSGVMELPLEMGAE
FT                   AEGKRVRDVAWPSGCLIIGLRRGEREIVPRGDTTLRAGDYLVVLFSGEEERKVRLAMRR
FT                   LCDAGL"
FT   gene            109670..110710
FT                   /locus_tag="BDP_0093"
FT   CDS_pept        109670..110710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0093"
FT                   /product="crcB-like protein, campher resistance"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08779"
FT                   /db_xref="GOA:D2Q733"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q733"
FT                   /protein_id="ADB08779.1"
FT                   /translation="MESQTRGPLHGGQADDEPKPPRWLGAGEDPNPATQAISVVEAANA
FT                   DAQPQGAAAASNPPQIPLAPLKRVQARFNPLADGLMYLVVFVGGFVGVGLRRVLDEMMP
FT                   AAEGQPFVPGTFVSNMLACFLFAMLVEYMAVASWWPRRMRQIASRGIGLGMLGGLSTMS
FT                   GLMLETMEGMSTHHVTGALLYLAISFVGGMIASVAGLGIMQLLLARRTRRAVREALRLS
FT                   DSGESDKQGADRHSRLSDSPESDNLTMRKGLAEGYTQVKVADMAHSAAQAALEAAAAAQ
FT                   AAATTAARAAQSESVESQESPGLAELADATRRNSPVPSVNPPSFEPKPITAEIPLVADP
FT                   TTGEVR"
FT   gene            110710..111078
FT                   /locus_tag="BDP_0094"
FT   CDS_pept        110710..111078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0094"
FT                   /product="crcB-like protein campher resistance"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08780"
FT                   /db_xref="GOA:D2Q734"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q734"
FT                   /protein_id="ADB08780.1"
FT                   /translation="MMWLLCFFGGIGAMARYVLDVSIQRSWNRSFPLSTLVINGIASLC
FT                   AGIAMMSYYAQSVDSQTVMLFLTGFLGGFSTFSTAINEVLSLIRKKRFAMALGYGVATV
FT                   AVPLVCVALGFGLASLAR"
FT   gene            111349..112758
FT                   /locus_tag="BDP_0096"
FT   CDS_pept        111349..112758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0096"
FT                   /product="branched-chain amino acid ABC transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08781"
FT                   /db_xref="GOA:D2Q735"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q735"
FT                   /protein_id="ADB08781.1"
FT                   /translation="MTAVSHIARHRRSGIVILCSIFAALSMLFILPPDSAMAADAVDVC
FT                   NPTSDNGCVNGILQDADKKAIADITVKLSGTEEAETTTDADGKWAFSVKDDGDYTVTID
FT                   ESVAEEHGLKSSSATVTIKKASFDKQRGVVRFDQVNDSASSDSSSSDSAKSGADSSSSS
FT                   GTATVSKKKAGSNIGKRIWQQLYSGIIFGLMLGLMSVGMNLVYGTTGLQSFSHGEQVTL
FT                   GGLMAYVGTQMLHMPVVASAIFAIVIGAITGLIQNEIVWGPLRRRHVGTMQQMIVTIGL
FT                   SMALQYTFQFFFGGDIKGIVKSVPDSFQLGPITTDMPTLLSALIAICVIIGVTLFLYKT
FT                   RLGRATRAVSDNAALAAASGINVDQVVRVVWILSCSMAALSGVLLGIYLNGISWNTGAT
FT                   LILLMFAAVTLGGLGTANGALIGSLVIGIVADMSSLVIPNDMRYASALAILIIVLLVRP
FT                   QGIFGKQQRVG"
FT   gene            112762..113745
FT                   /locus_tag="BDP_0097"
FT   CDS_pept        112762..113745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0097"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08782"
FT                   /db_xref="GOA:D2Q736"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q736"
FT                   /protein_id="ADB08782.1"
FT                   /translation="MDIMTIISNAAGELIAPTTAAYVLAAIGLNIHFGMTGLMNMGQAG
FT                   FMLLGAYGFAVTQSMGCNLFASVCAALALAVIYALLLGIPTLKLGPDYLAMVTLAAAEI
FT                   IRIIGRSTAMTNLTGGSAGISPQDFTEKFEALSPLPDGSTTFLLWTYSNNIANSWWLRI
FT                   VAWILVAIAAFLCWRWFHSPWGRMLKGIREDENAIRSLGKPVTKYKMESLILGGLFGAM
FT                   AGIIFVLPRSVQPDSLGRTVTFYVWTILLLGGAATILGPVLGSCVLWVLLTFVKEVMRN
FT                   TVPETLISSNQIEALGWVIVGVALMCLVIFRPQGLLGDRKELAFHA"
FT   gene            113738..114733
FT                   /locus_tag="BDP_0098"
FT   CDS_pept        113738..114733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0098"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08783"
FT                   /db_xref="GOA:D2Q737"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q737"
FT                   /protein_id="ADB08783.1"
FT                   /translation="MPDTTNTQQPAVSSFPQPGVPFHDLTKWATKAPEGETLISTAYKD
FT                   KVTEDLRFVENKPGVHKPDPILIADNVTRKFGGMTAVDVGHFEIERHGITALIGPNGAG
FT                   KTTFFNLMTGFDTPNTGTWQFDGKDMAHVQPEKVARMGMVRTFQLTKVMSRLTVLDNML
FT                   LGAPVQPGEGMFRALFPGMWKRQEKENVEKAEALLERFLLIKKKNDYAGALSGGQRKLL
FT                   EMARALMSDPQLVMLDEPMAGVNPALKQSLLDHIMALREEGTTVLFVEHDINMVRHIAD
FT                   WVTVMAEGKIVAEGQPKSVMSDPAVIDAYLGAHANVDLGDDSVLEDLKEA"
FT   gene            114735..115595
FT                   /locus_tag="BDP_0099"
FT   CDS_pept        114735..115595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0099"
FT                   /product="branched-chain amino acid transport system ATPase
FT                   component"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08784"
FT                   /db_xref="GOA:D2Q738"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q738"
FT                   /protein_id="ADB08784.1"
FT                   /translation="MSDIASVTDPAGLSDSPESDIQGGSADGLTRAQIHVGEPEGEPLL
FT                   DAVDLIAGYIPGVNILNGASLTLHEGEIVGIIGPNGAGKSTLLKSLFGLVHIHSGKLLL
FT                   KGEDITNLRADKLVSRGVGFVPQTENVFPSLTIAENMHMGAFQAPKLFNERFDYVCSIF
FT                   PKLGQRKNQLAGQLSGGERQMVAMARALMMKPSVLLLDEPSAGLSPMLQDETFIRVRQV
FT                   NKAGVSVVIVEQNARRCLQICDRGYVLDQGRNAYSGKGRDLMEDPKVVSLYLGNLEEEV
FT                   EEEGR"
FT   gene            116029..117333
FT                   /locus_tag="BDP_0100"
FT   CDS_pept        116029..117333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0100"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08785"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q739"
FT                   /protein_id="ADB08785.1"
FT                   /translation="MVIRMKHINMKSMKKLSITTTAVIAAAVMSLAGCGSSSSGSDSAA
FT                   SSSDSSAKTTKFVLGGLWPETGSLAYLAPPELAAEKLAVKDINDAGGVLGNDVTTVDAD
FT                   TSDADHADQNTSAAQSVLSKNPSFVIGPASSSVVKNTYKSITSQNVPMLSMGATSASFS
FT                   GLSDYFFRTVAPDTVQGAVMGNLIAQDGVQKLAIAVFNDEYGTGLRDTVVKTAGDAGVD
FT                   IVYGEKDTFDPTETNFSSIATAIKASNPDATLVIAFDQTKPLLKALASAGVDMSKLYFV
FT                   DGNTSDYSSELDAGLLKGSKGTIPGVNPSDDFIKRLESTGVDLKNTTTYAAETYDGIIL
FT                   AALAAQKGGSADGKTIQANMAAVSGADGGEKCDSYKACLALLKDGKDIQYQGQTGIGPF
FT                   NKNNDPSSANIGVYTFDGDNKPVFDHTQSGDVPTD"
FT   gene            117519..118793
FT                   /locus_tag="BDP_0101"
FT   CDS_pept        117519..118793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0101"
FT                   /product="branched-chain amino acid transporter system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08786"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q740"
FT                   /protein_id="ADB08786.1"
FT                   /translation="MKKSNSRKTLITITAAAAALTMMLSGCGSSSSSSSDSSASSTSDS
FT                   GTFMAAGLFPLTGSMAYLGPANIATMKLAQKDINDAGGVLGKDIEITSADTSDADHADQ
FT                   NTSSAQSVLAKNPSVVVGPPSSSVVKNTYKQVTSAKVPMISSGATSTAFSGLNDYFFRT
FT                   IPPDTVQGAVLGQIIAQDGVKNLAIAVFNDEYGTSLRDVVVKTVEDAGVKVVYGEKDTF
FT                   DPTETNFSSMVTSIKASNADATLVIAFDQTVPLVKELATQGIDTHKLYMTDGNTVDHSE
FT                   DFDAGLLEGSVGTIPGAHPTDEFQKNVKSFNSKVTDFTYTAETYDAIVLAALAAQKGGA
FT                   TDGETVQKNLMAVSGSTKGEECDSYKACLALLKDGKEIQYKGQTSIGAFNDAHDPSSAS
FT                   IGVYKYDADNKPVFDHSQEGSVPTA"
FT   gene            119020..120129
FT                   /locus_tag="BDP_0102"
FT   CDS_pept        119020..120129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0102"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08787"
FT                   /db_xref="GOA:D2Q741"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q741"
FT                   /protein_id="ADB08787.1"
FT                   /translation="MVGMRDVAKKAGVSLSTVSLVVNGTGYVSDDMRDRVQRAMNALNY
FT                   VPNELARNLYHNRTNMVGVIVPTIRHPFFATFTASLQHMLAGQGLSTMLCSTADAENGE
FT                   AEYVEMLRRHIMDGIVMSAHTAHTPDYWTSIHRPIVAFDRVLGEGIPSVGSDHEQGGRL
FT                   IADLLIRTGARHVVMIGGPRDQFFDLAARGEVEDVFDLEKTTFPTVRYYLTLEQELMKA
FT                   GIRYEYVEAGEVMDFDGYRRAVGETLDRVGPDGVDAVVSSDIGASFCVREALRRGIAIP
FT                   QDLQIVAYDGTYLTDLAGMKTTAVVQDFVAITQTVADHITQAIADEDAAAAKASLRKDD
FT                   NPFEPSVLIPVTLALGDTTRAVSAAADHS"
FT   gene            complement(120120..121073)
FT                   /locus_tag="BDP_0103"
FT   CDS_pept        complement(120120..121073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0103"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08788"
FT                   /db_xref="GOA:D2Q742"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q742"
FT                   /protein_id="ADB08788.1"
FT                   /translation="MSSIVLGVGNGKALFTGTSVAPDEDLVRFADPTDSIINAFDLSVL
FT                   RGDGIFEATTVWRGFPVSLENHLRRLAQSAKLMNMPEPNIPAMTRAVELVIDQYDDPEP
FT                   GPMLRIIVSRGLDPDTGVGRSADRTPTIFIFLDAKGTLHSLEPITMASMTRGYPSDITA
FT                   RAPWLLNGAKTLSYAFNCAVHRECARRGVGDAILHTEDGYTMECPNSSIVARYGGDFVT
FT                   PDPRIGILNGTSQREMFAWALQEGHKAVYRKLPIAELREADSLYMTHGGWVIPISEIDG
FT                   RALVVDTAQIQAVNDAIHSGRTHDDALGIGPTGDYE"
FT   gene            121478..122263
FT                   /locus_tag="BDP_0104"
FT   CDS_pept        121478..122263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08789"
FT                   /db_xref="GOA:D2Q743"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q743"
FT                   /protein_id="ADB08789.1"
FT                   /translation="MADLDAASTPAAARAAFRAGQVRPTCGVAQGYAQANLMILPKEQA
FT                   FDFLLFAQRNPKPCPLLEVMEPGVTEPATAPGADIRTDVPMYRVWRRGELVAEVPDIRD
FT                   YWRSDLVTFVIGCSFTFEFPLMEAGIPVRHITAGRNVPMYDTSIECRPAGAFRSTMVVS
FT                   MRGIPARQVADACRISGYYPSVHGAPVCVGDPAAIGIEDIAHPDYGDVPVLEPGDIPVF
FT                   WACGVTPQAAVMASKPEFAITHAPGHMFITDKRDLDYMV"
FT   gene            122290..123165
FT                   /locus_tag="BDP_0105"
FT   CDS_pept        122290..123165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0105"
FT                   /product="LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08790"
FT                   /db_xref="GOA:D2Q744"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q744"
FT                   /protein_id="ADB08790.1"
FT                   /translation="MNGIDLNSDMGESFGRWRLGDDESLLSVVSSANVACGFHAGDPSV
FT                   MLRTLETAAARGVTVGAHVAYRDLAGFGRRYVDATPAELKADVMYQIAALEGLAHAAGT
FT                   AVRYVKPHGALYNRIVRDEVQAAAVVDAIRCVDPSLGVLTQPGAVVGRLAADAGLRVFH
FT                   EAFADRAYNPDGTLVSRRLPGAVIADPSVVAARVMRMATRHEVEAVDGSVVTLNADSVC
FT                   VHGDSPSAVAMARAVRANLEAEGIEVLAFAADREETRRDFDGVSGHGVSTPEVSGAARG
FT                   GISSSIGRQS"
FT   gene            123162..124973
FT                   /locus_tag="BDP_0106"
FT   CDS_pept        123162..124973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0106"
FT                   /product="urea amidolyase related protein"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08791"
FT                   /db_xref="GOA:D2Q745"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q745"
FT                   /protein_id="ADB08791.1"
FT                   /translation="MRFRTCGDSGVLVELADLDETLRVFAALRSSKAAGIPGSNALDAV
FT                   TQLIPAARTILISFDPLLASRADIIAAVRALDVSTDVCRRSRTVEIPVIYDGEDLADIA
FT                   QLLGVSVPQVIARHCAHAWSVAFVGFAPGFAYLTGGDEIFDVPRRKVPRLSVPAGAVGL
FT                   AGTFSGVYPRVSSGGWQLLGHTEKTMWDEHADPPALLQPGDAVRFTPARERVVAGTASC
FT                   LSDSGESDKHDRILALQLSDSPESDKRCGPDSSIMATTALEATRPGLLTTFQDDGRCAA
FT                   DMGVTGSGAADPCSSHLANALVGNPTDVPVLEITGGGVRFTAHGDMVVAVAGAPAPITI
FT                   IGKATWNSGLGAQRNAGNQSHASERTVVIRQEAMLLRDGEVIEIGVPTSGLRDYLAVRG
FT                   GFDVARSLGSAATDTMSGIGPKPVAAGQLLPVLSPIGRHPSTMRGPRPNGGHGNSIGLP
FT                   EPWPEHLPKSDDITELHVRLGPRDDWFTATGISDFFDQIWTVTAQSNRVGLRLQGERSL
FT                   ERRDATELASEATLPGSIEVPTSGQPVIFLRDQPVTGGYPVIAVLTSESLILAGQLPPG
FT                   AKIRFRMSDSPESDKQNTQSQEHREAR"
FT   gene            124973..126793
FT                   /locus_tag="BDP_0107"
FT   CDS_pept        124973..126793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0107"
FT                   /product="biotin-dependent acyl-CoA carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08792"
FT                   /db_xref="GOA:D2Q746"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q746"
FT                   /protein_id="ADB08792.1"
FT                   /translation="MPRLQRILIANRGEIAVRIIHACHDTGRTAIAAYADPDADALFVH
FT                   LADEAYALHGVDAKSTYLNIDAIIETAKKAHADAIHPGYGFLAENADFAEAVAAAGMAW
FT                   IGPGADTIRMLGSKVEARRIAAEVGAPMAPGTTEPVRDPSEVVAFAERHGLPLAIKAVY
FT                   GGGGRGLKVVHRLEDVREAFMSATHEAELAFGNGDCFIERFLARPRHVEVQVLGDRTGS
FT                   VVAVGTRDCSLQRRNQKLIEEAPAPFLPDEITRRLESAAVAICKKACYESAGTVEFLVD
FT                   PDGTMSFMEVNTRIQVEHPVTEAVTGVDLVAAQLAIAEGARIREIPGLEDGCTPAVHGH
FT                   AIEFRINAEDPALGFVPFPGTVDGLRVPTGIGVRFDSGVEAGGTIPGQFDSMLAKLVIA
FT                   APSREVCLARARRALAEIAVAGIPTVVPFDRAVLEQPAFVAEDGDFGVYTRWIEEEFLP
FT                   SVDVAALSGGACGRRAAPTDPVESWIEIDGRRVRLGLPAGLASLASLAAGLSDSGESDM
FT                   QSAFLAPRMSDSGESDNHGGGTPLESTITGTLVRWLADDGAQVCEGDSIVVLEAMKMET
FT                   EIAASASGTLHRSAKVGDFAQYGENLGFIE"
FT   gene            126850..127878
FT                   /locus_tag="BDP_0108"
FT   CDS_pept        126850..127878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08793"
FT                   /db_xref="InterPro:IPR025504"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q747"
FT                   /protein_id="ADB08793.1"
FT                   /translation="MRTSILDWRHYPTIARIANMAACDVGRGSETLMTYSRGDLFHAAR
FT                   HLVSGRVGRSGRNGLPARALVVTGFFIPKADQPAAETDGPLGALEVCMALRAIGGDAWL
FT                   VNDECCEPVIRPAALGFLPEDHVLIAPDVSDSPESDNWSMNSAPRLSDSGESDKRAHGG
FT                   TPFDAWLNRVIDLVRAEGISTLIYIERVGPARDGNPHNMRGIDITEWTAPLSQLTLMGL
FT                   HTIGVGDGGNEIGMGRVEDYAIEGVVDHGMDIACTVSTDQLVVAGTSNWGAHALVCVMR
FT                   ALGRTEVDPYMEVEWQRVVLDVIVAHGGLDGVHMTNVATVDGLDSDRYFAEIMALASVA
FT                   RR"
FT   gene            128033..129547
FT                   /locus_tag="BDP_0109"
FT   CDS_pept        128033..129547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0109"
FT                   /product="sucrose phosphorylase"
FT                   /EC_number="3.2.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08794"
FT                   /db_xref="GOA:D2Q748"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR015325"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q748"
FT                   /protein_id="ADB08794.1"
FT                   /translation="MKNKVQLITYADRLGDGTIKSMTDILRTRFDGVYDGVHILPFFTP
FT                   FDGADAGFDPIDHTKVDPRLGDWNDVAELSTTHDIMVDAIVNHMSWESEQFQDVLANGE
FT                   ESEYYPMFLTMSSVFPNGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDI
FT                   DTDSDKGWEYLMSIFDQMAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEG
FT                   VKRGLEILIEVHSYYKKQVEIASKVDRVYDFALPPLLLHSLNTGHVEPVAHWTDIRPNN
FT                   AVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDEDVDNLVNAIHANTHGESQAATGAAASN
FT                   LDLYQVNSTYYSALGCNDQHYIAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGR
FT                   DINRHYYSTAEIDENLERPVVKALNALAKFRNELDAFDGEFSYEADGDTSISFTWKGDA
FT                   TSATLTFEPGKGLGVDNTASVATLAWTDAAGDHRTDDLIAEPPVVA"
FT   gene            129661..130317
FT                   /locus_tag="BDP_0110"
FT   CDS_pept        129661..130317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0110"
FT                   /product="hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08795"
FT                   /db_xref="GOA:D2Q749"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q749"
FT                   /protein_id="ADB08795.1"
FT                   /translation="MPKMSKLFDQNNMFFAIMGVLFDLIILNVLTLLCCIPIVTAGAAF
FT                   TAMHSVLWRMVRHEETYVARQFFESFKRNFRQSLLPWLGLLLAAVVLAVDGMLAWSMAS
FT                   MRGPLVACVAFAGLVVIAIAQYFFPLLSRYEDPTPVHLRNAAKLALGFFPRTLCMLVIL
FT                   VGFAVLYMQFFVYMIPLLLLMGVTLPQYCCAWIYNWIFRRIDGEIDTGGRTIPRS"
FT   gene            complement(130312..131916)
FT                   /locus_tag="BDP_0111"
FT   CDS_pept        complement(130312..131916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0111"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08796"
FT                   /db_xref="GOA:D2Q750"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q750"
FT                   /protein_id="ADB08796.1"
FT                   /translation="MADWLNNAIFYEVYPQSFRDSDGDGIGDFRGIISKLEYIRNLGCN
FT                   AIWINPCFDSSFYDAGYDVRDYYTVAARYGSNEDLAAVFEHAHELGMHVLLDLVPGHTA
FT                   IDNPWFKESCKDERNAWTDRYIWRPMSQSPDLNSPYASIRGFLGGIAERPDAAAVNCFS
FT                   TQVCLNYGFGTVTEDWQFAADSPEAQAGRLLIQDIMDFWLGLGCDGFRVDMAGSLVKED
FT                   PEHRWTSKLWRQVRAHLDETHPEAVLVSEWGNPREALHAGFDMDFLLHFGPSHYLDLFR
FT                   ENPYFSASANGDIKAFADIYRKMLTDTAGDGYICIPSGNHDMIRMRDTLTPAEMKLAFA
FT                   FLLTMPGCPFIYYGDEIGMRYAHGLKSKEGGYERTGSRTPMQWDHSTNAGFSSARRESL
FT                   YLPIDDAADAPNVASQETDSDSLLRTVRALNALRMAHPALQADGGIEFLHAEDHAYPLA
FT                   YARTADEADDANPSERIIVAINPSPSDARCTLSAVYGDAIGAAEDDVLFHIGTVAGVDE
FT                   GELHVPAGSATIFRCRS"
FT   gene            132249..133538
FT                   /locus_tag="BDP_0112"
FT   CDS_pept        132249..133538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0112"
FT                   /product="sugar ABC uptake system, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08797"
FT                   /db_xref="GOA:D2Q751"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q751"
FT                   /protein_id="ADB08797.1"
FT                   /translation="MRTLFSWKKAGAAVIASLMAVGMLGACGGGSSNSSGTKITIFNSK
FT                   VEIESQMEEMAKKYSKEKGVDVEVYYSNDTVAAHLATKYASKDPYTISMVDAKDVYSLA
FT                   KEHAVDLSDQSWVKDTDYAISIDGKTYGYPVSIEARGLIYNADAIKKITGKEFKPEDYK
FT                   TLDSFKELIQELKDGGMTSPTGVMKEDWSLAAHFLPEVYEEQEDPNAFLLDMKAGKVDL
FT                   NSNAKWTSLMNFFDVMKENNYAKSSAISAEREVTEQKLAEGEIAFMFGGNWDWSVINQY
FT                   DYSKNMGLMPVPQNMDDGTNEKLVGGGSKYFFVDSSDNTSDAQRKAAKEFLTWLAEDKD
FT                   GQEFITNEAALVSPFKNNTLEVADPLSKSVKSYADSGKLIPNYNYLPDDHYSVLGAKFQ
FT                   KWLAGEEDRATLAKDIQDYWKTAKFTGESA"
FT   gene            133623..134501
FT                   /locus_tag="BDP_0113"
FT   CDS_pept        133623..134501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0113"
FT                   /product="sugar ABC transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08798"
FT                   /db_xref="GOA:D2Q752"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q752"
FT                   /protein_id="ADB08798.1"
FT                   /translation="MKQNKLSYKIGQYLMFGGPATILFFAVVILPFFYGLYLTFTSWDG
FT                   VSAKKPFVGLDNYKTAIADTAYWQSLGRTFVYSVIAVVLVNIVAFLLAYMVTSGIKGQN
FT                   FFRAGFFIPNLIGGIVLGYVWKFVFNRAFVAIAEAATQSDHASLLSTPNGAMFCLILVS
FT                   VWQYAGYMMLIYVAGFMSVDQSLKEAAMIDGCNKGKAMWHVVIPLMRASFVQCIFLSTT
FT                   RCFMVYDLNLSLTKGEPFNQSVLAAMHVYNQAFVYKNYGTGQAEALVLFIVCAVIGMLQ
FT                   VYFGKKGEVAA"
FT   gene            134501..135358
FT                   /locus_tag="BDP_0114"
FT   CDS_pept        134501..135358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0114"
FT                   /product="sugar ABC uptake system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08799"
FT                   /db_xref="GOA:D2Q753"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q753"
FT                   /protein_id="ADB08799.1"
FT                   /translation="MEGQVSTRTKVLHALMVVVLTIVLLLFIAPFILVVINVFKTKADI
FT                   NTEPLALIGKHGFTLDNFPRAMEKMNFLTVFGNSAIITISATILTILFSAMCAYVIVRN
FT                   PSWRFGGAVFALMVASMVIPFQVLMVPLVSVYGGLLNVLNSRITLILMHTGFSVSLAVF
FT                   MFHGAIKTNIPNELEEAASIDGCSKWRTFWTIVFPLLKPTVATVAIIDAMAFWNDYLLP
FT                   SLVLGRRELYTIPIATQIFYGTYSNDIGLIMAALLLAMLPILILYLFLQRYIVEGVTSG
FT                   AVKG"
FT   gene            135647..137209
FT                   /gene="scrT"
FT                   /locus_tag="BDP_0115"
FT   CDS_pept        135647..137209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrT"
FT                   /locus_tag="BDP_0115"
FT                   /product="sucrose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08800"
FT                   /db_xref="GOA:D2Q754"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q754"
FT                   /protein_id="ADB08800.1"
FT                   /translation="MDKFVRPGIDDRPDYDKTLTPEQKEAVTRLAASMPERRAGDASQT
FT                   DAQVQATNLAAASDAAGSGLGAIAAVDTAVPDPSSAFMDMRDPMVSADGHRPTKTEVIR
FT                   LGIGFTISAVACAIPWVALSSIILPRVFESIDPASKESMLGLVNIFGSVVALLANIVFG
FT                   TFSDLTRSRFGKRTPWMVAGGLVTGLSIGAVSLTHSEPLIIILWCCAQLGYNMMLAPYV
FT                   ATMSDRVPDKFRGTVSGFYGAGIAVGQTLGSFVGAQLLKQGEAGIFGGWMMGMAIFSLT
FT                   GIVVVLIWPREKSNRDEARGELNVKSMLMSFRPPKNAPDFYYALAGRTMMMGGYWMINT
FT                   YQLYIAQDYVFAGDPGANVKAAELIATMAVITLVVSLIAAVAAGPITDKIGMRKVPVAL
FT                   ASCLFAVGALMPMLFRSATGMLLFAGVAGLGYGIYNAIDQALNVSVLPNPEEAGKDLGI
FT                   LNLANTLSTVIGSGMTSILVVIVKAVMGVSKTPVVAYTVVFGVAIVIVLIAAFLIMRIK
FT                   NVK"
FT   gene            137318..138898
FT                   /locus_tag="BDP_0116"
FT   CDS_pept        137318..138898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0116"
FT                   /product="Na+/sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08801"
FT                   /db_xref="GOA:D2Q755"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q755"
FT                   /protein_id="ADB08801.1"
FT                   /translation="MTDDNQNETMPTPQPLPGQVFIRPGIDDRPDYEKTLTPEAKAALK
FT                   RLAVQQRPRVPEASNERPEVQAARLAEGGSPLTAAAHLDAAVPNLESSFLDLRDPMTAP
FT                   DGSRPNALQVNRLTAGFALGSLLFAAPIAALDVVLIPQRIDQLVGDGRVAGLALTMALG
FT                   MVLSFFMNAWIAVGSDHTFGPLGRRTPWIISGALLSAASLAILSVCDLLQLVIVFWLLM
FT                   QIGYAMIAMPLAAAFGERVPDKFRDRADSWHGMGLALGQLLGILVAVYRTMHPAESGWD
FT                   GTTRSGIMLFAIWFIVAGIVTLLVLPREGSSTYMPRESVRKGSFFSQYRPPKHAPKFAV
FT                   AFIARMLAVAATTLIAVYQWYLAAFDLDADGLSGYGLTGAGAVVALMAVAAFVGSLMAV
FT                   LLLGPIARAFEDARVPAVISCMLFVIGAAAPCMMADKLFGVGLYALIAGFAYAMYDGTS
FT                   QSLNLATLPDVRSVGRSLAAFSVANTLGLLLGVIAGALAITALAAYLPLFGVAIGFMLL
FT                   AGVLTMLLK"
FT   gene            139302..140651
FT                   /locus_tag="BDP_0117"
FT   CDS_pept        139302..140651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0117"
FT                   /product="transporter of the MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08802"
FT                   /db_xref="GOA:D2Q756"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q756"
FT                   /protein_id="ADB08802.1"
FT                   /translation="MSAVETAAGKAQAMVRDSVKTVIAASMVGTAIEFYDFYAYGTAAA
FT                   NYFPRVFFGDTANPTVALLASLLTFAIAFIARPLGSLVFGHFGDRMGRKTTLVVSLLTM
FT                   GIATFLIGCLPTYDQWGVVAVAVLCLCRFVQGIGLGGEWSGAALVATENAPEDKRALYG
FT                   SFPELGAPIGFFLSNGTYFLLETFNDDQAMLSWGWRVPFLLSAVLVIVGLVVRVQMEET
FT                   PIFRMAQEQKKVVKSPLAEVFRKSWKQVIQATFLVAVTYTLFYTLATWSLAWGTKSVED
FT                   GGGDLGFTNQEYLFMLMVAVCVFAAFIMISCVNADRFGRRRVIVISSCCLVAFALLFPF
FT                   LLDSAVVGQRNFVANLAFLCIGFALMGTAFGPIGAFLPELFDANVRYSGSGIGYNLAAI
FT                   VGAAFVPTIATWLSHHWGVHSVGLYLGVMALCCLVAVLSCRETKDVDFTK"
FT   gene            140909..141961
FT                   /gene="ilvC"
FT                   /locus_tag="BDP_0118"
FT   CDS_pept        140909..141961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="BDP_0118"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08803"
FT                   /db_xref="GOA:D2Q757"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q757"
FT                   /protein_id="ADB08803.1"
FT                   /translation="MAATIWYEKDADLSVFDGKKVAVIGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPTSKSVEYAKEQGLEVQSVADATAEADVVMILLPDQYQAAVYKSEIEPNLKPGAA
FT                   LAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAVEQDPDGKTW
FT                   DLCLAYAKALGALRAGAIKTTFTEETETDLFGEQDVLMGGINHLCDMGFDVLTEAGYQP
FT                   EIAYFEVFHELKMLIDLANEGGLNKARWSCSDTAQYGDYTSTVITEETKKRMQYQLKRI
FT                   QDGSFAKEFMDDQAAGAPKFKQLQEEYSHPHLETVGPKLRAMFSWNNQVDADADMAESF
FT                   NGKIARTQVQ"
FT   gene            142272..143321
FT                   /gene="ilvC"
FT                   /locus_tag="BDP_0119"
FT   CDS_pept        142272..143321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="BDP_0119"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08804"
FT                   /db_xref="GOA:D2Q758"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q758"
FT                   /protein_id="ADB08804.1"
FT                   /translation="MAAQIWYENDGDLSVLDGKKVAIIGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPTSKSVEQAKEQGLEVKSVPEAAAEADIIMILAPDQYQRTIWANDIEPNIKPGAA
FT                   IAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYANGRGVPVVVAVEQDPRGDAW
FT                   DITLAYAKALGALRAGAIKTTFKEETETDLFGEQNVLMGGVNKLVEMGFEVLTDAGYQP
FT                   EIAYFEVCHELKMLVDLMNEGGLNKARWSCSDTAQYGDYTNTVINEDCRKRMQYHLGRI
FT                   QDGSFAKEFIDDQDAGAPKFKELQEEYGNVRIETVGPKLRAMFSWNNGQDDDADMATFT
FT                   GKIARSQVQ"
FT   misc_feature    complement(143387..144865)
FT                   /note="Similar to ISBlo3 ISBlo3 24-24bpTIRs"
FT   gene            143439..144014
FT                   /locus_tag="BDP_0120"
FT   CDS_pept        143439..144014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0120"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08805"
FT                   /db_xref="GOA:D2Q586"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q586"
FT                   /protein_id="ADB08805.1"
FT                   /translation="MWFFRMREDRRKHYDDGFRREALRLIEAGVGKRSLARRFAMPVQT
FT                   AEKWIMLYRSNGGEAVMGTTGNRRYDWETKVAAARDHVENGLSVAEVMARYGIASIAPL
FT                   QRWCREYRAGGAEALRPKPKGRPKGAKSKPRPKPTREQELTEEVAYLKAKVAYLEKLRA
FT                   LRAQKSRSASEAPSSDCSQGRGTGSTTC"
FT   gene            144026..144820
FT                   /locus_tag="BDP_0121"
FT   CDS_pept        144026..144820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0121"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08806"
FT                   /db_xref="GOA:D2Q760"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q760"
FT                   /protein_id="ADB08806.1"
FT                   /translation="MARSTYFHHLSHPAHETRPDLDPMVAEIWERTANGCGHRQIHMCL
FT                   VHEFGQKVSAKSVLRVMRRMGLRCPIRARNPWRGYSSYRGDAGGGVPNLLKRDFTAGKP
FT                   FEKLGTDVTEFKVAGGKAYLAPVYDMASKEIVAWDVSRHPGMGQQRRLLAMLEARLPGG
FT                   ANPILHSDMGWQYQHPWWRGELERLGIRQSMSRKGNCLDNAATEQVFGHLKDEFYRGRE
FT                   FDSYEQFKRELDAYVIHWNTRRRQIRLEGHTPEEFRSVSLAA"
FT   gene            145105..146907
FT                   /locus_tag="BDP_0122"
FT   CDS_pept        145105..146907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0122"
FT                   /product="sialic acidspecific 9-O-acetylesterase"
FT                   /EC_number="3.1.1.53"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08807"
FT                   /db_xref="GOA:D2Q761"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q761"
FT                   /protein_id="ADB08807.1"
FT                   /translation="MVTATGPAPGSDMMTSAEPAENRTASGVLYVAPIFASHMVLQRNK
FT                   PIVVFGALNADCAGLEVTAAICTPDGSPVAQAHAYASMEVRHGFSYWRIMLPAQSEGGP
FT                   YTLRVTAGNDSIEFHDVLIGEVWLAGGQSNMELELRNSDDADAELEDCTDPLLRFYNVP
FT                   KTGVIDRNAENASGWQESSPENSGVMSAVAYYFARKLRDELDPDLPIGIIDCYIGGTSI
FT                   SCWMSEDALRSSEAGQGYLTRFDEAIAGKTQAQFDLETSAWQERFDTWNASIAAAREAD
FT                   PDVTWDTLNQRYGECPWPPPVTPTSQWRPTGPFHAMLERVVPYSLAGFLWYQGEEDEPY
FT                   CESYRELLGMMIGEWRALWSENLPFLIVQLPQWIDKGHADAGTDPMLWPVLREAQWDAA
FT                   QTIDNVYAICTIDCGEFDNVHPTDKRTPGERLAECALRQIYGLDDVPVYGPTVLGFRCG
FT                   ENGHVCLFFRYAHGLHFEGVTPDDTDDDFVDQLPSLVRNAERSGFELAGVDGVFHPATA
FT                   AIFVDCDIEDLVNAKINVVDYNATEFGIPINSRSIGTITLATSEVPKPVALRYAWHSWG
FT                   PAPLFNSDNLPAQPFRLDLTDRED"
FT   gene            complement(146971..148032)
FT                   /locus_tag="BDP_0123"
FT   CDS_pept        complement(146971..148032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0123"
FT                   /product="acetyl esterase"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08808"
FT                   /db_xref="GOA:D2Q762"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR040794"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q762"
FT                   /protein_id="ADB08808.1"
FT                   /translation="MHTITFDDPALRFMGRIDDDNPKAPIWVFPYTQVSFRCTGSHIRV
FT                   KLRNHWNYGDIFLGAIIDGLEVKVPVPIDATTITLAEHLPDIEHEVTIFKRQDGGMCHL
FT                   EMLGIELDDGATILPPADARPPRRMEVYGDSVSCGERNEAIRYVGQADPEVDLSGYSDS
FT                   WHSYAAIAARMLGAELHDISQGGAPLLDGIGWFNAPHYLGMESMWDRIAYNPALGETKP
FT                   WDFTRYTPHVVLVALGQNDAHPHDFMASDYAGEAARHWRTRYVDFIHALRARYPKALIV
FT                   LATTILVHDPAWDRAIDEVCETVRSEGDIRVEHFLYSRNASGTHGHPRIPEDEEMAGEL
FT                   VAYLESFGPDVWE"
FT   gene            148206..149573
FT                   /locus_tag="BDP_0124"
FT   CDS_pept        148206..149573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0124"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08809"
FT                   /db_xref="GOA:D2Q763"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q763"
FT                   /protein_id="ADB08809.1"
FT                   /translation="MENTFPKDFVFGTATAAYQIEGAVNEDGRCPSIWDTFSHTPGATF
FT                   AGDTGDVATDSYHRWREDLALLNDLGVDAYRFSIAMPRIMPTPNGIPNAKGLDFYERIV
FT                   DTLLEYGIKPVVTLYHWDLPQYLEDAGGWLNRVTSYALGDYAAVVAKRLGDRVDTWTTL
FT                   NEPWCASYLSYGAKEQAPGLGLGPGAFPAVNHLNLAHGLMVQAVRDIVGDKSKYSVTLN
FT                   MPFNRGDADACHRLDLIANRAFLDPMLRGRYPDELFAITKGICDWSFIQPGDLENAHQP
FT                   IDVLGVNYYSTNRVAMSDRPQFPQETGPSTCPGASDIDWLPTDGPHTDMGWNIDPQGLY
FT                   DTLMRVHDRYPEVDLVITENGMACRDQLVVNEDGTKAVHDADRIDYLERHFAAAKRALD
FT                   DGVPLSGYFVWSLLDNFEWYFGYAKRFGITYVDYATQERTKKDSFLWYRDFIASRG"
FT   gene            150090..151466
FT                   /locus_tag="BDP_0125"
FT   CDS_pept        150090..151466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0125"
FT                   /product="ABC transport system, sugar-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08810"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q764"
FT                   /protein_id="ADB08810.1"
FT                   /translation="MNLKKIVAAGVAAVCAVSMAACGGSNDSSGVTDLTYDKIKLGETG
FT                   KDITASIKFYNGRTDMGLDSYPGKNWKSYIADFNKIYPNIKVEAQTDTNYADNALTRLQ
FT                   GGDWGDIMMIPSVDKSELENYFISYGSLDTMQKQVKLASEKAYDGKSYGVATDGQTSGV
FT                   VYNKAVFKKAGITELPTTPEEFIADLKLIKEKTDAIPLYTNYAAGFTMGAWDAYIGTTA
FT                   TGDTKYMNQKLVHTKAPFKDPGDGTHAYNVYKILYDAVADGLTEEDYSTTDWESSKSMI
FT                   NNGQIATMVLGAWAVTQMQQAGDNADDIGYMPFPISIKGKQYASMGGNYSMGINKKSSK
FT                   DNQEAAMIFVKWLTEESGYAMNEGGIPIKYGETDLPSIYEDFKDVTMEPDADSLEGEED
FT                   LFTEVNSDSELGINSNGNKRVQAIVEHAANKDKSFDDIMKDWNDAWYKAMQDDDAEAKY
FT                   "
FT   gene            151594..152655
FT                   /locus_tag="BDP_0126"
FT   CDS_pept        151594..152655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0126"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08811"
FT                   /db_xref="GOA:D2Q765"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q765"
FT                   /protein_id="ADB08811.1"
FT                   /translation="MTTAIAGATATSVDDIPFNPHKRDYKKAGIIVAFCVIPVTLLVVF
FT                   TYWPFIQMCGYSFYKMKYIGTPRFIGMKNYIDIFTRPELLATLKLSLYYMAGALIQVAL
FT                   ALYLATVLAFHVRGGSFFKGAMFFPYLINGIAVGFIFKFFYTRGYVLDTVLQWCGFTQD
FT                   TLPYWLRDQSINNWSLVASSIWRYLGSTLILFIGAIMSIDSSLYEAAEIDGANKWQQFK
FT                   HIILPGIQTILVLNIILSITGSLSAFEGPYVITSGANGTGTYMVQMDKIAHTDQKVGLA
FT                   SAMAVILLIIIIICTLLQKIVMGFLFRDADDGTAKARKQAKKADKARRRAMKAANKVQA
FT                   GKAPLFKNGKVSA"
FT   gene            152655..153545
FT                   /locus_tag="BDP_0127"
FT   CDS_pept        152655..153545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0127"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08812"
FT                   /db_xref="GOA:D2Q766"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q766"
FT                   /protein_id="ADB08812.1"
FT                   /translation="MTTATVAPQAEVQKVSFGYHLKLWVLSFLKYFSLVFITFWILLPL
FT                   VTCFFTAAKGTDEWRSTSVMTFPKNIFNFENYAEAFKLSNMGIAFRNSVIVLVCVCFLT
FT                   TIIGTQLAYVLSRFQFPGNALIRTAFMMAALLPGIAMQVAVYKIMGTFHLINSLWGYII
FT                   MSMGTDVISIYIFIQYFENLSISLDEAALMDGASYFTIYSRILLPLLKPAIVTCLILKG
FT                   VGIYNEYYSANLYLQDKQKLGTVAISLYAFTGPQGSKYNLICAGVIITLLPALIAFLIF
FT                   QKQIYNGVAAGAVKE"
FT   gene            153654..156365
FT                   /locus_tag="BDP_0128"
FT   CDS_pept        153654..156365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0128"
FT                   /product="mannosidase"
FT                   /EC_number="3.2.1.152"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08813"
FT                   /db_xref="GOA:D2Q767"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q767"
FT                   /protein_id="ADB08813.1"
FT                   /translation="MTHTPSTFAPLADGWTLTAVNIEAAPESLREALAAGIPATVPGEA
FT                   TLDLLNAGLIADPFDGANENDQQWIGDVDWRFTCRFDWHDNGADRHDLVAYGLDTIADV
FT                   ALNGRPVASTRNFHRSYRWDVRDLLREGSNELTVTFTSPVRESDRMEQARGYYPHTEHH
FT                   AFNQIRKPSYSFGWDWGIDVANAGIWREIGIDSWSGVCIASVRPLVDVAADGTGLLNVH
FT                   VEIERAGKGRIMSPYECHSVRAAVPVHVGLSGFGADVAADGVVAEGRNETVLTLAVPEA
FT                   KLWWPIGYGDQPLYDVAVAAGDSAEAAWNGHVGFRTVHVDTRADNVGRPFQIYVNDVPV
FT                   HAHGYNWIPDDAFIARVAERDYERGIRDLVESNSNMVRAWGGGIYESDEFYDLCDRNGI
FT                   MVWQDFMLACAAYPEDAETKAEVEAEAREHITRLSEHASLIVWNGSNENYVAYSEWGGY
FT                   KQALRDDDLPANEYGYGEKPWGDYYYAELFPALLAELDPGRSAYLPSSPMSFTKFVGAN
FT                   FDTDGTMHIWDAWNRADYTVYAQYTPRFADEFGYQAPPAWSTLTGAVHDDELEPFGKQM
FT                   LVHQKASGGNYKLARGMRSHITPGHLDDVSFGGVVNGKPSDGEHSWLIPTDNWADIEDW
FT                   HWACQLQQAQAMRFGVEHMRSLEPVNAGALIWQLNDDWPVVSWAAVDFNGQRKPLWYAS
FT                   RDFFAPRLATIQPRVSEEYRETHSWEGVRTANDHYELIVLNDTREAWKGSWKVERMTLA
FT                   GEVLASQTFDVELDAVSHVGLPLAEEIVDYADAGNELVVATASDGAFARVIFNPAEVIG
FT                   QKLAAPAEAFGTVASRVDGGVELKVTATSYVRDLFCMADKIDAKASVDAGMVSLLPGES
FT                   VTLRIDTGSDDDPQSFAAANVLRSANDLKREW"
FT   gene            156598..157632
FT                   /locus_tag="BDP_0129"
FT   CDS_pept        156598..157632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0129"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08814"
FT                   /db_xref="GOA:D2Q768"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q768"
FT                   /protein_id="ADB08814.1"
FT                   /translation="MAVQKSKVTIFDVAKASGVSSSAVSYALNGKSGVSEDTRAKVLKI
FT                   AHELGWKPNGAAQALAKSKTQRIGLVLGYDPKLLAVESYMMELISGLGAELEKHDYSLL
FT                   VRMAVGEHAKLSIIKDWIATGNVDAMLLVNIELGDPCVTLLEEHTEMPVLAIADASVSG
FT                   NLPTLSSADADAVRQAVQYLYDLGHRHIARVAGPEMLAHSYIRDSAFSDVATELGMRYR
FT                   CLHTDYTPETGSEATKRLLSFPEHPTAIIYDNDVMALSGLGVATAEGITVPDDLSIMSW
FT                   DDSFMCTAAYPNLTAMGRDVVGTGTKAAELLLKLIDGERVGNVMEEPYELRQRGTTGPV
FT                   PAER"
FT   gene            157881..158897
FT                   /locus_tag="BDP_0131"
FT   CDS_pept        157881..158897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0131"
FT                   /product="endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08815"
FT                   /db_xref="GOA:D2Q769"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q769"
FT                   /protein_id="ADB08815.1"
FT                   /translation="MTEIDAPVCAVETSARTIDRHDLPCRVNNVALATNPLHRYCADPN
FT                   LAIFDGRYFLYCTDDGVDDWGSTAFSVYVSDNLMDWERYPALDLRDVPWWTGSDGAWAP
FT                   SIVRNADGRYVLLFVADSQIGTAVANTPYGPFIPTVEPIVRKGTFGCHTIDPGVFIDDD
FT                   GTRYFLWGNGKAWIAPFSDDCLSFDESKAIGWIPGDFREAIWVHRHDGLYYASWSENDT
FT                   RDPAYCVKYAVAESLAGPWSEPRVLVEQNPRLHLYGTGHHNIVNIPGTDEWIIAYHRFA
FT                   YHPSGRWAGGDGCHRETVFAPLNHLPDGSLEQVRPQVGSYVRPLGIRPAGSVPAIPA"
FT   gene            complement(158884..159507)
FT                   /locus_tag="BDP_0132"
FT   CDS_pept        complement(158884..159507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08816"
FT                   /db_xref="GOA:D2Q770"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q770"
FT                   /protein_id="ADB08816.1"
FT                   /translation="MASNFFREDNPYNVVMSTIGDLAMLSVAWFVGSIPIVTIGISTSA
FT                   ACEVARTMQEARDHGIFRGYIAAFRRRIGTNFALSLIIAAVWALAAFDLRFLSMQRGGD
FT                   TISLVYGVTVAVFAILGVMLAFVLPLSGRSKLSVTEQIRQSFKLAVLKPLVAIAVFALD
FT                   ILPIVLLATVPGAIIWVPLLWIIVASGGSFWLQILMIRKAFKLE"
FT   gene            complement(159574..160299)
FT                   /locus_tag="BDP_0133"
FT   CDS_pept        complement(159574..160299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0133"
FT                   /product="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08817"
FT                   /db_xref="GOA:D2Q771"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q771"
FT                   /protein_id="ADB08817.1"
FT                   /translation="MALSTQLTEEQQEAINTLASAPAYANESKLSIFRQLPWRKKLEYF
FT                   REHFLIPVAAAAIIIALVTFLAVRFISPDARPALYAAVVDDALTTSEATNLQNELEDKL
FT                   GVSVIIDDYFDMDKDGLTKLQTMLSSKQIDVIIAPHKIFKQLAGYGYLTNLESTVSKSD
FT                   NIKLDDATVQLKGFSDADDDGIDSSGTGKGASKSYGLKLSDAAGWTSIADSDHSALIGI
FT                   ATGTKNTGTAQRFIDWLYR"
FT   gene            160488..162680
FT                   /locus_tag="BDP_0134"
FT   CDS_pept        160488..162680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0134"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08818"
FT                   /db_xref="GOA:D2Q772"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q772"
FT                   /protein_id="ADB08818.1"
FT                   /translation="MFDQGPHVVLRRDGVCLVLKTPEGEMPQVEYWGGDFGITSDESAL
FT                   NQLDAMTLKVTPPQEKPDAALRPSLLPQGAEAFAGRPGLEAYRGGKPVFVRWTSVTASP
FT                   IAAGGETEANTLNIVAEDAVNAVKLELKLSIKKGGLVLVEQTITNIDATDNPDAAALTV
FT                   NWLESTLPMPRRADTLTQFTGRWPLEKQPRTAVMPSGSVTRECRHGKTSHESPWMFIAS
FT                   DGEPKWSEGEVWACHLAWSGNQTYRIDNMPPHEPLIGAGELLGPGEIQLAAGESYTAPQ
FT                   VCFSYSANGLDGMASRFHTWLRSLPKHVSSPRPFTLNTWEAVYFNHDESTLKKLADRAA
FT                   AVGVERFVLDDGWFHERRDDTKGLGDWVVDPEVWPNGLDGIAQHVHDLGMQFGLWFEPE
FT                   MVNLDSDCAREHPDWILAAPEAVPYREDVSYRTQYVLDLANPDAYRHVHDQMAALVEQL
FT                   GIDYIKWDHNRDVTEPVHDGRYGLHEQTLACYRLFDDLKKEFPKLEIESCSSGGARTDA
FT                   GILQHADRIWGSDSNDPRDRVDIQRYTELVVPPEMIGAHVGPSPAHSTWRATELSYRAA
FT                   ISLEGCSGFEWNILECSDEEVEQLKAFVSLYKELRGVLHRGTVMHADFKDSALRGRGVV
FT                   SDDGKHAVWVVATVTNLRDVLTERLRMKGLDPKRTYGVRLRDEVGEVRWGWNTPQWITA
FT                   AQMGGFRVSGQLLEQVGLQLPPLWPLEAIVLEVEAL"
FT   gene            complement(162803..164299)
FT                   /locus_tag="BDP_0135"
FT   CDS_pept        complement(162803..164299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0135"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08819"
FT                   /db_xref="GOA:D2Q773"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q773"
FT                   /protein_id="ADB08819.1"
FT                   /translation="MSDVNAVNKPRETDDVPVPPTLRKSLKNRHIQLIALGGAIGTGLF
FT                   YGSSESIGLAGPSILLAYLIGGLAIFLIVRALSEMAVEDPKAGAFSYYATRYWSKRAGF
FT                   ISGWNYWFNYVLVAMVELSVVGSFVNYWFPNIPKWVSAVVFLVAIAALNLMGVNKFGEF
FT                   EFWFAIIKIVAVIAMILGGLYVIIANVPTASGIRASFANWFTIDGGFLPHGLMSRNADG
FT                   TWTGLMMALVVVMFSFGGTELIGITAGETENPRTTIPRATNGIIWRILVFYIVALGVIM
FT                   AVVPWSKIDGDSSPFVQIFDSVGVHAAAGILNFVCLTAVMSVYNSGLYANSRMLYSLAR
FT                   QGNAPAYLGKLSKRGVPVGGVITSAIIIAIAVVVVFVWPEFAFNYLMSIATIAAAINWT
FT                   MIMITELKFRRVVAAGDGPAELKGLKGQEALDKIVFKLPLARVTPYVVIAFMALVVVLM
FT                   CFSASYRIAVYAGIIWLIVLFAAYQLTQVRGGTAGDGIMA"
FT   gene            164724..165737
FT                   /locus_tag="BDP_0136"
FT   CDS_pept        164724..165737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0136"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08820"
FT                   /db_xref="GOA:D2Q774"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q774"
FT                   /protein_id="ADB08820.1"
FT                   /translation="MEQQEGKTVVTIRDVAQRAGVAVSTASRALSGGSASEATRRKVQE
FT                   AAEALHFVPNPAARRLTGGHSNVVALVVDEPTDFLFRDDFLAGILGQLSMSLARENLLP
FT                   FLILAEPDNAKGFEQLLHRSGAEGVVVASFHEGRKFADMLKRFDKPTVFIGSPPKGFKC
FT                   PYVDVDNYDGGYQAGKLLVERGCRHIALIEGPRDMPTPKERTAGFRAALKEQGLEPIAS
FT                   YAGSYEMDNGLKSMERIIAEYPQVDGVFAHSDKIAAGALHVLDRFDKQVPQDVAVVGFD
FT                   DLQAARLLNPQLTTLAQPLDDMAEAATRMLAHRLENGTWRVSFQRFPVRLVRRESA"
FT   gene            166259..167524
FT                   /locus_tag="BDP_0137"
FT   CDS_pept        166259..167524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0137"
FT                   /product="ABC-type sugar transort system, sugar-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08821"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q775"
FT                   /protein_id="ADB08821.1"
FT                   /translation="MIVGLGACGSSNSSSDSSSADGKITIKVQTFNNPGFGKPTSERPG
FT                   ADLWAKYEKAHPNVKIEETAVASSDDARAAFNTAISTGSNAYDVYVAEVDWMPSLLAMP
FT                   DKFVDLSSYTKDNDWVAWKSESATVDGKLIGAGTDIGPEGICYRADLLEKAGFPSDRES
FT                   VAEWLGGDDATWDSFFKAGKEYTEKTGLPWYDSMASNWQSMINQVEESYVSKDDKIIAA
FT                   DNAKIKDLYDQLTATKDMSAHLTQWSDDWNAAFKSDTGFATIQCPAWLINNIKGNTGED
FT                   FQGWDIADVFPGGGGNWGGSYLVVPESSPVKDEAAKLVAWLTEADQQVSVFTTANNYPS
FT                   SEGAQASSDVSSKTDAYLNDAPTGKIFANRAKAYDIVPYKGSQYFDIQTKMVDALNRVD
FT                   ATQEQTPDQAWKQWLEDVKALS"
FT   gene            167660..168784
FT                   /locus_tag="BDP_0138"
FT   CDS_pept        167660..168784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0138"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08822"
FT                   /db_xref="GOA:D2Q776"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q776"
FT                   /protein_id="ADB08822.1"
FT                   /translation="MSRSTKQPTPWRTRLGQFEWKASPYLYIAPFFLLFAVVGLFPLLF
FT                   TVYIATRQYNTLTGDGGVAICGATCNSDEPSIWANFNRVLHQQSFWDALRNSFSIFILS
FT                   SVPQIILALFLAWILNANLKAKTFWRMGVLLPYIVAPSAAGIIFSQIFSDKMGAINVLL
FT                   TDIGLNPIMWHGNAFWSHVAIATIVNFRWTGYNTLIFLAAMQAIPNDVLEAAVVDGAGK
FT                   WRTFRSVVLPMLRPTLIFVIITSTIGGLQIFDEPQMFHNGTSGYGGPNRQYLTLSLYLW
FT                   DMGFNKVTIGQPNLGRAAAVAWILFLIIVLLAVLNFWLTQRLASGGQPKIDKIKLAELN
FT                   ARQEAEYELAKRSGVEARRAASATAASTDAAERK"
FT   gene            168791..169741
FT                   /locus_tag="BDP_0139"
FT   CDS_pept        168791..169741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0139"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08823"
FT                   /db_xref="GOA:D2Q777"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q777"
FT                   /protein_id="ADB08823.1"
FT                   /translation="MTDITNEGNKRDLGTPALEQMYGKGVARSAAKQRRRKTLEVTSEG
FT                   RRAGWGTYAILVVTILIFVFPLYVALSIASQNSSSTQYGVQALIFGSGLIKNISRAFGA
FT                   MKFWQALSGTLFVAIVTSVSTVFFSTLAGYSFSKLRFRGRGVLFTIVIGTMTIPQQLSI
FT                   VPLYIMANKAGLFGSIWAVIIPGLVSAFGVFWMTQYLQDALPYELIEAARVDGCSMFRT
FT                   FISVAVPAARPAAAMLFLFTFIAQWTNYFWPMLILGPNKNSMLTVAAATLKGAYFTDYT
FT                   IVMAGVVLTTFPLILLFAVAGKQLVSGIMAGAVKG"
FT   gene            169938..172910
FT                   /locus_tag="BDP_0140"
FT   CDS_pept        169938..172910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0140"
FT                   /product="ABC-type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08824"
FT                   /db_xref="GOA:D2Q778"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q778"
FT                   /protein_id="ADB08824.1"
FT                   /translation="MAFVKDMIRMWLRSWKRFVSIAMITLLGVAVLTGIYAGCRDAFLA
FT                   SDRFFDAQGMHDIQVLSTAGLSDADVTALRRVTGVRKVQAERSQSVTIDVGGDKSVTMQ
FT                   EIGTNGIDQPYLQEGRMPTKSGEVAVTKQFIKDSGHTIGDRITVTPEASQVSDSGESDT
FT                   SAVSDEQSPEFPTELRIVGVVLDPQNLSNPDGYSAMTSFRSTATSDYTFFAPSDGVTGT
FT                   TYTSVTLLVDGAADESTFDESYETIVGKVMNRIKGKTKTNRQKARRQELIDAGQKKIDE
FT                   ARDKANRQFADAQKQIDENRSQFNQQIDQIVAQQSAMLGTGATMDESTRETMRETVISS
FT                   SPQLQEAKAQLDAAQSQLDEQRNSAEQTFQDKEDELESSVPNVRWYVQDRSSLGGYSAL
FT                   KSDLSSIRSIGNAFPVVFLLVAVMMSLTAMARMVEEDRGLIGTYIGLGYGRLQVAARYM
FT                   LFALLACLIGGGLGLLLGFLGIPAFLLIVIQGMYVLPGVRFEYDWLYGSLGIALFVVGV
FT                   LGATIYACVEEMRQTPAGLMRPKAPRAGSRILLERITPIWSRLGFLSKVTARNIFRFKS
FT                   RLVMTVGGVAGCTALIICGLAINDTVAELGVKQYRDIYRYDVMVVANDTDADAMRAKLR
FT                   ADGRTTSTMDIRVESGDLANDEGSEGIQLVVVPEEHLDELGEMVTLKPVASGWDGVRKF
FT                   FGLSDSGESDSKAVETTLRMSDSGESDKRSGSKAVLGDSGVIVSQSAANALGVKTGDTV
FT                   NLTNGDGIQAKAKVSEVTRNLIGSDIYVSESYYGKLFGSGSGMSDSPESDKSDSGGSLT
FT                   WNAVYAKLTGSDDAQIAYANTLEKDDSVMKTVCCADMAASFKFDLMGAVVALIVALAGG
FT                   LALVVLFTLANTNVSERVREMATLKVLGFFDREVHRYVNREMMILTAMGVVIGLPIGRW
FT                   VGGLLTAALNMPALYFEVEVKPMSYVIAAAATMAFALLVQLFVNPVLDRIEPVSSLKSV
FT                   E"
FT   gene            173262..173864
FT                   /locus_tag="BDP_0141"
FT   CDS_pept        173262..173864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08825"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q779"
FT                   /protein_id="ADB08825.1"
FT                   /translation="MKILSLGGGLLFCPHAIYRRSCRACDDAGSYDDARAGAAMMIDGK
FT                   FTAKERSYLASLPAVKSVSASHIRYTDQFRVECMCRYRAGESPAAIFREAGLDPKLIGY
FT                   KRVERCIARWKRRQDKEAKSGKRTSPYALDADDLRILEHGNLTQSEWGSPNAGDSEEGL
FT                   SQLARAQLAINERDLLIARQALRIDELERVLRQFVER"
FT   gene            173931..174980
FT                   /locus_tag="BDP_0142"
FT   CDS_pept        173931..174980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0142"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08826"
FT                   /db_xref="GOA:D2Q780"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q780"
FT                   /protein_id="ADB08826.1"
FT                   /translation="MRESRCETVRAEDLMESETVGMGWRQPAFDEVIDVADEMRERRRN
FT                   RRSMRMMYAIGALLIVAAICIGGFPAALQYRAAVELSRTSAQSARTIAGWPYPQADDAF
FT                   AAAKSYNERLAVSGQPILGEAKDPFAAVQGGSRASETDDDDGSASSKDEEYQGLLDSGG
FT                   GVMGTIRIPKISVNLPIYHGTSQSALASGAGHLYGSSLPVGGKNTHAVITGHRGLVNAT
FT                   MFTRLDEMRVGDYFYLDVMGHTLGYQVDRISVIEPNDTSKLKIVPGEDRVTLMTCTPYG
FT                   VNTHRLLVSAVRSSIPDVIPDESDAAKDARLIAIVAAVITLLLGLVLLWLRRKPWHIRR
FT                   HAAKWPKRG"
FT   gene            175202..178972
FT                   /locus_tag="BDP_0143"
FT   CDS_pept        175202..178972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0143"
FT                   /product="Fimbriae protein with LPXTG motif and von
FT                   Willebrand factor typeA domain"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08827"
FT                   /db_xref="GOA:D2Q781"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q781"
FT                   /protein_id="ADB08827.1"
FT                   /translation="MKRACDEWQAVRKGGLAKRVITALVAVAMLGGLGYATASTAVAQD
FT                   DTTQQQAQQTEQSAKTTSESQDEKTSDSEATSKKAATDETSADGSAEDTNTTDADAGVE
FT                   AQNGADETAVQAANEPAATSVADGGSPESGSLLLDESFKNSTFGDANWTTADSACLTAA
FT                   TSGSLKCENTQDSSDIQGENGKGYLQLTDNSENQKAAVLYNQPVISKSGLHVTFDYYMY
FT                   QTSGAGKYTTPADGISFFLTDGAATLSKAGTSGAALGYATSDDDGIGDSSKRGEGVAQG
FT                   VLGIGFDRFGNFSTQHAAGTTARVTGGDDCTQSGTNAGNSVTVRGAGKIDVDGKWNNGY
FT                   CIVASENVAAGLDSGKATKSENDTNGESVDITIAPVIDDSATTQHLTVKIAGETVLEKD
FT                   IDRLPDSVKFGFSASTGADHQVQLIRGLKVYSVNKLSQLDLVKSMNKDTYPDADSHTFN
FT                   VGDEVPYTFVVRNSGTTTLNNVAVNDPNITNVSCGTDTLAANQQTTCSGTLTLTEDMVD
FT                   SEGHFTNTATASGTDDEGNAVNSPQASVTIKAIKPLGAPEKHKRIKKNSDNTYTVNVDV
FT                   TGAANSSTITTTQSVDFTLVLDVSSSMSDEMDSDQGSIKKMTALKSAVNNFLGEAAEIN
FT                   EQSGSELIRVGLVKFAGKESSKVGNETYTEGRFVYNYSQIVSPLTADMSDLKNKVSALR
FT                   HNGATRADLGFKHASTVMSGARTDAKRVVIFFTDGTPTKVSDFDKDVANSAVTYAKSLK
FT                   DSGATVYSIGVFDGANPSSIEENQKNQFMNAVSSNYPHATAYDKLGTGSNAGYYKVVSN
FT                   VSDLKSIFEKIQTNETTDGFTNVSIEDTLSKYVELSGKNYTVTAKDANGNEVTLKENSD
FT                   YTLTYDESAKKFTVVFQNMLQDGVTYTLSYNVKPTQEAYDEYAANGYGGTVGDADTDLD
FT                   GSTTSSGQLGFHSNESACLAYTANGKRHVCSDNPYLHPVIQVVSSTLHIEKQWSGDGEK
FT                   PASINVTIKQGNSDYKTVTLTPDDNGNWSTDVIIPAGESKTYTVTENDPGNQWNVSYQH
FT                   KVGDGNLADGNAVTVPQSATSQTATVIVTNKQALVTLPADSITVNKKVVGTNTGHDFNF
FT                   TMIATGDNAGKVTWPRTDQSKSKVTISQVSQTQVKSATFGDELTFPAANATYTFQVTED
FT                   KPTDTTGWKYDDSEQTVTVTVSYDETQKKWTAVASPAEVTFTNRYIAVASLPLTGGTTD
FT                   RQWLMIGGGIAGMAMLMIGAAGIWRGRKRLV"
FT   gene            179119..180678
FT                   /locus_tag="BDP_0144"
FT   CDS_pept        179119..180678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0144"
FT                   /product="Fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08828"
FT                   /db_xref="GOA:D2Q782"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q782"
FT                   /protein_id="ADB08828.1"
FT                   /translation="MKLRKLFAGIAAAATLLGGMALGATSAQAARLADATFTFTAETAE
FT                   QLTHANLTAYRIGDYYQLSTDCYGVITNNDNKNAVDSALASALGTDAVKTDQDNLAAAL
FT                   STGALDISATRPWTTTADGAASATRAFANTLESEGKLTNGQQVTLTTPTGSDENGWSAT
FT                   VDLFPGIYVFVDNATEGTVTKAVPMIVASGTVDAEKKQLVDPNHGDNTVNMKNTKNIEK
FT                   NKTVDKAYAAIGDTLTYTLTGTVANPAPAAFAFTDTPGVGLTVKAGTYEFYTVGADGDI
FT                   EDPSTDFTFPKADVTGDGETSFDITVNDPSKYAGRTIKVVFQALVNDEAVVEDGVVNDL
FT                   DNYGTPIEVTTKFVGFDFKKIDSDNKGIEGAEFQILDGRVALYFVKQDDGFYKKAASED
FT                   TEGATDTLVSAADGTVKVTGLDATKAYTVSETKVATGQYLDLKPSFTVNFNNDHEAVLS
FT                   RTIDPWGLVNTADKTVKNVKSVDQLPLTGAAGTILFTVMALLLAGAGATVVLKARSKNA
FT                   KA"
FT   gene            181005..181577
FT                   /locus_tag="BDP_0145"
FT   CDS_pept        181005..181577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08829"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q783"
FT                   /protein_id="ADB08829.1"
FT                   /translation="MARGGGSFSSEEIQLLRGLPAVANVTQDRITYSDTFKQVCTIRYL
FT                   AGESPTKIFREAGLPPDLVGYKRIERSVARWKAAAIKSVNGSDSMSDGEIIAQLVDRYR
FT                   RALVTRKNLDSIAENIIGMESDASMAATNAEASLKAMQPSSPQTADTGTDAIDAETASI
FT                   IIKQQARRIDELERANEALREQAAHVA"
FT   gene            181773..183341
FT                   /locus_tag="BDP_0146"
FT   CDS_pept        181773..183341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0146"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08830"
FT                   /db_xref="GOA:D2Q784"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q784"
FT                   /protein_id="ADB08830.1"
FT                   /translation="MTYENPNSAGQGGMQSETSPADMRAAQAATPATAEPVESLDKGNE
FT                   MARGLNNRHVQFIAIGGTIGTGLFLGSGKSIALTGPSIIFVYIGVGLIMFLLMRAIGEM
FT                   MYRDPSQHTFINFITRYLGRGWGKFAGWTYWIVLILTGMTEITAVSTYFVTFFGMFDIN
FT                   LKAWKWLIELCFLVALTCVNLIAVKVFGEAEFWFSMIKITLIVGLIATAVVMLVIGFHY
FT                   PATHIEGVDGTIAGATVSLRNLVNGFQIAPNGWMSFFMSFQMVFFAYLLIEFVGVTVSE
FT                   TQNPRKVLPKAVNEIIMRILIFYVGALVAIMCIVPWRNFHQNADGSFGSPFIMVFKYAG
FT                   LDWAAALVFFVVITAAASSLNSLLYSAGRHLYQLAQDSDSPAMSRLAEVSDRKVPAKAI
FT                   VVSGCMILLSPIINALPGISSAFVLFSSAASAVVIFIYVLTMFAHRGYRKSADFLADGF
FT                   LMPAWKVTDWIAIAFFVFVYGTLFLSADTIGSAIAGVVWLVAFGGYCLLHERYQNRDLK
FT                   DSLRK"
FT   gene            complement(183490..184404)
FT                   /gene="thiG"
FT                   /locus_tag="BDP_0147"
FT   CDS_pept        complement(183490..184404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BDP_0147"
FT                   /product="thiazole synthase ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08831"
FT                   /db_xref="GOA:D2Q785"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q785"
FT                   /protein_id="ADB08831.1"
FT                   /translation="MSTENTVTTAEKDFATAPNATLDELVGTTTNTAILPEPDAHAYDE
FT                   IATGSADPLILGGHEFTSRFILGSGRYDLNLIKATIENAGTQIVTMALRRCRTTENNLL
FT                   DYIPKGITMLPNTSGARNAEEAVRIARLAREVCQTDFVKVEIEHEAKYLLPDNEETIKA
FT                   TAMLAKEGFVVMPYMFPDPIAAKRLEDAGAACVMPLGAMIGSNKGLRARDFIEVIIRNA
FT                   NVPVIIDAGIGRPSQAAEAMEMGADAVMAYTAIASAGNIPLMARAFKKAIEAGREAYLS
FT                   GLGKVTEDHAVPSSPTNEADYIG"
FT   gene            complement(184435..185148)
FT                   /gene="thiF"
FT                   /locus_tag="BDP_0148"
FT   CDS_pept        complement(184435..185148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="BDP_0148"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08832"
FT                   /db_xref="GOA:D2Q786"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q786"
FT                   /protein_id="ADB08832.1"
FT                   /translation="MTFEPSATPEQIQARQTAFNGLPDPATLVSREEIRAALLDRHTAA
FT                   TQDKLDAARVAICGCGGLGSTIAVALTRIGVGHLHLIDFDRVDMTNLNRQQYFLKDLGQ
FT                   YKTEALRSNLRQINPFIDITVDTVKVTDENVPTLFEHEDIICEAFDVPENKTMLVNAVL
FT                   ENLPSKKLVSASGMAGFRSSNLVSTRRVSKNFYFCGDGETAPVPGAGLMAPRVGVVACH
FT                   EANMITRLILGEEDA"
FT   gene            complement(185397..185591)
FT                   /gene="thiS"
FT                   /locus_tag="BDP_0149"
FT   CDS_pept        complement(185397..185591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BDP_0149"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08833"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q787"
FT                   /protein_id="ADB08833.1"
FT                   /translation="MIINGKEEHIATPITVAELIEQRGLRAERVAVELNGEIVPRTLRA
FT                   QTQLKGTDTLEIVTFVQGG"
FT   gene            186417..187481
FT                   /locus_tag="BDP_0151"
FT   CDS_pept        186417..187481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0151"
FT                   /product="oxidoreductase in aldo-keto reductase family"
FT                   /EC_number="1.1.1.149"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08834"
FT                   /db_xref="GOA:D2Q788"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q788"
FT                   /protein_id="ADB08834.1"
FT                   /translation="MKDSATDAVPGAVMGELAGFTIPRLGMGTMALAIEGRPDRDTAIR
FT                   AIHAGLNAGVRYLDTAWSYYLPSRPGTGTPEDLGYGEKLVRDALATWDGPRDEVLVATK
FT                   TGYRRTMEPAVRVSDSPESDTDDPAAPCAYSAARDDDSVTPAMRSDRSAERQHLQAVGS
FT                   RYGWMADSRPETMIRDAKESAMRLGVEALDLLYSHGPDPAVDYADQIGALKRLLDEGVI
FT                   RNAGISRVNNEQIDLAREILGDGLVAVQNQFSPSYPDPEHTLEHCEKLGLAFVCWSPLG
FT                   GFLDAFDQRAYDAFRVIADKRGCSYQRVVLAWELSRYDRLFTIPSARNPHEIQDSFAAT
FT                   ELTLADEELGFLNS"
FT   gene            187645..188145
FT                   /locus_tag="BDP_0152"
FT   CDS_pept        187645..188145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0152"
FT                   /product="MarR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08835"
FT                   /db_xref="GOA:D2Q789"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q789"
FT                   /protein_id="ADB08835.1"
FT                   /translation="MGYEQEAFRKLMSNIWGKKSRMQEEMSKGAKGEPFIVQELSRKGP
FT                   QTPTQLAAAMRATTGRVSTLLSALEKKGQITREIDPNDRRIVHVSLTEAGERRAEKQRE
FT                   DMREAVCWIFSQMGERRTREFVDLAVEFTTYMSLCMPGKSRPTPEQVRQAFGSTGGSDG
FT                   AAS"
FT   gene            188453..190210
FT                   /locus_tag="BDP_0153"
FT   CDS_pept        188453..190210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0153"
FT                   /product="ABC-type transporter, permease component"
FT                   /EC_number="3.6.3.44"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08836"
FT                   /db_xref="GOA:D2Q790"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q790"
FT                   /protein_id="ADB08836.1"
FT                   /translation="MLRIMRYLSKAEIGQMLIALVSIIGQIWLDLTLPDYMSNITELVE
FT                   TPGSSMSDIWVAGGKMLAISLGSAACAVVTGYIAARVGASFSQRLRSLEFNKVESFGPA
FT                   EMNRFSTASLITRSTNDITQIQMFITMGLMMIVKSPIMAVWAVCKIAGDGFEWTLATGI
FT                   AVAVLLVAIGILMALVMPKFKSMQRLTDNINLVARENLTGLRVVRAYNAEDYQESKFTQ
FT                   ANKELTETQLFTNRAMAVMMPLMNTIMNGLMLAVYWIGAYLIEAADATDKLTTFANMVV
FT                   FSSYSVQVIMSFLLMSMVFVLWPRADVSAQRVLEVIDTEPMVVDGSRTAGKSGMEGDIE
FT                   FRNVSFAYPDSREAMLEGISFKAAKGQTVAFIGSTGSGKSSLINLVPRFYDATQGEVLV
FT                   DGVNVRDYTLKALRDKIGYVPQQAFLFKGTIAGNVAYGDTELRERDVKDACDVAQATEF
FT                   IDKKEHGYESDISQGGANVSGGQKQRLSIARAVYRHPEILIFDDSFSALDFKTDRAVRD
FT                   ALAKEAKDSTKLIVAQRIGTIMDADRIVVLDEGRVVGQGTHRELLETCEVYRQIAQSQL
FT                   SEDELKGGR"
FT   gene            190212..192050
FT                   /locus_tag="BDP_0154"
FT   CDS_pept        190212..192050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0154"
FT                   /product="ABC-type transporter, permease component"
FT                   /EC_number="3.6.3.44"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08837"
FT                   /db_xref="GOA:D2Q791"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q791"
FT                   /protein_id="ADB08837.1"
FT                   /translation="MPRGPMGRGPAEKPKDFGGVMKKLIRFCRRYIPVIIIALVLGAAG
FT                   TVCQIIGPDKLKDMTNEITKGLPAIVHGKPVMNSIDFTAVGRIAWLLVALYVGYAVLCY
FT                   LQSWLMASVTQRTAQQLREEIGRKINRLPLKYFDKVSYGDVLSRITNDVDAIGQTLGQS
FT                   LGSLITSVTLFFGALIMMFYNNVILTLCAIGSALLGLIVMGGIMKASQQYFARQQAALG
FT                   DVNGHVEEMYTGHTVVKAYGGEADSISRFERYNQDLYVSGWKSQFLSGLMMPLMNFIGN
FT                   FGYVVVCVVGAVLAMDGKIEFGVIVAFMMYIRLFTQPLSQFAQAFQNLQRCAAASERVF
FT                   GFLEEPELADESDKRPLLGVDADGRPQPVRGDVEFSHVRFGYESDKTIIHDFSASVKSG
FT                   QKVAIVGPTGAGKTTMVNLLMRFYEISGGTISIDGVDTKSVPRWNVHDQFSMVLQDTWV
FT                   FRGTVRENIAYSKKGVTDEQIVAACKAVGLHHYIMSLPDGYDTILDDKASLSQGQKQLL
FT                   TIARAMVEDAPILILDEATSSVDTRTEELIQKAMDALTVGRTSFVIAHRLSTIRDADMI
FT                   LVMDGGDIVERGTHEELLAKGGFYADIYNSQFTLAG"
FT   gene            complement(192186..193325)
FT                   /locus_tag="BDP_0155"
FT   CDS_pept        complement(192186..193325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0155"
FT                   /product="conserved hypothetical protein with ATPase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q792"
FT                   /protein_id="ADB08838.1"
FT                   /translation="MAMNPFKPTAGKMPPILIGRETAIEEFTEGLDNGAGAPGRIMLVT
FT                   GQRGFGKTVLLTEFRRIAAERGWETISETASPDVAQRLIEALTPSGLHINQASVSPSVS
FT                   IPGIASASLGHIDLSSTTTPLTLRNAIAKRLESGKIGKGKGILITIDETQAASLDDLVA
FT                   IATAIQHVTTSIDETNVPDAEKKGIAIVFAGLPSTVNDLVNDDVVTFLRRALRCELDNV
FT                   PLVDVKNAFLESVADSGKTIGNDEAWLAAQATNGYPYMVQLVGYYMWQASQRRHATGIT
FT                   ASDVATGIADAQIAFDDAVCAPALDGLKPAELEFLNAMACDAPAATAVSAIETRTGRSR
FT                   SWVNKYRAALIKDKIIQPAGHGSLEFAISHLGAYLRKRL"
FT   gene            complement(193503..194549)
FT                   /locus_tag="BDP_0156"
FT   CDS_pept        complement(193503..194549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0156"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08839"
FT                   /db_xref="GOA:D2Q793"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q793"
FT                   /protein_id="ADB08839.1"
FT                   /translation="MVSLSLRMPHVTAFPKALGTGIVISTPQPVHEDLRTRMSELLETY
FT                   EQVLSRFRDDSLVAEIGRAKHGGNFDFPDWTEPLFGLYDALFAATSGAIDPCIGEDLIR
FT                   LGYDASLSFTVKPGSAEHLGALRGRPTWGDDVERRGTTLITRRPVDLDFGACGKGYLVD
FT                   LLGAFLASASAEFVIDAGGDLLIHSAEPIAIALEDPDDSTRAIGVAHIIDGALCASAPS
FT                   RRHWEVAVNERTQLSIHHLLNAIDGLPVQQTEATWVYMPGSAPDPSARVREPEARATHG
FT                   APRTSDSSPQDAIGPFAAHPSALADGLATALFTTSPEELRRAFSFACVTLNAGRHAAVS
FT                   SDFPGRLF"
FT   gene            194739..196148
FT                   /locus_tag="BDP_0157"
FT   CDS_pept        194739..196148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0157"
FT                   /product="symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08840"
FT                   /db_xref="GOA:D2Q794"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q794"
FT                   /protein_id="ADB08840.1"
FT                   /translation="MMSGGAAQTVQSGQSRKALDLPMPKVWAFAVGQFGWALLSGIISN
FT                   WLVYFYQPDNETIAQGQTVFVPQGLAVLGVVTVVGGITAFARFFDAFVDPAVASLSDRC
FT                   QSAVGRRMPFLKCAALPLALVTVLVFWSPINGTSWVNGVFLFVAVIGYYIALTFYCTPY
FT                   NALIAELGHDSKQQLTISTAISFTWVAGTAIAYVAPVVWAGFVPGLGRVNAIRLTFSIM
FT                   AAIALACMLVPPLAIKERDYVNSQPTSESTVESLKQTFGDGEFRKFVCSDVVYWVAITT
FT                   FQTGLPFFVTSLLKLPETTTTIYFVLMTAVSVLFYLPVNLMANHVGKKRILLVAFAIFT
FT                   CAFAFAGALGSGLLGAIPPMAQGLILSIVGAIPMAAFGILPQAIVANIADASSKTTGQD
FT                   RQGMFYAARTFAMKMGQSVAMLLFTGVSTIGMASGTGYRIAAICAAVLCGMGGLVFAFY
FT                   NERKVLSVLES"
FT   gene            complement(196152..197195)
FT                   /locus_tag="BDP_0158"
FT   CDS_pept        complement(196152..197195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0158"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08841"
FT                   /db_xref="GOA:D2Q795"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q795"
FT                   /protein_id="ADB08841.1"
FT                   /translation="MPANKKVGVSDIAKHAGVSIGTVSNYLNYPERVSETLKTKISRAI
FT                   ADLGYVPKHSNGQIPASNATPVIGFVMTDIEHSLFTSIFEGAQEVCEDHGMQVVGLNAL
FT                   SDKQRQSDMVRLLIGMNVAGIILSTVEDSPEDVAAARAAGIPIILIDHTNPRDADPVCS
FT                   IMTDNVSAGQIAAEELIRTGCTKLAFLAHSFDYESVQDRQLGVQKAVMLATRSNRTPQV
FT                   SAEVIDSGGLYIEDGYESGLTIAAMPEGERPDGIITVDTPLGVGVVNALLDQGVRIPED
FT                   ISVIACDEAQIKPLGSLPLTSVAANATDIGRKAMTQMLDHMSDADAHVHATTLIKPILV
FT                   RRASTRR"
FT   gene            197414..198727
FT                   /locus_tag="BDP_0159"
FT   CDS_pept        197414..198727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0159"
FT                   /product="MFS-family sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08842"
FT                   /db_xref="GOA:D2Q796"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q796"
FT                   /protein_id="ADB08842.1"
FT                   /translation="MNAAAQKKEGIGGYMPLAVAAGIGSMLGSGIIVGLSATITVWQNG
FT                   LGLDTTQVGLLSGILTFAIAFGSLFGGRLADKIGRVLVFNWINLLYAIGAAICVFAPDF
FT                   TVLLIGLIIAGVASGADLPISMTIVSHDAPNDKVAAQLVSTTQVFWQVGVFISFICAFL
FT                   VSTMEGAMGGRVVFAILAVFAVIAWLWRLISPTFRRFHEEADARDAAAGHVATATEKVS
FT                   VTKMLFAGTENSKMLLGFFLAITIFYCGWNLLANTWGQFQTYMLVQANASQSLATGLGI
FT                   ILNFITLALNIAFASIAGGKYRNKLFFVGMGISIVAMVCLALGGTNMWVIFGATALMNL
FT                   GGPFAGEAMYKVWTQESFPIEIRASIQGFINGFSRLLCGLFALITPALVLPSTIKTTMW
FT                   CFVGVVVLELVAGSIMIAKQNKYGTDEERQLKASSAEA"
FT   gene            198788..201460
FT                   /locus_tag="BDP_0161"
FT   CDS_pept        198788..201460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0161"
FT                   /product="alpha-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08843"
FT                   /db_xref="GOA:D2Q797"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q797"
FT                   /protein_id="ADB08843.1"
FT                   /translation="MRIMDTQIIKPIAVGDLHITRFTIEHFPGDALGIPTATPRMNWTY
FT                   SRTVPDGSQILLKISRRIPGAQAREEYTYLPPEDNVLVPWQFTPLASREEVFATVQLVS
FT                   AAHKPLSDPSATLHFEAGLMQEYEHVADFVGPSWAEPETDHRHLPLVRTEIAIKAKPKR
FT                   ARLYLSALGLVEAEINGVKIGNDALIPGWTNYEQRVQCWTYDVTDELNEGANAMGFWLG
FT                   DGWYRGRLGFDGGYVNYYGDRLGVFAQLEIEYEDGGIEHVYSNAWDRQWKASLGPIVCS
FT                   DLCEGERYDARLEQPGWSEPGFDDSNWKPVSEIFYDPAKIENPDTSPVRAHEINEPVSI
FT                   ARTGDTPDGRGIWLVDFGQNCTQRIRLRIAGLEAGQSVELHHVEVLEPNGEIATRTLRR
FT                   GQQHDIYTSNGTDAWWEPRFAMHGFRYAQIEGVVGELTVADIECHVYHSVMDRAGELET
FT                   SNPLLNRLHANASWSMRSNFVSVPQDCPQRDERMGWTGDICLFAPTAAYLYDVYGFLKS
FT                   WLKDVRADQVKWGTVPFYVPFIPLGGWAHPQAISTWGDSAVEVPWVLYMESGDPQILAD
FT                   SYELSRDWIDEVAGYLSADGVWDRRPDYVLGQLGDWLDPTAPPDDPTQAMTEKELVATA
FT                   FFARSCAQAEQIAQILGKSEDVVRFGDLRKHVTSGFLGRFTNLDGTMTSDTQCAYALAI
FT                   AFGLLDGEPVRRVKAGNRLAKLVRESGGKVSTGFAGTPFVLPALTMTGHNEEAYGLLLS
FT                   EECPSWLYQVKMGATTTWERWDSMRPDGSLNPGGMTSFNHYALGSVAEWMHAHIGGLEA
FT                   IEAGWKRFRVAPVIGGGIDHASTAHVTPYGKASVAWKTSETGVELDVTVPIGATAVVEL
FT                   PDHEPTELIGGTHHLVVAL"
FT   gene            201547..202863
FT                   /locus_tag="BDP_0162"
FT   CDS_pept        201547..202863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0162"
FT                   /product="MFS-type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08844"
FT                   /db_xref="GOA:D2Q798"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q798"
FT                   /protein_id="ADB08844.1"
FT                   /translation="MSLNDESAVAAAIPPEEIAPDTGRRLTTAEKLRFGIGFALFSLLW
FT                   MTAGTSGSGVLLPQRFDELNIGTPEVILGAMNSVGCIFALFANIIFGALSDITRSRFGK
FT                   RTPWIVAGGFVTAAGYVLAFSSASLAGIVAGWSIVQVGVNMMIAPAVAVLSDRIPENVR
FT                   GTFSSFYGGAMIVGQSAGTFLGSKFIDTMGVGFVIGAVLFAITGILTIIIWPAERSSKV
FT                   GSAADDTKANVKLSPAAIAKSFIPPTKNCRDFYLALVGRLLLIFGWSMISGYQLYILKK
FT                   YCGLSVDDAASTLATMSLISMVVLMICSVVSGPISDKLHKRKIIVAIGSVIIAVGVAIP
FT                   FFMPTALGMMLYAGIGGVGYGIYIAVDQALNVDVLPSADEAGKDLGILNLANTVGQVLA
FT                   PVATGAIVVATGSYAQIFPVAIVSVLIGAVVIMLIKKVA"
FT   gene            203197..204942
FT                   /locus_tag="BDP_0163"
FT   CDS_pept        203197..204942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0163"
FT                   /product="high-affinity Fe2+/Pb2+ permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08845"
FT                   /db_xref="GOA:D2Q799"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q799"
FT                   /protein_id="ADB08845.1"
FT                   /translation="MSLRDVRSQGLGRITAIIAAMMIALATMFAFTSMPQQALAADDSQ
FT                   TNFDSWTEVAANIEKQLETAEQDYNDGNYYQAGTDFQNAHWVGYDASNFSKVVNDTIGA
FT                   DKQKALLQEFTDLESLAYQQDQGDAITAKVDALTADLNATAQTLDADTSLADPKTYAKQ
FT                   RAEETAKERKKLDAAKKNSSKGKGDRTWSDVASEMNVILDKAYKAAISGKGAEGSSLVN
FT                   NAYYQYYEKLGFEKNVMNAISGDRVSQVEYQFKMTRKTMRDGGSQKEIKKLVDDLKSWL
FT                   VEDAATLDGGATSNVNSFTKFITSSVGQAFLILIREGLEALLVVAAVIAYLVKSGNKRF
FT                   TKFIYLGVLAGLAGSGLIAVLFTFLFGGSGPIQEISEGVCALIAMAMLLWTSNWMLNKS
FT                   SVEAWNRYIRNKTEAAVASAQSKMEAGEGVSFGMVVSLAMLSFLAVFREGAETVIFYES
FT                   IYSMSQDSRGMWIGGIAAAVVLLIIFFVLRFTSVKIPIGPFFLVTSILMAVLVVIFAGG
FT                   GIHALIEGDLIEGTYLSNVPTNDWIGLYPYVECLVAQVLAAIAVITLFVVGFVKKRKLK
FT                   ISDIS"
FT   gene            204974..205636
FT                   /locus_tag="BDP_0164"
FT   CDS_pept        204974..205636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0164"
FT                   /product="hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08846"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7A0"
FT                   /protein_id="ADB08846.1"
FT                   /translation="MKNKKIAALLGLLLAGSMAFSLSGCGNSNSSASNDKSSSSSSTAT
FT                   DDSSKDDSSSDDSAGFEEIQVDEKHSDQEVGPLTVNAVYFQPIDMEPSGMGLKAADASF
FT                   HLEADIHANQKGTELGYGKGDFVPDLTVNYDIIDKTSNESVGSGTFMQMNASDGPHYGA
FT                   NVKLDKAGSYKLVLKIESPEKKGWMLHVDPETGVKGRFWTEPLEVTFPDWNYTPQEW"
FT   gene            205722..206993
FT                   /locus_tag="BDP_0165"
FT   CDS_pept        205722..206993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0165"
FT                   /product="hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08847"
FT                   /db_xref="GOA:D2Q7A1"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7A1"
FT                   /protein_id="ADB08847.1"
FT                   /translation="MLLQYVTVLQGLLAPALLIMALNVMLTVGEGRDKPLSAYWRLTGF
FT                   LVGFAGAIVFAALRATAVITQRTFVNYPTLWCCVIFDIAVFVIVIFARRITTAWHDHRP
FT                   LLDAANLIAALAIAATTFRALPDVILRLTIFVEPGDPVFTSDMLLRALGFALGAATAII
FT                   AACIFRTMRSTAVRWSFTTAVLLLIMLLFASHFTDLAQLLQSKRIVSFPTAAFLALVWG
FT                   INHQREMAIAMALVFVIPAAASIVMGFKIKPTGPNEAIARSHVAFRRRAKAAGAWSLVA
FT                   MIGITVALTYGVAQTQKVITLSPPEEYSLKDGVATITFSQVSDGHLHRFQYKAKDGTVM
FT                   RFIIIKKNGGAYGVGLDACDNCGDAGYYEKDGKIICKKCDVAINLATIGFKGGCNPVPF
FT                   DYQVKPGKIVIQTSVLDALSSHFQ"
FT   gene            207015..208358
FT                   /locus_tag="BDP_0166"
FT   CDS_pept        207015..208358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0166"
FT                   /product="ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08848"
FT                   /db_xref="GOA:D2Q7A2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7A2"
FT                   /protein_id="ADB08848.1"
FT                   /translation="MFFLRMIFRSFSRQFKRRLLIAVTVCLSATVSVAMLGVVFDVGDK
FT                   LNAELSTYGSNITVQPKADAVVSDLYNTGGSSGSSSDSDPTAFLKESDAPKIKTIFWAF
FT                   NITNFAPELNIHVDAGCSDGSASADSCKATNVPIVGTWFAKTLHMDSGESTVAGMNGMR
FT                   SWWKLDGSWPKDDTEQGLIGTSLASQLGVKIGDTVTLGKTISTGERNQVKVKITGIYDS
FT                   GDSDNNGMYIPSIVAQTLANLPDSIDKIEVKALTTPDNDLARKASKNPNALTQDEWETW
FT                   YCTAYPSSIAYQIEEVIPGSVAKQVRQVAALQGDVLQKTQAVMVLMTVLSLVAAAIAVA
FT                   NLMAASIGERGSELALMKAIGATDGAVSRLMLAETAVISLVGALVGALFGSGVAQIVGH
FT                   VVFGSGITMRPMVFVLVFVLLAVTVLIASFSSIRSILNLKPAEVLHGR"
FT   gene            208375..209694
FT                   /locus_tag="BDP_0167"
FT   CDS_pept        208375..209694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0167"
FT                   /product="ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08849"
FT                   /db_xref="GOA:D2Q7A3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7A3"
FT                   /protein_id="ADB08849.1"
FT                   /translation="MTNRKMFFAMLWGAVFRRRSRAVMAVIASLVGAATLFCLASVCIA
FT                   VPQQMNEEMRAYGANLIVTPADATSKSEGISTATITNVTALVTAEHSAKSAAYRYESVR
FT                   INSAPYTLAGVNPKAVQTLNRHWNVTGDWPSEGNVMVGRDVADALGVHIGSRITIGYRA
FT                   SDNSAASSASGSSDSGESDNQSDENGSQMSDSGESDNQTVGKLGQTESQVKENGRVSSD
FT                   IMNNEGTEFRVAGIVDTGGNEDSIVYATTADVAKLAGSKRGADVVEYSVNAMGDDLNAI
FT                   VKTLNANPNTGVKAQTVTKITSSDTRIITMLQTLFWIVSLVVLVLTLVGVGTTISSIVS
FT                   QRRNEIGLRKALGASSQAIGTEFYVESAIYGLIGGLFGTAIGYALARVLCVTVFERAIG
FT                   FNWLLGLASLVLSMLIAVVASIPPVRRATRIDPAIVLREE"
FT   gene            209697..210509
FT                   /locus_tag="BDP_0168"
FT   CDS_pept        209697..210509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0168"
FT                   /product="ABC-type transporter, ATP-binding component"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08850"
FT                   /db_xref="GOA:D2Q7A4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7A4"
FT                   /protein_id="ADB08850.1"
FT                   /translation="MGSENILLELDHISKIYGDLHAVDDLNLTVPEGEWLAIVGSSGSG
FT                   KTTLMNMIGCMDTPSKGSVMLEGRKLEDLNAKQLADVRKNMIGLVFQKFYLVPHLTAAE
FT                   NVMVAQYYHSVVDETQALEALERVGLKDRAHHLPGQLSGGEQQRVCIARALINCPKLIL
FT                   ADEPTGNLDEKNEKIVLDLFRQLHEQGTTIIVVTHDALVASCAQREIMLNHGVLIGEKW
FT                   NDEAARQAYEAAGGKPASTGSTAEGAQTGETAIEFADPTKAAKTGATE"
FT   gene            210532..211095
FT                   /locus_tag="BDP_0169"
FT   CDS_pept        210532..211095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0169"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08851"
FT                   /db_xref="GOA:D2Q7A5"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7A5"
FT                   /protein_id="ADB08851.1"
FT                   /translation="MTMTDEKSTAVKVIALTAASLALLSACGEPKATPMDDEYAGNSGE
FT                   SVESQEDKSKTDGKATDNSSNDDDSVKNHADDSNSTKSDKKDTGNYADGTYSINGQYGP
FT                   VGEDTIDVHLTVKDQNVTDVSIVGHPFTSISKKHQDAFAKAVPDAVVGKPLKDLKIDKI
FT                   AGASWTTEAFNKALEVARQEASIQ"
FT   gene            211299..212363
FT                   /locus_tag="BDP_0170"
FT   CDS_pept        211299..212363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0170"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08852"
FT                   /db_xref="GOA:D2Q7A6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7A6"
FT                   /protein_id="ADB08852.1"
FT                   /translation="MNNGLDHKATLKDIATKAGVSVTAASLVLNNRRVRISKEKRDRIL
FT                   QVAKQLDYRPNQVARNLAAGESRLIALIVPSIENLFFASLAKRLECECANDGYSLVVAV
FT                   SEESRAKEHAVMNRLSALGVDGVFLVAACESYEAERELRKDAERVMCPVVLMDRLFSSS
FT                   WCDGLAFDGYLGGRQASQRLVDAGHRRIGCVTDEADGEGLGVRTRGFVDVLQESGIGFD
FT                   PALWVRGDYRFSSGYMAADRLIDMGVTAVFCGNDLMAAGFIQRVTERGLCVPADISVVG
FT                   FDDVLEYYGLFRAVTSVAQDISQLAKRGWGKMREYIELLDSDDVDGCPWLENHHAELLK
FT                   PHLVEHGTISDIAM"
FT   gene            212754..213839
FT                   /locus_tag="BDP_0171"
FT   CDS_pept        212754..213839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0171"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08853"
FT                   /db_xref="GOA:D2Q7N2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N2"
FT                   /protein_id="ADB08853.1"
FT                   /translation="MISSNPMRMGSGSETGKPHMVFSQLRGGVMAYVTIRDVARRAGIS
FT                   VSTVSRALNGNGRISAETKHAVEKAMEELHYIPDSRARAMRSSSTKTVGLLVPDIRNGY
FT                   FADLAYAIQDTLSKAGYCTFIGTSSENVRQQDVFITNMLSQHIDGAIIVPQGEMSEALQ
FT                   RLLRRQLPVVFVDRRADELDMVPLVDSDPFPGMESALRDIQEQGHSKVGYVSGPILDSP
FT                   TLRERELAFRDCGTRLFGEENVFVESTSFDQSSCVSVIRRMLSSGVTSMVFGYSPDTVR
FT                   AIAMMNGVGGVLESGMSFISFDDIELFRLTTPQVSVISQQVQRLGCLGAETFLDMVQGG
FT                   HPRSRRVETIYIQRGSVESVR"
FT   gene            213991..215493
FT                   /locus_tag="BDP_0172"
FT   CDS_pept        213991..215493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0172"
FT                   /product="ABC-type sugar transporter, ATPase component"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08854"
FT                   /db_xref="GOA:D2Q7N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N3"
FT                   /protein_id="ADB08854.1"
FT                   /translation="MTQLSLVGVSKIFGSTKVVNNVSVKVEPGKVHVLLGENGAGKSTV
FT                   IKMMSGIYQPDEGHIEIDGKEVRIPNVDTARKFGIAVIHQELNLVPQLSIMENLFLGTL
FT                   PNKAGFVDRKTMAEKARKAIKLIGLEEDVHTAMGELGVARQQMVEIAKALMQDASILIL
FT                   DEPTAALTRRECDQLFAIMDELKAKGVGMVFISHHLDEIARVGDVVSVLRDGQYIDTVP
FT                   ASTSEDELVKLMVGRDITNQFPRIAQEPGEVLLDVKELTREGALDKVSLQVHAGEVVGL
FT                   AGLVGAGRTEVIRAIFGADSYDSGSVSVCGKKLQKKSIAQSIEAGLGLVPEDRRTQGLI
FT                   LDASVAENLGLATMLSTAKCGFADLAGQRRRENETAQKLRIRMANVNQTAGSLSGGNQQ
FT                   KIVFGKWSMANVKVLLLDEPTRGVDVGARVEIYDLINEITANGGAVLMASSDLPEVLGM
FT                   SDKVLVMSEGRITGHMPASKATQEKVMALAVSHMDDENDNEH"
FT   gene            215514..216503
FT                   /locus_tag="BDP_0173"
FT   CDS_pept        215514..216503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0173"
FT                   /product="ABC-type sugar transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08855"
FT                   /db_xref="GOA:D2Q7N4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N4"
FT                   /protein_id="ADB08855.1"
FT                   /translation="MTNADKKLGYDSGDKTTVARIKTFASQNGALIGLIILCIALSIVA
FT                   PAFLSASNLMNVGIQAATVAILAFGQTFVIVAAGIDLSVGATAAVASMLVAYTGANMGL
FT                   PAGVTIIVGLLAGAVFGALSGMMNAFLRLPSFIATLAMMSVARGLTLVISDGRPISTSG
FT                   MVNFFGGTIIGIPVPIIMMVIMGIIASVILNFTTIGRSMYAVGGNMEASRLSGISVHKT
FT                   QIMVFVLSGIFAAVAGLVIAGRLHSAQPQAADGYEMDAIASVVIGGASLSGGKGKVSGT
FT                   FIGAILLAVIRNGLNILNVSSFWQKVVIGLVIAFAVSFDTLRRKVDAH"
FT   gene            216634..217581
FT                   /locus_tag="BDP_0174"
FT   CDS_pept        216634..217581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0174"
FT                   /product="ABC-type sugar transporter, sugar-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08856"
FT                   /db_xref="GOA:D2Q7N5"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N5"
FT                   /protein_id="ADB08856.1"
FT                   /translation="MLNPCFKKTIRAAVAVACAATLAIGASACGASNSGNGSDKVALLI
FT                   STLNNPFFVDLRDGAQAEANKLGVNLLVSDAQNDSATQQNQAQNAQSQGAKAVIINPVD
FT                   SDAASPAVAPLLSANLPVISVDRSVTGEDVTAHIASDNVAGGAQAADELAKAIGEKGDI
FT                   IILQGTPGAASTRDRGDGFKKEIKKYAGIKVVAEQTANFDRSEALDVTSNLMQANPNIV
FT                   GVYAENDEMALGAIQALGSKAGTDVKIVGFDGTDDGLKAISSGTLTGTIAQQPKELGKQ
FT                   AVQAAVKAIKGEKVDKTQSIEVKTVTKENVADFQ"
FT   gene            217666..218112
FT                   /locus_tag="BDP_0175"
FT   CDS_pept        217666..218112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0175"
FT                   /product="sugar mutarotase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08857"
FT                   /db_xref="GOA:D2Q7N6"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N6"
FT                   /protein_id="ADB08857.1"
FT                   /translation="MGSISQSACQHYERIADMLTHGILNAQLSAALAGLRHKDVFVVSD
FT                   CGLPVPQGIEVIDLAVVFGVPRFEEVLEALRPQLVLEEGLMAEEARGEQAERWVKDHFN
FT                   VPLSYVPHDGSGGFKSHVRNAKFVVRTGETTSYANVIFRCGVPF"
FT   gene            complement(218235..218888)
FT                   /locus_tag="BDP_0176"
FT   CDS_pept        complement(218235..218888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0176"
FT                   /product="TetR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08858"
FT                   /db_xref="GOA:D2Q7N7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N7"
FT                   /protein_id="ADB08858.1"
FT                   /translation="MNTGVPPTVSPAASPASVVETAVQGAVQKIQGRREQLREQTDRKI
FT                   MRATLEIMISKGVAAVTIEEVARRSGVAKTTIYRRYKNADDLLQRIQLEVAGLPDFGDL
FT                   QPSRSGLQAMLERIQNCFDSEIGLKAVGVVLSSDNDSLKTIADQVITPAEQRFATFVER
FT                   GVASEAFRRGLDTKFLFSTILGSMLTCKALYKDSDSDVPWSERMATLIWPFVKA"
FT   gene            complement(218900..221137)
FT                   /locus_tag="BDP_0177"
FT   CDS_pept        complement(218900..221137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0177"
FT                   /product="phage-infection protein-like hypothetical
FT                   membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08859"
FT                   /db_xref="GOA:D2Q7N8"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N8"
FT                   /protein_id="ADB08859.1"
FT                   /translation="MKAIWKLFVGDVKRLTSNVVSVIIVIGLTVLPALFTWFNVAASWD
FT                   PFSNTGNLKFAVANVDAGYKSDLIPVKINVGDQVVNTLRANSQLDWTFTSKEEAIDGTK
FT                   SGKYYAAVIIPKDFSKRMMTFFSKDSKHAELTYYNNEKKNALAPKVTGQGADTVSAEIN
FT                   EMFSKTLTETALDLATQLSDQLDKPEAKNQLQQFSSNISDFAAGLTQTASSLKTFSSLT
FT                   GSAQTLLDSSGTLIQQAASSAKTAGKQLKSASGSVTDLSGALNTSTEALSTAIKQSGES
FT                   FAAVGDEVDSLFANVSTQAGDTATALRNQASNVTNQAAQYQHIVDDLQKTHDDLQNKLD
FT                   TDTSLTDLEKKTLTAIIGKFEASISKLNNAIDMQKTLAATLTDAAQHIDDGISDSKESQ
FT                   AAIKDLATQAKASINAVHSDFDTNLKPQLNEIGSSVSTASSALNASAANLKSALGDLNK
FT                   TTSSADKQLTTIREVLDSTADSLTTTGNKLSTFNDTLSDALNSGDMSMVKDVLGKNTDS
FT                   LATTLAAPVKVKRTAVFPVKNFGSQLAPLYTFVTLWVGSLLMAVTLKTSVSRKTRMALG
FT                   NPKPHQLFFGHYLVFAVIALMQATFSLGGSLLFMHVQAVHPWLFMISGWISALIYSFFA
FT                   YTMVASFGNVGKAIGVLFLIMQISGSNGAYPLAVMPRIISDISPFLPVTHSVTAMRAAI
FT                   AGIYNNDFWTSIGALALFIPPLLLIGLLLRIPMMKFNKWYIAKVESTKVIM"
FT   gene            complement(221134..223776)
FT                   /locus_tag="BDP_0178"
FT   CDS_pept        complement(221134..223776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0178"
FT                   /product="phage-infection protein-like hypothetical
FT                   membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08860"
FT                   /db_xref="GOA:D2Q7N9"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7N9"
FT                   /protein_id="ADB08860.1"
FT                   /translation="MSNVLKILHRDIMRILRVPAAWVIMTGLTVIPPLYAWFNIYGFWD
FT                   PYGNTNNIRVAVANVDEGTDNAMLGQLNLGDQIESTLKKNDQLGWQFMSKAKAMEAVQS
FT                   GDCYAAIIIPKDFSEDLAGVITGNSERPTLEYYVNEKASAFVPKVTDSGTTTVDRTVNS
FT                   TFVSTVSEVLSKTVNSVSDTITTQTDNVTSEAVAELDKTQRNVEKIRTTISDLSANLAN
FT                   TPDQIQAARAALNDVQTAAASAGKGLSGTANLITDTQTRINTFSSTASASLDQGSALLS
FT                   QLSTQTNTSVNTVTSGLAAANGYAGSAIGTMQKVNSDNAKVLDSLQKIDISNVSPELNK
FT                   QYQQIISDLQSRNRQSANTLNDLNQLNTDTKNTVAGTTKLSNQFNTSAQSTLNSATDAR
FT                   NAINSSALPQLNSGLSSLAATAGTLSGTVTSQNFLTQQTSSVLDQLERVSADTRSMLKD
FT                   TDEQLQTIENKLGQLSTDLNALSGASLLNDLIGEDGLDVTKIADFMQSPTVIKTKNIYP
FT                   VNTYGSGMAPMFNTLSLWVGAFAYMVIMKLEVDDDDLEDLDLTTTEKYLGRFLLLAIPA
FT                   AIQGALCAIGDLIIGVQAVNPFMFILTGTLTSLTFLSITYALSTTFMHVGKGMCILLAI
FT                   LLIPGGSGLYPIDMMPRFFRAVYPFIPFRYTIDAFRETIAGFYDGHWLKMVGVMLLFVA
FT                   IAFFIGIVIRPLLTNLNRLFAREIEESDMIIGERPMVENRGYNVSQIIHVLSDKGGYRE
FT                   AIEYRASRFTELYPKLKRGALIAGFIVPTILATVFSLTNGTKLVALATWIIWVLLIIGF
FT                   LMVIEYMRDSMRRQVELGSLSDEAIQGMLMERQKARIRRKKRALEERKAKLTRKAAKHH
FT                   RTKNEKDNA"
FT   gene            224093..225652
FT                   /locus_tag="BDP_0179"
FT   CDS_pept        224093..225652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0179"
FT                   /product="Possible adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08861"
FT                   /db_xref="GOA:D2Q7P0"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P0"
FT                   /protein_id="ADB08861.1"
FT                   /translation="MVYAAHHPRQTHRPVGKIIAIAAAVSLVSGFGAGAGVAAIVKASA
FT                   TSQQSVMSLVGQGGGADTMSYDYTGSYSGALTADGKSVESSGETVSATSSDQNAALVQN
FT                   GGTLTITNGKLTKSGDSDNADNCNFYGTNSALLAVGEKSKAIISDSSIDATSSGSNAIF
FT                   STDSASVLANNVNITTSAANSRGLDATYGGSIIANAMTISTKGDHSASLATDRGGGSVS
FT                   VTDSTLNTAGSGSPLLYSTGDIEVSGVTGTASGSQIAGMEGLNTILINNSTLESTNTGT
FT                   TGSDPVANGVIIYQSTSGDAESSTGQHATFQAKDSTLKSAITSGSMFYFTNTTADVVLS
FT                   NTDLDFDSDAANLIMAAGNDSNNWGTAGSNGATVNFTGRSQTLKGKVSADTISSVTLNL
FT                   LEGSTWTGSAEITENSAGSTSDAPITVNVDGTSTWVVTADTTVSALNVADGGKVVDSSG
FT                   KTVTIKANGKTVVSGDSDLTVTVTGSYGTTVEAGSDTELSSDVTDRTAFDKQFGTSTSW
FT                   SF"
FT   gene            225710..226285
FT                   /locus_tag="BDP_0180"
FT   CDS_pept        225710..226285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08862"
FT                   /db_xref="GOA:D2Q7P1"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P1"
FT                   /protein_id="ADB08862.1"
FT                   /translation="MTNFDFDTRNTQNQQQNTDGQPTQTMPEQQGTQASQPAQQYYAPP
FT                   TQPAQPVPDSFNGPVAAKSNTKLGGKVIGVVAGISLLCGLVGGVGGAFAVNALSGSNEP
FT                   QMSQQGGPSQGGPGQMGGQSGNGNSQNGNGQMGEPPSGQGGQSGSDGQSDSNGNSGSQS
FT                   DGSSSGKSSGSNSSSSYSDADDSDTIAS"
FT   gene            226615..227880
FT                   /locus_tag="BDP_0181"
FT   CDS_pept        226615..227880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0181"
FT                   /product="hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08863"
FT                   /db_xref="GOA:D2Q7P2"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P2"
FT                   /protein_id="ADB08863.1"
FT                   /translation="MNEHETSAAIADETVIDAIEGAQAVDAVTADESSDPADRRLPLIF
FT                   RIYGIIMLVEGVVTLPIIVLAALYAVRAVIEGRMAVDAINLTVILSVIHAVVLLATTAC
FT                   LAVFGVLLVLNKRRHVAQWTYVMIPLTLAEGLLSLALQGLDVNLIAPAVQLVVLIALHI
FT                   TADPSLREERRLQFALRRMDARSEYEDAVAVGMAGRDLTGKGYISLDFFNLFWLFVVGC
FT                   VFGLAIETIYHFILFGEYQDRAGFLWGPFSPIYGFGAVILTVLLNHLWRSNWLLIFCAS
FT                   ALIGGAFEYFTSWFMETAFGITAWNYTGQWLSIDGRTSGKYMFFWGLLGLIWVKLILPR
FT                   LLALIQHIPWKVRYSLTAVCFVLLFVDGVMTLMALDAWYSRMAGIAQNSPVSQFFATYF
FT                   NDAFMVDRFQTMSIDPSSAGRM"
FT   gene            complement(227946..228182)
FT                   /locus_tag="BDP_0182"
FT   CDS_pept        complement(227946..228182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0182"
FT                   /product="glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08864"
FT                   /db_xref="GOA:D2Q7P3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P3"
FT                   /protein_id="ADB08864.1"
FT                   /translation="MTVTVFTNPSNPQCEATEQELAKLGVRYVAIDLTQNPSTFEQIKD
FT                   AGFKQIPVVISPNSSWSGHRPDLIRQLAQSFAA"
FT   gene            228429..228644
FT                   /locus_tag="BDP_0183"
FT   CDS_pept        228429..228644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0183"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08865"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P4"
FT                   /protein_id="ADB08865.1"
FT                   /translation="MRRPHPSMPTIAAGVSVASSSYGFSAQMDCPVANANDLPALKWHE
FT                   DTQQRKEQEPEMANEMPLRYGLVLSK"
FT   gene            complement(228704..228776)
FT                   /locus_tag="BDP_tRNA6"
FT   tRNA            complement(228704..228776)
FT                   /locus_tag="BDP_tRNA6"
FT                   /product="tRNA-Lys"
FT   gene            228903..229388
FT                   /locus_tag="BDP_0184"
FT   CDS_pept        228903..229388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0184"
FT                   /product="truncated dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08866"
FT                   /db_xref="GOA:D2Q7P5"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P5"
FT                   /protein_id="ADB08866.1"
FT                   /translation="MSCTTILVGKKASYDGSTIIARDDDSGSGRYDPKRFVAITPEVST
FT                   DNLYWTNRLIAALADAHFYETSNAIEAFAEAACTYGHRLVEHTDAALRNIGKDSDDSAV
FT                   GDSVAETAGEPIAGRLRAANDEMAEYLRTHATKLLNDVLYTSSNLMRNGFAMSDRWN"
FT   gene            complement(229426..230457)
FT                   /locus_tag="BDP_0185"
FT   CDS_pept        complement(229426..230457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0185"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.1.212"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08867"
FT                   /db_xref="GOA:D2Q7P6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P6"
FT                   /protein_id="ADB08867.1"
FT                   /translation="MQEKKTLTFVVPAYNMETYLGRCVESLIAAKRNDDIEVLIIDDGS
FT                   SDGTLAMAKSFEQRHPGVVRAIHQDNKGHGGAVNTGIAAASGMYVKVVDADDWVGAESL
FT                   ELVMATLREEAERTDPIDMLVTNYVYDKVGKIVKHVVNFRRAMKSDERLTWNDLGHFGL
FT                   AEYILMHALTFRTAVVRASGMQLPEHTFYVDFIYAYQPFPWVKTIKYLDTPFYHYFIGR
FT                   DGQSVQTDVMIRRVDQLRLVNQYMVRATPERGTVPEGLYRYMIHFLAIETSVASVFMIL
FT                   SRKPENYAKKKEMWADIKAYSPSMYADVRRKAMSRALNLRGSIGRFVIRNGYFVAEHVV
FT                   GFN"
FT   gene            complement(230681..231436)
FT                   /locus_tag="BDP_0186"
FT   CDS_pept        complement(230681..231436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0186"
FT                   /product="TetR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08868"
FT                   /db_xref="GOA:D2Q7P7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P7"
FT                   /protein_id="ADB08868.1"
FT                   /translation="MASTSRMTSFQRREQLIEIGRSLFASKGFEAVSVEEIAATAKVSK
FT                   PIVYEHFGGKEGLYAVVVDREMRALTDTLVNALSDQQAHPRQIVERAALALLTYVEENA
FT                   KGFRVLTRDSPKTDPAGSFSSLLGDISIRVEDLLTESFKRQHLPAKGVPYYAQMLIGMT
FT                   VYTCQYWADQRKLSKEQLAAHIVNLAWYGLSRMEAKPELRFEGDKAQREAEKRMEREER
FT                   KAVKGPKSENPLPQSSPMATSSPEETEAD"
FT   gene            231701..232897
FT                   /gene="ftsY"
FT                   /locus_tag="BDP_0187"
FT   CDS_pept        231701..232897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BDP_0187"
FT                   /product="FtsY signal recognition particle"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08869"
FT                   /db_xref="GOA:D2Q7P8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P8"
FT                   /protein_id="ADB08869.1"
FT                   /translation="MDTNVIIAIVAIVVIAALLLLGGWWFGKSRKKAVDKSVEDAKAKA
FT                   DKRLAQEVQKAETAQEAEEVQEVAAEVPPIASTEEAKAAPAVETPESTGSRIQRLKAKL
FT                   AKSGNPFGKVLFNILAKDHLSESDWEDVEDTLLLADVGAEASEQLVEELRNDARISGQS
FT                   DPSEVRKALKDKLLKLVGTDTDRRLNADKEGANKPSVIIMVGVNGTGKTTTAGKLARLF
FT                   VADGKQVMMGAADTFRAAAADQLETWGAKVGVPVVRSDKDGADPASVAFEASEQAKETH
FT                   ADVLIIDTAGRLQNKANLMDELGKIRRVTEKNLPVDEVLLVLDATTGQNGMAQAKVFAE
FT                   AIGITGVVLSKLDGSAKGGIVISVQKELGVPVKLVGLGEGPDDLAPFDPEGFVDGILA"
FT   gene            complement(233005..234162)
FT                   /locus_tag="BDP_0188"
FT   CDS_pept        complement(233005..234162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0188"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08870"
FT                   /db_xref="GOA:D2Q7P9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7P9"
FT                   /protein_id="ADB08870.1"
FT                   /translation="MATFIVSLCAMLALTTCSGLVCRKLQLPEVIGQILVGIVCGPALL
FT                   NVLHSSDYISLFSDLGIIILMFLGGVGCDLQLLKKYSKAAIIIACMGVVFPVVVMGGVS
FT                   LAFGFEPIPAAFIGVVFSATSVSISVAVLKEAGLLDSKEGVSILGAAVADDVIGVILLS
FT                   VMCTLVNTGSVNVADLGLIILKQAAFFVGAVVVIVWIAPALMTLAGVLKAPSGIAVMAV
FT                   IICLAMAWASDLAGLSYAVGAFFAGIAVSNSDYAEETDRYIEPVGDTLFVPVFFVGIGL
FT                   NTTAVDDSRMIVFIVIMTILGVITKIVGCGLGGAMAGFGAASSVMIGAGMVPRGEMALI
FT                   TAQIGFNEHVLGNEYYSTIIFIISLVTLVAPLLLKLTIKRIPAQA"
FT   gene            234618..235913
FT                   /gene="amtP"
FT                   /locus_tag="BDP_0189"
FT   CDS_pept        234618..235913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtP"
FT                   /locus_tag="BDP_0189"
FT                   /product="ammonium ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08871"
FT                   /db_xref="GOA:D2Q7Q0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q0"
FT                   /protein_id="ADB08871.1"
FT                   /translation="MGQLDSGNAAWILTSASLVFLMTPGVAFFYGGMVRAKAVLNMMIM
FT                   EVAALSVTMIMWVLWGWSIAYAGSSVGGIFGDPATGFLLKDTMVADDGVFGSAALNSNN
FT                   YPVSVDVAFQSAFAMITVALICGAIAERVKYSTWMIFVALWITFDYAPLAHMVWNGGLL
FT                   SADGAISQAIGAAAHDFAGGTVVHINAAVAALVIVLIIGKRKGFGTQPFRPHNVPFVML
FT                   GAFLLWFGWFGFNAGSAFAADGTAGYAWVSTSAATAAAMLTWGFTEKIRTGHYTAMGAA
FT                   SGIVAGLVAITPAADVVSPLWAIVLGGIAGVLTCLACGLKFKFGYDDSLDVVGVHGVGG
FT                   FTGTVLIGFFGEGTGLFAGGDWRQLVVQLLVAIVAIIWSAVITGIIAFALEKTIGWRVT
FT                   EAQEVGGIDLADQGERAYDFAGTASSVLKEVK"
FT   gene            235915..236253
FT                   /gene="glnB"
FT                   /locus_tag="BDP_0190"
FT   CDS_pept        235915..236253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="BDP_0190"
FT                   /product="nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08872"
FT                   /db_xref="GOA:D2Q7Q1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q1"
FT                   /protein_id="ADB08872.1"
FT                   /translation="MKLITAIIQPHKLDDVKEALAAAGVHGLTVSEANGYGRQRGHTEV
FT                   YRGAEYTVDLIPKIRIEVLADDADAETLVGVIVKSAGSGTIGDGKVWVAPLDSVTRVRT
FT                   GETGSAAI"
FT   gene            236437..238263
FT                   /gene="glnD"
FT                   /locus_tag="BDP_0191"
FT   CDS_pept        236437..238263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BDP_0191"
FT                   /product="protein PII uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08873"
FT                   /db_xref="GOA:D2Q7Q2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q2"
FT                   /protein_id="ADB08873.1"
FT                   /translation="MTSAVDGLKQRFMAMSQPDADGVYRDGAAKRKARTDLAMTCLKQL
FT                   WQEALDAVSFEVPATGIGLGAVGSLARGQVGPGSDLDLVVIYEPHALTDRQLNELANKL
FT                   WYPIWDSGLDLDQSVRTRTQCEAVTDHDLPAAMGWLDVVPIAGDTQLIETTATSILERW
FT                   RKAARKRLPELLGSATSRLNEFGRMAYINQPDIKEARGGLRDSVLVAALAASWLADRPH
FT                   GRYDDAVERLLDVRDCIHLVANKDTNILLSPYQAKVSAMLGLADPTLPDGEREAKSIDD
FT                   LQTLLARVGRQIAFSLDSTASRAEHSLTHEKPRFAFFQVFQPRGGGRRQAPTFDVIAPG
FT                   VAKHEEEIVLAPGADPKTDAKLALRVAVASAEFGLPIAPGTLQNLRNCPIRDRDWDEES
FT                   RKLFVRLLATGPELLNVWEEIDFVDIPGRWIPEWLGVRNRPSASAAHRYTIDRHMVEVT
FT                   TRLGRETPRGNRYDDRHYTALLLAGILHDIGKRPGVTNHASEGARHASTVLKRMGFDRD
FT                   IIWWVTLLVREHLTLSEFATGQNPNDPTVGDELASRIDHDPVLLDMLFDLTRADGSSLG
FT                   ATSGETISKQYGWSKWRESLVRNMYNATRYHM"
FT   gene            238743..240203
FT                   /locus_tag="BDP_0192"
FT   CDS_pept        238743..240203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0192"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08874"
FT                   /db_xref="GOA:D2Q7Q3"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q3"
FT                   /protein_id="ADB08874.1"
FT                   /translation="MRLVSMAEETTWNGAPAQGRRNGGFTPSGGNGFSGGNAVRDMIFD
FT                   RIPPHDDDAEMAVLGGMLMSKDAIGEVSQTIDVTDFYQPRNQTVYEAIISLFAASQPVD
FT                   AVLVANQLLKDGDLEKVGGSDYLHSLVASVPTAANATFYADIIHQRAILRNVIAAGTKI
FT                   AQLGYTAEGSQAEDVVNLAQAEVYEMSTGKVRQDYAAIGPVIGDTLDQIERLQNGEVSR
FT                   GVPTGFRDIDDVTQGLQPGQMIVVAGRPAMGKSTLGVDFARAASLHHGMPTVIFSLEMS
FT                   KTELAQRIIAAEANIPLAAMRRADDITPERWNMLNNLQDALQNAPLFIDDSPNMSLMEI
FT                   RAKCRRLKQTNDLKLVVIDYLQLMTSGKAVESRQQEVSDFSRALKLLAKELEVPVVALS
FT                   QLNRGPEMRNDKKPQLSDLRESGSIEQDADVVFLVHRPDFYDKEDRPGEADIIMAKHRN
FT                   GPTDTFHLAFLGAYSKFKDMPQDYQQEV"
FT   gene            240205..241779
FT                   /gene="murE"
FT                   /locus_tag="BDP_0193"
FT   CDS_pept        240205..241779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="BDP_0193"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthetase"
FT                   /EC_number="6.3.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08875"
FT                   /db_xref="GOA:D2Q7Q4"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q4"
FT                   /protein_id="ADB08875.1"
FT                   /translation="MAWNSFATPLIGKAVRAASRLAHGGGSAFPGKIVERIDPGFLART
FT                   LDRLPLGVVLVSGTNGKTTTTRMVASMLESLGLKVFTNPTGSNFTRGVVSSLLSEVSLS
FT                   GKLDADIAVLELDEAYAVHFVRQVQPDYCLLLNVMRDQLDRFGEIDNTARLLSKAAEAT
FT                   TGTVVLNREDPRIARLADVVHAEDGVEVRYFGLDASLRGFFPSDDDMQTTVDTESGESA
FT                   ANATHINPPQDVDKSVASSVESTEIADSAEPSADVTLLAVGDHRASFGIDGKTYETDVR
FT                   LEGVYNLYNAAAALAVVRAVAADANAMFLPFLGADANDSGDSAADFATQAVYSTGPIES
FT                   PEVDVPSAKTLRKLGISPRIVDFARSTTQAMIDAAAQVTPAFGRGEVIDVNGSPVELLL
FT                   VKNPMGFRLSLASFKPEGCDTMICINDEYADGRDMSWLWDVDFTSLRGTGVRMVSGVRA
FT                   WDMALRLEYDQVPVEAVSTELEESVTAFVNANPGTRKHIYCTYTAMLKVRAALGRIADV
FT                   SDAGVGK"
FT   gene            241798..242556
FT                   /locus_tag="BDP_0194"
FT   CDS_pept        241798..242556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0194"
FT                   /product="cobyric acid synthase, glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08876"
FT                   /db_xref="GOA:D2Q7Q5"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q5"
FT                   /protein_id="ADB08876.1"
FT                   /translation="MSQAIDIVSLYPKDMNIYGDSGNVLTIQRRLALYGYEPHVHAYNQ
FT                   GDEWPEHVDMILGGGGQDTGQKKIIGDFFMRADLLRSLAADGMPMLMICGLYQLFGEYF
FT                   ETVDGSRLDGIGVIGAYTVGREVRMIGNLTETSDDFGKIVGYENHSGQTFLREGVQPLG
FT                   HVEADGTGNNGEDHTEGARVNNVIGTYMHGSLLPKNPAIADFLIRTAVERRYGTFDPVA
FT                   VGQTSAQKAALNRINEVAQRARRVAMSRPR"
FT   gene            242826..243062
FT                   /locus_tag="BDP_0195"
FT   CDS_pept        242826..243062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08877"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q6"
FT                   /protein_id="ADB08877.1"
FT                   /translation="MADFDFGDGLRKVFLAGVGALATTVEKSQEIVDDLVKKGELTVEQ
FT                   GKALNAELKHKVQEAKEASEEAKPEAETETKAE"
FT   gene            243133..244965
FT                   /locus_tag="BDP_0196"
FT   CDS_pept        243133..244965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0196"
FT                   /product="ABC1 family protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08878"
FT                   /db_xref="GOA:D2Q7Q7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q7"
FT                   /protein_id="ADB08878.1"
FT                   /translation="MSVNAQSDRSDNARPESVEPVTLSDRVNAVINPAADPSPDAAATA
FT                   AAKSGVSQSTQWQTSIETIGLFGPRKDTFSTRYHLTRRGKLKRLKQIAQIANHFDVLHG
FT                   LTPVKMRLMLEALGPTFVKVGQILSMRSEILPQPFCDELAKLRADADPMPYSTVLQVLE
FT                   DEYGRPVDEIFDHIDATPLGSASLAQVHRAKLTSGEDVAIKVQRPGVRETMAQDVSIMR
FT                   SIAKVATRTMHSAQVVDLSGVVEELWDTFESETDFLVEARNLSEFNRFCERYKYMDCPK
FT                   PYIDLCTEHVVVMDYVEGISVSHPDQLLEAGYDLKEIGTKLVDNYATQVLDEGFFHADP
FT                   HPGNIMVSGGRIVLLDLGMTGRLNAKTRSVLKDMIFAVAEQDSPALADGLLRFAGAEAD
FT                   PEDYPALLADLDVIVKEFGTVDLVELDIAAMLTALTQMAQRHGIEVPSTVTTVGRALVT
FT                   LEGLLDEFIPDVNMIQIISDHIAASTSKKDFIKEETKSLAIEGHQALHSLLAAANELKV
FT                   ASRMLTRGQLRVNMEMVGSQEPIHLLANMVNRLTMALIVVGLFIGSSIVYYAGIKPVIF
FT                   GIPIVGFLGYVIAFILSVWIVFDIYFKGRNSKKR"
FT   gene            245113..246099
FT                   /locus_tag="BDP_0197"
FT   CDS_pept        245113..246099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0197"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08879"
FT                   /db_xref="GOA:D2Q7Q8"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q8"
FT                   /protein_id="ADB08879.1"
FT                   /translation="MAEAEPWRPLPFDEVIDISAGEARKRRLRRQLHAWYAFVITLVIA
FT                   AINIAGFPYVLQWRASLRTAQTADAAAQHVEGWPYPQAEEAFAAAKRYNRKIAASDQTV
FT                   LGEAEDPFTSTAGGSHASGKDSLAAKDSEYQSLLDSGDGVMGTIRVPKVSIKLPIYHGT
FT                   SDAALASGAGHLYGTSLPVGGKSSHAVITGHRGLVEAAMFTRLDEMREGDFFYIEVMGE
FT                   TLGYEVDRIDVIEPSETSRLRVVKGEDRVTLMTCTPYGVNTHRLLVSGHRVKIPVPAPD
FT                   PNAMHDPMRMGLYAVLGVLVPGWLFFLILGRRRNPRPRIMRHAVVHL"
FT   gene            246284..249970
FT                   /locus_tag="BDP_0198"
FT   CDS_pept        246284..249970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0198"
FT                   /product="Cna protein B-type domain protein,
FT                   collagen-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08880"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Q9"
FT                   /protein_id="ADB08880.1"
FT                   /translation="MGGFSCLPGGANKGALSNVPQPVAAVVAVVMLLVTVIVAPSAQAD
FT                   ETSSVPFSDHVVSNTVSPSGTTINLFDYWVQPYGCADIDDSYCNGQAFNHSDTGINAGK
FT                   QLRFTYNGESQNTINKWTGSASPRKGMVKSLLQDGYPVIAADQLYSWDGKITDGTQSLA
FT                   YLFDTENTESDSRKVYPNVTGLLQLQNGYYVYDSTKNFATLNDKSTSGKSSYSMTLYDT
FT                   PGVRAEWGSSVGEFFPFNSAEDVFEDSNGSLSNKVSSRNSVLNHYFGVHSQSEFMQPVN
FT                   GIINDEAMTFDFQGDDDVWVFIDGVLVGDVGGIHNSAALHIDFQTGSVKVTDASGNSTY
FT                   TNTTIREMFANAYGGEDSDEFQSVEWSQTNTSTFADSTYHTLDFFYLERGNNESNLKLK
FT                   YNLADIPENNLVKLDQQGNRVAGANFELYKAGSDYSYTAADLISKGTTDKDGVYTFTNH
FT                   ETGKPVNFADLARNGRGITHYVLKETKAPPGYRKSSDIHLRYQISPAGDGVLLCNDESG
FT                   KWDSGAWSVAHETMTVADGATVYDMNGTSHDVTQGKVFAVIMHRDKTAAGTLESDAWRA
FT                   VSGSALEGWNLSSDAVNGMADVVQLAKSDGAGSTNYLHFFGLDSEGKYSASISSLPGDI
FT                   FTYYFMRSDAEKADSLYAMGVYYTTADSTEGINASNTVRLDTTETGAYGRQFLRNFGVQ
FT                   IAITDVRNDPIVQKVDDAGNPVEGAEFSLYAADQVNADGTSLLEGATALQTCVTANTSY
FT                   PYEMKGSCMFGMAGSSSEGVQGSGVDLDNGTYYVKETKAPEGYEINDTLVKLLITDNGI
FT                   FADAGTEDNGVSTMTHIGTLNEALKQFAANRDINRTLSDLKVTQLRCADEECVTNGSWS
FT                   ETIGSEHGKSVDVSWTGDYKNGYYTLTDQSTMTDNGFVNTTGWTYYKVSQAEDKDDGSQ
FT                   GKGVRFSLKNSNLAHIFTGANVIRVQDKRKASLTLTKKVTVGDGYDKPDDFDTQRFSFD
FT                   VTLSADDAATLQQDGTTDYYHGTISGGTGDGKKDDRQIVMKLHRDSESATSGKLLQCVA
FT                   DGDTDAEKCAETASITLSNKQTLSIANISDGVTYTIKETGLPNGYVFESAQSSNLTGTI
FT                   QRSSGIAAAVVGNVYQPNSITLVAGRFVTVVKKVVGSATGSYPFEFQLQAAQGTPLPTC
FT                   GTADTCSVSDVDANGNHVMKKTLTYQTSGEQSQSMTFGDITFTKPGTYTYSLSEITPSS
FT                   GAL"
FT   gene            249998..252349
FT                   /locus_tag="BDP_0199"
FT   CDS_pept        249998..252349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0199"
FT                   /product="GLXTG motif protein"
FT                   /EC_number="3.2.1.91"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08881"
FT                   /db_xref="GOA:D2Q7R0"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR038174"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R0"
FT                   /protein_id="ADB08881.1"
FT                   /translation="MVTVTVAVEDGNLVVAGVKTVRTYDDSGAAVTGTDATATENQAVF
FT                   TNNYSKGPRAVTFSATKNYTENGYPYQAGMFSTKLTAIGSYATASEAKTTVAELPNNAD
FT                   SVPMPTGSSTGSMDADFDDFHTASFPRISFDGGTGNNTYVYKITENSGTVADATAMTYD
FT                   STEYYVFVAITVTDDMVNADISYYKNEAGTLTKVEIPADGSNPVRFTNTYAASAVSATP
FT                   QGSKTLTGRARTAGDSFSFALTAADEATQEAVTNGTVSGAACADDCTVESILASATSTN
FT                   VTAESGEAQSFEFTQLTFGKAGTYTFNVAEQSGNAGGITYDTHISTVTYVISDTDANGK
FT                   HTGRLNVAKVSYSNATATTEADRKVTDAAAFTNAYHAIATFAGLTVTKELHNRNAGTTR
FT                   NLYAGEFTFTISGDDEASAQRISAGTFASDRKFSNGYAAGREAQSATKYGNAVSGMTKL
FT                   SNLVFNESDVGKTYRFVVKELAQHTNPNTGAVNTKLDSDSTKLTGETATDVKIDGIWFR
FT                   QWTYLVSVTVSDNGDGTLNVSTSKSVVKGDGSTSTADDITFVNTYETLKSTEIDDTSAS
FT                   APLYKQLSGRDWADSEKDRFTFTVEKCNYSTNAGSFSDASSIVCTSDGTTLSTLPSPSR
FT                   NSSVTIGKDQVVPTKAGNFAKIGFGSFSFSKPGAYVYKVTEVAGDDTTLTYAANVRYLR
FT                   FRVEENQMKGVYSVIVTTPGYDAPTATDANDGAAFVNVCKSAERLPLTGGLTTRNFLVG
FT                   GFVVGLLAVFAGLGIHEWWNKQRRKEQLLE"
FT   gene            252504..254252
FT                   /locus_tag="BDP_0200"
FT   CDS_pept        252504..254252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0200"
FT                   /product="FimA fimbrial subunit-like cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08882"
FT                   /db_xref="GOA:D2Q7R1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R1"
FT                   /protein_id="ADB08882.1"
FT                   /translation="MKMRKLFAAVAAAATLIGGMVLSASSAQADGVAAGTTITVNNPQV
FT                   GHTYTAYKFANFTSVTAGEGANGSKIAHVEITTESAWVNVVTAAAEAATGASIPAEYTQ
FT                   NPAAYVAMFDAATLREFADALTIPTGTSAAGTPLSGTTEGAASGTISGLTASSWYLVKD
FT                   TVKSNNNDVQGGPEAIVATQIIDGNGVTYGEFVNGLKADAKQNAITAMGEFNAKATVPS
FT                   APVETVTSLTDCAANNNTNTKCTVRVGQTLSYNVTAKVPTDYASYDAYTFTFTDTPGTG
FT                   LTVSSANIKVNGTKVSAVSGITITGFTNGDLVGNGSAAFTVILSKTALDTVLNGKTATN
FT                   NYYDIELTYDAVVNGSAENTVTNTTTVTDPSGTSEPGKVEKNVGQFSIKKVGKDDNGGW
FT                   TTALAGAEFSIIPADDDTARRYDANATAETATALKFTEITGGNKGSYTLNADQSATSGV
FT                   TSALATSSDSNNKGQLKLNGLAQGTYTVKETKAPAGYSSQFLPTFTVTVNADGTVTFSD
FT                   LGNLDLVAGDATAKTATVRNVKSLTQLPLTGGAGIILFSVIAALLIAVAAIATVRIRAV
FT                   KRELQA"
FT   gene            254611..255675
FT                   /locus_tag="BDP_0201"
FT   CDS_pept        254611..255675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0201"
FT                   /product="phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08883"
FT                   /db_xref="GOA:D2Q7R2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R2"
FT                   /protein_id="ADB08883.1"
FT                   /translation="MSSSFFKKALIGGAVAAGAAVWAIAPRTFSDKRRNYVPAIPDVWY
FT                   AHRGLHDAGSGLTAQYAAESGEYVALARRMAMKAGYGNPSVLGAIAPENSLAAFAAACE
FT                   AGYGIELDLQMTADGEVVVVHDDDLMRVAGDPRRIKDLTYDELTRIPLFPTDAPGASKA
FT                   APLPGSLEKPPLVTTPDHAPEGYYQHVPLFADVLKVVAGRVPLIVEYKFEDNSKWDPRD
FT                   VELMEKGDALLQAYSGAYVVESFNPAAVNWYKENRPEVCRGQLSWWPEGKDAPTDPVAL
FT                   AKEYAAGALVFDWISRPDFVAYDWKGGNSPQVRLARFMGAVPVSWTVRSRDELAQCDDW
FT                   FDHHIFEAFVPDER"
FT   gene            complement(255720..256361)
FT                   /locus_tag="BDP_0202"
FT   CDS_pept        complement(255720..256361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0202"
FT                   /product="Uracil phophoribosyl transferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08884"
FT                   /db_xref="GOA:D2Q7R3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R3"
FT                   /protein_id="ADB08884.1"
FT                   /translation="MDIHVLNHPLVDHKLTVLRDKNTASSTFRELVSELVMLEAYEATR
FT                   DVEVVDKPIETPVSPMIGKHIASPAPLIVPVLRAGLGMLDGMTKMIPSAEVGFLGMKRD
FT                   EENPTQQITYANRLPEDLTGRQCFLIDPMLATGGTLVAATHYLAERGAKDITAVCILGA
FT                   PEGLKFVEEHLDPSIKFKLVLCAVDEKLNDKCYIVPGLGDAGDRLYGVID"
FT   gene            complement(256609..257337)
FT                   /locus_tag="BDP_0203"
FT   CDS_pept        complement(256609..257337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08885"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R4"
FT                   /protein_id="ADB08885.1"
FT                   /translation="MSTNMHYGSGSVIPSRTAGFTNTGSPRPSRPGQLDQMMADNIAGG
FT                   ADPAQINEMSHASAAALLDRVHHTQDAALVERVLTLVDREGVDVIAELWSHAEPDSLPG
FT                   ILWRLYLLRTWMRKNRESIARLWRVGEPVATTASAIAGVDQAPTEEDIAHTADSILAGA
FT                   FTGDFAVALERAAAFTDVVALGLRIEAKKLTSRGAQSAGDAEKTARAKASRLLHTAGNL
FT                   FATAKDFRHGASLWRRGRLE"
FT   gene            complement(257327..258403)
FT                   /locus_tag="BDP_0204"
FT   CDS_pept        complement(257327..258403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0204"
FT                   /product="Phosphohydrolase (MutT/NUDIX family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08886"
FT                   /db_xref="GOA:D2Q7R5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R5"
FT                   /protein_id="ADB08886.1"
FT                   /translation="MRRIVEAAGGIVYRWKVGGQIADNPQIATRKTAKELLDDIEVCIV
FT                   HRPKYDDWSWPKGKLEQGESHRHAAVREIGEETGVSIALGPYLGEVEYPLSEEGKKTRH
FT                   SHDRTVDTKHTLYWMARPITGEDAEHLIDAFGPVHRADVGEINDIVWVSVREARKILTH
FT                   STDKDILAAFVDRVQEGAATAQNLLIVRHAKAESRKSWKGTDANRPITPKGAAAAFALN
FT                   RELACYNPTRLATSPWMRCQETLQVLSWQTDRPMEHIDALTEDAFADHPTMAWLAFLDQ
FT                   IRQTLNTRQTTAICMHRPVIGGMFDHLRGMCSRKQLAKQLIAKSPYMPTGTAIAMFIID
FT                   TPQGPNIIDIQKVTPLVY"
FT   gene            complement(258506..260740)
FT                   /gene="ppk"
FT                   /locus_tag="BDP_0205"
FT   CDS_pept        complement(258506..260740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="BDP_0205"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08887"
FT                   /db_xref="GOA:D2Q7R6"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R6"
FT                   /protein_id="ADB08887.1"
FT                   /translation="MAQIFDAPSKAILRSQIAEHIAETDKNDRRELQAGEEPLPNDRFF
FT                   DRELSWLKFNKRVLELAQDEDLPIIERASFAAIFANNLDEFFMVRVAGLKRRIDTGIAV
FT                   TAASGLSPRQQLRAISEQAHRLQDEHAHYMIDHILPDLAKEKIVLLSWDKLTAAEQERL
FT                   SRYYRQQVFPVLTPLAVDPAHPFPYISGGSINLAVLVENPASGKSHFARVKIPGNLNRL
FT                   VPVDDLTDDETTDVRYGFITMENLIIAHLESLFPGMIIKEARSFRVTRNEDIDVEEDDA
FT                   ENLLNAMEKELLRRRFGPPIRLEISDETSPFLSQLLADQLRVSADEVYRLPAPLDATVL
FT                   FELGGIDRPDLKYRSFVPTTNRQIAEVESSRAQDIFAAIRERDILLHHPYDSFSTSVQA
FT                   FLAQAAADPKVLAIKQTLYRTSSNSPIIDALIDAAHAGKQVLALVEIKARFDEDANIAW
FT                   ARKLERAGVHVVYGIVGLKTHCKLSLVVRQEADGLRRYCHVGTGNYNPKTARIYTDLGL
FT                   LTCDPVVGQDMTRLFNQLSGYAPKSSFHRLLVAPRTVRSGLIQRIRREEDAARAGKEAW
FT                   IKIKVNSIVDEKTIDALYRASQAGVKIDIVERGICALKPGVPGLSENIRVRSILGRFLE
FT                   HSRIYAFANSDGPQIGEGPAAGPEVWIGSADLMHRNLDRRVEALVRITAPEQIDELIKY
FT                   VDLQMADSTASWHMEADGTYVRHSKDAEGRPLVDCQEYLIKRHTRRPATH"
FT   gene            261370..261996
FT                   /locus_tag="BDP_0207"
FT   CDS_pept        261370..261996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0207"
FT                   /product="TetR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08888"
FT                   /db_xref="GOA:D2Q7R7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R7"
FT                   /protein_id="ADB08888.1"
FT                   /translation="MVAARSEKEPEESLAHPRLGPAQRREQIIDAASQLISRNGFWGFS
FT                   VRQVAAQCDLTEPAVIYHFKNKVGLLIAVLERRDREDMAQYSHSLGVEPEQIWNGDVRF
FT                   GIRDICDVLMARNAKQPEIVRLYTILQGESLSDHHPAYEYYQKRERRVIAMLTRAAEHD
FT                   GLEHPQQEAHLALAMMDGVQLRWLRNPEDVDLMTLWRAYADARWW"
FT   gene            262178..264340
FT                   /locus_tag="BDP_0208"
FT   CDS_pept        262178..264340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0208"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08889"
FT                   /db_xref="GOA:D2Q7R8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R8"
FT                   /protein_id="ADB08889.1"
FT                   /translation="MTAFDQAVETIRRGSDSATLAAQLYGELTDDERMNLLDGDIYYWQ
FT                   GRLDIVRHGYNIAPYVMGAVNRLGIPGIRFVDGPRGCVSGHGTAFPVSMARGATWNEAL
FT                   EERVGEAIGEEVREQGGNLFGGVCINLPRHPAWGRIQETYSDQPVLLGSLGAALTRGVR
FT                   RHAMACVKHFACNSMENARFKVDVKVDEATFHEVYGPHFKTVIDAGADAVMTAYNSVNG
FT                   EYCGQNAWLIRQTLRKDWGFTGIVASDFVWGLRDVTKSVKAGLNTEEPFHQQRYTKLRA
FT                   ALGRGDVTWDDIRELGERILDTQLRFYAQRDMREPAGTMAGAEHAALAREVAEQSMVLL
FT                   KNDARALPLDPAAVSRITVAGRLTDAANTGDQGSSNVRAPYTVTPLEGLRTAFGDDAVD
FT                   YAEGCDPAEAARRARHADAAIVVVGYTANDEGEYLKSVVSPDMLPLLPEPVTAEQCAAK
FT                   QACQAYMKEGVSTFGGNAEGGDRASLHLNPEDVELIHAVAEANPRTIVVVVAAGAVLMD
FT                   EWVDEPAAVMMGWYSGMEGGHALADIITGKVDPSGRLPYAIARSEHDLPPFDREATSVR
FT                   YTRWYGQRLIQHRGSQALFPLGYGLSYQSYGIGEPAIADSDRERQTAILHVPVTNEGGH
FT                   AGRHVVQVYGSLQEGERAGERELLGFASASIPARQTVDVAISLDFSALGRWNAQERKVA
FT                   LETGKIRIEASSFWGDPDASTMEVEL"
FT   gene            264337..265599
FT                   /locus_tag="BDP_0209"
FT   CDS_pept        264337..265599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0209"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08890"
FT                   /db_xref="GOA:D2Q7R9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7R9"
FT                   /protein_id="ADB08890.1"
FT                   /translation="MNTAQPTVWTGTVSDEQQAKVPWVVGVALVLGVFLWMGPYMGVNV
FT                   VLLPAKTALLAGDGKASVVAVLSTSAMIVAAIANIIFGALSDLTRSRFGRRSPWIIGGS
FT                   VLAAAAMMFVSWAPTVPLLIVGWCVYQCFLNAIVAPLIAVITDRTAPKFRGTISAMYAL
FT                   GYSVGIYGGQMIGARFLTDQSMGFTVLAVLTLIGGPLAALIMREGSSLAMPRKRFTAQM
FT                   FWEHFSFPTRHCRDYYLALFGKFLIVAAKFAISGFQLYILTDYMMQSADGAKHYVSVIS
FT                   MCMMVTAIAMTVIAGPISDRIGSRKIPVIACSLLVAVGSIIPFFSNDPKMMIAYALVAG
FT                   TGMGAYNAVDQALNVEVLPSKDTAAKDLGILNLANTGGQVLGPVLAATLINMFGYHALF
FT                   PLAAVCSLLGALLIVFIKSVK"
FT   gene            265879..266835
FT                   /locus_tag="BDP_0210"
FT   CDS_pept        265879..266835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0210"
FT                   /product="ATPase for chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S0"
FT                   /protein_id="ADB08891.1"
FT                   /translation="MPPQAATSRQPISPQRFYTPPGVVGDGNDDTVPPWSEADSSQPMS
FT                   VHGTVARLHAAHPVAEHADMDGVVVLSSAVAGVGVSTLAAMLARTLTQRGVKCVLVDAD
FT                   LQGGGLDVLLGIENEDGSRFGDINAPLGNVDGKALLRELPVWDGVPVLSCDPWKIENPQ
FT                   WWEIQACIRALAQTRRTVIVDMANHVGLDSLKDCAGALHIVAVEMTVLGLARAKTWLKS
FT                   LVTVDGNGGSSPILVGIEPRGTIRNRGTTGVAEACEYLECEIGIVIRSDGKLCSALLEG
FT                   LGLRKPNTTMRKALERLADRVQERRGGKRADHGTRPS"
FT   gene            266816..267805
FT                   /locus_tag="BDP_0211"
FT   CDS_pept        266816..267805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0211"
FT                   /product="pilus assembly protein, type II/IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08892"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S1"
FT                   /protein_id="ADB08892.1"
FT                   /translation="MELGPLSEVAREPGVTDIAVTCDGSVWVDGGDGMRLRRLRVPFDS
FT                   AQSIRNFAVRLCSQLGRRLDDACPIADASTVDGVRVHAVIAPLVPQGAAISIRLPDATA
FT                   PRLESLAHHGMFPVAWLPLLRGLVRRKATMLVTGGTGAGKTTMLKALLMQCPPTERIIT
FT                   VEEVRELGMFHHANHVSLVTREANVEGVGAIDLSQLIAATLRMRPDRVVVGECRGAEIA
FT                   DLLRALNSGHRGGMTTLHANSVEAVPSRLVALGLLAGLDPRATAALAENAFDVVLHVER
FT                   TQGYRRISQIGQLTVRDGRLQGSPLAFWNGGQVRTNERWVDFMRRWGV"
FT   gene            267802..268614
FT                   /locus_tag="BDP_0212"
FT   CDS_pept        267802..268614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0212"
FT                   /product="hypothetical membrane-spanning protein, pilus
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08893"
FT                   /db_xref="GOA:D2Q7S2"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S2"
FT                   /protein_id="ADB08893.1"
FT                   /translation="MRACRYEAGRWRDSETHKESVMKWLAWCAAVMATLAVWLWLRRHE
FT                   PFGQSRLSDLHGCVDGGAGPKDQTPAGQRPQADGREGSVVGEPTGNAVASAPLPHMASV
FT                   ACVAALQASVRSGATLVQAFEELGGYAFATPELTRSRIEMVLRCRCPPEEQGGQMRRLS
FT                   AELYAACQLSMALGCETSRCLAAVLASLKRQRLLEDLHRNAFAMPQATVKLLMALPLLT
FT                   VLLGEGMGARPLAFLCGDARGLLCLGFALGCYAIGLLWIRVLLRENHP"
FT   gene            268661..269176
FT                   /locus_tag="BDP_0213"
FT   CDS_pept        268661..269176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0213"
FT                   /product="type II secretion system protein, pilus assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08894"
FT                   /db_xref="GOA:D2Q7S3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S3"
FT                   /protein_id="ADB08894.1"
FT                   /translation="MLESWAIASACCTSGAVWLWYWSPTRVLPGEEAAHELPMPLVLEM
FT                   LAVAIRRGASIPHALIVVGRIVGGDFGEGLSSVGGALNQGVDWDQAWPSGDDIALVRDV
FT                   FAASWSSGASPLNRLDAAIEQLDWDERSQIERDAAKLSIRLLLPTGLCFLPAFIAIGVI
FT                   PAIASFLG"
FT   gene            269328..269615
FT                   /locus_tag="BDP_0214"
FT   CDS_pept        269328..269615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08895"
FT                   /db_xref="GOA:D2Q7S4"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S4"
FT                   /protein_id="ADB08895.1"
FT                   /translation="MNAEMSINVDGRPDVLGRVGRRMFALREQADRMVCLLDARIRTLT
FT                   SEPEEGAATAEYAVVLVAATGFAAVLVGIMKSDAVKTMLTNIIKKALSVG"
FT   gene            269622..269981
FT                   /locus_tag="BDP_0215"
FT   CDS_pept        269622..269981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0215"
FT                   /product="conserved hypothetical protein, TadE-like family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08896"
FT                   /db_xref="GOA:D2Q7S5"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S5"
FT                   /protein_id="ADB08896.1"
FT                   /translation="MLTSWWKRHADEGSATAEFAVVLPSVAAVAMLMLCLGRAVVVSMD
FT                   CQDAVAVAAHAMTIAGRDGESRARSAALAAAGNDARVSFSRNADSVTITVQCPVIPDPV
FT                   GVLPTRVTAKATRYL"
FT   gene            270074..270430
FT                   /locus_tag="BDP_0216"
FT   CDS_pept        270074..270430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08897"
FT                   /db_xref="GOA:D2Q7S6"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S6"
FT                   /protein_id="ADB08897.1"
FT                   /translation="MRLFAKADEGSGTVSGIALIAATAVMLGVVAAAGNLLICLHRAQH
FT                   VADLAAVASATALHEGSAVPCEVASRTTRGNGAELQSCEIIGEDARITVAVGTNVPFAS
FT                   QVIKSSRAGPVACE"
FT   gene            270541..271764
FT                   /locus_tag="BDP_0217"
FT   CDS_pept        270541..271764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0217"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08898"
FT                   /db_xref="GOA:D2Q7S7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S7"
FT                   /protein_id="ADB08898.1"
FT                   /translation="MNESSHSNMTVAVVGNPTSNKGRGAKTGEQVIGLLQSAGDRHGFE
FT                   VIDVTGTSFEDSLVKAKSRRDEYDYLVVVGGDGMIALGTNAVGCSGKPLGIVATGSGND
FT                   FARGLELPVNRVETAVDGIVGAMMRGSHIDVDMGLVTSLPGGYAVDSSTGDELPRVQEA
FT                   AVTAHTVRGLLAVDPLQSNMGLDFTDEYLGEPNSLDINRYYAGMLSCGLDASINDRANH
FT                   SHLPNGTLRYFAAVLVELTHMKRYGYHIKATLADGSVDERDIISPLLTVANSRHIGGGI
FT                   EVSPYSRFSDGLLDLIWMDHVPNFVECAEAISHAYNGRLLASKVFGWQRIREIEISRAD
FT                   DGDEPPVFMADGEYIGHLPVKVTAQSRALRVLVPPAVAEAQARDGEEQTLEAIARDHRD
FT                   PLTGNFLD"
FT   gene            271879..272595
FT                   /locus_tag="BDP_0218"
FT   CDS_pept        271879..272595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0218"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08899"
FT                   /db_xref="GOA:D2Q7S8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S8"
FT                   /protein_id="ADB08899.1"
FT                   /translation="MFTVAVVEDEADAARRLEACLARYSRDHPGVRFDVTVFSEPTRLL
FT                   EGYRPVWDVVFMDIEMPNMDGMAAARRLRALDGQVALVFVTNMAQFAAKGYEVDALDYV
FT                   IKPFSYNDFERKLRRAVAIRGEESASVMIMQRAGTQRVLLRDIEYIEVKNHNLLYHTER
FT                   GILTGTGTLQDVEDKLGDRGFLRCSKAFVVNGRHVVAVKGNELTLSGGENVTIGRTYRK
FT                   AFMVALAASMGDGNVM"
FT   gene            272639..273937
FT                   /locus_tag="BDP_0219"
FT   CDS_pept        272639..273937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0219"
FT                   /product="two-component histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08900"
FT                   /db_xref="GOA:D2Q7S9"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7S9"
FT                   /protein_id="ADB08900.1"
FT                   /translation="MVQAIDVILAFFTDNGMVVELMVSTLLFTWWLERRDMFWWRALTG
FT                   AAVMLVESMLWHGYVPENLWTVTVQNIIVFALLIAWIGECWKVNIRQALFYFVMSGAMQ
FT                   HLVYRGARLLSVGLHRCWPDGAWIDTYAYSFVQIPLYCLAYAVFARPMAKKDISMVGGR
FT                   SVFAMMVGMMLCVSVFTNMFNFLALPASGAAAFTVFSLFDFVTCVFMLELAIELVSKQR
FT                   AHAEGEVLRHLLRQQKQQMESTKETIDLINVKTHDLKKQIVQLGPAISQEQAGELQQLV
FT                   EIYDSSVRTGNETLDVLLASKSLLCEQRGISFDRMIDGGLLDFMKPSDIYSLVGNALDN
FT                   AMEAVSALPDDAEKYIAVRICESKGMAMIRVENPFAGELAFSDGLPVTTKGDTQYHGFG
FT                   TRSIRMIARQYHGYMSISARDGIFRLTVILPLQ"
FT   gene            274101..277238
FT                   /locus_tag="BDP_0220"
FT   CDS_pept        274101..277238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0220"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08901"
FT                   /db_xref="GOA:D2Q7T0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T0"
FT                   /protein_id="ADB08901.1"
FT                   /translation="MHERTGLWRGITAVGALLLAVAIMAGTIMETYRTSLDAFVGTRSQ
FT                   RTVTDQSADNGDSWTYKSEYKTAKEAYEGFKKTAMDEAQETYVLLKNSDNALPLSKSAK
FT                   ITMFGVRSYAPVYGSSGGSVTDGNSTVEITKAFEEEGFQINPSMLKAYQNYFKDKKWTT
FT                   PQFGGGILPEYEDITKYNDPCELSLDELAKLNPEYKSQYGEYQDAAIVVVGRPAGENGD
FT                   GYYPGQDGLADGVNTVTGNILSLSDEEMALVNEAKANFSKVIVLVNSTNPMEIANLQDD
FT                   PDIDAIMWIGYPGAYGFYGVADVLNGTVSPSAHLGDVMAKNSAVAPAMSNYGNVAWKNA
FT                   SDFSEDAAVNSYLMEAEGIYTGYRYYETRYADIVMGNGGDTASAGTYAASDGTVATADG
FT                   TWDYANEVVYPFGYGLSYTTFEQKLDGVEIKGDKKTAVATVTVKNTGSVEGKSVIQLYA
FT                   SVPYTDYDKKNGVGKSAIQLMDFEKTNALKPGDSQTITMTVDLSNLASYDSNKAKTYIV
FT                   DPGDYYFSIGDDVHDALNNVLAAQGYSESDGMTAAGDKTKTYTWSWDGGVDADTFATSS
FT                   TGTKITNQLSDGKYATDYNAFDKGAVTYLTRSDWNGTFPKTYSGISANEEVSKLLNNDF
FT                   IDLKSDGDVSDITIGDTSSSLTLNDMKGASYDDERWDELTSKVSVKEFMHFAETAFHAI
FT                   GAIDSVGLQEMTTDDGPGGSDSHYLNEGQYQGKAYADADDYADKSSRVAPSPTNLAYSW
FT                   NKELAYRNGEVILGESSLVFRLPIMIAPAMNLHRHAYNSRGVEYYSEDPILSGYIGSAV
FT                   VQGAQSKGVLVNVKHLAFNDQEINRSGIATFMSEQKAREMELRNFQQAFEANGKPASFE
FT                   SDDAKKNTYTQGALGVMTSYNRIGAVASSANAAVMVNILRDEWGFTGYNVTDFTSVSPH
FT                   AAPKESVLAGTSAFCGFGNQGVKYWDAATLSKDRDMLLAIKQNMHYSLWAIANSNAMNG
FT                   VNSSTHTENVMTWWRAVYLGVIAASGVVTLIGLAGYTTTRIRPARNADNGPTAASK"
FT   gene            277250..277708
FT                   /locus_tag="BDP_0221"
FT   CDS_pept        277250..277708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08902"
FT                   /db_xref="GOA:D2Q7T1"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T1"
FT                   /protein_id="ADB08902.1"
FT                   /translation="MATTIKTHVSELAAAAATLIGLMVYLVNSTTGYMAGQGLSALVIA
FT                   LSVVAIVALAARAFAGNRLPAVLNDVLLIGAEVLLLVSFAQFVLERVRLAADIYFIPVN
FT                   YPASEQTSLNVALIGVACYLVAILLLVVKAFTAKDAQHTAVMLEPAAE"
FT   gene            277850..280360
FT                   /locus_tag="BDP_0222"
FT   CDS_pept        277850..280360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0222"
FT                   /product="glycoside hydrolase family 2"
FT                   /EC_number="3.2.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08903"
FT                   /db_xref="GOA:D2Q7T2"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T2"
FT                   /protein_id="ADB08903.1"
FT                   /translation="MQAADFNAGWAYRHLDADEDWTAVTIPHDAMLYEPRHALAASGLN
FT                   SGWFEGRDYEYVKHFMPERDMAGSRMLLEFEGVYHHAEVWVNGEKAAFRPYGYTNFYVD
FT                   LTGRVRFGEDNEIRVIARNADQPNSRWYSGAGIYRPVTLWTSPAEHIAVDGLFVRTIAA
FT                   DPANGTARIRVEVETTAEGSVHIEIADMAGGIAASVTQPCEAGVNRYELGIADAKPWSV
FT                   NRPELYVCTARYTTQHGDSDEAATTFGIRTLEWGSGGLLINGERVIIQGACIHHDNGVL
FT                   GACAYADAEERKIRLMKANGYNAIRSAHNPCSKALLEACDRLGVLVMDEYIDHWYIHKT
FT                   QHDYVDYFDEWWRRDLADMVMKDRNHPSVILYSTGNEVSETAQKRGIALTRAMTEYLHA
FT                   LDDSRPVTCGVNIFFNFLSSIGFGQYSDKKAAKEAEAAEKRRAAGQAADKHKAVGSEFF
FT                   NNMAGVLGADFMKTGAALPFCDWVTRDAFAAMDVAGYNYGIKRYVHDLKKYPDRLILGS
FT                   ETFCNDAYRFRELAKREPRLIGDFVWAGMDYIGETGVGAWEYEDYATLNIEYGWLTAGS
FT                   GRVDLTGRALGEAYYTRVALEEASGPWLAVCPVNHTGDKHSPSAWKMSNAIDSWSWNGC
FT                   EGRKANVEVYARAASVSLVLNGREIGRKAMRNDCIACFSCTYEPGTLEAVAYDESGREI
FT                   GRNQLVSASAETRLNASVEYTGRELAYVRVRYTDGHGVTKPLERGTLRATLIGPDGKGG
FT                   GAGGDADEAVGGAKLLGFGCAAPCNKGSFVTGETGTYYGEALAVVRMPQSQEGTAVLHI
FT                   SDGRLSAQVSVEPIGIVNRADSTR"
FT   gene            280366..280959
FT                   /locus_tag="BDP_0223"
FT   CDS_pept        280366..280959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0223"
FT                   /product="hypothetical membrane-spannning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08904"
FT                   /db_xref="GOA:D2Q7T3"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T3"
FT                   /protein_id="ADB08904.1"
FT                   /translation="MMPERTEIISGHGGGPIAVWWRRFAAKHRLIAQFVMFYAFSLFVT
FT                   ILQYVMLTFLPNLFYANTNWCDIPCQLIHLTLGPVDTYVFDYPVTGDATGGMGYFAAFA
FT                   ITLFMAQCVNFPMQRNITFKSHGNVWFQIAWYVVAFVLITIVCSFLMGLYVPLCKRFFA
FT                   PAVYNILITVINGGVQMVIYFPIYKIIFPEGEAK"
FT   gene            complement(281123..282109)
FT                   /locus_tag="BDP_0224"
FT   CDS_pept        complement(281123..282109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0224"
FT                   /product="hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08905"
FT                   /db_xref="GOA:D2Q7T4"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T4"
FT                   /protein_id="ADB08905.1"
FT                   /translation="MLFQVYGDTAVYQWIGWILVFCCLIGANELARRTKTGGIVAFLVV
FT                   PAILTVYFITIYVAAAAGAEWALTNPTYVHMTSWFHYAKLYAATAGCIGFMALKYKWGA
FT                   IGKSEWFKCFPFVIVAINILIAVVSDFESAIRAWGTTWVSTEGVTLMGGWHNVFNGVAG
FT                   LINIACMTGWFGIYVSKRKQDMLWPDMTWVFIVAYDLWNFCYTYNCLPTHSWYCGLALL
FT                   LAPTVANFFWNKGGWIQNRANTLAIWCMFAQVFPAFQDESKFAVQSVNNPNVNLTVSII
FT                   ALVANVLAFGYIMYRARKQHVNPWLQEVFTGTKDFEQAMARREDLAA"
FT   gene            complement(282148..282747)
FT                   /locus_tag="BDP_0225"
FT   CDS_pept        complement(282148..282747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0225"
FT                   /product="TetR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08906"
FT                   /db_xref="GOA:D2Q7T5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T5"
FT                   /protein_id="ADB08906.1"
FT                   /translation="MNGRNQISVATAGDARRAQIVHAAREICLEKGFSKITVSDIAGRV
FT                   GMTRSLFYHYFQDKDQVADAVLDDVIDEVITVLEEWNRNREVGNISKALDDVVRLTRGL
FT                   INDEGPFSQRMIADGNAELYIKFIDRAADRIAEYICASTVRDFERLHGMPIRNVHETFY
FT                   TLIVGLISLIRLHPDTDDTVVRQVAAQTLHLDPYIE"
FT   gene            complement(282950..283828)
FT                   /locus_tag="BDP_0226"
FT   CDS_pept        complement(282950..283828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0226"
FT                   /product="AraC-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08907"
FT                   /db_xref="GOA:D2Q7T6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T6"
FT                   /protein_id="ADB08907.1"
FT                   /translation="MEHAQVYTLPSFCPFTSGHTDPPSSANGVSFAFCGISRTEPGHDV
FT                   GPALRDHTIIHLVLSGSGELHSQGAVFRLKAHDGFIIRPDSPVTYQACATDPWTYLWLG
FT                   LGGNGAQRCLAGIGLAHDRNAFHVGDTSAFLALIQSCFDYTSGSFADEIKLNAITLEFL
FT                   HRLALAMATAGGATTQSRPDDAGAGGALATAAAQYVAEHYAESINVGRVAEALHTDRSH
FT                   LSRRFKSATGLTLKDYIDNIRIAKACDLLSMTDMEVAQVARACGFSSLEVFSRKFKMAR
FT                   SVSPARFRSGT"
FT   gene            complement(283971..286235)
FT                   /locus_tag="BDP_0227"
FT   CDS_pept        complement(283971..286235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0227"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08908"
FT                   /db_xref="GOA:D2Q7T7"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T7"
FT                   /protein_id="ADB08908.1"
FT                   /translation="MTDNTAAIIVHEHTRQFHLTNGRISYVFHADGQGKLINLYFGAAV
FT                   PDREDFSYLTEVTHSPTTTCRIPGNLTYTLERMRQEFPEYGGGDYRRPALEVRQGNGST
FT                   LTDLTYAGGYRIIAGKPRLAGLPATYVEHDDEATTLEIELIDRPTGLTVILQYTIFRDQ
FT                   PVIARSVRITNGGGEPVSLERVMSLNLDLPDRNYTMTEFAGAWARERHPHTQPLHYGVQ
FT                   QIESLRNASGHFLNPCAVFARPATTESQGEAIGVAFEYSGNFDLHAEVDTFDVTRVQVG
FT                   INDFGFSWRLAPGETFQSPEALLAFSAEGLTGLSHAFHRTVLEHIVRGPWKRRERPVLI
FT                   NNWEATYFDFNEDRLVDIARTARNAGIELFVLDDGWFGARNDDTAGLGDWRPNPRRLPN
FT                   GLASLARRVNDLGMRFGLWFEPEAVNADSDLYRAHPDWAIRTPHRKPSHGRNEYLLNFA
FT                   DAAVVDNIFEQMSALLGSANISYIKWDMNRFVSEGYDLSRDAEHQGEAYHRYILGVYDL
FT                   LERLLTAFPELIIEGCASGGGRFDMGMLFYTPQIWCSDDSDAIERLKIQYGTSMFYPLS
FT                   TMGAHVSITPNHQTMRSAPLATRANVAAFGTFGYELDLGRLSDAELDEVHRQVAWFKRY
FT                   REILHTGDFHRLIAPYGNEKAAWMVVSRDRHTAIVGDYRLLITPNGAFTRLALRGLDAG
FT                   LTYKVDCTGASSIAGRSFTGAELMRIGLVDSDASCGQMDDVNPLGVTTDFSSRLFVLTA
FT                   D"
FT   gene            286492..289047
FT                   /gene="dnaX"
FT                   /locus_tag="BDP_0228"
FT   CDS_pept        286492..289047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BDP_0228"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08909"
FT                   /db_xref="GOA:D2Q7T8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T8"
FT                   /protein_id="ADB08909.1"
FT                   /translation="MALALYRRYRPDTFDGVIGQDQVTVPLMRALDEGKLTHAYLFSGP
FT                   RGCGKTSSARILARCVNCEKGPTSHPCGECESCRDLATGGPGSIDVVEIDAASHNGVDD
FT                   ARELRERAGFAPARDRYKIFILDEAHMVTPQGFNALLKIVEEPPEHVMFIFATTEPDKV
FT                   IGTIRSRTHHYPFRLVPQEVMGPYLERICSDEHIEAEPGVLRLAMRAGGGSVRDTLSVL
FT                   DQLMVGSVDGVIPYDSAVALLGFTPEALIGEAIDAVIDKNGEALYGVVQKVVVGGFDPR
FT                   RFVEDLLARVRDLLVLTLGGERAESVLSDDSAAEDMDDLRRQASALGLAALTTMADTIN
FT                   ATLGGMTGAISPRMRLELLAARLLAGRETNGSSGVAGDATAPDAAAQPSGGSARYGMAG
FT                   SRRRPAQAETQPSQPAPSVPQQSVQASTAPKSSADAVTSGMASTMAAFEQAMNAPLGDG
FT                   EAKAPSQTAAPLPANDNRTPDQKWDALVASLPDDVRRYINREKVPRIMLDEQAQGGPKL
FT                   WIKFDRSLSKYAFAKAVASESLNGTNNVVSIVRAEVHKVFGPSVTLAPAKKLADGEVAV
FT                   PWSKLSPEEQRKINAQLVQEQLKAATLLTQNLGSDSAAGKEPKDGEKAESAADPTDGES
FT                   HRGGSATASAEADPWSAPAQSAAPADDDPWGAPMQSPVAVNVNDVKAPERHRKHVAVPD
FT                   ISDDVDPWAASVPTPQGMSDSMRAPDPMQTADSVQAMPQDDDDPWNQPLPQPVQQSQSQ
FT                   PSQQSQTPSARQHRDLRHEAAPAADDPWSQRFAAPEPAKPQVAAEDDEYSMSDESLGTA
FT                   TALDVDELSRIFEVNKIEDFTADDLKNPRNMQTKKSLDD"
FT   gene            289078..289680
FT                   /gene="recR"
FT                   /locus_tag="BDP_0229"
FT   CDS_pept        289078..289680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BDP_0229"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08910"
FT                   /db_xref="GOA:D2Q7T9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7T9"
FT                   /protein_id="ADB08910.1"
FT                   /translation="MALAYDGAIQRLIDAFAHLPGIGPKGAQRIAFYMLNASDEESQGL
FT                   IDAITEVKEKVRFCEICGNVCETSPCPVCVDPRRDRSVICVVEEPKDVMSIERTREYRG
FT                   LYHVLGGAINPMANVQPSDLNIAKLIERLKDSEVKEVILALNPNVEGEATTSFLAQLLS
FT                   QTDIKVTRLASGLPVGGDLEYADEITLGRALAGRRNV"
FT   gene            289863..290624
FT                   /locus_tag="BDP_0230"
FT   CDS_pept        289863..290624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0230"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08911"
FT                   /db_xref="GOA:D2Q7U0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U0"
FT                   /protein_id="ADB08911.1"
FT                   /translation="MALIVQKYGGSSVADPESIKRVARRIIETKNAGNDVAVVVSAMGD
FT                   TTDDLIDQALSIDSNPPAREMDMLMTAGERISMSLLAMAIHAAGSHAYSFTGSQAGFMT
FT                   DAQFGTAHIKAVKPDRVRRALDLGSVAIVAGFQGVNEGGDATTLGRGGSDTSAVALAVA
FT                   LDADVCEIYTDVDGVFTADPRIVPAARRIPVIDYESMLEMSSCGSKVLALRCVEYAQRF
FT                   NMPLHVRSSFSHRRGTLIVPEGVDPRNLPNI"
FT   gene            290669..291232
FT                   /locus_tag="BDP_0231"
FT   CDS_pept        290669..291232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0231"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08912"
FT                   /db_xref="GOA:D2Q7U1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U1"
FT                   /protein_id="ADB08912.1"
FT                   /translation="MSENNKSLGDLFPDLGPEVPIISGVAHDSTESLATVRRVPNEPGM
FT                   AAKVFTMLAEAGVNVDMIVQASASTGTADISFTVPGTAAAKVQEVLQEKQDELGYQSFD
FT                   VDANVGKVAVVGVGMKTHSGLAAKFFNALSDEGVNVLMISTSEIRIAALVPLGQLNDAV
FT                   RALHTAYGLDSDQVEAVVYGGTGR"
FT   gene            complement(291650..292744)
FT                   /locus_tag="BDP_0232"
FT   CDS_pept        complement(291650..292744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0232"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08913"
FT                   /db_xref="GOA:D2Q7U2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U2"
FT                   /protein_id="ADB08913.1"
FT                   /translation="MSEKIKVGILGATGMVGQRFVTLLENHPWFEVVTLAASVHSAGKT
FT                   YEEAIGGRWKMETPMPEFVKNMVVKNVADVEDVVKDVDFVFSAVNMPKDEIRAIEEEYA
FT                   KTETPVVSNNSAHRWTPDVPMVVPEINPEHYDVIAHQRKRLGTKHGFIAVKPNCSIQAY
FT                   TPALAAWKEFEPREVVVSTYQAISGAGKTFNDWPEMLGNIIPFISGEEAKSEKEPLKVF
FT                   GHVDDEQGEIVPFDGPLRITSQCIRVPVLNGHTATVFINFGKNPTKEELVDRLVSYTSK
FT                   AAELGLPHAPKQFIQYLTEDDRPQVKKDVDYEGGMGVSIGRLREDSIFDWKFVGLAHNT
FT                   LRGAAGGALESAEMLKALGYITKK"
FT   gene            293048..293668
FT                   /locus_tag="BDP_0233"
FT   CDS_pept        293048..293668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08914"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U3"
FT                   /protein_id="ADB08914.1"
FT                   /translation="MSKASEEAQKQLDRIVALGYPDVADMSAGAFRALARPLIRALEDS
FT                   DLGSDILLVPTRELVSPESLIARTSINRMAGFTTMPPRDIASFLPQDGFEPPEGPFYLV
FT                   LEPHTGTCYINREPDVARKLIDSDERLPLTLEEGLAIATQHPEWLLEKNGFNLLGSRSA
FT                   DGRVPSIWMSQNAPRLGAVWPNSRHTWLGNAYCVARRGVSLFH"
FT   gene            complement(293906..295423)
FT                   /locus_tag="BDP_0234"
FT   CDS_pept        complement(293906..295423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0234"
FT                   /product="phosphohydrolase, calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08915"
FT                   /db_xref="GOA:D2Q7U4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U4"
FT                   /protein_id="ADB08915.1"
FT                   /translation="MTLRFNSDGSFRVLQLADIQDGPNVRKDTIRLIEAAIHEAHPDLI
FT                   VFTGDQIRGYDPAYIDTFLRRRDEKPGTHVRAVTEFEAKLRGIKRHPLSKALLNTQPTD
FT                   DNWTIDGIGTDSPKLVRRNGNGTKSKLESWAQSINSATMDALIEEARQKVRDTFAAFLG
FT                   PALEARIPFAATYGNHDFQCGVLADDQDDIYREFSGCMNPVAGSSPLALEPGTFALPIE
FT                   ASDGSGRIAMSVMMVNSGDYAEQPANDANNAGHESIASYAKYASNSRGWDLADSDGYGT
FT                   PSPEAIEWLRTVQCEFGARNGDGRAVPAIAFQHIPPQEFYDCLREVPAYTPNAVEGARK
FT                   FAGHCYVLDHDLCRPGSRLGEAIGCADDNVGEVQALREAGGYFALFCGHDHKNAFVGHV
FT                   HDLDLGYAPTCGFESYGPKSRLRGIRLFEFNERNPQGYVTRMLTWGDLVGRYSSNEVRV
FT                   FFEDHCVTDLIGIRNELRRPQVFATLIGVGSMGLAALAHATLKLFRR"
FT   gene            295611..297521
FT                   /gene="leuA"
FT                   /locus_tag="BDP_0235"
FT   CDS_pept        295611..297521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="BDP_0235"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08916"
FT                   /db_xref="GOA:D2Q7U5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U5"
FT                   /protein_id="ADB08916.1"
FT                   /translation="MGQGQSSVFDLAAIAAASNGGNNDPLLPPARFIGAPQKPSKMPYN
FT                   KYVAYDKQVPFDFPERTWPGKRLQRAPRWCSVDLRDGNQALVNPMDSERKLRFWNLLVS
FT                   MGFKEIEVGFPSASETDYDFIRMLIERELIPDDVTIVVLTQAREHLIRKTYECLKGARR
FT                   AVVHFYNSVSVLQREVVFRKDKAGIKKLATDAATLCKELEGEAEGIDLYYEYSPESFTG
FT                   TEPEYAVEVCNAVIDVIKPTPEHPMIINLPATVEMTTPNVFADEVEYVSNNLVPRDAVV
FT                   LSLHPHNDGGMGVAATELAVLAGADRVEGCLLGNGERTGNVDLVTLGLNFLTQGIDPQI
FT                   DYSNVPEIRKTVEYCNQLKISERHPYAGNFVFTAFSGSHQDAIKKGLEARQMAADRAGA
FT                   DLDSFVWLVPYLPIDPKDIGRTYEAIIRVNSQSGKGGMAYLLKANHNLDLPKRLQVEFD
FT                   KVVQAYADETKKEVKDEDIWRLFKDEYLPVEESGATAAGVVVGDSKDESLEQWGRLKLL
FT                   KVSVSSGEDGSDTVLKARILDRGVNVGVDEPIEREVSGMGNGPIAAFLNAVSNFGITAS
FT                   IMDYVEHTMSVGTDAMAASYVECQIGEEEDTQIVWGVGIDTSIVTSSLKAIISAINRSE
FT                   R"
FT   gene            complement(297646..299190)
FT                   /locus_tag="BDP_0236"
FT   CDS_pept        complement(297646..299190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0236"
FT                   /product="beta-xylosidase or endo-arabinase"
FT                   /EC_number="3.2.1.99"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08917"
FT                   /db_xref="GOA:D2Q7U6"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR032291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U6"
FT                   /protein_id="ADB08917.1"
FT                   /translation="MIRKTIAAIIAAAMLLGTAAGCSGTSSGEKPIVNTTSDIKRGSSH
FT                   DPSIVEADGKYYIFGSHRAWLKSDDLVNWESFTNNLSTDYKKILGDFWEEWPKQPANSD
FT                   LTGNMWAPDVIYNKAMKKWCMYMSVNGINYKSAIVLLTADTIEGDWTLVGPVVYSGFRD
FT                   DTVAKTDVPKVLGSSEVPTRYLSPGDTEINAIDPSVKYDDDGSLWMTFGSWFGGLWALK
FT                   LDASTGLRDYTTTYETAKDETDQYYGIKIAGGHGNSGEGSYIMKQGDYWYLFVSYGALQ
FT                   QQGGYQIREFRSKNITGPYVDEDGNNAVSTETIGSNWTLKTGIRLMGSVEWSGNDNANI
FT                   EVAQGHNSAFVDEDGTAYVVYHTRFSNRNEEHEVRVRELLTTADGWLVAAPYEYTGVKA
FT                   NAKGYQESQLTGEYEFVVHDPTTFFQGSNGTAKDGKYPYKGVDEPITIKLESGGKVSGD
FT                   KTGTWSVNKDSNQMTITIDGTEYQGDFAQLPRETDLKSVMTFTAIGGNTCVWGSQV"
FT   gene            299298..301412
FT                   /locus_tag="BDP_0237"
FT   CDS_pept        299298..301412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0237"
FT                   /product="beta-xylosidase or endo-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08918"
FT                   /db_xref="GOA:D2Q7U7"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U7"
FT                   /protein_id="ADB08918.1"
FT                   /translation="MSANYALLCYTRAATSREEANNEDIAYSVHLALRSQITGKWEPLN
FT                   ENYGIFFPAGVPIAAATESSRRACRAAVRFGTEPFDGPRPASDAVRYDAVMPGVDITLK
FT                   SLRDPYLFRLQDGRFAIAATRTNREGTPDGSEKSAFLLAVSGDLTSFIQPGLVLLRTEN
FT                   GVNHPSVTFDETAARYVITFTGDDGRSYSAQTEDIVASARSGEPLDVTENTQASERHHS
FT                   FDCDIPDAVPGNVISVTEDEAKHLIARFGRVYNVAATVSPQHINALSGGEDARGAVMAL
FT                   TRTRAELVYSDGSTATRAVNWNREQLETIAREASEGKLRAGESRTVEGKIRQTVYPVPF
FT                   AVERADPSVFAWNFNGKPMFMFIATDDTDGNCIDPNNGATHMPLRVADSIEELSDVAGG
FT                   RAKEIDLLTCGDLNSEGREMTGCFWAPELHVIGGKLSILFMPCFDGPSVNPDGTPNDRA
FT                   GKPDMWTGSCHIMQLKQHSDGTDFDPREPENWTVPQPILDPDGATLNPIQRISLDMTVI
FT                   VDSGRWYYAWQQVGSIWIASFDPSNPTRLTSRPTQIIVPEFAWDNMIAEGPNAFVHDGK
FT                   IYLIYSGSLVGIDYTTGLATAPAGRCIDLTDPANWTKLDYPLQKSGLYNGQWQLGTGHG
FT                   MWSHDEDGNLIYVFHNAEYEHGRYGGRDAQVRRVHWSAEGMPILDMDSAEELNPDYAYV
FT                   TMQINVSDAD"
FT   gene            301511..302584
FT                   /locus_tag="BDP_0238"
FT   CDS_pept        301511..302584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0238"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08919"
FT                   /db_xref="GOA:D2Q7U8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U8"
FT                   /protein_id="ADB08919.1"
FT                   /translation="MSRQTGSNGEHVVTMREVAKAAGVSIKTVSNVVNDYEFVSQATRD
FT                   KVNKAIDELGYTVNVSARNLRTGQTGIIGLAIPDLQMPYFAQLSSLVIEEAKKLGLRVI
FT                   VEPTLYSREGEIDALHGSQQTMIDGLIYSPLELDQDDVDQLKVDYPLVLIGERIFTDLV
FT                   DHIATENVEGAKRATSYLLQTGCRRVAVVGVHPGEKVGSAALRYRGYREALEEAGVEFD
FT                   ERLVVSSGMWHRSDGVKAMNSLFDSGVIPDGVVALNDMLASGVMHAIQMHDYRIPEDIS
FT                   VIGFDNSDDSQYLSPALTSIDPGLEAVARLSVKVLKERIDGREPNGEHPGRKVFRKVSS
FT                   SLVMRQSTKLPQESLVV"
FT   gene            302765..303787
FT                   /locus_tag="BDP_0239"
FT   CDS_pept        302765..303787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0239"
FT                   /product="exo-alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08920"
FT                   /db_xref="GOA:D2Q7U9"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7U9"
FT                   /protein_id="ADB08920.1"
FT                   /translation="MAVYNNPIVLQRADPWVLKVDGEYYFTGSDPEYNCIAIRHASTIN
FT                   DLQKAPETVVWRKHESGPASIYIWAPELHRINGAWYIYFAGAATDFETSGLPTHRMFVL
FT                   ENTDDDPTSDNWVEKGQIATPVDSFSLDATTEVIDGVQYLVWAQKDPAIEGNSNLYIAK
FT                   MTNPWTLESEPVMLTKPEYDWECIDFLVNEGPAFLFHENKIYITYSASGTGVPYAVGLL
FT                   TAERGSDLLDKASWTKSPVPVFKTCAEHGQYGPGHNSFTKSEDGADDLMVYHCRNYTEI
FT                   TGDPLFDPNRHARVGVVKWTEDGPDFGVPEPDNLWTPTTTDVLPADGGALAGTPAVRRS
FT                   "
FT   gene            304040..305635
FT                   /locus_tag="BDP_0240"
FT   CDS_pept        304040..305635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0240"
FT                   /product="ABC-type sugar transporter, sugar-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08921"
FT                   /db_xref="GOA:D2Q7V0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V0"
FT                   /protein_id="ADB08921.1"
FT                   /translation="MKIKKSTKALAAAASLAMLSTVGLSACGGSDSGETDSNGKPIIRV
FT                   ALIKRSTQIEAKEMKLQKDLEAACDCTIKWDEILDTQWSQQASTVLASGDVADITVWGY
FT                   NSSNFAQYDYWEDLSDDLDQMPNVQAYFKEVPNAKKFGSDIDGHVWQVPSDYGNASGVK
FT                   WSSGQNLMINKSWLEKLGLEVPKTWDDLTKVLTAFKNDDPNGNGEADEIPMLINQLGTA
FT                   GFNWWDPFLLLNGTGLNTQMIANGNQGIYIKDGKIGNFMITDNFRQVIEYYHSLIEQGL
FT                   MPKDILTRDSSQNSADISNDGKTAKVGLIFGWNTGNFGDLKDQYESIEVPAAPGVSYEE
FT                   TTWEPQFEDIYNGACVKAGLDDEHKAAALKIINKWIEPDTSMESYYGDLDKYISNEGDG
FT                   KYKVIEFQKDLSTYGLADRGLTYVSDDMSVEGDEDKVLAEKDGKTYETQQSHIGDKDLI
FT                   PAYVRLSAEDNTTVSNNNSNIFNYAMPLISTWIQDGGLTDAKWNEYVDTMKQQGVDENV
FT                   KLWQKWYDKTMAEE"
FT   gene            305790..306773
FT                   /locus_tag="BDP_0241"
FT   CDS_pept        305790..306773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0241"
FT                   /product="ABC-type sugar transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08922"
FT                   /db_xref="GOA:D2Q7V1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V1"
FT                   /protein_id="ADB08922.1"
FT                   /translation="MDMAVSQIAASASNADVPDNDYIAKHKPLPIRIGTHLRRYWQLWL
FT                   MALPAMVFVFIFAYIPMYGIQLAFREFVPRKGLTGGTFVGLKYFNKFFQSPQFANLMRN
FT                   TISISLWTLVMGFICPIILALLINQLGSKKIKGFVQTITYMPHFISTVVIVSMISIFLN
FT                   PTSGFIGRFLNEDGKSILGDPNLFTPIYWITEVWQHCGWNSIIYLAALAGVDTALYEAA
FT                   KMDGASRLQLIRYVDIPAILPTCGVLLILNMGSVLNVGFEKVFLMQNSLNLSSSEVIST
FT                   FVYKMGFVSNQYSYSTAIGLFNTLINFVFLVMANAISKRVSDTSIF"
FT   gene            306801..307754
FT                   /locus_tag="BDP_0242"
FT   CDS_pept        306801..307754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0242"
FT                   /product="ABC-type sugar transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08923"
FT                   /db_xref="GOA:D2Q7V2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V2"
FT                   /protein_id="ADB08923.1"
FT                   /translation="MSNSVAPAIKTANNEIPWNPKVRQKKQPSDYVVDFLIGLLVVAVV
FT                   VVVLYPLWFIVIASFSNSALVSQGAVTLYPKDINFSGYTKILEDSRIWTGYKNTIIYSV
FT                   IGTAVNMLVTLPVAFSLSRREFKARRVILFLFTFTMFFAGGLIPSYLLFKDLGILNSMW
FT                   VFILPGAVNVFNVIIARSFFETSIPEELHDAAQVDGLGYFRYFMKIVLPLSSAIIAVIA
FT                   LYYFVGHWNDFFTGLIYIRNQEKQPLQNVLQNILLANQMTTSGGGSDGRSMLERQQAAD
FT                   QIKYGIIIVSTLPLLVVYPFLQKYFNKGVMIGAVKG"
FT   gene            307902..308978
FT                   /locus_tag="BDP_0243"
FT   CDS_pept        307902..308978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0243"
FT                   /product="endo-1,4-beta-xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08924"
FT                   /db_xref="GOA:D2Q7V3"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V3"
FT                   /protein_id="ADB08924.1"
FT                   /translation="MTEATDAYGYLLVHFIEDPDGYAEKIYMDVSDGDNPRRWLPINDG
FT                   KPVLTSAIGTTGVRDPHIIRNPETGTWYVIATDLRVFGGDDAGWFEWTRHASTNLIIWE
FT                   SDDLLHWSGPRMLDVSRKPDGSHLELGMAWACECLWVPDYYPAEHEGGRGAFVMYWSST
FT                   IFNNEDTRHDDKDVYCTVLWGATTDFTQDTFEYGGVFIDNDGDAIDTTMIQRPLPDGGM
FT                   RTYRITKDNAHGNGIWMDSTDAKRWWEPDTQWTLVQDRIGAEYVPDGNPGGVEGPAVFA
FT                   NHHNDGGADDEWYLFVDVIPSIGYQPMISHDLDKGWVKLESQDYFLTEHTKHGGVASLT
FT                   RAEYERLRPLAALADLRG"
FT   gene            complement(309101..311362)
FT                   /locus_tag="BDP_0244"
FT   CDS_pept        complement(309101..311362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0244"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08925"
FT                   /db_xref="GOA:D2Q7V4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V4"
FT                   /protein_id="ADB08925.1"
FT                   /translation="MVSQTRSVSSRSHAPQADGTRSARSNTHNVQRNSHGSHRANGPKK
FT                   NRTKRKHLVLKWVLGIFAALLTAGIGLFAYMYVTTSVPEPEAFALAEKTTVYYSDGTTE
FT                   IGSYAEQNREIIDCSVLPDYVGNAIVSSEDRSFYTNKGIDLVGIARALYNNLTTGSRQG
FT                   GSTITQQYAERYYLGETTSYSGKLREAFLAIKIAQQQDKSQVLCNYMNTIYLGRGAYGI
FT                   QAAAKAYFNKDAKDLTLSEAATLAGIIPAPSAWDPAVDEAQAQKRYKRVLSIMEEDGYI
FT                   TAKQRKESQFPQAIEYQQSNQLEGANGYLLTMVQNELIGTKAFSKQDLETGGYKIVTTI
FT                   DKSKQDLMYSVVSPSQNGMQGVVPDGMQFGALSVNPKDGSIIALYAGDDYLTKQLNNVT
FT                   QATYEVGSTMKPFALLAAINEGVSLNTMFNGNSFRTFPGITETVSNYGNANLGYVNLYT
FT                   ATEQSSNTVYMDLQTKLGTKKIADTAREAGVENTSLDGSEPYTVLGNNGLSVEDMTRAY
FT                   ATLANQGNKPTLHIVASVKTPDGSDLYNAPTTAEQVFEANSANLVTKALTGVVQRGTAT
FT                   EARATGHTIAGKSGTANDSRAASFIGYTPSVVTTVAMWYPDANGNPQEIPAFGSWTGGS
FT                   DYPVHLFTEYMTQALADTPNETFPTATDSGKVGGSDGTWGTGAQKSYTSQTTPKAEEST
FT                   QPTTPSPTETTTPDSGSGSGSGDGDADSGSGDNGGSGSSTDQSSQGQSDQGQSTQSPQQ
FT                   "
FT   gene            311593..312735
FT                   /locus_tag="BDP_0245"
FT   CDS_pept        311593..312735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0245"
FT                   /product="myo-inositol-l-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08926"
FT                   /db_xref="GOA:D2Q7V5"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V5"
FT                   /protein_id="ADB08926.1"
FT                   /translation="MSIRVAIAGVGNCASSLVQGVEYYKDTKDEDKIPGLMHNNFGGYR
FT                   VRDIEFVTAFDVDALKVGKDLSEAIEASQNNTIKFADVPNLDVEVLRGPTEDGLGEYYR
FT                   QMIEESTAEPVDVAQVLRDKKVDVLVSYLPVGSERADKAYAQAAMDAGCAFVNCLPVFI
FT                   ASDPEWAQKFRDAGVPIVGDDIKSQVGATITHRVLARLFEDRGVRLDRTYQLNVGGNMD
FT                   FMNMLQRSRLESKKISKTRAVTSVVPHDMDPHNVHIGPSDYVAWLDDRKFAFVRLEGTT
FT                   FGDVPLSLEYKLQVWDSPNSAGIVIDAVRAAKIALDRHLAGPILAPSSYFMKSPAVQHE
FT                   DGEARRLVEEFIKGNVEGTEEQLDADVAAAKAAGKDVWKA"
FT   gene            complement(313116..314294)
FT                   /locus_tag="BDP_0246"
FT   CDS_pept        complement(313116..314294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0246"
FT                   /product="UDP-glactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08927"
FT                   /db_xref="GOA:D2Q7V6"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V6"
FT                   /protein_id="ADB08927.1"
FT                   /translation="MTEKVQYPDLVVVGAGLFGLTVAQQAVEHLGVRVEIIDVRDHIGG
FT                   NAYSYMDEETGAEIHKYGAHLFHTSNRRVWDYVNRFTSFTDYVHRVYATHDGEVYPLPI
FT                   NLGTVNQFFRAHYTPAEAKALIAGQAGELAGTDPQNLNDKGISLIGRPLYEAFIKNYTG
FT                   KQWQTDPKDLPAGIINRLPVRFNYDNRYFMDTWEGLPVDGYTAWMERMIDDPRIHVTLE
FT                   TDFFDESQPYNKAALAAAGVPVVYTGPVDRYFDYSLGELKWRTVDFKEVRYDEGDHFGC
FT                   PVMNFSDADVPYTRAIEFKNFNPERADRQNPDRTVVWEEYSRFAERGDEPYYPINTESD
FT                   KALYARYEELAKAEPRTVFGGRLGTYKYYDMHNVIDTALTAYEQQVEPLLKK"
FT   gene            314611..315702
FT                   /locus_tag="BDP_0248"
FT   CDS_pept        314611..315702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0248"
FT                   /product="pre-pilin peptidase or phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08928"
FT                   /db_xref="GOA:D2Q7V7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V7"
FT                   /protein_id="ADB08928.1"
FT                   /translation="MSMTDEFKPIIRDPQKSANMLQQNASSEALGSTGSNTSTDPVADV
FT                   LSADEVRRGLAKADPLTRHPRISSIVQCVAFGLILLAASVGVWWLGVYTLSGQSYEDMV
FT                   WSRFPHVLPAWLGPVAHIFAISLLVQGVSVAMAIIALIVLIVRKRWLLIMQLAVFGGLC
FT                   FTAAKVLKSVLPRPYLINLDSNPANSAPSGHTILAAAAGVMLVCAVPRVLRALAAAIGW
FT                   LYAVLVGLSVIAAQWHRPIDVIMALLIVGGLALLMLAVSFANGMDEPGKRTSSPSVQIV
FT                   GSVMLTFGTLGTLYGAYIIWQIQPGLDLSAEWTNAGACASTAILTASVCALVFGLVLVM
FT                   RQLTASPLTKLGLVGAPPAPPKQ"
FT   gene            315803..318817
FT                   /gene="topA"
FT                   /locus_tag="BDP_0249"
FT   CDS_pept        315803..318817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="BDP_0249"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08929"
FT                   /db_xref="GOA:D2Q7V8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V8"
FT                   /protein_id="ADB08929.1"
FT                   /translation="MATGSKLVIVESPTKARKIGGYLGSDYTVMASVGHIRDLAQPSQV
FT                   PSADKAKFGKFGVDVEDGFKPYYIVDGDKKKTVSELKSALKKADTLYLATDEDREGEAI
FT                   AWHLVQTLKPKVSIKRMVFHEITPEAIKASLNNTRDVDGAMVDAQETRRILDRLYGYEL
FT                   SPVLWRKVGPGLSAGRVQSVATRLIVERERERMAFVRAPYWDVTATLEAMGAEGDNVAF
FT                   DSRMVSLDGRRLAGSKDFGEDGLLTAAGAKDNVVQLDETQARALAQSLEFATFTVTSME
FT                   SKPYRRRPLPPFTTSTLQQTAGNRLSMSSRQTMRAAQGLYENGYITYMRTDSVTLSQEA
FT                   IAAARSAVKSHFGDTFLSDAPKQYATKTAGAQEAHECIRPAGAQFRDPDEVAKKVPADQ
FT                   ARLYALIWQRTLASQMADATGSTATVRLSASAGDQGEAVFQASGTVIEFPGFMKATGEG
FT                   RHASSDRATDKTAEQSVKANDDNASLPPMRPGDELAATEVAADGHETQPPARYTEASLV
FT                   KTLEAKEIGRPSTYASIISTIIDRGYVYERGRALIPSWLAFSVVKLLETKFPKYVDYQF
FT                   TADMENGLDQIAHGMETGKDWLTSFYFGSGEGAAQSQDEAHAGLQQQVAQLGEIDARAI
FT                   NTIEIGDGLHVRVGRYGPYLEDVNDLDGEGNPKRASLPDTLAPDELTVEVGHDLIEHHS
FT                   GGPRELGKDPVSGGTVEVRNGRFGPYVALIVPQSEAAGDAAAAQAKPQRGSKKAAADRP
FT                   KMASLFKTMSPESLTLEDALKLLSLPREVGTYEEANAETGELQQVTVMANNGRYGPYLT
FT                   KTGADGKSDTRSLASEDEIFTVDLDKAKELFSQPKYGRGRGRGAAKPPLRDLGVDPETQ
FT                   KHVTIKEGFYGAYITDGETNRTLPKQYAAESIEPAEAFRLLAEKRAQGPSKRGRGRKAS
FT                   AKKTTAKSTKAGKPNAIEKARADRRAKVRELADQGWANTRIAKEIGSTAATVKADIDWL
FT                   TANEGYFRPEVVPAR"
FT   gene            318859..319617
FT                   /gene="tmk"
FT                   /locus_tag="BDP_0250"
FT   CDS_pept        318859..319617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BDP_0250"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08930"
FT                   /db_xref="GOA:D2Q7V9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7V9"
FT                   /protein_id="ADB08930.1"
FT                   /translation="MGSHGTVMDMQGMFISFEGVDGVGKTTQVERLRAHIEAQGRECVV
FT                   TREPGGTALGVAIRGMLLHGVAAADAGVPANKADGGRQPEPADIAPRTEALLFAADRAQ
FT                   HVAEVIRPALERGAVVITDRYLDSSLAYQAGGRELTLKEIRDLSLWATNGLLPERTYLL
FT                   DMDPAASHARLRHSEDRMESAGDDFQNRTRNAFLELARAEPERFRVIDASQSIEEVWQR
FT                   IEHDFAAIDHLRPTLRSTVSTGENTEGIAR"
FT   gene            319614..320765
FT                   /locus_tag="BDP_0251"
FT   CDS_pept        319614..320765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0251"
FT                   /product="DNA polymerase III subunit delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08931"
FT                   /db_xref="GOA:D2Q7W0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W0"
FT                   /protein_id="ADB08931.1"
FT                   /translation="MSVWDSIVGQRQVVEQLKTVSCGDPKSIAQSWLICGPPGSGRSNV
FT                   ARAFAAALESPDHGLGDEPTKVTQQVLAGTHPDVTVLATNKVTIGIDQVRDLITTSEQM
FT                   PSTAPWRIIIIEDVDRMLERTTNVLLKEIEEPSEHAIWLLCAPSAQDVLPTIRSRTRIV
FT                   NLAVPSNQAVAKFLEETSQVEPKIAARAARLAEGHIGIARLYACNERIMSDRDELIVGV
FT                   LNLAKASDAVLLAGNLIDNAKAQAEADVEVKAAAAEADFRRINGLGPKDRIPPKLRGAY
FT                   NAIAKKDELKRQATRLTRDVLDRALNSVASIYRDVAVLQNNAEDAVGLINLENRSSIAE
FT                   LSVRLDRAAAVRRLEDIATARRRLNGNGNPALVFEALFCALIP"
FT   gene            complement(320806..321819)
FT                   /locus_tag="BDP_0252"
FT   CDS_pept        complement(320806..321819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0252"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08932"
FT                   /db_xref="GOA:D2Q7W1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W1"
FT                   /protein_id="ADB08932.1"
FT                   /translation="MAGRNESNRSITNVAALANVSIATVSRVLSGKRTKDDDIARRVRA
FT                   AAEQLNYSVNYAASALRSTITNTIGLVIPSATETFSAQLLDEIEPTIDVDSQQLLLGIG
FT                   PNQAAQGERIASLVARHVDGLIVVPAAGADLTEILEQYAGTLPIVQVGGRQRSFHTSMV
FT                   GIDEDAAMEMTIGHLADQGIESVAYMAGKEISFESAELFAMFHTQVRAHHLKTQADWNR
FT                   FGERSVQRGFDCAMRLFSEPLVQPEAVVCADDTIAFGMMVALHALGLRVPQDVLIVGYN
FT                   DSPIASTTMPTLTSVRPPFQQIVSEALRLIALGPEHPAHVSLPPQLIVRDSTVVAR"
FT   gene            complement(321963..322223)
FT                   /gene="hpr"
FT                   /locus_tag="BDP_0253"
FT   CDS_pept        complement(321963..322223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpr"
FT                   /locus_tag="BDP_0253"
FT                   /product="HPr family phosphocarrier"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08933"
FT                   /db_xref="GOA:D2Q7W2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W2"
FT                   /protein_id="ADB08933.1"
FT                   /translation="MATRNLVINDPVGIHARPAAQFAQAVTASNCNVTIAKEGGDAVPA
FT                   GSILSIMGLGIKQGDTVVINVEGTDADACADKLIGILANAA"
FT   gene            322508..324160
FT                   /locus_tag="BDP_0254"
FT   CDS_pept        322508..324160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0254"
FT                   /product="PTS system, enzyme I"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08934"
FT                   /db_xref="GOA:D2Q7W3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W3"
FT                   /protein_id="ADB08934.1"
FT                   /translation="MNIKGVGIGRGVAVGPVIRMAAPLPEPSDAPRAEGIDAETEIIRV
FT                   ERSLALVNADLNRRAEEAANGDEGAQKAAPILQAIAMFASDPSLAQSIRNLIGQGKTAE
FT                   RAVLEGFAAVEDMFRAIGGYQAERAADLHDVGQRVIADLMGAPAPGLPVSETPFVLVAE
FT                   DLSPADTAALDMSKTLAIVTSQGGPTSHTAILARARGIVAVVSATEATELTDGTNVIVN
FT                   AAKGEITVEPSEEEITAAEAAKSRAAAAKELRGNPGATKDGHRIPLLANVGKPSDAATA
FT                   LEYGAEGVGLFRTEFLFIGNAEPPSVEEQTKAYIELLSQFPGKKVVIRMLDAGADKPLP
FT                   FLTPEDEPNPALGLRGLRTLKAHMDVLEGQLKALAAADAATDADLWVMAPMVADEHEAD
FT                   YFVRLAKSHGLKFVGAMAEVPSIALMADKVAKVADFVSIGTNDLTQYTLAADRTLGSVA
FT                   NYQTAWHPAVLRAIKMICDAGNANGMPVGVCGEAAADPDLAVVLAGLGVNSLSMTPVAL
FT                   DDVRAALAEVTLEEAKAKAAAALNGDYYNPADR"
FT   gene            324429..324986
FT                   /locus_tag="BDP_0255"
FT   CDS_pept        324429..324986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08935"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W4"
FT                   /protein_id="ADB08935.1"
FT                   /translation="MKISADFTVIPDAFAKAAPPENCIDGTPIVSFPFYIDELDSSVQF
FT                   LHWEFVDPDSIPVCGFQWNHWSLANLPVDALMYDFNDSHALAIPADFSRTVSAMIPETV
FT                   QGRTSAASPLLTGRSTDPAVTMRYNGPYPPDRDHDYYLHVWGTTAPLAGLNQGFWLNEM
FT                   ERALRNGGNPIDQGGIFLTGKA"
FT   gene            325109..326707
FT                   /locus_tag="BDP_0256"
FT   CDS_pept        325109..326707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0256"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08936"
FT                   /db_xref="GOA:D2Q7W5"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W5"
FT                   /protein_id="ADB08936.1"
FT                   /translation="MACTTILVGKNASYDGSTIIARNEDSANGEFCPKRFIVVKPEEQP
FT                   RTYRSVLSHVEIDLPEEPLQYTAVPNADLKEGIWGEAGVNEANVAMSATETLTTNERVL
FT                   GADPFVELAPAKGREGEDGYEPEVPGGIGEEDFLTLVLPYIKTAREGVERLGALLEEFG
FT                   TYEMNGVAFSDVDEIWWLETVGGHHWIAKRVPDEAYVTMPNQLGIDEFDLEDALGDQEE
FT                   HMCSADLGEFIARNHLDLSVENTTPFNPRDAFGSHSDSDHVYNTPRAWYMQRFLNPYDE
FT                   QWDGPDADHKPTADDIPWARQPERKITIEDVKYVLSSHYQGTPYDPYGKLGDQRTRHMF
FT                   RPIGINRQSQLAVMQIRPYRPQVSRAIQWMAYGSNPFNTLVPFFPNVDSTPKYLEDTTV
FT                   RVTSENFYWENRIIAALCDASFADTANAVERYQEKTGAMGHRMVAAADEQIDRLCEDSD
FT                   FDAEFDADDESADVQPMEPDEIIEATRNAEAREILAAANRTMADQLKEETDKLLDSVLY
FT                   TASMNMKNGFHMSDF"
FT   gene            326798..328315
FT                   /gene="fhs"
FT                   /locus_tag="BDP_0257"
FT   CDS_pept        326798..328315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="BDP_0257"
FT                   /product="formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08937"
FT                   /db_xref="GOA:D2Q7W6"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W6"
FT                   /protein_id="ADB08937.1"
FT                   /translation="MTNIEDFTSQYGLVQKIDAFGYLDYLKNNPDAPRKHGKVVLVTAD
FT                   TPLKASRGEGKTTTTIALIDALRERGIDATAVLRQPSMGITAAGSKGGASGGGKASLTH
FT                   PELIDWGLCGEMGAIEAAQNLLVSFAEKAIDEGKLDEILVPRVSEVPSRSLRQIAVDRG
FT                   KGNVAERTVLTPTCELMQIVVLSRSMDEIADRVARMIAGTKDGKAVTFGEFVDLWRITG
FT                   ILSDAVKPAKTETVNGAPVYVHGGPFANVSIGIPTLVSVEMACALHDVVIVEAGYGADA
FT                   GAQKWLDIACREYGAQWPSAAIVVTRASTWRDDPALAWRYPFHVQRLEGLDIPTFPLIN
FT                   LWDGEDDQIPALKATTEELEFREPIIGNLYRDGGDALAPQLDAFVDAVVNGSMPAEPHS
FT                   HKGMALVENVRWVAENAYGVPAERVVLKDSFAESLNEAMNLCASAGMDLGDMALVAVKS
FT                   PATMTDNDSAPEEERTVTLKKVEVHSGAGLVHVNLTTSLTTPMPKIV"
FT   gene            complement(328476..328823)
FT                   /locus_tag="BDP_0258"
FT   CDS_pept        complement(328476..328823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0258"
FT                   /product="MIFH/DOPD protein family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08938"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W7"
FT                   /protein_id="ADB08938.1"
FT                   /translation="MPVIHTHVSVSTTPEQREALKTAYGKAITAVPGKSEGWLMCPFED
FT                   NMPIYFGGDDSQPAAYVEVNVFGRSVPGSAWEKLTEQIMAALGKELGIPADRTYIRYTA
FT                   TTDWGWNGGNF"
FT   gene            328931..329467
FT                   /locus_tag="BDP_0259"
FT   CDS_pept        328931..329467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0259"
FT                   /product="hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08939"
FT                   /db_xref="GOA:D2Q7W8"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W8"
FT                   /protein_id="ADB08939.1"
FT                   /translation="MKFGLVGVIAFVIDWGILNLLVGVFHMHNVIAATISFIISLIFNY
FT                   TASMKLVFKPRDDMARWMEILIFVVGAVIGLLMNDALIWVSTYGMNHDAFVTQHTEYLI
FT                   RTNVGKLFATAVVMVWNFLTRKWLLDDTHTNAMNRLKKAENRLSEEELEAKWQNSFSHK
FT                   LGVWSLEHTPKGWPK"
FT   gene            complement(329590..331014)
FT                   /locus_tag="BDP_0260"
FT   CDS_pept        complement(329590..331014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0260"
FT                   /product="MFS-family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08940"
FT                   /db_xref="GOA:D2Q7W9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7W9"
FT                   /protein_id="ADB08940.1"
FT                   /translation="MTNQVFAGVTSVGHRLFGGYAELLRIPHTARFSVGSVIACMPFPM
FT                   VGMTITIAVQHYYGNYSLAGALTAVQAIALAVASPVLGKLVDKFGQRQVSIPTIIVWMV
FT                   AATALVSCITARVPSWILFCIVPFMAAIPPWGAMSRQRWTTLLKGDSEKTNRALSLSGV
FT                   FDECMWVIGNPLASTLAVISGVLAFSFTGMCVVVGALMFLTELTTEPKSQTQLAREAGM
FT                   TRKEYRERETARSKALQAEAAVEYARDRARSEGKTAAEVQAAMEQAAADVKAGRKESIW
FT                   GPGLIAVCVTWFGLGAFQSAAGISIVAFATEANMKQYTGFVFACFSFSSLIGALVYGAK
FT                   NWTIPLWKRFYFCLAVVDLGIGSFMFAKHLWVIMIIYLLIGVCQAPTWVNGNQLMLHLV
FT                   PPTRFTEGMAWMGAMNSIGGSVGSAIAGQFIDRMGSHGGFLVVTVLALASLAIALFGFK
FT                   QIKDSTEQPMLTSVSV"
FT   gene            331355..332014
FT                   /locus_tag="BDP_0261"
FT   CDS_pept        331355..332014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0261"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08941"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X0"
FT                   /protein_id="ADB08941.1"
FT                   /translation="MHATTIHFVRHGKVENPEHLLYERLPGFHLSELGVRMAQATAHYI
FT                   AISPQLNTVSAVYSSPLERTRETAGEILESLNAVRGLRGEKPLELVTDERIIEAGNEFR
FT                   GKRIGHGEGALWRNGNYKLVRNLWKPSWGESYQSIAHRVQDFALEKVSEHPGEQIVVVS
FT                   HESPIWSYRHMLETGHPEHNMLLRHTALASITSITYDCATRKVMSITYVDPAADVQ"
FT   gene            332023..332133
FT                   /locus_tag="BDP_0262"
FT   CDS_pept        332023..332133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0262"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08942"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X1"
FT                   /protein_id="ADB08942.1"
FT                   /translation="MEEGLQRGARGSLFEAGFHVMIGLTEVGTAKEHYDF"
FT   gene            332123..333133
FT                   /locus_tag="BDP_0263"
FT   CDS_pept        332123..333133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0263"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08943"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X2"
FT                   /protein_id="ADB08943.1"
FT                   /translation="MTFEIDDSLVARVSALPVVMDAANVGVSLISLWPLQNAQQLENDA
FT                   DYAEGLQVRFSLLMALAMLRNSDKVNIAAAEAVYDGMEVIPGCPLWVVNALLEANDAYD
FT                   CMSAYSATGDIQLVFKAADYLSIVLDDKTKTAMEEVLSTVAAEVAKKAQGSASADGMTD
FT                   GGDFDAVAAAEACLSTSTNADEVAVRFASALMICDKLMNIMCEGFDDVNDQAIRVLPVL
FT                   LYVNELREQFSVPRIFMTYPQLLELLSLRKTAHMIDDSGATASIGNSLGTLGVTAQFVG
FT                   MLAAQEWAYHRCEILWDPEEAKRKAKEEDEQKSKEALAEKFKHVKDDPDKPQIDL"
FT   gene            complement(333261..334262)
FT                   /locus_tag="BDP_0264"
FT   CDS_pept        complement(333261..334262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0264"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08944"
FT                   /db_xref="GOA:D2Q7X3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X3"
FT                   /protein_id="ADB08944.1"
FT                   /translation="MTDPNQYGPQVPPQYGQSMPQQNQYGQSGQSQQGNAYGSYQQPQQ
FT                   GAPQYGAPQYGAPQGQPAPQGSNFFALTAPLDQPAYNCTMGESFIRFWKKYAVFKGRAS
FT                   RGEFWWWVLCNIIIVFAISLLFGLLGAIAGHSASYATLRISRVVTGLWSLATLVPNLAL
FT                   SVRRMHDTNKSGWSVAVCYGVLLVGYILTIAGTTMTGIGAVNAIYSGDTSTAATGAILT
FT                   IIGSLVLIAGCIVYIVFMARRSDPAGVRFDDPSTAGYAPTAPAMQNQYANYAAPTPDMN
FT                   VPAAPTSSAAPTAQATPFTPTVPSIPDVPLPAAPSDQSETGQNPYGNNTDQQ"
FT   gene            334460..335980
FT                   /locus_tag="BDP_0265"
FT   CDS_pept        334460..335980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0265"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08945"
FT                   /db_xref="GOA:D2Q7X4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X4"
FT                   /protein_id="ADB08945.1"
FT                   /translation="MTEAENTKPELPENVRVRFCPSPTGIPHVGMVRTALFNWAEARHT
FT                   KGTFVFRIEDTDAQRDSEESYNQIIEALNWLGIDWDEGINVGGPDGPYRQSERTQIYKD
FT                   VAAKLFEAGYAYESFSTPEEIEARNVAAGRPKAFGYDGYDRNLTEEQKAAFRAEGRKPA
FT                   LRIRMPDDDVAFDDLIRGRIEFKAGSVPDYVIVRPNGDPLYTLTNPVDDAMMNINVVLR
FT                   GEDLLSSTPRQIVLYRYLIELGIAKEMPLFGHMPYVMGQGNKKLSKRDPESNLFLHRDN
FT                   GFIREGLLNYLALLGWSIAPDRDVFSMDEMIEKFDVRDVKANPARFDIDKAISINAEHI
FT                   RMLEPQDFLNRAVPYLNRDGVVSADSWDALTDREREILSASVELVQPRVRLLGEVAGMV
FT                   GSLLSTEGYIEPDADARKQLKDSAPAVLDAAIASLSAVADDDWKTDILHETLNKALVED
FT                   GGYKPRLAFGPVRVAMSGRRVSPPLFESMEIVGKEISLARLQGLREHL"
FT   gene            336143..336218
FT                   /locus_tag="BDP_tRNA7"
FT   tRNA            336143..336218
FT                   /locus_tag="BDP_tRNA7"
FT                   /product="tRNA-Glu"
FT   gene            336254..336328
FT                   /locus_tag="BDP_tRNA8"
FT   tRNA            336254..336328
FT                   /locus_tag="BDP_tRNA8"
FT                   /product="tRNA-Gln"
FT   gene            336446..337882
FT                   /locus_tag="BDP_0266"
FT   CDS_pept        336446..337882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0266"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08946"
FT                   /db_xref="GOA:D2Q7X5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X5"
FT                   /protein_id="ADB08946.1"
FT                   /translation="MTELQHAAKAASTRPRIQPAEEGDGRPLSVSARLGRLQFHQSGKF
FT                   RVLQFTDIQDGPKVSKDTVKLIEASLDATRPDIVIFTGNQIAGYDAAYSQTMRKRRWNK
FT                   AQAAVQSSAERYEEALRQTRSMVRSTIEQLVRPLADRSVPWVVTFGNHDFQCGLDNAEV
FT                   ERICQEFPGCLNPAPTETSAGEKVGMLPEQRVYGCEPGTFALPVMNVDRTCNVLGLVLV
FT                   DSGDYARSGGYGSPSVAALRFLADVPHALVTQSQAIAAPRETQASQEALPCMVFQHFAI
FT                   PQYYDLLKPVAANAARAIEGYRNFAGNHYVLDESKTQPGSYLGEGISCPDADSGEYAML
FT                   CDNGYFAISAGHDHRNGFVGTVAIPGTQAAEQTAGECSAESEASAGAHGLMMIASPTSG
FT                   FGSYGPVPEKRAARLFEFDIRHPYEPRTQLLEYGELVGKPSTGKAYAYGMTSESRPDSE
FT                   GMDLLHRPTWWSKLLSRFRK"
FT   gene            complement(337895..338716)
FT                   /locus_tag="BDP_0267"
FT   CDS_pept        complement(337895..338716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0267"
FT                   /product="Transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08947"
FT                   /db_xref="GOA:D2Q7X6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X6"
FT                   /protein_id="ADB08947.1"
FT                   /translation="MTSSNTRITMPESQQDDAATPAENPYQTTTENNEIHSGVGVLDKT
FT                   VKILDALESGPATLGQLVAATGLARPTAHRLAIALERHRFVLRDQHGRFVLGSRFAELA
FT                   AAAGEDRLLTAAGPILQTLLDRTGESAQIYRRQGDQRVCIAAVERASGLRDSIPVGAML
FT                   SMEAGSAAQILLAWEDSERLHQGLRHAKFTAAKLSAVRKRGWAESVNERDEGVCSISAP
FT                   IRNASGQVIAAISISGPNGRMGVNPGRRYAPLVMAAGKYLTEALIKASAGR"
FT   gene            339001..340404
FT                   /locus_tag="BDP_0268"
FT   CDS_pept        339001..340404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0268"
FT                   /product="leuC 3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08948"
FT                   /db_xref="GOA:D2Q7X7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X7"
FT                   /protein_id="ADB08948.1"
FT                   /translation="MGTTLAEKVWADHLVRKGSDGAPDLLYIDLMLMHEVTSPQAFEGL
FT                   RLAGRKPRHIDQLIATEDHNTPTVDIDRPNPDETSALQLSTLEKNCKEFGVRLCPLGDA
FT                   DQGVVHAFAPVLGLTQPGMTIVCGDSHTSTHGAFGAMALGIGTSEVEHVMATQTLSLKP
FT                   FKTMAINIEGELPKGVTAKDIILAIIAKIGTGGGQGHVIEYRGEAIRKLSMDARMTICN
FT                   MSIEAGARAGMIAPDEVTFEYLKGRPHAPEGEMWDKAVEYWKTLKTDDDAVFDTEVTIK
FT                   AEDLEPYVTWGTNPGQGIRISGNVPDPESFNDETERTAAERAIEYMGLKPGMPIKDIAV
FT                   DTVFIGSCTNGRLEDLRVAAAIMKGHHKAENIHRVLVVPASSRVRLQAEKEGLDKIFKD
FT                   FGAEWRNAGCSMCLGMNPDKMVARERSISTSNRNFEGRQGKGSRTHLASPAVAAATAIR
FT                   GTICSPADL"
FT   gene            340442..341131
FT                   /gene="leuD"
FT                   /locus_tag="BDP_0269"
FT   CDS_pept        340442..341131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BDP_0269"
FT                   /product="leuD 3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08949"
FT                   /db_xref="GOA:D2Q7X8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X8"
FT                   /protein_id="ADB08949.1"
FT                   /translation="MEKLTTLTGVAVPLRRSNVDTDQIIPAVFLKRVKKTGFDDALFYA
FT                   WRRDPEFVLNQPEYKQGKILVAGPDFGIGSSREHAVWALHDYGFRVVIASRFADIFYGN
FT                   TAKNGVLAAIMPQESVELLWKLLDEEPGRDMTVSLEDRTVTCGDVTLPFEVNDYTRWRL
FT                   MNGYDDIDLTLQHEDDILAYEKMRAEKFPFKPKTLPVRREPEQPIESAREGEYPDWQGP
FT                   LADRGII"
FT   gene            341211..341711
FT                   /locus_tag="BDP_0270"
FT   CDS_pept        341211..341711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0270"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08950"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7X9"
FT                   /protein_id="ADB08950.1"
FT                   /translation="MGPRVARSVIAGRVRWPIAALFSRGGRLVVRCSIWETYSAFANTE
FT                   GGMILLGVSERSDHSLHITGVDDAHKLVQDFWNTVHDSSTISSVVLSENDVVVRHTGQG
FT                   DIVSIDIPRASRERIPVYVGPNPLKGSYRRNGDGDYLCDSETVHAMLRDSDLRPLDRKI
FT                   VGG"
FT   gene            341701..342384
FT                   /locus_tag="BDP_0271"
FT   CDS_pept        341701..342384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0271"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08951"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y0"
FT                   /protein_id="ADB08951.1"
FT                   /translation="MADEVIHGGISDARNPILMKMFNLIGIGEKAGSGFDVMRAGCDFA
FT                   GTAYPELEVGEHPDRVTLTLYPRKIQDYGAVEGGGISTPSGSAVSDFAVSGSSIPAGPM
FT                   AIASAGTATPITATGANATYAPNGRRMAEVGEDAGGGQRSSIRFNLGGASLVAQPMEPQ
FT                   SNVEKITRALTAGGPLPTSQLAKVLGLGLTRTREILGSMVGEGVIEPVGVGRGRKYQIV
FT                   SDKAA"
FT   gene            complement(342426..343367)
FT                   /locus_tag="BDP_0272"
FT   CDS_pept        complement(342426..343367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0272"
FT                   /product="Two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08952"
FT                   /db_xref="GOA:D2Q7Y1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y1"
FT                   /protein_id="ADB08952.1"
FT                   /translation="MYVIAADDEPLILNSMTRLLHAVFPDAQVRGFGTAQEVESFAREA
FT                   VASCANIAYAFLDLRLRGENGLRLAKAIKDISPHTKIVFSTAYADYSFGLRGDSNTGFV
FT                   MKPATEGDIRDCVAVLDDVLRREPSYRGEFPTDAANGRHEQLMIRTFGDFEAFHHHEPL
FT                   PWESQEAKDLLALLIHARTAPLTDTRIADALWPVDADSTDARDAGATRMERQSGYAGRP
FT                   KHAFALSLRIRGLVKSLRRTLQTVHPQAGKLICHSHNTTSVSTDPIDGLTVHCDLFDML
FT                   HGSAYAVNTYYGEYLPAYPWASFPIADLDPDL"
FT   gene            343461..344777
FT                   /locus_tag="BDP_0273"
FT   CDS_pept        343461..344777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0273"
FT                   /product="Two component system histidine kinase sensor"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08953"
FT                   /db_xref="GOA:D2Q7Y2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y2"
FT                   /protein_id="ADB08953.1"
FT                   /translation="MPSDILHKQGVSPERTRSKSMNHIRRALTYWYTFGYPEINSPHYI
FT                   RRLACDNLDMVRRCCMFCQLFLMVMCITRLALVGCEWINLWPFVIASVIVTIILVINNR
FT                   LDDTKNVLFHSYAQTAVFSVTLVVLAGFYDFIAAPGSIAVMTCMALLCVGSLFDSRPID
FT                   NLIAYAIGLAVLYAIALAESGPSLVSNLFNMAVSVLLGLCISWYKSRSHFGQLLANDKE
FT                   LKALQHAARVQIMVSQINPHFVCNVLATIQAMCDTDVDKAKEALGLFSAYMRDNTDAVA
FT                   RTEPVPFAMELQHVKRYVSLEQMRFGDKLAVMYDIDTTDFRLPALTVQPIIENAIKHGI
FT                   GKKENGGFVRLSARERQGVVRIEIADNGVGMDERTLYGLTGSILQTAESVDRPEGDGRS
FT                   HVGLTNVRERLRLMSHGTLAVSSQPGRGTTVIISIPKGI"
FT   gene            344906..346033
FT                   /gene="pyr"
FT                   /locus_tag="BDP_0274"
FT   CDS_pept        344906..346033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyr"
FT                   /locus_tag="BDP_0274"
FT                   /product="pyr Dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08954"
FT                   /db_xref="GOA:D2Q7Y3"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y3"
FT                   /protein_id="ADB08954.1"
FT                   /translation="MSQGFAPFYDVNRTYEDNYLQGPFGAFAKVLQEDRGPSAAQSSAP
FT                   VQTASGEDFLGFHVNLPFGIPAGPLLNERFTTAAFRMGFDLAVYKTVRSRAWGCNAFPN
FT                   VLAVHPKNADGSLIPGSAELDEGVLADTRYELPISISNSFGVPSRDPDEWQPDMKKAIE
FT                   AAGSGQLLVPSFQGSRVDGMDQDDYIADHVTTARLVCETGAGLMEMNTSCPNEGHNRLL
FT                   CHDPHLVGRITEAVKNEIGDRPLVVKLAYIPNDADLEIMVKETAAHGTVQGFSTINTIS
FT                   AKLVDAHGNQALPGAGRDRSGVCGNAIRGAGLDMVGRLHAIREKLGLDFTIVGVGGVVR
FT                   PEDYRAYREAGANAVMSATGAMWNANLARDIASSI"
FT   gene            346161..347486
FT                   /gene="murA"
FT                   /locus_tag="BDP_0275"
FT   CDS_pept        346161..347486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BDP_0275"
FT                   /product="murA UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08955"
FT                   /db_xref="GOA:D2Q7Y4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y4"
FT                   /protein_id="ADB08955.1"
FT                   /translation="MSENKDDILHVVGGKPLNGTIKVRGAKNFVSKAMVAALLAPGKSV
FT                   LKNVPEIRDVHVVSDLLRLHGVDVDVDGAKGIVTIDATKVQLADVADVDTLSGSSRIPI
FT                   LFSGPLLHRLGEAFIPALGGCNIGGRPIDFHLETLRKLGANVDKEHKDGIHITAPDGLH
FT                   GAKIHLPYPSVGATEQTLLAAVLAEGKTELSGAATEPEIMDLVCVLQKMGAIISVDVDR
FT                   TFRIEGVKELKGYTHTSLTDRIEAASWASAALATHGDIFVKGATQPEMMTFLNVFRKIG
FT                   GEFDITDRGIRFWHPGGDLKPVAIETDVHPGFMTDWQQPLVVALTQAKGLSIVHETVYE
FT                   NRFGFTKPLVQMGATIQLYRECLGSLPCRFQQRNYKHSAVIFGPTPLTGRDIDVPDLRG
FT                   GFSHLIAALTAQGPSNVQGISLIDRGYADFRGKLEALGADFD"
FT   gene            348679..352410
FT                   /locus_tag="BDP_0276"
FT   CDS_pept        348679..352410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0276"
FT                   /product="Putative sortase-anchored surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08956"
FT                   /db_xref="GOA:D2Q7Y5"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y5"
FT                   /protein_id="ADB08956.1"
FT                   /translation="MVAAFVAVATLLAMVVVSGVASHQSAWAGELQGFDIGSKVTSLEI
FT                   KKKVNGSWVDAVEITPDDDVRVTVQFVGAETQSIKSNGNKAYIKVDGPADCSSFAGKSY
FT                   ELTDSAYSVSHGGTPGNYEYVKQGDNWYIVLTFNDAYLDWGGQTIQGSVYLNMKAAQDQ
FT                   YPSDGKSETITIGEKSGQVTVKPGKDQQGGDGKGSYNLQKSASNLHYSEDSKTAYYDYT
FT                   VTLTVNKDVTGPIEMKDTLTGKGWSYVEGSWKVSGDNAPSISPTVGTNDSGATASIIIG
FT                   ENGKTIKAGTYTITYSTSTSIESSKFKSKDGISNKVEISGSDAGTTIWPSSKTQTINKS
FT                   GNYADGEITWTVTLNKGDIVQFLDQPADFTDTIPDGLELDGDVTVTQYNADGSVVGSSS
FT                   ATVTDGKTISYSTPTGQYYYVITYKTKVSDNASIPIGGKEFTNTGKTTGGLEGTSDGKV
FT                   TVPNHVVDKQRVSQDNPTSTDGKTTANVHWKTTINVNGSLDGYTYDDYAGTYWSNILNK
FT                   HVNPMSMSDAQRNAIVVKGADGKALTKGTDYTVSASDHTENGIATGLFKIIFKEVTGPV
FT                   TIEYETTVDGSMLNGQTARNVAYVTDGKGHSDTDEAYTETIQVINKKDLIWKFSNTQND
FT                   GDASEKNIDLEVGQALPWTLWLNKGKTLTGDLTVVDTLPEGVKFDESSLKIAIASDGNV
FT                   YGNVGTWGTLGDSSKVTYQYDSSTRQLTLRIPKEAYVVNGQSLMIFVTYSTPVTDASGK
FT                   GFSDNDRLKFTNKASLEQNGETADTSFTENVKRTPVAKHGSYDQINGKLNYTIPLNPDG
FT                   ATLNGGSPLTVTDTLQAGSMQSKVKLDSVKLFTAVTVDGTIQAGTWVKDLQLADNASVD
FT                   TYTYDEANNKFETKIADSTAYVLETTYSVSGADDVADDIQVTNTVKLSGNQEWNKSDQS
FT                   TKIEAATGGSVSTGDHILLIKHDKAYFEKKLSGAKFTLEALRDGTWMSLAILITNDQGQ
FT                   ALYPSGQENVGLRQTLYRLTEIQAPDGYELDSTPYYFYVIDEDATFDVPESIEGDQSYE
FT                   PSNVVAYKLPKNQNAMLTIDRYDEEEVKPNPGQIKVTKVWKDKDGQEVTDPVALSKMVP
FT                   VQITLTKTVTAEDGSVTTETVGTKELSSDNNWVCEWNDLSAEENVKYSVIETPVDGYRA
FT                   TYKLNGEASAGTNFSLEQDGDLVTVTNTPASASVELPSTGGMGDAWFIGGGVLTVLVAS
FT                   FGLAESLKNAKRSKVSQK"
FT   gene            352647..354134
FT                   /locus_tag="BDP_0277"
FT   CDS_pept        352647..354134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0277"
FT                   /product="Putative sortase-anchored surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08957"
FT                   /db_xref="GOA:D2Q7Y6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y6"
FT                   /protein_id="ADB08957.1"
FT                   /translation="MKRAINALVAVLATVAMAVAGFMGAGTAFADEANTITGPKNGHTY
FT                   EAYQIFTGDLADGKLSNVKWGSATAKNGTAVTDAELKTVTDLASKSVNDNAQATANAIA
FT                   AYLKSDAQPTATIDDTNPTAQVPSGYYLIKDKNNTVPDGQAATTYIVTVAGNVTITPKS
FT                   DVPSFEKKLKDTNDTTGETSDWQDSADYDINDAVPFKLEGTVASNYADYDTYYFAFHDV
FT                   EENSLTFNKDSVKVYVDDTEITSGYSVVTEGLTDDCTFEVKFANLKTIDGVKAGSKIRV
FT                   EYTSTLNENAVLGKHGNVNKAKLQFSNNPNDSQNGETSPTGETPWDNVIVFTYKTVINK
FT                   VDDKNQPLKGAEFTLSKKMKDGSTKTVAVVKDSEGTTFTFNGLDDGDYVLTETKTPAGY
FT                   NSIKPITFTVTANHTITWEGEDRDTILTSLSGNAASGEITFTPTDDKSELDTNVVNKPG
FT                   SSLPETGGMGTIVLYAAGAVLVIAAGVYFGLKKKNAR"
FT   gene            354265..355206
FT                   /locus_tag="BDP_0278"
FT   CDS_pept        354265..355206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0278"
FT                   /product="Sortase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08958"
FT                   /db_xref="GOA:D2Q7Y7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y7"
FT                   /protein_id="ADB08958.1"
FT                   /translation="MSAFFAFVLVAGLVLLAYPSVANWWNQLHQSRAVATYIAQSKDYS
FT                   KQQRKVMIAMARQYNAQLSQRALLSKSENENDRWVMTDAEKRYYESVLDSTGTGVMGYV
FT                   TIPSIKVRLPIYHGTDEGILQIATGHIAGSSLPVGGESTHAVVSGHTGLPSAKLFTGLD
FT                   KLKKGDTFAFHVLDQTYTYQVDQISVVLPKDLSKLNIESGMDYATLVTCTPYGVNTHRL
FT                   LVRGHRIANPDAADTTDYDARIRLMSAIIITTTLLVLTAIFSWLAWTTRRYLAQKRAMR
FT                   PMPLSGEPWDDVAGIADPLNDNQRRHAKEWRK"
FT   gene            355254..356201
FT                   /locus_tag="BDP_0279"
FT   CDS_pept        355254..356201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0279"
FT                   /product="Collagen adhesin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08959"
FT                   /db_xref="GOA:D2Q7Y8"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y8"
FT                   /protein_id="ADB08959.1"
FT                   /translation="MIVAFVCAAACALAVALGAGVAVAHADETGRAGGTGTIELKYEYQ
FT                   GESLEGDGVSLYRVADWDGGAFTLRDEYADADFGTDARGWDGLMDDLKDGKASAEQFQA
FT                   AANTLDAYVRAEGIEATQTGTIYGLGASFSGVDKGLYLVVYDRFEDAVKTCGSSASLVS
FT                   VPSNENGKLVSDVKAYSKSSCEATPESPETTRVDVTKVWKGDTQQARPGSIQVQLIRDG
FT                   EVYDTATLAAGNNWKHSWSGLDASHDWLVREKNVPEGYVVAVERDSTDVTITNTATKQA
FT                   STGSNVMVVAGLMVAVALAALVTLAIVRTRRNRN"
FT   gene            356699..357265
FT                   /locus_tag="BDP_0280"
FT   CDS_pept        356699..357265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0280"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08960"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Y9"
FT                   /protein_id="ADB08960.1"
FT                   /translation="MAGSQGLFTLKEAAYLRSLPAVKEVSATRITYSDRFKVECVRRYL
FT                   KGESARKIFRDAGLDPSLIGAKRIERCIARWKTTKSIVDEAARIDANASGEDGVDTAAS
FT                   GQVGCIDAKSVLDSYDIANAAFAAISTSKSGREMFDVRDLIIYQQVQQITALQEKVAEL
FT                   QRRIEHLTDVAAARNVATETAAATD"
FT   gene            357401..358321
FT                   /locus_tag="BDP_0281"
FT   CDS_pept        357401..358321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0281"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08961"
FT                   /db_xref="GOA:D2Q7Z0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Z0"
FT                   /protein_id="ADB08961.1"
FT                   /translation="MRGGRASPPTMVGMASKGKPSPRSAVKPLSDAQVAKLAAAHHLVD
FT                   PTRDFPTGPRTANTAEIEAQNPKATHRLLTGCDVVLRNRSKVRAWGLEHVPETGPFITA
FT                   ATHVTMYDVFVPMVGLFHQGRRPRYMAKAEMATWPLIGKWFQLVGMQPVQRRSGKAKAI
FT                   EETSIEILTSGRPLTVWPEGTVTRDPQKWPMSMKNGVGVIALESSRRLGYQVPLFCSVT
FT                   WGAASINHFWPWPRKNVVMCYDAALDYADLLEGSSEWGESVPEHLADELTRRIRVRMTE
FT                   IMAEIRGEQAPDGYWDYRTMRRVRE"
FT   gene            358435..359433
FT                   /gene="gpsA"
FT                   /locus_tag="BDP_0282"
FT   CDS_pept        358435..359433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BDP_0282"
FT                   /product="gpsA Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08962"
FT                   /db_xref="GOA:D2Q7Z1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q7Z1"
FT                   /protein_id="ADB08962.1"
FT                   /translation="MTNVTVLGAGAWGTTFGQVLADAGNNVTMWAIEPEIVEGIRDHHH
FT                   NGVRLPSVAVLPNNMTATGDRAEAVRDADIIIVAIAAQFARVALQEFKDLIPKTALVAS
FT                   LMKGIERSTGKRMDEVVTETLDLPAERFAAISGPNLSKQIADREPAATVVGCTDLDNAR
FT                   TIAAACSTDYFRAFVTRDVIGLEMCGSLKNVVALAVGMARGAGYGENTAAMIETRGLAE
FT                   LTALGAAAGADPKTFAGLAGVGDMIATCGSPLSRNYTFGSNLGKGLSVEEATKVSNGVA
FT                   EGVPTTDAVVALGKQYGVATPLATAMSHVLSDGISCAQMLSELFDEGISEE"
FT   gene            359501..360637
FT                   /gene="ddlA"
FT                   /locus_tag="BDP_0283"
FT   CDS_pept        359501..360637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BDP_0283"
FT                   /product="ddlA D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08963"
FT                   /db_xref="GOA:D2Q827"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q827"
FT                   /protein_id="ADB08963.1"
FT                   /translation="MAKKRIVVMYGGKADEHSISCISTAGVLRALDVEKFEAIPVGITK
FT                   TGQWIVDGEDPRGWNMSEGMPIVRKTDTAKDVVLDVALGQDGFFAREADGTLTSLGHVD
FT                   AVLPVLHGPYGEDGTIQGLFEMMNVPYVGCGVFASAACMDKHYTKVLLAAAGIPVAPGI
FT                   TLDARDCDAACAFAANGETMLAAVQAAGLRYPLFVKPSRAGSSFGVTKVEREGDAAELA
FT                   AAVFEASHHDWRVLVEQGIDAREIECAVLCPKAGDEPRASWPGEIVLDKRAGGDDQFYD
FT                   FDSKYMDAEASHVEVPAALPQETLELVRETAKKAFKAVDGTGLSRVDTFVTADGKVMVN
FT                   EINTMPGFTPISMYPKAWDATGVSYTDLISTLIEGVLE"
FT   gene            360799..361956
FT                   /locus_tag="BDP_0284"
FT   CDS_pept        360799..361956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0284"
FT                   /product="Solute binding protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08964"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q828"
FT                   /protein_id="ADB08964.1"
FT                   /translation="MISLRKFAAGSIAAVLAFSMAACGSSSNSSSETSGKAVSVDEKSA
FT                   SATSLEDFGTMDDLVAAAEKEGALNVIALPHNWSNYGEVINGFKKKYPKIKVNEQNPNA
FT                   SSKEEVDAGKTNKGTDAAPDVYDLGLAVASTSTDNFASYKVQAWDKIPDSAKDKDGKYY
FT                   ADYTGIMSIGWNADKYGDINSIDDLTDAKFAGTVALNGKPAEAGAAFNGYLMINQLAGG
FT                   DIDNLQPGLDFFKKLKDCGNLTTVDVTDGTIDSGQTGVVMDWTYNQASYQKSLKEKGVN
FT                   WKYKTFKNAQVVSYYNQAINVDAPHPAAARLWEEYLYSADAQNEWFKGGANPLLLDSMK
FT                   EDGTVDQDTLKSAITIEGDPVSYTNEDSTRITEWLQNNWDKTIGN"
FT   gene            361958..362872
FT                   /locus_tag="BDP_0285"
FT   CDS_pept        361958..362872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0285"
FT                   /product="Permease protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08965"
FT                   /db_xref="GOA:D2Q829"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q829"
FT                   /protein_id="ADB08965.1"
FT                   /translation="MTAALTSGARANRAGSSAISLSAHKRELGTFAVSIPFFAYTACFL
FT                   LAPTAIVVIGAFQAADGGFTIANFAKLFEANTIAAFATSILVSLASAVIGAIVGALASY
FT                   ALVIGSKPNGLLRRMISAISSVLAQFGGVMLAFAFIATIGINGMGTVLIKQLTGLTVNP
FT                   NWLSSLPGLITIYCYFQIPLMIIIFLPAVDSIRPQWREATESLGGNTFQYWTRVAGPIL
FT                   APRFISAFLLLFASAFSAYATAAALFSQRSILVPLMIQGAMRNEMDPNQQGFAQVLAFA
FT                   MIVVVAVVMLMSHAVEKRAGQWQ"
FT   gene            362863..363765
FT                   /locus_tag="BDP_0286"
FT   CDS_pept        362863..363765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0286"
FT                   /product="Permease protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08966"
FT                   /db_xref="GOA:D2Q830"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q830"
FT                   /protein_id="ADB08966.1"
FT                   /translation="MAVNAAPVTTQSQKTASPQAKQMPPQLRAARVDKQRIIKTVILGV
FT                   TLLFLFVPLVSMFLFTIRHPLSGKWSLDPWIAIFTGDGSALGADLTTLWSGLGTSLALC
FT                   VVTVAIMLALLVPTMVIVHIRSRRLERIIEWVATLPLTIPAIVLVVGLGPIYRWLSADV
FT                   FSTNPIWLCFAYVVLVMPFAFRALAVGLNSIDVKTLCEASRSLGSSWPRVFFRVLIPNL
FT                   WQSILSASFISIAVVLGEYTVASLLGRMNLQVALYQLGQSNSQISTAMSLLALLFGVIL
FT                   LVALDLISDAIRRSKEGDK"
FT   gene            363765..364985
FT                   /locus_tag="BDP_0287"
FT   CDS_pept        363765..364985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0287"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /EC_number="3.6.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08967"
FT                   /db_xref="GOA:D2Q831"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q831"
FT                   /protein_id="ADB08967.1"
FT                   /translation="MSLAEQKAVVAHTAEAFTDVEPDANMVTEAAKAVLKDSEAHGGGV
FT                   QMLGVDKIYPGSNVKALNDFNLEIKPGEMVVLLGGSGCGKSTALRSLAGLEDIQAGRIL
FT                   VGGQDVTGVPVNKRDMAMVFQAYSLFPHMTALQNVEFGLEIRGVTRAERRHLAMEKLDL
FT                   VGLADQAGKYTQQMSGGQQQRVALARALAVNPRVLLLDEPLSALDAKVRVQLRDEIRRI
FT                   QLEAGTTTVFVTHDQEEALAVADRIGVMNHGRIEQIADPQTLYRRPETEYVATFIGLTN
FT                   RLPGISNGAEAVVFGQRVPLLEGSRKEGAVVLVRPENMTIAMHEAGVAGSGSGAGEVGR
FT                   VEMVHFLGALARVDVRIMAAEYRGLGGEDGAALRVTVQVPANELPSGLTVGSEVMVAPR
FT                   PIAALAV"
FT   gene            365069..366208
FT                   /locus_tag="BDP_0288"
FT   CDS_pept        365069..366208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0288"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08968"
FT                   /db_xref="GOA:D2Q832"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q832"
FT                   /protein_id="ADB08968.1"
FT                   /translation="MTMTFPQQPQYPPQYPQYPPQQPQYPQYPQPRSQYPQQMPPQQPY
FT                   PQPASPYDFHAWLKDAKRNFSRIGWGMCAMVVAWEGLAVIVSALLRSTVLQHASSMPNW
FT                   AIYLCSSMPLYCVAMPLAWLLMRTVPALPTREFRLGPKRFFMLFVMILPLVYVANIVSV
FT                   ILAMLLSGGRANNNLADVVSQIDIWNVVFLVICAPIFEEWMFRKQLISRLRRYGEKTAI
FT                   LFSALAFALFHMNLYQALYAFMLGLMFGYVYTRTSRLRYSVAMHVLFNFNGGVIAPWVA
FT                   SRMDAKTLSMMSSNGAGAGAQVAGVVLIVMLYGLCMLGLIIAGVILLVREAKHLEFYTA
FT                   PEELPRGTRVGTALGNSGMVAFIILTVALTALTLIVSMV"
FT   gene            complement(366248..367036)
FT                   /locus_tag="BDP_0289"
FT   CDS_pept        complement(366248..367036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0289"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08969"
FT                   /db_xref="GOA:D2Q833"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q833"
FT                   /protein_id="ADB08969.1"
FT                   /translation="MDPLEIIWKWLQSNYGKLVFLAIVVLIAIIIDKALTRVVRKILDR
FT                   SQVPNASIFVNILRVVVWVLAVATVLQPVFGVNPTTLFTALGIGGLAVSLGLKDTIANV
FT                   IGGFGLMLGHVIQPGDYVSVSGTKGVVKDINWRQTIVRERNGNEMVIPNSILNTASLEK
FT                   LDPINECLVQVPFTAKAGIDPDQMEQDIIAAVEKETKGLANTQYPTKVKLTGFSPYGIE
FT                   GMVYAFAKSDLLLSTMADAVARAIANAEYLEHGAIATDEQ"
FT   gene            367089..368345
FT                   /locus_tag="BDP_0290"
FT   CDS_pept        367089..368345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0290"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08970"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q834"
FT                   /protein_id="ADB08970.1"
FT                   /translation="MGNVVDYVRSEFRTFGELEFSNVDSLVLSELSYMCLSGLVPAFEA
FT                   AKSVATVPIARLLRAEDYPAMFASNSGDMNDYRLALLRAVCESPRFRGLRVGEYAERLD
FT                   TCREQQFAAMTFDLGDCPHAVASPDSDDSADSSAGAAGLLYVAFRGTDGTLVGWKEDFN
FT                   MAVRCPVPSQESAYRYVDSIMERSAGFLSVSSAPDIMIGGHSKGGNMAAYAAMLVAQHD
FT                   IEESCEQARNLGLMPALGGTVAGRNGRIPRIYSHDGPGLPQAMVDGQAYRAISGRIDKT
FT                   VPESSIVGMLLQTSAHYTVVKADAIGIMQHLGASWQVADGAFERASGLSGGAQVVKKTI
FT                   DTWLDTVGRERRGRAIDQLYEIFAAAGYANIADLTANWTDSLPKILAAAKGTDRETRAL
FT                   IRDVLKAVPASAAKALDPR"
FT   gene            complement(368342..369076)
FT                   /locus_tag="BDP_0291"
FT   CDS_pept        complement(368342..369076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0291"
FT                   /product="Putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08971"
FT                   /db_xref="GOA:D2Q835"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q835"
FT                   /protein_id="ADB08971.1"
FT                   /translation="MRFAIEKIFLWWLFYSVVGWVWETGLNLVLRKKWVDRGILNGPLC
FT                   PIYGFGAASVIVLLHDVDNPIALFLSSGMLACTLEYFSSWAIEKLFHIRLWDYTGKPFN
FT                   INGRIYLNGFLAFGIGAAVVKEYVQPWVSDVLDSWQPLTLDILTIIFTLILVTDISLTL
FT                   SGLLSFDNRITQLQRELAQYEARGRERFDEKFAATEARARKVLSWQQQRLIQAFPTMTS
FT                   VRDSRIMQRVRESMSRHDSRTR"
FT   gene            369349..370554
FT                   /locus_tag="BDP_0292"
FT   CDS_pept        369349..370554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0292"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08972"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q836"
FT                   /protein_id="ADB08972.1"
FT                   /translation="MGNIIDYARTETRSFETLPFRAADALVLAQLSYDDVPECVPTLDE
FT                   LYARYSTFARRVQSFSFRRPIASLRTLRFAPFHGVTIAHADDELHHDRAVPDHDVESVG
FT                   LIDPQITHDFYRAVAANPRFADVEMSAFCEQFDGDEQTQFAAVTYRLPNNTLVVTFRGT
FT                   DDSLVGWKEDFNMAFRYPVPAQVSAADYLGKVAQLWRGPIILTGHSKGGNLAVYAAMNA
FT                   EDKVKDRIEHIYSLDGPGFPEAVVRSFEYASVHERITKIVPDSSVVGMVLETPERCMVV
FT                   KSDVDGIMQHFAFSWQMHGGEFAKVEDVANSSVTFNKSLNGWLSGLSEEQREHAVDALF
FT                   SVLAASGADNISGMVAAGPKVIPDMLGTYVGLSGEDRRNINQALMILLQAALSRNPKVQ
FT                   RK"
FT   gene            370681..371334
FT                   /locus_tag="BDP_0293"
FT   CDS_pept        370681..371334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0293"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08973"
FT                   /db_xref="GOA:D2Q837"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q837"
FT                   /protein_id="ADB08973.1"
FT                   /translation="MPRPRRDSEILPAKERLENAFWELLAERNYHKITVTDIVRVADVN
FT                   RNSFYYHFSGLPELADSAILHAVENTPIPSRPGANFNPDDEWRKHITALLRDPDQRQRL
FT                   DRLALLAGPHSSPELIESLRDFGRLTMISVLGLDAEHLDLKTDLMLDFTVGGMLAVLQR
FT                   WPKLHEQLPIDTVFNEDLAVLAAGMFMSMSRSNMLDYWRRIFSNGFVPGANPRQ"
FT   gene            371438..372628
FT                   /locus_tag="BDP_0294"
FT   CDS_pept        371438..372628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0294"
FT                   /product="Aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08974"
FT                   /db_xref="GOA:D2Q838"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q838"
FT                   /protein_id="ADB08974.1"
FT                   /translation="MINEAYKAMLGGKSVIRELSEYATARGAEIGYENVFDYSLGNPSV
FT                   PCPQSFTDVMADMYATAEPVALHGYSPSLGIPSVRTAIAESLNRRFGMDYTADHIFPTT
FT                   GAAGALAHALRVVTKPGDEVITFAPYFPEYQPYVDGTGARLTVVPADTQNFQINFEAFE
FT                   DAMNPGVAAVLINTPNNPSGAVYSAETLTRLAEFLRAKQVEYGHDIFLISDEPYREIVF
FT                   DGGTQPYPSTFYDNTLSCYSYSKSLSLPGERIGYVAVNPRATDAELIVPMCGQISRGTG
FT                   HNCPSSSIQLGVAKVVDETSDLSVYETNMNLLYDALTRLGFEVVRPGGTFYIFPKALED
FT                   DANAFCMKAKDYDLILVPSDSFGVPGYFRMAYCIDTEKVERSIAALERFVHEVYGR"
FT   gene            complement(372685..373548)
FT                   /gene="gnt"
FT                   /locus_tag="BDP_0295"
FT   CDS_pept        complement(372685..373548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnt"
FT                   /locus_tag="BDP_0295"
FT                   /product="gnt 6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08975"
FT                   /db_xref="GOA:D2Q839"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q839"
FT                   /protein_id="ADB08975.1"
FT                   /translation="MGGNMAKRIAAAGIDVVGYDRSPESDRTVDSLEALVAALDAPRIV
FT                   WIMVPAGEATDGTVNELAELLEPGDMIIDGGNSRYTDDTRHAAQLDGKGIRFMDCGVSG
FT                   GVWGIDRGYALMVGGSKENFESARPIFEALKPKGDSGLVLAGPVGGGHFAKMVHNGIEY
FT                   GMMQAFGEGFATMVKSELVEDPAAVMSSWRDGSVVQSWLLDLLAIAFRTDPTLASMPPV
FT                   ANESGEAKWMIEAALELGVPTPATAAALYSRQTSRGGADDILRVVSTMRAQFGGHVTKI
FT                   DEIATH"
FT   gene            complement(373733..375079)
FT                   /locus_tag="BDP_0296"
FT   CDS_pept        complement(373733..375079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0296"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08976"
FT                   /db_xref="GOA:D2Q840"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q840"
FT                   /protein_id="ADB08976.1"
FT                   /translation="MNQGGFMNLIAAAIIGIAIIVILIAVCKVHPFLSLLAGSFAMAVC
FT                   AGVEYDKAFDSFTSGVGSTISNVGLLIAFGSIIGTILFKSGGADTIVDTIMDKTPLQRL
FT                   PWAMALIAFIVGIPMFFEVGVVILIPVVLFAARRAKTPVILLGIPALAGLSTLHAFVPP
FT                   HPGPLTAIGALNANLGITLALGLLVAIPTVIISGPLFGKLAAKWVPISAPENKAEAEAP
FT                   KSAENRPSFASAITVIMLPVVLMLAASVVDLTGQSETAWGRVLAFLGTPLVALLLTTIF
FT                   AMVVLGYLQKFTRDAVNGMVGQSFGSVAGIILIVAAGGGFKQTLVDSGIGDVIASSITE
FT                   SAMNPLIAGWLVAVLIRLATGSATVATVTASGIMVPLATGMSPTHLALLVLAIGAGSVF
FT                   FSHLNDAGFWLVKEYFGMTVGQTLKTWSLMETVLSVVGLGGVMLLSLVL"
FT   gene            complement(375125..375664)
FT                   /locus_tag="BDP_0297"
FT   CDS_pept        complement(375125..375664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0297"
FT                   /product="Gluconate kinase"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08977"
FT                   /db_xref="GOA:D2Q841"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q841"
FT                   /protein_id="ADB08977.1"
FT                   /translation="MSIHVVVMGVAGCGKSTVAEAIHERLGYAYAEGDDFHPQANIDKM
FT                   SAGIPLTDEDRWPWLQVINKWMVAREALGENTVVSSSALKRSYREALSENVPTFFIHLS
FT                   GTQELIQQRLNERKGHFMPPALLPSQFAILEPLSPDENGVEVSIEGSVDTMVERALDAV
FT                   NEYARSVAPQSRQQAA"
FT   gene            375810..375962
FT                   /locus_tag="BDP_0298"
FT   CDS_pept        375810..375962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08978"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q842"
FT                   /protein_id="ADB08978.1"
FT                   /translation="MAEINGGNTWWKHMVDTMGKRACGQSAQHAVFVMMQTSRRAAHMR
FT                   NKSEA"
FT   gene            375973..376698
FT                   /locus_tag="BDP_0299"
FT   CDS_pept        375973..376698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0299"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08979"
FT                   /db_xref="GOA:D2Q843"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q843"
FT                   /protein_id="ADB08979.1"
FT                   /translation="MAAIAENAGGELMQDSVSQTLAIEMLDGIWQAGDSLTLEDMQSRF
FT                   GISRTVAREVAKTLESLSAVWVRRRVGLVARPFSEWQALNRQVIEWRLHSTQREQQLYS
FT                   LTELRLAVEPAAAASAARLAPIDVKAKFPVYTAQMRQAAETSEEGEDGLSRFHELDVEF
FT                   HSLILRESGNELFAALAGTIATVLRGRVELGKYPMKPKPAALDAHDAVADAIAKGEPER
FT                   ARTAMLDIVDEVARALKFF"
FT   gene            complement(376732..378174)
FT                   /locus_tag="BDP_0300"
FT   CDS_pept        complement(376732..378174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0300"
FT                   /product="Alpha/beta fold family hydrolase membrane
FT                   associated protein"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08980"
FT                   /db_xref="GOA:D2Q844"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q844"
FT                   /protein_id="ADB08980.1"
FT                   /translation="MTTEASWLAVDTIIITAVANCVLPLESAHLDGAATAMNVAVAVVL
FT                   AAAVIMIPGNPTHPKTLRARNLKICYRGTAALKAFWWSAALSIVVQTVLAFHLLPSGWK
FT                   LWLGSAIICFLVESLLFWRGMIAVYVSSVQLGLKIRAIGLICGWIPIANLIALVRIIRT
FT                   TDAEVVFEEAKERLDADREAERICATTYPILLVHGVFFRDSNVLNYWGRIPDELRKNGA
FT                   TIHYGNHQSAASVRSSAYELTERIRQIVELTGCGKVHVIAHSKGGLDMRYAIARCGAAP
FT                   FVASLTTINTPHRGCGFADYLLSNIPEAVQRQVEAAYNAAAARLGDPQPDFMAAVHDLT
FT                   QAGCARLNAEMQSESANPPQRKQTEAHADAVRSPMPEPLNNSRFAGMVCRSVGSRLKHA
FT                   TTGKFPLNFTYPLVKWFDGPNDGLVARSSFLWGESFTWIEPQGDRGISHADMIDLNREN
FT                   IPGFDVREFYVQLVADLKRRGL"
FT   gene            complement(378271..379062)
FT                   /locus_tag="BDP_0301"
FT   CDS_pept        complement(378271..379062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08981"
FT                   /db_xref="GOA:D2Q845"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q845"
FT                   /protein_id="ADB08981.1"
FT                   /translation="MSSVEELFEAMHAWPEVEAIALGGSRTTGNADEKSDYDVYLYVTA
FT                   PVPTQRRKKLLSDYCSRMEIDNNFWENEDNCTLNDGTDIDILYRDLDSFMNGVADVVEH
FT                   FHASNGYTTCLWHNVITSTIVFDRNGRFAAAQRRFSVPFPEPLRRNIIERNTRLLHGNL
FT                   PSYDAQIRKAAIRGDEVAVNHRVAAFMESYFDVLFALNRLTHPGEKRLEKLASRNCAIL
FT                   PKDFEANLDTLFGTMFTDVDQLSGTLQIIVDNLQRSVDTNL"
FT   gene            complement(379203..380495)
FT                   /locus_tag="BDP_0302"
FT   CDS_pept        complement(379203..380495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0302"
FT                   /product="Major facilitator superfamily MFS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08982"
FT                   /db_xref="GOA:D2Q846"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q846"
FT                   /protein_id="ADB08982.1"
FT                   /translation="MTYSTTADTTSKSPEANAKMTTREKKWIVYDVGNSAFVLLSTAVV
FT                   PIYANSLLKAAGETNIVSTWGYAQTIASLVIAVLMPLLGSIADVQGMKIKFFTGFFLTG
FT                   VVMCCAMALPLGWLAFLIVCVLATIGLNGSLTFYDSMLVDTTTNERMDRVSSHGYAWGY
FT                   IGSTVPFIVCIALIFGGPGLFGWTTVACTRASFVITAAWWVTFTIPLLTSYRQVHYRAT
FT                   ADQTGEAIRHTFSELASTFRAIRKNKPLWMFMIAFFFYIDAVNTVISMSTSYGTQLGID
FT                   STQLVVALLVTQFVAFPSAIIYGKLANRFGAKTMITAAVVAYMCIVFFASFLLRSAVEF
FT                   WILAILVGMFQGGIQALSRSYYGKIIPKQHANEYYGFYDIFGKTASIIGTFLVATTTSV
FT                   TGNASLGVLSIAVLLVVALAFLLLQKDPTRA"
FT   gene            380803..382749
FT                   /locus_tag="BDP_0303"
FT   CDS_pept        380803..382749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0303"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08983"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q847"
FT                   /protein_id="ADB08983.1"
FT                   /translation="MGADVPNVLDANADMLQLLVNQPLPDAVDMIIWRGSTNAEQAGPF
FT                   ERFAARLLIEAGAARIRDIAAGSDLEAIRLSTTKRFWLRFDAGELSQEQCDLLHAVESA
FT                   LNRIDYADDEAHATVQDGMSADSIDERFYLRKSQEFMSDVSHKIGIIDGLQAGENRFRT
FT                   MRGVEGVRGGDWDISTRFANVCESLSLPFRMSYRFDEDARAGVMVVHFSVPKPAIMPVE
FT                   RQHADGFASAYAVRLGGLLAWAAFSSGVRITQVDLTGCLGNTDGTPVISMGFDRVPFMM
FT                   GALPAMKNGQCDEMSLDVDPLALLNLLKPVRYRGQFDANRGFTQIEPLTMPAVFLQKRV
FT                   PEWQDQRELPESLRGFLRADRACELDVMHDESPISTDDVIAIVEENEDSPMVAELQLEV
FT                   ALTQLGEAGEAKIGANGEIPLYCSRSAGRLMVSLLEGDEHTRYWKLPDAAVDVHQNLGM
FT                   LAKDNGGKERAESEGLTCIKLGPTCMRFREELAQVYAKNDEYGKAADVLIEALKLAVLP
FT                   VDCEVLYYRLGYALWQIGRLQEALACYTMMVNGGTPFRNAARDEAYELSQQMGLASAEM
FT                   SYDDACSAMRAGGIPVAPSEKVLDVLARAAIELTDAGFPLFAQDAVWVLGSRVGGDVMG
FT                   SVSASLRMGVMES"
FT   gene            382960..383154
FT                   /gene="rpmB"
FT                   /locus_tag="BDP_0304"
FT   CDS_pept        382960..383154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BDP_0304"
FT                   /product="rpmB LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08984"
FT                   /db_xref="GOA:D2Q848"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q848"
FT                   /protein_id="ADB08984.1"
FT                   /translation="MAARCAVCGKGPQTGYTVSHSHIRNKRTFRPNLQPVRTTIDGENV
FT                   RVRVCVKCLKAGKVQRAEA"
FT   gene            383279..385924
FT                   /locus_tag="BDP_0305"
FT   CDS_pept        383279..385924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0305"
FT                   /product="RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08985"
FT                   /db_xref="GOA:D2Q849"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q849"
FT                   /protein_id="ADB08985.1"
FT                   /translation="MNATLETPITSIETNRRRVGALKSLGVVSIGDALTYYPFRVTEPV
FT                   PLRALREAKIGEKMAFAAHVREVRVFPMARRGFRLIATVDDARFAQSRRVAGSLASLVF
FT                   FSYRKSYVDWVQRRLHDGALLVIAGEPSVYNDRLQFTHPDMLTVNPTDMQSDRHHDMQS
FT                   PAESGEWNDGPGDGPACDPLQSNLPQSNLTFDAETVQEALTRVCRPRPVYHANSRISSE
FT                   HIHESILKYMDALRGDEYLAAQRVATVESGRAGEFDRPNIDRAAQTEALAAAVPDIVPE
FT                   HLRAAEGLMHRAEAFMAIHDPTNTKDCDAALHTLRYEEALICQTALVKSRDASRKAAAS
FT                   ACSETALLDDFIASLPFDLTAGQRQVIADISADMACDYPMQRLLQGEVGSGKTVVAVAA
FT                   MMQAVGSGLQAVLVAPTQVLAEQHYESISKMVQRMGGAVRTAEYGESHEQSTHNQGVDG
FT                   GAQVGGRSAGGELAGTGPTGGGLAAGESGIGNLPGGDIPVLLLTGGMKLSARRRVLAVA
FT                   ASGTPCIVVATHAAFSKTFQAPNLALAVIDEQHRFGVEQRESLNAKADKAPHLLVMTAT
FT                   PIPRTAAMTWFGDLDISWLTELPGGRKPIRTFVVPEADAHTMASMFALIRSRLDAGERA
FT                   YVVCPRIDADSTEVDTSPDEDPGRSFDELYELGEDDEQRAQRPPLHSVAEIKERLAGLP
FT                   QFAGIRFATLTGRDDDETKMRVMADFAAGTTPILVATTVIEVGVDVAQASCMVIFDADR
FT                   YGLSQLHQLRGRVGRGGTNSWAFLISRAEAGSDAAQRLEVIRGSLDGAEIAQADLEFRG
FT                   AGDVLGDAQSGGRSSLKLLRVVKDVKIIEHARTAAEELVAADPDLLGEVQLAGAVLDFT
FT                   RGNETFLTSN"
FT   gene            385935..386522
FT                   /locus_tag="BDP_0306"
FT   CDS_pept        385935..386522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0306"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08986"
FT                   /db_xref="GOA:D2Q850"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q850"
FT                   /protein_id="ADB08986.1"
FT                   /translation="MRVISGRFKGVALTTPKAGTRPTTDRTKEAIFSHLDSWGVLDDAR
FT                   VLDLFAGTGALGIEALSRGARELVAVESSAPAATLIAHTLTALKRNRSWESGMSARVIK
FT                   ARAEKYAAGAAVASFDVIFIDPPYIFETEACNQLLSDLAGGDMTSSDTIIVLERPTRSD
FT                   DPTPPDGWVIADRRDYGETAVYYIEPASVGNL"
FT   gene            complement(386580..387539)
FT                   /gene="trmD"
FT                   /locus_tag="BDP_0307"
FT   CDS_pept        complement(386580..387539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BDP_0307"
FT                   /product="trmD tRNA (Guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08987"
FT                   /db_xref="GOA:D2Q851"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q851"
FT                   /protein_id="ADB08987.1"
FT                   /translation="MKIDIVSVFPEYFEVLNLSLLGKAQAKGLVTVQAHNLRDWTHDVH
FT                   HSVDDTPVGGGAGMVMKPEVWSECLDDLLGLAPATIAADAVDCAAEHACGTCDGEASIS
FT                   TDDTTAEVPDGTAADSPRPVLIFPNPSAPLFTQQDATELSHADHLLFGCGRYEGYDARI
FT                   PQYYRAQGVDVREYSIGDYVLNGGEVAVSVMLEAITRLMPGFMGNPASIVEESYTGGNA
FT                   LLEHRQYTKPAEWRGLKVPDVLLSGDHGKVDRFRRDEALSKTDELRPDLIEALDCTQLD
FT                   KADRKTLMSLGWEVSGPHPRKRESLNLPTLTHPSPSVD"
FT   gene            complement(387663..389147)
FT                   /locus_tag="BDP_0309"
FT   CDS_pept        complement(387663..389147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0309"
FT                   /product="Aspartate ammonia-lyase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08988"
FT                   /db_xref="GOA:D2Q852"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q852"
FT                   /protein_id="ADB08988.1"
FT                   /translation="MALTLHTPQRPIAPTRKAHQTRIEHDCIGSAEIPAEAYWGIHTLR
FT                   AIDNFPVSGITVSDHPELIRAYAQVKQACARANGELSNINAYQAALIDRACEDVASGEL
FT                   NDQFPVDVLQGGAGTSTNMNVNEVIANRALELGHHARGEYDIIHPNDTVNKSQSTNDTY
FT                   PAACRLALIGASGMLVDRTSQLVDAFHTLSERTMPIVKIGRTQLQDAVPMTFGQEFGGF
FT                   ASQLDADARLLSSQQTPLAVVNLGGTAIGTGICADARFRERAIRHLAELTDLPIRAADD
FT                   SVGATSDVGDFVTLSGAIKRTALHLGKIANDLRLLASGPRAGFEEIHLPARQAGSSIMP
FT                   GKVNPVIPECVNQCVFMIMGMDATISCAAEAGQLQLNAFEPVMLHALLTGMHTLANAMD
FT                   TLREHCVSGITVNEQAGMDEVMRSSSLATALIGYIGYERAMTIAQEALVRNTTVREIAQ
FT                   KEKVLSPELLDSILDPHNLTHMHCMPTGAMHGCLKK"
FT   gene            389141..389245
FT                   /locus_tag="BDP_0308"
FT   CDS_pept        389141..389245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0308"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08989"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q853"
FT                   /protein_id="ADB08989.1"
FT                   /translation="MPWCSSWLPDVFRSMAHHNRKKYIAQDEYIPDIP"
FT   gene            complement(389357..389944)
FT                   /gene="rimM"
FT                   /locus_tag="BDP_0310"
FT   CDS_pept        complement(389357..389944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BDP_0310"
FT                   /product="rimM 16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08990"
FT                   /db_xref="GOA:D2Q854"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q854"
FT                   /protein_id="ADB08990.1"
FT                   /translation="MHVDDPQQPELLRVCRIGRAQGLKGEVTVQIFTDEPEYRFAPGAV
FT                   LYTKDGEEEYVVEHSRTFKNRWIIKFEGIDNRDSSEAANGTVLYGEADDPEEMLQADEW
FT                   YPKDLIGLEARLADDNTLGLEPGMAIGKVVDVIEVAQWLLKIRLANPVKDADGVVVENS
FT                   ALVPFVDELVPDIDLEEGYLTLNPPGGLIPGL"
FT   gene            complement(389966..390205)
FT                   /locus_tag="BDP_0311"
FT   CDS_pept        complement(389966..390205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0311"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08991"
FT                   /db_xref="GOA:D2Q855"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q855"
FT                   /protein_id="ADB08991.1"
FT                   /translation="MIMLAQAVEHLIKNIVDFPDDVSVKSHENARGELIRVRVNPEDIG
FT                   RVIGRSGRTANAIRTVVQALSDHKVRVDIMDVRR"
FT   gene            complement(390202..390651)
FT                   /gene="rpsP"
FT                   /locus_tag="BDP_0312"
FT   CDS_pept        complement(390202..390651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BDP_0312"
FT                   /product="rpsP SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08992"
FT                   /db_xref="GOA:D2Q856"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q856"
FT                   /protein_id="ADB08992.1"
FT                   /translation="MATKIRLKRMGKKFYAFYRVVIMDSRTKRDGRAIEEIGTYNPNTQ
FT                   PSTININSERAQYWLGVGAQPTEQVLNLLKITGDWQKFKGLDGAEGTLKTVEAGPDAAA
FT                   RVEAVEAQAQKLKAAKSEAAAKAAAEAEAAATEEAPAEEPAAEAE"
FT   gene            391191..392234
FT                   /locus_tag="BDP_0313"
FT   CDS_pept        391191..392234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0313"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08993"
FT                   /db_xref="GOA:D2Q857"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q857"
FT                   /protein_id="ADB08993.1"
FT                   /translation="MIIALWIVLLVCIVWIALGEMPAGWDGHLPLPYLIALIPFMWIPT
FT                   LTISIAGFALHEIALGCTALAVCLASLLRKEQYWINNLQTHNTAQMIADRLAEKRETSR
FT                   ENNTEETETGAEDARHGQFRVMTLNCRFGRANAAAIVEAVKRYDIAVLALQELTENLIA
FT                   ELDAAGLADLLPYRQLGEVKESDNGGFNGVWIRVEPSDASPVTVVIPAADVPGLCFPID
FT                   SMRSITFASAHPKSPMRGCRDWSAGIIGLGAFATTQNQGDITVVMGDLNSGTDHPSFRK
FT                   LMRLGFKDAALVEAKGRRATFPSWLPWPRIILDHVLFTSGLDASDVRSFTVEGSDHLAL
FT                   AATLTLK"
FT   gene            complement(392582..394207)
FT                   /gene="ffh"
FT                   /locus_tag="BDP_0314"
FT   CDS_pept        complement(392582..394207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BDP_0314"
FT                   /product="ffh Signal recognition particle, subunit
FT                   FFH/SRP54"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08994"
FT                   /db_xref="GOA:D2Q858"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q858"
FT                   /protein_id="ADB08994.1"
FT                   /translation="MTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADVALDVVR
FT                   SFTGRIRERALGTEVSQALNPAQQVVKIVNEELTDVLGAGVDRPLNFAKNPPTIIMLAG
FT                   LQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYAPEKGVQ
FT                   SAGGEAVASPGLTTGDPVKVARDSVAFARQKLYDTVIIDTAGRLGVDEELMRQARDIRD
FT                   AVQPNEILFVIDAMIGQDAVQTAKAFDEGVDFTGVVLSKLDGDARGGAALSVASVTGKP
FT                   ILFASTGEGLKDFEVFHPDRMASRILDMGDILTLIEQAQKQFDEEEARKAAVKISDGSF
FT                   GLDDFLDQLQQVRKLGPMKNLLGMIPGMAAHRKELEQFDEKEIDRTEAIIRSMTPAERR
FT                   DPSIIDGSRRARIAYGSGVTVSQVNALLQRFEQASKMMRRMSNKAGAGMPGFGGPSMGG
FT                   GKGKSKKGKKKGSKSGNPMKREAEEKALRDKLAGKNSGGKSSGSAFAKKPQNPALPAGL
FT                   QDVMGDSGTELPPNFGGGLSGLLH"
FT   gene            complement(394286..395929)
FT                   /gene="cysS"
FT                   /locus_tag="BDP_0315"
FT   CDS_pept        complement(394286..395929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BDP_0315"
FT                   /product="cysS Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08995"
FT                   /db_xref="GOA:D2Q859"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q859"
FT                   /protein_id="ADB08995.1"
FT                   /translation="MTNTQEPQNTNTSGVAGTVQTVAGAATELKLYDTASHTVSSFVPL
FT                   RPGQVGIYVCGATVQSSPHIGHIRAAVAFDVVRRWFQRLGYKVTFVRNVTDIDDKILDK
FT                   AAAAGQQWWERAYIYEREFTEAYDTLGVEPPTYEPRATGHMIDMIDLIRKIIDNGHGYV
FT                   VTDENGNPTGNVYFDVASWPHYGELTHQKQTAVSDDASKITDAMGPSVDNAGDDKYNPI
FT                   DPADMSPDKHDPRDFALWKAPKDSDPLDARWNTPFGTGRPGWHIECSAMSHRYLKDMFD
FT                   IHGGGLDLRFPHHENEMAQTRAAGYDSAARWMHSAWVTAKGEKMSKSLGNGLSVPAVLA
FT                   ENSAWVVRYALGSVQYRSMLEWSDQTLAEAQSAYDRVANFIERAGAAVGEQPSHDEIAA
FT                   ISADALPADFVAAMNDDINVSGATAAIFTAIRSGNTLLSKLADRADSDAAKAEVREALV
FT                   NVRAMLDTLGLDPLAEPWVNGGVAGGAAGAAADSAEHAALDKLVSEQLAERAEARKSKD
FT                   FARADAIRNALNAAGIAIEDGPQGSTWSLQ"
FT   gene            396057..396785
FT                   /locus_tag="BDP_0316"
FT   CDS_pept        396057..396785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0316"
FT                   /product="putative amidotransferase"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08996"
FT                   /db_xref="GOA:D2Q860"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q860"
FT                   /protein_id="ADB08996.1"
FT                   /translation="MTQSQVLILQHVPWEKPGRILDGLDDLGLSYQIMNVAKEKKPEFP
FT                   DFDEVAGVVLMGGPMGALDYDKYPGLKAEAKLTRAAVSVGKPVLGVCLGHQIIATALGA
FT                   KLKSGDAPEIGFAPIKRVDKHDFFSMWNKTVDVLHWHNDVVTLPEGAQPLARSEKTKNQ
FT                   AFRFGSALGLQFHLEVTPTLLEEWLDEPGMVKDLKAAGGSKSKLREAYVECNPQLQPLA
FT                   DQVFSGFAARCNSYAQSLQG"
FT   gene            396951..399173
FT                   /locus_tag="BDP_0317"
FT   CDS_pept        396951..399173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0317"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /EC_number="3.6.3.41"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08997"
FT                   /db_xref="GOA:D2Q861"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q861"
FT                   /protein_id="ADB08997.1"
FT                   /translation="MPTYDLGLEHVSLAFATKTIFTDVTQGVFEGDRIGIVGKNGDGKS
FT                   TLLHLFKGTQEPDSGRVTKRNGLTFGMLDQRDPLDDDATVREAALEGREDYEWAAETKS
FT                   REIVEALLGGISLDARIGSLSGGQRRRADLARLLLKDWDILALDEPTNHLDVVTIHWLA
FT                   EHLKNRWSAGAGALLLVTHDRWFLDEVCESMWEVHDGVIEPFEGGYSAYMLQRVERDRQ
FT                   ADVRETKRRNLARKELAWLTRGARARSTKQKFHVKAARELIADVPPVRNTLELKQMATS
FT                   RLGKQVVDLIDVTQIFEHVNGESDIDPDVAEMEASASRVDVVPAMYAEPQVHGSVEVAV
FT                   DDLTDPRLVDAGVPAAQQAVEAAGRSVGKSAGTTAEQTAAVPSQDGAEPDDSAPQVTSA
FT                   AQKITVTGRKILDDVTWLIGPGDRFGIVGANGAGKSTLLKILDGTITPTAGHVNIGKTV
FT                   KFAVLSQRLDELEKLGKYKIKEVLSRYKPSYIVDGKETTPGQMMERLGFESAQLMTPIK
FT                   DLSGGQKRRMQLLLILLDEPNVLIMDEPGNDLDTDMLAVMEDLLDTWPGTLIVVSHDRY
FT                   LLERVTDQQYALIGGKVRHLPGGVQDYLDMTEAIKNGKNPFADEKSADKGRRNGNTGDS
FT                   HADVGSATASAGMATGAIGDSAGSPAADSAKLTGKAFHEASKRVAAIERKLAKLEERKA
FT                   ELESQMAEHDPSDYEGLGKINGQLQAVADESESLEMEWMELSEQLE"
FT   gene            complement(399305..399859)
FT                   /gene="ilvN"
FT                   /locus_tag="BDP_0318"
FT   CDS_pept        complement(399305..399859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="BDP_0318"
FT                   /product="ilvN Acetolactate synthase small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08998"
FT                   /db_xref="GOA:D2Q862"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q862"
FT                   /protein_id="ADB08998.1"
FT                   /translation="MANYPASQPGSKRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRVTVTADVEEVPLEQIIKQLNKLLHVLKIVDLDPNTTVERELVLIKVAA
FT                   DESNRSDVLEIVRLFRVRVVDVNPESLTIEATGAEGKIDALLGLLEHYGIIELVRSGAV
FT                   AVTRGPKALSEKVLGSEITGR"
FT   gene            complement(399887..401752)
FT                   /gene="ilvB"
FT                   /locus_tag="BDP_0319"
FT   CDS_pept        complement(399887..401752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="BDP_0319"
FT                   /product="ilvB Acetolactate synthase large subunit"
FT                   /EC_number="1.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB08999"
FT                   /db_xref="GOA:D2Q863"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q863"
FT                   /protein_id="ADB08999.1"
FT                   /translation="MVLPTPLQAFSGMPKASANTEKQTIVDGEKMTGAEALVRSLEDLG
FT                   VQDVFGIPGGAILPVYHAIKDDTKFRFVLMRHEQAAGHAAEGYAVATGRVGVCIVTSGP
FT                   GATNMITPIADANMDSIPLVVITGQVGVNAIGTDAFQEADIVGATYPVVKHSYLVTRAQ
FT                   DIPRVLAEAHYIARSGRPGPVVVDITKTAQTGDMYYSWPQRMILPGYNPTTKAHGRVLS
FT                   DAAKLFEQSYRPVLYVGGGAVRSDAGELVKELAEITDAPIVTTLPARGIVPDSDPKVLG
FT                   MLGMHGTIAATGAVQRCDLLVAIGARFDDRVTGKLDAFAPGARVIHIDIDPAEIGKNRQ
FT                   PDVPIVGDVATVLKDLIPEIKREQAMHGKPDISHWWEVINKWVEDYPIKWEQPTDGSLA
FT                   PQWVVKQLSVMADPDTIWVSGVGQHQMWATQIIEFDKPHSWISSGGLGTMGFGLPAAIG
FT                   ARVGSAREFADKKPVWLIDGDGSFQMTSEELATAFLDRTPIKIALLNNSVYGMVRQWQT
FT                   LFYEHHYSATNLLDGENTPDIMDVPDFVKLAEAYGCVGMRAFTEEEAIECIKKANAIND
FT                   RPVLIDFRVWKDAMVWPMVAAGASNDDVTYMPGIKPLQRAAAENE"
FT   gene            complement(402030..402914)
FT                   /gene="rncS"
FT                   /locus_tag="BDP_0320"
FT   CDS_pept        complement(402030..402914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rncS"
FT                   /locus_tag="BDP_0320"
FT                   /product="rncS Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09000"
FT                   /db_xref="GOA:D2Q864"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q864"
FT                   /protein_id="ADB09000.1"
FT                   /translation="MAHHQTGTKNSTSKNPRTPEASKTSKAIRPTAVKGKTAPADPTAA
FT                   STGNTRERTHISTSITTEGEMTANVLLEALGTTLAPELLVEALTHRSFSHEHPGAKNYE
FT                   RLEFLGDAVLELVSTETLYAAHPDMTEGQLAKMRAKAVSEESLSHIAREKLHVGPYILL
FT                   GNGEAEQHGAEKSSILCDIVESLIGATFIQHGIDEARKVVHHLVDDTLAEVATEGPALD
FT                   WKTSLTVKAHDMGLGEPYYRMSVSGPEYAQVFTAKAMLEGSDEVIGIGKGSSKRKAQLA
FT                   AAEAGWKALDNRH"
FT   gene            complement(403168..403362)
FT                   /gene="rpmF"
FT                   /locus_tag="BDP_0321"
FT   CDS_pept        complement(403168..403362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BDP_0321"
FT                   /product="rpmF LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09001"
FT                   /db_xref="GOA:D2Q865"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q865"
FT                   /protein_id="ADB09001.1"
FT                   /translation="MALPKYKTSRANTHSRRANWKAKAAQTVTCPNCGAPALPHMACPS
FT                   CGSFRGRVYREAVRSIHTK"
FT   gene            complement(403448..404068)
FT                   /locus_tag="BDP_0322"
FT   CDS_pept        complement(403448..404068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0322"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09002"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q866"
FT                   /protein_id="ADB09002.1"
FT                   /translation="MARIEDSPWAVSVAQVASRAGQSKPLDAMFPAPSGIGDEIVGVDE
FT                   GADVQVVGSFDSIVDGLILSARISAPVHAECTRCLKPIQRNWDVNVTAFFPYEDKTAVK
FT                   GGKNGAKASEEEVDIVAGEDESEDTYPLLEGGSWADLEALLRDTLVEELPLQPLCKPDC
FT                   KGLCSQCGIDLNEQPDHHHDVTDIRFAALEGLKARLEGTADGE"
FT   gene            complement(404071..404814)
FT                   /locus_tag="BDP_0323"
FT   CDS_pept        complement(404071..404814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0323"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09003"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q867"
FT                   /protein_id="ADB09003.1"
FT                   /translation="MMTDETQPYDVAQADDDDQTSQQPVQAASVAARTSGKPSFSMSDL
FT                   PDLRETLDPDASAEGPTGHSREEFTTVYDIIDNMEAALTEAKPSLFAPSVVKVDREMFT
FT                   DQLDQLKKMLPVQLERASALMREAERRLESAQTQANAIVASAQSRAADTVREANEQAQF
FT                   LAGQENVTEIARRKARDILDQAQAKADHLTQGADKYCSTVMESLQQQLGKLDHDVQAGL
FT                   RVLYDRQREAGEHLPHLESNDYPEG"
FT   gene            complement(404811..405305)
FT                   /gene="coaD"
FT                   /locus_tag="BDP_0324"
FT   CDS_pept        complement(404811..405305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="BDP_0324"
FT                   /product="coaD Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09004"
FT                   /db_xref="GOA:D2Q868"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q868"
FT                   /protein_id="ADB09004.1"
FT                   /translation="MTIAVCPGSYDPVTAGHLDVIERCAHFFDEVHVVVAVNAAKTPMF
FT                   SEDTRVDIIRQALKERGCRNIKVASTTGLITDYCKRVGATVIVKGLRQNGDYEAELGMA
FT                   LVNRKLADVETLFLPAAPDLEHISSSIVKDVARHGGDVTGMVPDCVIPLLGEALKNEKR
FT                   A"
FT   gene            405470..405790
FT                   /locus_tag="BDP_0325"
FT   CDS_pept        405470..405790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0325"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09005"
FT                   /db_xref="GOA:D2Q869"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="InterPro:IPR027310"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q869"
FT                   /protein_id="ADB09005.1"
FT                   /translation="MAWHAIVDGVYDDADPVSPLSDPDAGTGTAVLERPEEKTQLDDGG
FT                   NGDADRFAHYVSRDRIQESKLTGRPVVALCGKVWVPKRDPSQYPVCPDCKRIYDEMMNS
FT                   SF"
FT   gene            complement(405938..407011)
FT                   /locus_tag="BDP_0326"
FT   CDS_pept        complement(405938..407011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0326"
FT                   /product="Oxidoreductase"
FT                   /EC_number="1.1.1.91"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09006"
FT                   /db_xref="GOA:D2Q870"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q870"
FT                   /protein_id="ADB09006.1"
FT                   /translation="MDSTAPRNASRRTAPFFQGGTLLEPTTVYTPSPARYDSMTYNHVG
FT                   ASGLKLPAVSLGFWHNFGDITPYDTMRQIVFTAFDNGVTHFDLANNYGPEPGSAEKNCG
FT                   RLLHEYFHHHRDELIISTKAGYEMWLGPYGDLGSRKYLLASLDQSLERLGLDYVDIFYH
FT                   HHMDSHTPLEETMGALATAVHSGKALYVGLSNYDGPTLEQATAILDELHVPFIINQNRY
FT                   NIFDRTVERNGLKETAHRLGKGLITFSPLDQGLLTDRYLNGIPADSRIAHDGRFLQENA
FT                   LTPAKLQQIRDLNGLAAERGQTLAEMALAWLLHDGMVTSVLVGASRPQQLLDNIGALRN
FT                   ITFTDEELRRIDEISSR"
FT   gene            407105..407527
FT                   /locus_tag="BDP_0327"
FT   CDS_pept        407105..407527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0327"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09007"
FT                   /db_xref="GOA:D2Q871"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q871"
FT                   /protein_id="ADB09007.1"
FT                   /translation="MGSYTIREMARKFGMQPSTLRYYEDQGLLTDVGRDDAGRRVYGDE
FT                   HIGQLEAIACFKHAGMSIDELKRFFAYEGDERTHISDMVELLENRRDVIVEQRASLEEA
FT                   YMHVLRKLHLYKDLQSSYENGTQPPDWADYDGKDFR"
FT   gene            complement(407710..409107)
FT                   /gene="pncB"
FT                   /locus_tag="BDP_0328"
FT   CDS_pept        complement(407710..409107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="BDP_0328"
FT                   /product="pncB Nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09008"
FT                   /db_xref="GOA:D2Q872"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q872"
FT                   /protein_id="ADB09008.1"
FT                   /translation="MQAVIGHRPDYTYGQFHQKSRKALEMLDYSPALMTDMYEYTMLDA
FT                   CLKDGTANRKCVFEIFTRHLPLGRHYGVVAGQGRILDALEHFHLDDNDLKFLSDRKVVS
FT                   PETIAWLENFRFSGSIKGYREGEMFFPNSPILQVEGTFGECTLLETLLLSILNYDSAVA
FT                   SAASRMVSAAKDRPCMDMGGRRTNEWAAVAAARAAVVGGFKGTANLLAAQMYGLKAIGT
FT                   AAHCFTLVHDDERSAFESQIAALGRNTTLLVDTYNIEEAVKTAVEVAGPELGGVRIDSG
FT                   DLASLAQRVRNQLDALGATNTKITVTNDLDEYALASLQTAPVDSYGVGTMLVTGSGAPT
FT                   CAMVYKLTERENSAGDMQPVAKKSKDKATVPGRKLAYRSYEYSLAECEHVISGSEEKLA
FT                   AYQPEEGWKDLLVDYVTNGENHTEYQGHDAIVNAHNYRAKALAELPIGAQSLMKGDPVI
FT                   PTEVTVL"
FT   gene            complement(409095..409301)
FT                   /locus_tag="BDP_0330"
FT   CDS_pept        complement(409095..409301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0330"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09009"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q873"
FT                   /protein_id="ADB09009.1"
FT                   /translation="MSIISDFLPRDTITIRPLALLGVTPQMEPAEAGTRWCPSVGLFRR
FT                   SVPSERRFGPESQDDARMMICKR"
FT   gene            409314..410078
FT                   /gene="rph"
FT                   /locus_tag="BDP_0329"
FT   CDS_pept        409314..410078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="BDP_0329"
FT                   /product="rph Ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09010"
FT                   /db_xref="GOA:D2Q874"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q874"
FT                   /protein_id="ADB09010.1"
FT                   /translation="MVAIKDMLGEQTVIRADGRKVDELRPVRITRRFTDVPEGSVLIEC
FT                   GNTRVMCTATFTSGVPRWRKDSGLGWVTAEYAMLPRATADRTDRESVRGKIGGRTHEIS
FT                   RLIGRCLRGVVDMKALGENQVQIDCDVLQADGGTRTASITGAYVALVDAMRWAERHRHI
FT                   KSADRVLKDCVSAVSVGVINGKPMLDLPYIEDSQAMTDMNVAMTGSGEFIEIQGTAEHR
FT                   PFSRAELNALLDLAEQGNKELQAAQRAALALD"
FT   gene            410122..410811
FT                   /locus_tag="BDP_0331"
FT   CDS_pept        410122..410811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0331"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09011"
FT                   /db_xref="GOA:D2Q875"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q875"
FT                   /protein_id="ADB09011.1"
FT                   /translation="MKIIVATHNEGKLVEIRRILEERLGAGAADAELVSAGSLNLPDPV
FT                   EDGVTFQENALLKARDVAARTGCPAIADDSGLIVDVMGNAPGILSARWAGRHGDDKANN
FT                   ALLLAQIADIPEASRTARFRCAAALVVPGAKREDDTAESAGKPYAITSETVEIGEMPGV
FT                   LLHAPRGEHGFGYDPLFVPDDQPTRAVEAGVRLTSAEMEPAEKNAISHRGKALRALVPA
FT                   VEALLRQ"
FT   gene            complement(410872..411879)
FT                   /locus_tag="BDP_0332"
FT   CDS_pept        complement(410872..411879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0332"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09012"
FT                   /db_xref="GOA:D2Q876"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q876"
FT                   /protein_id="ADB09012.1"
FT                   /translation="MSALIQPIALLLIILTGYLFKRAGRFKDRDYRILQTAMFDLVLPG
FT                   AIVYSFATNPHDSSMLWISVFGFVVAFIPPVIIFLTSRKRPVQDRAFTMLNGSGFNVGC
FT                   FCFPVVQAFLGTAAIVPAAMFDIGNCVMVAAGTNVMTQTLLHIQPGKTLGEQYQGHAPT
FT                   LPYVKPKDRDAKRLARKALFRNVFKGFFGSVPFDTYLLMIVLTLADVKIPAVIATLAQP
FT                   LSNANSFCAMLMVGMLMDLPAGRADVMKLLKVIGWRLPFGIAFAAAAWLMLPFDASIRE
FT                   AVAMCCLAPIAVFSTLFTDKVLGNAKLAGFSLSISAIISLIMMTGTHVLVTALA"
FT   gene            complement(411987..412067)
FT                   /locus_tag="BDP_tRNA9"
FT   tRNA            complement(411987..412067)
FT                   /locus_tag="BDP_tRNA9"
FT                   /product="tRNA-Leu"
FT   gene            complement(412110..412185)
FT                   /locus_tag="BDP_tRNA10"
FT   tRNA            complement(412110..412185)
FT                   /locus_tag="BDP_tRNA10"
FT                   /product="tRNA-Thr"
FT   gene            412334..413482
FT                   /locus_tag="BDP_0333"
FT   CDS_pept        412334..413482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0333"
FT                   /product="putative guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09013"
FT                   /db_xref="GOA:D2Q877"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q877"
FT                   /protein_id="ADB09013.1"
FT                   /translation="MSSDTGFDDFHAIIPAGGTGTRLWPLSRRDRPKFLYDLLGQGRTL
FT                   IQSTYDRLEAIAGKGNVYVSTGVGHVGAVREQLPQLDADNIFAEPIPRDSTAAIVLATA
FT                   VIARRCGERCVVGSFAADHVIRGRQSFAESVRQAVATARAGYVTTIGIAASRPSTAFGY
FT                   IHQGRSLAADVPDAPAARLVERFVEKPDAATAQAYLSTGEYRWNAGMFVMRADVLLDHI
FT                   RRAKPLMYEAISRIADAYESPVRTRGAAVERAMARDWAGIEKIAFDYAVAEPLSVAGGV
FT                   AMIPGDFGWDDIGDFNSVAALLPSANERNIKILGDAESVAYLDSAGDVVVPESGRTIAL
FT                   LGVNDMVVVDTPDALLIAPRARSQEVKSMVAHLDRLGAEDIL"
FT   gene            413722..415419
FT                   /gene="gpi"
FT                   /locus_tag="BDP_0335"
FT   CDS_pept        413722..415419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpi"
FT                   /locus_tag="BDP_0335"
FT                   /product="gpi Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09014"
FT                   /db_xref="GOA:D2Q878"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q878"
FT                   /protein_id="ADB09014.1"
FT                   /translation="MAINPPVDATKTPEWAALQKHYDELQSEGISLKQWFADDAARVEK
FT                   LSFDAGDLHFDLSKNLIKPETLQLFADLAKAVKLDERTKAMYTGVHINNTEDRAVLHTA
FT                   LRRPIEDEGKYIVDGQDTVKDVREVLDRIYAFADKVRSGEWTGVTGKKIETVVNIGIGG
FT                   SDLGPVMVYEALKPYADAGIAARYISNIDPNDLAEKTKGLDPETTLFIIVSKTFTTLET
FT                   LTNAREARTWLLEELKASGAIDGSDEKNAEAIKKHFVAVSTNLEKVAEFGIDPNNAFGF
FT                   WNWVGGRYSVDSAVGTSLAVVFGPARFEEFLHGFHEIDEYFASTPFEKNVVVLLGMLNV
FT                   WYRNFFKVASHAVLPYDQYLHRFPAYLQQLTMESNGKSVRWDGTPVTSETGEIFWGEPG
FT                   TNGQHAFYQLIHQGTQLIPADFIAFVNTPNPVKDGDQDVHELFLGNYFAQTKALAFGKT
FT                   AEEVRAEGTPEEIVPARVFTGNRPTTSIFGVALTPFAVGELIALYEHITFVEGTVWGLD
FT                   SYDQWGVELGKQLAKQITPAISQDDEALAAQDASTQSLIKFYRANREF"
FT   gene            415690..416055
FT                   /gene="rplS"
FT                   /locus_tag="BDP_0336"
FT   CDS_pept        415690..416055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BDP_0336"
FT                   /product="rplS LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09015"
FT                   /db_xref="GOA:D2Q879"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q879"
FT                   /protein_id="ADB09015.1"
FT                   /translation="MVNAIEAFDAKHMKPAEEIPAFRPGDTVEVNVKIKEGNNSRIQAF
FT                   TGVVIARQGGGVRETFVVRKISFGTGVERRFPLHSPIIDSIKLVRKGRVRRAKLYYLRK
FT                   LRGKAARIVERRDNSAK"
FT   gene            416076..416822
FT                   /locus_tag="BDP_0337"
FT   CDS_pept        416076..416822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0337"
FT                   /product="lepB Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09016"
FT                   /db_xref="GOA:D2Q880"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q880"
FT                   /protein_id="ADB09016.1"
FT                   /translation="MKSARQLHGCRADSYIRRYDKGHCVRNETTEGPNMKHAANTGADN
FT                   GFDWRDTLIWCGVPVAIVLLVRMFLVGFYVIPSGSMMDTIEPGDRVITTKLTPKLFSLR
FT                   RGDVVVFKDPDHWLQEENSGRLGGDFLIKRLIGLPGDTVACEGPGQPVTVNGVAIDESS
FT                   YIRSGVDPSSFAFKVKVTAGHIFVLGDNRANSADSRYHQDDSSHGLVPIDDVVGVGLAT
FT                   YWPLNRIGALDAHHDVFKDVPEGSAG"
FT   gene            416822..417526
FT                   /locus_tag="BDP_0338"
FT   CDS_pept        416822..417526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0338"
FT                   /product="Putative ribonuclease"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09017"
FT                   /db_xref="GOA:D2Q881"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q881"
FT                   /protein_id="ADB09017.1"
FT                   /translation="MAVSTVPTLQLEREIAARGYDVIVGFDEVGRGSLAGPVMVGAAAI
FT                   RTADLDGPDALDVPEGVADSKMLTEHRRETIFESLKSWSASWAVGASSNAEIDEWGISY
FT                   ALGVAALRALDEVERELGIADDGRPIRVGAILDGPNDYITKALGTFDAPDVPVPATVTT
FT                   KVKGDRYCATVATAAVIAKVTRDRLMIELGERPEYAIYEWQRNKGYGSAAHREAIAAHG
FT                   PSDLHRISWHLG"
FT   gene            417925..418770
FT                   /locus_tag="BDP_0339"
FT   CDS_pept        417925..418770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0339"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /EC_number="3.6.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09018"
FT                   /db_xref="GOA:D2Q882"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q882"
FT                   /protein_id="ADB09018.1"
FT                   /translation="METTTHHVLRASDLVMDYAAQPGTAKPVASAMHMLALNHVNFAIR
FT                   AGESIAVMGPSGSGKSTLLHVLAGIVRPTAGNVSFRGTDLARLPDADCTKLRRSAFGFV
FT                   FQSGQLLPELPAVENIALPMMLGGARYQQAADTAMLWLERLGLRQLAAQRPGEMSGGQM
FT                   QRVSIARALAVQPAVVFADEPTGALDQSTGRDIMGILMDASRANGAAVIVVTHDPNVAA
FT                   FCDRTLIMRDGQLYDEGPHPQPTQAELAAAHGPGAQWPQPVTGAHGVPMYGNPPQGGMR
FT                   "
FT   gene            418767..420275
FT                   /locus_tag="BDP_0340"
FT   CDS_pept        418767..420275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0340"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09019"
FT                   /db_xref="GOA:D2Q883"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q883"
FT                   /protein_id="ADB09019.1"
FT                   /translation="MNTFALWRLFHRPGTRGTAGHTSVLAVVAFAAATTIFLTVLGGVH
FT                   GFIWRASADHTIGCMINPGPSNCAPGTYEAWSKTLETGNRLMIHGSGHWTAAQSAAVMN
FT                   TYAGGYVLLAGFACMLLIVPFVALAGSAARLAASRRDARLAALRLAGATTAQVTKLTAL
FT                   DAASQALLGSLIGILGYVAVMPLIMLLNFQNRRFTFEELWVGSLALIAVIAGVAVLALA
FT                   SSLITLRRVAITPLGVMQRTSPPLPTKWRVLIFAVIMAVGYMVLSNLQSFARFGEGTVY
FT                   AMVFGIIFLCFALVNLVGTWVVTFRAKLRARRPKDAATMIAMRRILDNPKRAWRNVSGV
FT                   ALAVFIAGMTSVCGLVASGINGNVDPLDPSMLYARDISTGGFLTLAFAAVLAAVSSGVM
FT                   QAGSVYDQVGEYRMLTLEGTDKTTLDKARMMEVITPLNTVVAVSGGCSLLLLFPIMAAA
FT                   LFRPATLMTLVAGIALCYALIAVGAIAANHVARTLNLADYRADD"
FT   gene            complement(420295..421218)
FT                   /locus_tag="BDP_0341"
FT   CDS_pept        complement(420295..421218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0341"
FT                   /product="Hypothetical transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09020"
FT                   /db_xref="GOA:D2Q884"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q884"
FT                   /protein_id="ADB09020.1"
FT                   /translation="MEGFCVIGIVIGTGYAAARLRIGGPTAQMVLNRFSFFVSSPCLMF
FT                   AILSKEKIFEIFHSSIIVAFFSAMLVGAVFLILNRLFFHMKPADATIGALNSLYLNSNN
FT                   IGLPIATYILGNPALVAPILVMQQAVFTPIGLTVLDVTTKGRVSAKEILKQPLHQPLLI
FT                   GSLLGIVVSAISAKAGHFVVPSCIFDPINMIGNSAVPMILMAFGMSLHGTKPLQEKADI
FT                   PATFTVAALKNIVMPIIAFLLSYFVMGFRGPTLYACVVLAALPTGQNVYNYAARYNVGL
FT                   SFARDGILFSTLTSPVFIAIIAALLS"
FT   gene            421381..422586
FT                   /gene="dapE"
FT                   /locus_tag="BDP_0343"
FT   CDS_pept        421381..422586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="BDP_0343"
FT                   /product="dapE Succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09021"
FT                   /db_xref="GOA:D2Q885"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q885"
FT                   /protein_id="ADB09021.1"
FT                   /translation="MRRMSELEIGFDASAGKQAALNTLMEQIMGSYSVSDDEGPLTDAV
FT                   ETFLTMQPHLTVHRHGDTLVASTDFGRAQRVILAGHLDTVPVIDNFPPKWLEPGDPLIR
FT                   EDVAAGHEGERVIWGRGATDMKGSDAVMLYLAATLTDARYDLTYVFYDHEEVAAEKNGL
FT                   RKVVEAHPDWIAGDFAIIGEPTDCGIEGGCNGTMRFDVVTHGVAAHSARAWMGENAIHK
FT                   AAEILNRLNAYENRAVEVDGLTYQEGLNATLISGGKGTNVIPDECRVHVNYRFAPDKTL
FT                   AEAKALMIGVGAGAELGNGEHMATGGVFAGFGIEMKDESPSARPGLNSPLAASLVDLVR
FT                   DRTGRDPLAKLGWTDVARFAILGIPAVNLGAGSPLLAHKHDEQLPESDLVLMADLLEDW
FT                   LR"
FT   gene            422894..425674
FT                   /gene="rne"
FT                   /locus_tag="BDP_0344"
FT   CDS_pept        422894..425674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="BDP_0344"
FT                   /product="rne Ribonuclease G"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09022"
FT                   /db_xref="GOA:D2Q886"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q886"
FT                   /protein_id="ADB09022.1"
FT                   /translation="MRLQRVARSIVPSNTSEGFDEIEAVVSANADSTVPAPRRRRGGRR
FT                   VVRGVGAAGASLELKVEEHAPAPLFEEPKLPTSKPESEDAESRDEAEPVRPVRRRRRAA
FT                   DAEDEVESRPVRRRRADDDDERDDYEAPRRRAVDDDDDRPARRTRGRRRASADVEFRDS
FT                   RDEHGEESTDERALDAVEMLPEGHVQRRGSRPMTSLLFQEPVLPAVPAPREDADRDDSH
FT                   DADGSVDVQEERSSRRRRRRSRDAEQDEQSRRDEDDRNDRNDASGDDEEGSSHRSRRSR
FT                   RLNAQERRAAAEVEQIEEDLVLDDITYAPIDDESRSGKDDDDEGEAPTRTRRRRRSRGN
FT                   HEDADEQQGADEQSGNRRRVRDEDDDEDGAVTRRRRRRRGGAKSEDAEEPLVRRSRKQQ
FT                   YIDEITDVEGSTRLEAKKQRRRDNRRERSRQSQLMEQDFLARREHVDRLMVVRERERHT
FT                   QISVIEDNVLVEHYVSDIQEVATVGNIYLGRVQNVLPSMEAAFVDIGQARNGVLYAGEV
FT                   NWDSARLEGQPRRIELAFKSGDPVLVQVTKDPIGHKGARLTSQVTLAGRFLVLVPSGGM
FT                   TGVSRKLSERERSRLKGIVSKIAPKDMGVIIRTAAEGASEEAITKDLESLVRQWERISA
FT                   KRDEFLHGKRPKLLQGEPDVAIRVVRDIFNDDFGKMIVEGERVYGRIEEYLDTMAPDLK
FT                   DKLEKWDPAEHEGKDVFDKWQIDSQLRKGMERQVYLPSGGSIVIDRTEAMTTIDVNTGR
FT                   FIGRGKSLEETVTRCNLEASEEIARQLRLRDIGGMVMIDFVDMVMPANRDLVLRRLVEC
FT                   LARDRTKHQVAEVTSLGLVQMTRKRIGQGLVEAFSEECPTCKGRGFILHDEPTVSADYD
FT                   DPYALKGGDPFVKTNKHGHGTDVQVPKGSSPDVKAKLAQIAAAAVAANNAEPDEE"
FT   gene            425819..426127
FT                   /gene="rplU"
FT                   /locus_tag="BDP_0345"
FT   CDS_pept        425819..426127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BDP_0345"
FT                   /product="rplU LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09023"
FT                   /db_xref="GOA:D2Q887"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q887"
FT                   /protein_id="ADB09023.1"
FT                   /translation="MYAIVKAGGHQEKVEVGDVILVNRLKAQKGETVEFPVALVVDGAN
FT                   VILGAKDLAKLSVKAEVINDEAKGPKINIMKYKNKTGVARRKGHRQQLTAVKITAIA"
FT   gene            426168..426419
FT                   /gene="rpmA"
FT                   /locus_tag="BDP_0346"
FT   CDS_pept        426168..426419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BDP_0346"
FT                   /product="rpmA LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09024"
FT                   /db_xref="GOA:D2Q888"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q888"
FT                   /protein_id="ADB09024.1"
FT                   /translation="MAHKKGASSSRNGRDSNAQYLGVKKFGGEAVVAGNIIVRQRGTKF
FT                   HPGENVGMGKDHTLFALKDGSVKFGVRRDRKVVDVIAA"
FT   gene            426518..428209
FT                   /locus_tag="BDP_0347"
FT   CDS_pept        426518..428209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0347"
FT                   /product="GTP-binding protein, GTP1/OBG family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09025"
FT                   /db_xref="GOA:D2Q889"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q889"
FT                   /protein_id="ADB09025.1"
FT                   /translation="MSDFVDRVTVHVKGGDGGNGSAGIRREKYKPLAGPNGGNGGNGGS
FT                   VIFLADQNANSLLDYRFMPHREAGSGTMGLGDTKDGSKGADLILPVPVGTVIFEAKGPQ
FT                   GARKYPGEQLADLRHVGDRYVAAAGGNGGLGNAALANRTRRAPGFALLGEPGEERDVIL
FT                   ELKSIADVALVGFPSAGKSSLIAAMSSAKPKIADYPFTTLVPNLGVVMAGDSRYTIADV
FT                   PGLIPGASQGKGLGLEFLRHIERTEIIAHVIDCATLEPDRDPMSDYRALEHELAEYADK
FT                   LELPLGAIPIPERPRIVILNKVDMPEAKELAEFVKPEFEALGLKVFIISTASHEGLKEL
FT                   NWALAGLVADMRKEVAKREQAEEEARVVIKPLEETKNRRRRNDESGSALEFTVERKESG
FT                   NGDVWYEVLGGKPERWVMQTNFDNDEAVGYLADRLAKLGVEDELRRKGAKPGDEVRIGR
FT                   GDRAVEFDWDPTIAAGAEMLDGAQLGARGVDLRLQGQDGRTQRRTNSERRRQYHEMMDA
FT                   RQAVREAMMAERAAGHWADPSVDDDRHDENSLFGRGESADTDDVKE"
FT   gene            428317..429450
FT                   /gene="proB"
FT                   /locus_tag="BDP_0348"
FT   CDS_pept        428317..429450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BDP_0348"
FT                   /product="proB Glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09026"
FT                   /db_xref="GOA:D2Q890"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q890"
FT                   /protein_id="ADB09026.1"
FT                   /translation="MNTPSQAQVRRAIAEAQTIVVKVGSSSLTEPSGHLDPERLNALVA
FT                   ALARVRLMGGRVVLVSSGAIAAGFGSLGFDARPTDVADQQACAAVGQGLLMAQYEAAFA
FT                   RYGLRVGQILITVSDTIAPQQYRNVRRTLERLLDLGAVPIINENDSLASNEIRFGDNDR
FT                   LSALIANIVVADALVLLTDVDALYTAPPSEPESKRIAYVPNVEDALEKVQVGGTGSNVG
FT                   TGGMVTKMEAARVAAVSGIPSVLTCAANAGPAMMGDPVGTAFAPIHDRGSSRRLWIGFA
FT                   AHPFGTLVADAGAAKAVRGGAASLLAAGVLEVRGEFAAGDAVWIDDEAGNHLAKGLAGF
FT                   DSEEIPQMLGRNTAQLKRFLGEEYAHPLVHRDNLVLV"
FT   gene            429550..430758
FT                   /gene="aspC"
FT                   /locus_tag="BDP_0349"
FT   CDS_pept        429550..430758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="BDP_0349"
FT                   /product="aspC Aspartate aminotransferase"
FT                   /EC_number="4.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09027"
FT                   /db_xref="GOA:D2Q891"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q891"
FT                   /protein_id="ADB09027.1"
FT                   /translation="MADWQTLSDRINRVAPSATLAVDSKAKAMKAAGIDVIGFGAGEPN
FT                   FPTPAPIVAAAACAVQDPKNYRYTPTAGLPELRKAIADKVSRDSGYEVDPSQVVVTNGG
FT                   KQAVYEAFQILLDEGDEVIIPAPYWTSYPEAVKLAGGVPVEVFAGADRNFEPDIDAIEA
FT                   ARTERTKAIIVTTPNNPTGAVWKPETVKAIGEWALEHHVWVISDEIYEHLNYDGAKTTY
FT                   IGAVVPEVRGQLLVLNGVAKTYAMPGWRVGWMVAPAEVAKAASKLQGHMTSNVNNISQR
FT                   AAIEAVSGPLDAVYDMRAAFDKRRRTIVTALNDIEGVNCPTPTGAFYAFADVTALLNRP
FT                   LGPNRTVFADTTELAAALLDEGHVAAVPGEAFGAPGYLRFSYALADDDLVEGMKRMKAW
FT                   AEA"
FT   gene            430990..431065
FT                   /locus_tag="BDP_tRNA11"
FT   tRNA            430990..431065
FT                   /locus_tag="BDP_tRNA11"
FT                   /product="tRNA-Trp"
FT   gene            431098..431325
FT                   /gene="secE"
FT                   /locus_tag="BDP_0350"
FT   CDS_pept        431098..431325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BDP_0350"
FT                   /product="secE Protein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09028"
FT                   /db_xref="GOA:D2Q892"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q892"
FT                   /protein_id="ADB09028.1"
FT                   /translation="MAKASNREKAVKPNIFMRIGLFIKQIIDELRKVVTPTSKELFFWA
FT                   LAVFIFVLFLMALVTGMDFGLGKLTLWIFG"
FT   gene            431349..432161
FT                   /gene="nusG"
FT                   /locus_tag="BDP_0351"
FT   CDS_pept        431349..432161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BDP_0351"
FT                   /product="putative transcription antitermination protein
FT                   nusG"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09029"
FT                   /db_xref="GOA:D2Q893"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q893"
FT                   /protein_id="ADB09029.1"
FT                   /translation="MTDEVIFDNLDEAPEATEEAVAAVEALPEAGETEVSEEPAAEETA
FT                   EQVETETSADAAVESEQDERDAGTKAVEEFSKNLRTLEGKWYVLHTYSGYEKRVKTNVE
FT                   SRVASFGLEDKIFQIEVPMEEVEKHTEKGKKIITRVRVPGYVLIRMLPDENARRIVRET
FT                   EGVTGFVGPTKEPAPLSRKEVVSMMAPMIASEALKKAGDKPAAAKKRTLEVSYAVGDQV
FT                   TVTDGPFTTMAAVVSDVEPTTQKLTVLVSIFGRDTPVELGFNQVEKLA"
FT   gene            432462..432893
FT                   /gene="rplK"
FT                   /locus_tag="BDP_0353"
FT   CDS_pept        432462..432893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BDP_0353"
FT                   /product="rplK LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09030"
FT                   /db_xref="GOA:D2Q894"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q894"
FT                   /protein_id="ADB09030.1"
FT                   /translation="MAPKKKVSALIKLQIQAGKANPAPPLGPALGSHGVNIMDFCKAYN
FT                   AQTQDKMGQVIPVEITVYEDRSFTFILKTPPAAALLKKAAGIQKGTENPLTHKVGSVTK
FT                   AQVREIAEIKMADLSARDVEAGMKIIEGTARSMGITVTD"
FT   gene            432908..433600
FT                   /gene="rplA"
FT                   /locus_tag="BDP_0354"
FT   CDS_pept        432908..433600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BDP_0354"
FT                   /product="rlpA LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09031"
FT                   /db_xref="GOA:D2Q895"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q895"
FT                   /protein_id="ADB09031.1"
FT                   /translation="MVKRSKKYREAAEKVDSNNLYTANEAIALLKSMPEYNFDQTVEAV
FT                   LRLNVDPRKADQLVRGSVNLPNGTGKTAKVLVFARGPKATEALEAGADIVGDDDLVEKV
FT                   AGGFLDFDSVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTMDVTKAIKDIKGGKVDF
FT                   RVDKNGNLSFLIGKLSFTEQALEENFKAIADEVKRLKPSTVKGRYVTKATITSTMNPGV
FT                   PVDPAILA"
FT   gene            complement(433731..434510)
FT                   /locus_tag="BDP_0355"
FT   CDS_pept        complement(433731..434510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0355"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09032"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q896"
FT                   /protein_id="ADB09032.1"
FT                   /translation="MNSDQADILDLLSGHTDDSTIERLAFECLMNGIADERVTSLLNVL
FT                   AWRGAFDCFAIGGVPASNPMAASLAARKSVRDLGGENAIIGTYGSFLLMLVRQIGAATP
FT                   EVTCTSVMPAFAESDPVYLSPVRSGVAGASHALRETLFSLQAAPALSTQSRPLRADELL
FT                   PERALLGDDYAREELYRNVYRVLRGDNPDDPTYLTVSTFLRYGSSLENTAKELNVHPNT
FT                   VRYRLKRAAETTGWDATDPRDAYVLTTALAIGRMREH"
FT   gene            434596..436659
FT                   /locus_tag="BDP_0356"
FT   CDS_pept        434596..436659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0356"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09033"
FT                   /db_xref="GOA:D2Q897"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q897"
FT                   /protein_id="ADB09033.1"
FT                   /translation="MPDMTEVRKSRSRGARLSGFCRWTLAVLACLWLAWCCAIGPLYWY
FT                   NVGLDGFGWANMLILALSFAVFFAIVVALVRFGRGQRVLPRYFTRRHERLHEEVEGTPT
FT                   TILGIVLKHVHDATHSRPGRAVHAVVIWVGRKLTRCTDCWWKLMLVFVIGWLWIPTTLL
FT                   AAYGADIRSQIREFSWAWNQWTGLKQPYIGFFSFVPMDIYPTAHYMWPANPTYLTDQHN
FT                   IVLTVFYGAVAAISRYFTDSNDAGIVTLAALQWLFAAFCCAATANRFFNLPWRRLGVGS
FT                   FDFSHPERHDCWNQRDFMHPEAGVVARPSRLRAGAKTRFVILLFFMVCPLAVFATISLT
FT                   KSPLFAFAFVWWFGVWYELHMTHIKALPTINGKPTRLRKRSMLAFFMSSVVMLISAKYA
FT                   WYIIVLALILALLNDRKRWKTYVVTLLLPTVLIHGGIVFLADSGAIISGDPIESRGIQL
FT                   QQIARVAKYNPQGIPADAASKLEPIFNLDQMADAYYQQDADPVKSSGIQSKKVSYKWRT
FT                   VTKEDMENFNKAWLEIVKANPVIALDAFFAECFGYFDVTDLPYVSMDYYVNNDYVQEDN
FT                   DWIHLYNHEWRDKVADFAKQWGKIPVFGWLVHGNLYVTLTLLIGAAEVVLRRWRSLSWH
FT                   LPLLLLMGVMITAPANNFERHMLPVAFVFGFLCLQFWRESRRQRHTAVPTGS"
FT   gene            complement(436797..436925)
FT                   /locus_tag="BDP_0357"
FT   CDS_pept        complement(436797..436925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0357"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09034"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q898"
FT                   /protein_id="ADB09034.1"
FT                   /translation="MLVEPTESKDNTQSAATQVPGIVNAESINPIQYPLTCYLPAV"
FT   gene            436909..437691
FT                   /gene="birA"
FT                   /locus_tag="BDP_0358"
FT   CDS_pept        436909..437691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="BDP_0358"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase BirA"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09035"
FT                   /db_xref="GOA:D2Q899"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q899"
FT                   /protein_id="ADB09035.1"
FT                   /translation="MGSTNTYAADLVRSGELYGDARRGGEIAVVCADAQTAGRGRLDHR
FT                   WTSRPGESFTVSFVVNVPVSIVRDASIGGWLQMIAGLAVLEAIRGACPHRSAEPQLKWP
FT                   NDIVVGGRKLGGILAEMVPIPDCGERVAIVFGVGLNLNVPVDRLPTENSISLQMLTSDL
FT                   PDPTALRDELAARIVRDLRLRLTDFEADPQREAKRCLEAMNVVCWTLGKPCEAHFTDGS
FT                   ALQGRAIALNPDASLTMRDRFGALHRVTTADVGVLQNR"
FT   gene            complement(437771..438352)
FT                   /locus_tag="BDP_0359"
FT   CDS_pept        complement(437771..438352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0359"
FT                   /product="Putative BioY-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09036"
FT                   /db_xref="GOA:D2Q8A0"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A0"
FT                   /protein_id="ADB09036.1"
FT                   /translation="MYHAILTIKSLSNGKFGSIFKPVLFALLLWAASAAGEIPVPGTPV
FT                   PITLQTFVIMLAALMLPWRQAGAAIALYLAAGALGLPVFAGGASTLALVGPSAGFLLGF
FT                   LPAAVITSLLKGEARTDSAKGSMLTAARYCGAALVGCVAVDYLFGFIIQSAVTSVSLPV
FT                   VAVASMGFVFGDVIKAVVASAVAAGLAKLR"
FT   gene            438519..440381
FT                   /gene="accC"
FT                   /locus_tag="BDP_0360"
FT   CDS_pept        438519..440381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="BDP_0360"
FT                   /product="accC Acetyl-/propionyl-CoA carboxylase alpha
FT                   chain"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09037"
FT                   /db_xref="GOA:D2Q8A1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A1"
FT                   /protein_id="ADB09037.1"
FT                   /translation="MPKNVNTLLVANRGEIALRVVRTAREMGIPTVAVYAEQDRHAQYV
FT                   QMADDAYLLSGDTYKDTYLNEDLLIDILHRSGADAVHPGYGFLSEVASFAQKVIDAGAT
FT                   WVGPNPKALVDLGDKITARRVATFAKVPPVPGISHSISDMRLLLDFAHTHGYPLMLKRT
FT                   DGGGGRGITLVRNDDELRGFYMNHDALQGGDLNEYFVERFIDKGRHVETQCGRDTHGNF
FT                   TVYSTRDCSVQRRNQKLVEEAPAPFLPDTVMEQLARYSRNLFEAVGYVGLGTCEFMVTE
FT                   QGKVYFLEVNPRLQVEHTVSEEVCGLDLVREQLTIANGGELTVEHPIRGHSFELRLTCE
FT                   DPAKNLTPSSGTLTALRWPSGPGIRVDSGVLEGDTISPKFDSMMGKLVVTASDRANAVA
FT                   RVRRALEELSIEGVPTPASLFERIFNDDEFTAEHGAAYDVSTKWLERKYLNKEAASSHG
FT                   GQPASLSGAADEGKDIESSETFVIEVNNHRVSLTVPTDIVANLTGSAKARDAKRAIQPL
FT                   RGQGLHHVKRGPQASEGQSGIIASPMQAVVTRINVAEGQEVAKGDLLVVLESMKMENYV
FT                   YAPVKGTVTKIFVGPANGVEAGETLLTINVAGTTPESKDEEAEQ"
FT   gene            440378..441979
FT                   /gene="accD"
FT                   /locus_tag="BDP_0361"
FT   CDS_pept        440378..441979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="BDP_0361"
FT                   /product="accD Acetyl-/propionyl-CoA carboxylase beta
FT                   chain"
FT                   /EC_number="4.1.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09038"
FT                   /db_xref="GOA:D2Q8A2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A2"
FT                   /protein_id="ADB09038.1"
FT                   /translation="MTDILTSPAVQDAVDHVEGSQPIRPAVLRAAQLAHEAEDHARDRQ
FT                   HVKGKLTARERLDLLLDTGTFEEIGRFCGGDINGGQAGAAVITGFGEIHGRKVAVYAQD
FT                   FSVKGGTLGVAEGRKICRLMDQALNLKVPIIALIDSGGARIQEGVAALTQYGHLFTKTC
FT                   EASGFVPQLSLILGPCAGGAVYCPALTDLIIMTRENSNMFVTGPDVVKAATGEVISMED
FT                   LGGGHVHNTTSGVAHYLGEDEADAIDYARTVLAYLPSNSDLTPPTYAYAATRADRDVAR
FT                   RLADVVPENDRQPYDVLDVIRCVVDYGEFVQVHELFACSAVVGFACIDGHPVGIVANQP
FT                   NVNAGILDVDSSEKVARFVRLCDAFNLPVITFVDTPGYKPGAQQEHAGIIRRGAKVIYA
FT                   YANAQVPLVTVILRKAFGGAYIVMGSKSIGADLNYAWPSSQIAVLGATGAVNIIHRKDL
FT                   QKAKDSGKDVEALRAKYTAEYERTTVNANLSLEMGEIDAMIDPEQTRETIVDALRLLAS
FT                   KKRARKTTKHHGNQPL"
FT   gene            442046..451399
FT                   /gene="fas"
FT                   /locus_tag="BDP_0362"
FT   CDS_pept        442046..451399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fas"
FT                   /locus_tag="BDP_0362"
FT                   /product="Fatty acid synthase Fas"
FT                   /EC_number="2.3.1.179"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09039"
FT                   /db_xref="GOA:D2Q8A3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR032088"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A3"
FT                   /protein_id="ADB09039.1"
FT                   /translation="MNAFFLDRLNSEPHALAFAGQSTPWPVALADQSTNPVLDGELHAH
FT                   AAAAQALLYPVAADLLATTGRPVDLFGFEANPARLGDAASAAASVPGIALTQLGALIDA
FT                   AELGYNPAKAKPIAVLGHSQGVLAVHMVQAIEQAGSIAAATAQIDEILAIATLIGVAGT
FT                   RQARQLGLAARHGEATPMLSVKDITRAQVDALIARVSGVHGPIAVAVANSATHYVLSGY
FT                   PEDLAAFGVEVAKEHRRQAKLREEKVRGGRVFDPVLEYLDVTLPFHSPLMAEAVSQTVS
FT                   WAQSCGIDADHARELAAEVLFNHVDWAARVSALMKSTDPSALWVLDFGPGATVGKLFST
FT                   VAQGTGVGVVEAFTTADRGALSTLETSPERTQNWTRFAPSVIHTAAGDKVRTAFTELTG
FT                   KAPVLLAGMTPTTVEPEIVAAAANAGYWAELAGGGQVTASVFDRHVAKLEEELEEGRTV
FT                   EFNAMFMDRYLWNLQFGSQRIVPKKRASGTPIDGVVISAGIPEFDEAVELIHSLNADGF
FT                   PYVSFKPGTIDQIRQVVRIAKAVAPTKVLIEVEGGSAGGHHSWESLDDLLLSTYAEVRE
FT                   QSNLVLVAGGGIGTPERGADYITGEWSTEYGRPLMPVDGVLVGTAVMTAKEAHTSAEVK
FT                   RMLVNTPGIDAKGAAGDPFAPLGEQWVPSGQALGGVTSGLSHLHADIYELENSSARCGR
FT                   LLVRVMKHPEELESRREEIIEALNATAKPYFGDLKTMTYLQWAQRFADLSFPWADETYA
FT                   DRFLHLLQRIEARVTEQESGEFTSLFASRADVQADPHAAIAKLGEAYPQADELTVTPMD
FT                   EAWFPTLVREYPKPMPFVPVIDNDLLRWWGQDQLWQSEDPRYSADSVRIIPGPISVAGI
FT                   TTVDEPVADILGRFESAMVQRVAAHDVAKDLSAFAQLGAATCAEEFIRKSPNISWVGHL
FT                   MANPAYGTDNGDADYEIRKVGTNGDVEQYDLDIHLDTYWDNDPDGGASKHAVRDIVIPL
FT                   NVNGTEAGLFPVVDRDRLPEHVYRMLADTAGIGNIAITGDKLTAMPTIERMEDAADRPF
FT                   GEAHTQYTLSANLGFDHEAATGGALPNDLVPSRIAPDALVGPAWPAIYAALGSVYVKGF
FT                   PVIEGLLNAVHLDHLVELEVNEDELLEHTGETIALTSWAEDYFESASGRVVTIHVTHTA
FT                   EDGTLLANETERFAIRGRAYSDALPPEAPDYGGLDAEIESTPRRLLRRVTVTAPHEMTA
FT                   FARTSGDFNPIHTSHRGAAVSGLTAPLVHGMWLSATAQYAVQALDDKGAHYEIAGWTYN
FT                   MYGMVQLDDEVEISIERVGRVAHSGMVLEVTSRIDGNIVSRATAIVRAPKSAFVYPGQG
FT                   IQKQGMVLDERAKSAAARDVWERADKLTRSRLGFSILAVVRDNPKELTANGVTYRHPEG
FT                   LLNLTQFTQVALATVAFAQTARLREAGADIWPAYFAGHSLGEYNALSSFANVIPLETVL
FT                   ELVFHRGSTMHHLIPRDEKGRSNYRMGALRPNQFGVGDDGVREYVESIAKASGEFLEIV
FT                   NYNLAGQQYAVAGTIAGLKALQADAARRVAECGGKPAFMLVPGIDVPFHSTLLRKGVPE
FT                   FRDKLDALLPAHIDYRGRLVGRYIPNLVAAPFAMTKEFAARILEVVPSERIKAALDDPQ
FT                   VWDSYAEDDQKLGRLLLTELLSWQFASPVRWIETQALLFSSVEQGGCGIEEYVEVGLGN
FT                   APTLANLGAKTLRLPQFSGRDVTVYNVGRDEGRVYMTDSDSLVAQDDADDSAVAEAVVQ
FT                   TAAQAATQDASPAQPAAAPASVAAAPSAPAGAPSGANVADMPFKAADAIAMLLAYSAKV
FT                   RPDQIGDSDTTDTLTNGVSSRRNQLLMDISSELGVASVDGAAEATVKALSALVNKVAPN
FT                   YKAFGPVLADIVRDRVRGLFGAAGVKLGQITKRVTDTWQLGEGWASHVVAALVLETREG
FT                   ASSRGGDLASLTAAAASNAAEANALIDAAVQKVASDRGVAVSMPSAGGASGGAVVDSAA
FT                   LDAFAAKVTGADGVLASTARFVLDQLGVAAPVADEPADEGSAVVAAVEAELGSDWPKQV
FT                   EPRFDARKAILFDDRWASAREDLARAYYDNDASILDGGFVGLGKAIAAEADWYADRIAS
FT                   EGETTRSALATAFRHVAIEALNGISDDASASRFAGDVAVVTGVAPNSIAAQVVNGLLAG
FT                   GATVVATSHSFKPSVKAWAKQTYREHAAGDARLWLVPANLSSYRDVDALVQWVGNVQKK
FT                   TSGATTTILKPAYEPSLFFPFAAPPVHGTLADSGELFESQARLMLWGVERAIAGLAKIG
FT                   ADTDVQHKLHVILPGSPNRGIFGGDGAYGEVKSSFDAIVNRARAEKAWSGRVTFAHPKI
FT                   GWVRGTGLMGGNDPLVAVVERHGLKTYSTAEIAVKLLDLATRESREEAVRAPLDVDLTG
FT                   GLGAEPIDIRALRAEAMADAEAKAAEQIGSQDADGSTPEGAMLIKALPSPRAPRQAAVD
FT                   LKDWQNVTARPEDEIVIVSVGELGPWGSGRTRFEAELGIHADGRVDLSAGAVLELAWNM
FT                   GLLTWNDSPKPGWYDADGNLVPEEDIAERYHDEVVARSGIRPFDEGMGGDYQGGTDEEE
FT                   AEVFLDHDVTFAVPTRQIAEEYVKLDEAHTSIAADAESGEWNVTRHAGSMIRVPRRAAM
FT                   TRTVGGQFPKGFDPVKWGIPASMVGDVDKIALWNIVTTVDAYLSAGFTPTEILEAVHPS
FT                   MVASTQGTGFGGMASMRKLYLDRFLNHEIPTDILQEALPNVVAAHVMQSYIGGYGNMIQ
FT                   PVSACATAAVSLEEGADKIALGKADFVVTGAIDDIGVESVIGFGNMNATANSEEMYAKG
FT                   IDARFFSRANDRRRGGFVESQGGGTILLTRGDVALKLGLPVAGVIGFVHSYADGAHTSI
FT                   PAPGLGALAAGMGGKDSKLVHDLARLGVTPDDIAVVSKHDTSTNANDPNESELHNTLAH
FT                   AIGRTDGNPLFVISQKSLTGHAKGGACIFQVNGLTQLFKSGVVPANAALDCVDPKLERD
FT                   DHMVWLREPLKIGAVKAGLATSLGFGHVSGFAAIVNPGAFEASVAYTAGREALKTWRER
FT                   ANARLAAGQRRLEEGMMGRAALYEPIDNRRFHEDGRGYDAHEVEKAMLLDPNARLGASG
FT                   YFEA"
FT   gene            451633..452088
FT                   /locus_tag="BDP_0363"
FT   CDS_pept        451633..452088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0363"
FT                   /product="Putative holo-[acyl-carrier protein] synthase3"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09040"
FT                   /db_xref="GOA:D2Q8A4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A4"
FT                   /protein_id="ADB09040.1"
FT                   /translation="MLGLGHDVVDVGAFDEQLGLSGSRMRGLFSARELRQAAQRAKAKN
FT                   DGETVHLAVRWAGKEAFLKAWCEALAFVAERDAATPARPYTIDAFPWPDIEILDDSHGV
FT                   PHVCLPPEVRCKLRESLGSPQCYAIHISLSHDGAIASAVAYITADRG"
FT   gene            452238..454052
FT                   /locus_tag="BDP_0364"
FT   CDS_pept        452238..454052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0364"
FT                   /product="Putative glycosidase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09041"
FT                   /db_xref="GOA:D2Q8A5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A5"
FT                   /protein_id="ADB09041.1"
FT                   /translation="MAARSKSDEAFANRLAQHGEELEELFTSLYGDAEALESLRELMNE
FT                   AHAARPADLKRLDTKRVADPEWYKRGNMFGMTMYTDLFAGDLKNLAEKVPYLKEQKLTY
FT                   LHLMPLLKMPHPQNDGGYAVEDFDSVDPSLGTNEDLAALTKKLRRAGISLCLDFVMNHT
FT                   ASSHRWAKAAQAGDPEYQGYYYCYDDRTVPDQYDAVVPEVFPATAPGNFTWNEDMHKWV
FT                   LTSFYPFQWDLNYRSPKVFIAVMKSVLGLANLGVEVFRIDAVPYIWKELGTNCRNLPQV
FT                   HTIVRMLRIVLECVCPAVVLKGEVVMAPKELAAYFGTPEHPECHMLYNVSIMVNLWSAL
FT                   ASGDVRLLKDQLDKLDALPGNCWFVNYLRCHDDVGWGLDEPEELRLGIDPLKHKEFLYH
FT                   FYEGSVPGSWAMGELYNYDEASKDARSCGTTASMCGVERALITHDRPLLDISMKRDLMM
FT                   HSAMAFLRGFPMLSCGDEIVQLNGWEYKEDPDRVEDSRNLHRSPFNWENAEKRKQAGTL
FT                   QKRMWDGLKGIREMRDDPCFGPDAWVTTWDAHNDAVLAMVRHVEGRTVLGLFNFSSARQ
FT                   TAYLDSDGDIMLPAEVTLEPYQVCVAEA"
FT   gene            454142..454215
FT                   /locus_tag="BDP_tRNA12"
FT   tRNA            454142..454215
FT                   /locus_tag="BDP_tRNA12"
FT                   /product="tRNA-Gly"
FT   gene            454351..455037
FT                   /locus_tag="BDP_0365"
FT   CDS_pept        454351..455037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0365"
FT                   /product="Narrowly conserved hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09042"
FT                   /db_xref="GOA:D2Q8A6"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A6"
FT                   /protein_id="ADB09042.1"
FT                   /translation="MERNMAQAKSNKAAEAVDGAVETVDVSKHPTASIEQSDLSLADIE
FT                   RRESHPGRWVLFIVLVLAAMIAPYWWGRAIAVKDATWLVAHLSFLNPRGVALISWTVTI
FT                   MTMAGLGLMVADAKKWLWGTIFVIGLAAEQFVAGLCLLSFNFWNATYVMYGNASGLANA
FT                   ANLGIIAAGFGVAVYAVLWVGLLVCIKKESKLNVLTRSWASFILFFVIELVALGVVLFG
FT                   GLLTAV"
FT   gene            455185..455454
FT                   /gene="rpsO"
FT                   /locus_tag="BDP_0366"
FT   CDS_pept        455185..455454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BDP_0366"
FT                   /product="rpsO SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09043"
FT                   /db_xref="GOA:D2Q8A7"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A7"
FT                   /protein_id="ADB09043.1"
FT                   /translation="MALTAEEKQEIIKTYATHEGDTGSPEVQVALLTKRIADLTEHLKE
FT                   HKHDHHSRRGLLLMVGDRRRMLDYLKRVDINRYRSLIERLGLRR"
FT   gene            455685..458327
FT                   /gene="pnp"
FT                   /locus_tag="BDP_0367"
FT   CDS_pept        455685..458327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="BDP_0367"
FT                   /product="Pnp Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09044"
FT                   /db_xref="GOA:D2Q8A8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014069"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A8"
FT                   /protein_id="ADB09044.1"
FT                   /translation="MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDD
FT                   SMILSTTTAGSSPKENYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIID
FT                   RPLRPLFPHTLRNEVQVVETVLAVNPDDAYDVIALNAASASTMISGLPFEGPVSGVRLA
FT                   LIDGQWVAFPRWSERERAVFEIVVAGRVVENGDVAIAMIEAGAGKNAWHLIYDEGQTKP
FT                   DEEVVAGGLEAAKPFIKVICEAQAELKKIAAKETKEFQLFPEYTEDLYNRIDEIAHADL
FT                   DEALSIAEKLPRQDRIHEIKEGVKATLAEEFTDMDDAEKDKEIGNAFKELQRQIVRRRI
FT                   LTQDYRIDGRGLRDIRTLSAEVDIVPRVHGSALFQRGETQILGVSTLNMLKMEQQIDAL
FT                   SGPQSKRYMHNYEMPPYSTGETGRVGSPKRREIGHGALAEKALVPVLPSREEFPYAIRQ
FT                   VSEAIGSNGSTSMGSVCASTLSLLAAGVPLKAPVAGIAMGLVSGDVDGQHIFKTLTDIL
FT                   GAEDAFGDMDFKVAGTSEFITALQLDTKLDGIPADILASALQQAKEARTTILEVINECI
FT                   DGPAEMSPFAPRIITTTVPVDKIGEVIGPKGKMINQIQEETGAEIAIEDDGTVFISSEG
FT                   GEGAEKAKEIIDSIANPHVPESGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLA
FT                   NGERIDAVEDVLKEGDTVEVIVQGVDDRGKISLAIPGFEDQESSAPRREHGDRSDRDDR
FT                   RGGRGRRDDRRSDRDDRDYDDRPRRRRSDRDDRDYDDRPRRRRERDYDDRDDRDYDDRP
FT                   RRRRSDRDDRDYDRDDRRSDRRGGRGRRDDRNPRYAADENYDEYRADREERSERPRRRI
FT                   RRDFDPFED"
FT   gene            458500..459063
FT                   /gene="lemA"
FT                   /locus_tag="BDP_0368"
FT   CDS_pept        458500..459063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="BDP_0368"
FT                   /product="lemA LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09045"
FT                   /db_xref="GOA:D2Q8A9"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8A9"
FT                   /protein_id="ADB09045.1"
FT                   /translation="MNIGIIIAVVVIVLIVLWAISAYNGLVTLRNRVKNGWAQIDVQLK
FT                   QRADLIPNLVETVKGYASHESEVFTQVTQARAGVVQAAQSGDVAQRIQAENQLSRALVN
FT                   LQATAEAYPELKANENFMDLQSQLKSLEEKIAYARQFYNDVVQKYNTRIEVVPTNIIAG
FT                   LFHFEQATYFQVDEADRQTPQVKF"
FT   gene            459145..461436
FT                   /locus_tag="BDP_0369"
FT   CDS_pept        459145..461436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0369"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09046"
FT                   /db_xref="GOA:D2Q8B0"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B0"
FT                   /protein_id="ADB09046.1"
FT                   /translation="MPMKFRHMLTSAITAIIISVIVVGGIIVVFEANGDEPDMSYKTLD
FT                   LDAQITADGDLRVTQHIDVTLRDRSDDDYERPWKQLYQQYDLSEDAITNITDISVSDPF
FT                   TGKEYPQGSIAIPSNYSKLEWNEQHAGQWYIADVTQGDSNPQPYDPQTQGFTAKHSNGN
FT                   GESTTARVERELKSDSAATSAQHRTVEIGWNIPSISSASGLKFDVSMTFKNAVTKYKDV
FT                   TAMQWEPFGKKNRIPIGKVTGTLTFPDGATSKNTWGWLHVTRANSTDRGKNGSLVFSAD
FT                   DIRSGDYLDIVAMFDSTLAGNVARTSGKDAKSTFMKIETQDEKEWRDEQRHSARMRVLS
FT                   WVVTGALGIILCILGMIGAIRSIRASQYHGGIEYWRDPPDMSPASAAKLMGVLAGPSGL
FT                   GGRDSSIRNRQMSSTVMSLASKGAIAIYPGPAELYVGYDMSATSATTLAAMIASNGKES
FT                   ELRKSSTVVILPVVYDNVESLNLSQSERAALDILVKAAALTGSRVYDLKAMKSALGKYS
FT                   KAYKLQEAFDRACDKEFGRLGATQSTGYGARMCGVFGVLLSLVMTVRFVSSGSELALAL
FT                   VECLPIMVVSIFIIKITRSTAITEAGQQYAGQVQGLKNYLEDFSDFTDRNVLDLTLWGR
FT                   YMVYATAFGISAKAAAQLAKAYPEVTDPEWLDQNAASSYLYWPCRSYSLTSGSAFASAA
FT                   GSFDASAFSANYGDFGAQLNSSFSDIRSTMAATAPSSSSGGSGGGFSGGSGGGFGGSSG
FT                   GGGGGSFGGR"
FT   gene            461566..462429
FT                   /locus_tag="BDP_0370"
FT   CDS_pept        461566..462429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0370"
FT                   /product="Oxidoreductase, aldo/keto reductase family"
FT                   /EC_number="1.1.1.188"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09047"
FT                   /db_xref="GOA:D2Q8B1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B1"
FT                   /protein_id="ADB09047.1"
FT                   /translation="MTLFRNLGPFRTTAIGHGEMPLTIENNRGHDIGIETLHASLDAGC
FT                   RHIDTAWAYYTPGEEEQTGEKLVREALETWHGPRDEVTVATKVGLRRAWEGDKPVWPRD
FT                   GKPEHLIAYGKQSAQALGVDSIDLLYLHRHDPEVPYNESCEGIKALLDQGVAQWAGVSN
FT                   VSIEQLKIAQEILGDKLVAVQNQYSPIHLETQDTLDYCAEAGLAFVCWSPLGGYRHPYD
FT                   EHLFDPFREVAAKHDVSYQQVVLAWELAKGDHMFVIPGAHRPETILDSLKADELELTDE
FT                   ELAFLG"
FT   gene            complement(462528..463187)
FT                   /locus_tag="BDP_0371"
FT   CDS_pept        complement(462528..463187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0371"
FT                   /product="Conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09048"
FT                   /db_xref="GOA:D2Q8B2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B2"
FT                   /protein_id="ADB09048.1"
FT                   /translation="MGLFFQGLTLGLAYTAPIGMQNLFVINSALTKPRRRALLTALIVL
FT                   VFDVSLSLSCFFGIGKLMQRYDLLRLGVLAVGGLVVLHIGAGLLFARKHGQSSDNIAQS
FT                   RNTAHQVASRFGGDNELLSTIITAGVVTWLNPQAIIDGTLMLGAFSATLTMSQSTPFIT
FT                   GVEIASALWFIGLTLLISVFSHKFSPKVIGFMNRACGAVVMLYGIKLLADFAIAIL"
FT   gene            463389..464945
FT                   /locus_tag="BDP_0372"
FT   CDS_pept        463389..464945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0372"
FT                   /product="Putative multiple substrate aminotransferase"
FT                   /EC_number="2.6.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09049"
FT                   /db_xref="GOA:D2Q8B3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B3"
FT                   /protein_id="ADB09049.1"
FT                   /translation="MAESTARRVMARVAPLNIDWKPSRESDRPITEQIVDYMCEQVSSG
FT                   NWAIGSRLPSQRALAEWFGVNRSTIIAAINELSDYGIVEGQHGAGTRIVSNTWSLMLPG
FT                   APDWADYVGSGFFRANNATIQAINRYEFVPNMTRIGTGELDPRLFPKAMWKQVLGEAAN
FT                   EIDSLGYPPPEGLPALREAIAAHMCATGIECTPAQVLVTSGALQALQMISMSLLPANSI
FT                   VYAESPSYVKSLQIFQSAGMRLKGVPMDADGLDVAALQRLLLGQETVTSSSGLPSDHLL
FT                   SATTRKHAENAILYTIPTNHNPTSITMSERRRHELIACCVANRLPIIEDGAYRDLVFDG
FT                   EAPLPLKALDETGMVITLGSASKALSPGLRIGWIVANEPIVQRLADVKMQMDYGASVLS
FT                   QWTFTRFLSSGLYDEYVAGLKIELRRRRDRALETLRKTMSGLAHWTTPHGGFYIWLTFD
FT                   RSMRMNRLFQETAERGVLLNPGDIYDFAADNSLRLSYSYTTPEEFAAAVDVLAAVAREL
FT                   G"
FT   gene            465051..466319
FT                   /locus_tag="BDP_0373"
FT   CDS_pept        465051..466319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0373"
FT                   /product="Putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09050"
FT                   /db_xref="GOA:D2Q8B4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B4"
FT                   /protein_id="ADB09050.1"
FT                   /translation="MAGLNKEINLPRGVALAVGMVLGSGMLGLPGIVVAAVGSRMAIAS
FT                   WLAVILAMVPMVAIFSRLGSRYTTAAGLTEYARIAFGPWAADATSVLLWGTYAIGIPAL
FT                   AWVGGAYVCSLFDIAQYPWGLVCALMILLASTIVNLLGTRLTALINTISLWMIAALICI
FT                   LVGTHLDLLVLGIRELPSITTGFDLSGLISGAGLIVWAFLGWENMSFSAEEFRNPKRNI
FT                   PMTYWISFAVVSALYLALAFVVNGAEIAGTHITGASGLTSLLPDDWKAVITVLIVIAIL
FT                   ANANSWVLGASRLTFSAGRNGLLPGIFTKTNRNGVPVNALIAMQVIYTGVIVIAGLLHL
FT                   KADNLVGIVSQDFIVLYVVSIIAFIISERNEGGVSGASWLIALLSLGLCGIILTGFTWW
FT                   ILYPTMLVAVGAAVHRRRMRRGK"
FT   gene            complement(466362..467327)
FT                   /locus_tag="BDP_0374"
FT   CDS_pept        complement(466362..467327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0374"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09051"
FT                   /db_xref="GOA:D2Q8B5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B5"
FT                   /protein_id="ADB09051.1"
FT                   /translation="MWRRTRPFDMASALEVFSLALNENGKVFIVPMESGCITGSQPTCA
FT                   FDEACRCCSILVIPGFSSFEIGTVPQAREQEITLLQHAHSQGTTLVSLCTGAFWLASCG
FT                   MLDGRIATTHWQYCEQLGEQYPAINVRHNVLYVQQDNIWTSAGASAGTDACLSITRQLL
FT                   GDAIAESVSKQMAVTLERSGSHIQIADATSSSQHRFDSDLDHLRMLFLAHPEHPWKAGD
FT                   LAAALGMSVRTLERKFKEWGTTPHQWILRERLLMAQSLLISTTMRIDSIAHAVGFSDTD
FT                   LMRRHFLRLFGMTPHQFQLRNERSRLADSSGNPPNGTLRQ"
FT   gene            467552..469096
FT                   /locus_tag="BDP_0375"
FT   CDS_pept        467552..469096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0375"
FT                   /product="U32-family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09052"
FT                   /db_xref="GOA:D2Q8B6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B6"
FT                   /protein_id="ADB09052.1"
FT                   /translation="MQRRNKPEVLAPAGNLRGLKTAVDYGADAVYCGGKAFGMRSAPKN
FT                   LSLEDFEEGARYAHERGVRVYVTFNVLPRNNEVEAMREYLGQLKDTGVDALIVSDIGVM
FT                   LMAKHIAPNLELHVSTQAGVTNYQAANAFYELGARRVVLAREMDLQAVRDIRARIPDDL
FT                   DIECFVHGAMCMAFSGRCLFSNYLTGRDGNHGECAQPCRWKYSIVEEKRPGQYFPIEQT
FT                   EEGAYLFNSQDMNMLAHIDDLIDSGATSLKIEGRSKSAYYIAAMTNAYKTAVNEYMVQR
FT                   GFEDTDGNMLEPFRDRVIRPSDPEYGKPEINDAIMRNADGAFAGKPDIDAVPVAGTITT
FT                   EPEDLSYHARSTRRKSNTAAEVLPDGWYHAGVRPAGHITLPDWLLDEPDKVAHRDYSTG
FT                   FYYPEHKVRQSTDRSAYFRAWLVVGEVLSWSPEDGGRVTIMSRNKIEAGQNVEFVLPGA
FT                   APLAYTVPAGGFRDADGHWVEAINNPAHVFSMPCPQEVPVNAAIRSRTKQPTLKAE"
FT   gene            469153..470169
FT                   /locus_tag="BDP_0376"
FT   CDS_pept        469153..470169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0376"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09053"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B7"
FT                   /protein_id="ADB09053.1"
FT                   /translation="MSNEQYDDAILNSNAIDPTDKDGNPIPVTIPIMLAPGITVVYTTR
FT                   LGGASEGDFAHFNLGGKTGDNPEHVLANRMALAATLGAKISLVSQVHSGNAVDVDEAFV
FT                   LNRPFGFDVSGTKADTARTVDDTAGEPAVIEADGQVTSQKNVALGMFAADCLPVLMADP
FT                   EAGVIGAAHCGRRGLQQGVIGATIGAMAAKGAKPERIVATLGPCICGDCYEVGGDIADE
FT                   FDAQFPGTFTLSRFGQPGIDIAAAALQELAKAGVPADNIVSSRPRVNAATQYLSEDEEL
FT                   AMLCQSDGEGEPQLSERFRNIRRSLCTLENPLWFSHRRAALAGKRHEGRMLALIVRE"
FT   gene            470206..471102
FT                   /gene="ispD"
FT                   /locus_tag="BDP_0377"
FT   CDS_pept        470206..471102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BDP_0377"
FT                   /product="ispD 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09054"
FT                   /db_xref="GOA:D2Q8B8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B8"
FT                   /protein_id="ADB09054.1"
FT                   /translation="MEGVAAMPLGFTVESMTEREQRQAQSAPVVAVVLAAGFGTRFDES
FT                   NPKQLVSVGGKPIVCWSIEAFENNPRVSDIIVVVNARVNDMVNALIDENGYGKVRAIVP
FT                   GGEERVDSTLAALDLLKQAGIPADAKILIHDSVRPFVAQPSIDGCIDALDRFEAATVAF
FT                   ASTDTVLLTEDLGDRKVVRAVPDRPDTFRAQTPQAFRFDTINKAYELAAADPGFHPTDD
FT                   TRVVVDYLPDTPVAIVEGSETNLKITTQADMPIAEGIAAKLTGRPAAIAGDDTAKQEAK
FT                   ARMRAVLAEAAAEMHRH"
FT   gene            471160..471849
FT                   /gene="pcp"
FT                   /locus_tag="BDP_0378"
FT   CDS_pept        471160..471849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BDP_0378"
FT                   /product="Pcp Pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09055"
FT                   /db_xref="GOA:D2Q8B9"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8B9"
FT                   /protein_id="ADB09055.1"
FT                   /translation="MQQINIVISGFDPYEGVDVNPAMLVPQALAERWRDPSADEAGCDD
FT                   LLQDVDVAISTVVLPVSFANAWPALLDTIEKAQPDIIIATGLKRSSRGILLERCATNLM
FT                   DAAKPDADNVIPSRRPINSEGPAAYWTRLPLRSILKDFAKHEIPATLSSDAGTFVCNSL
FT                   FYHLLDWSARQDRRILSGFVSLPIVNEQPHPQHGLSLAQQIAAGRDVIRETVRYHLQPS
FT                   SGDILLG"
FT   gene            471994..473478
FT                   /locus_tag="BDP_0379"
FT   CDS_pept        471994..473478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0379"
FT                   /product="Narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09056"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C0"
FT                   /protein_id="ADB09056.1"
FT                   /translation="MVDQFPIVLRGYDKDRVDEAFAAAQETVNRLREQVQADDQTILQL
FT                   QAQLQEEKNRKANPNSFASLGANAQQMLSSAEQTSAELLERAKKDAAAARATVQLQAET
FT                   LLNNAKIDSKRIMDDANAKATAALAKAKADAESITTNAQRNADRLRSEAQKTVTAQRQT
FT                   VDLELTNSREEHDKRLASERASQQREISDMRAEATEQIAAQRKSANEEIARLKSETNDQ
FT                   IEAALADANKKLADVREQVSKMMTDAQRRAAEITDTAKAKAQEITDEAEVHRTKTMSQV
FT                   NAEVEQIRADISAQQDEATKKVNELLADLAERREAAKQQADELIAEAKNTREEADTYAS
FT                   DRRNTADAQAASIVKQATEDADEQINERREAAKAELDGVQKRIADLQTREAQITQRVSE
FT                   LRAMFANAFSGFGASNLSVVNAVDGEGADDNPEEPAATFDEDVADEAQQGDEVTQSAES
FT                   VESAESEVSAETVASAESVESAEHADGETDEEHDER"
FT   gene            473622..474965
FT                   /gene="pepC2"
FT                   /locus_tag="BDP_0380"
FT   CDS_pept        473622..474965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC2"
FT                   /locus_tag="BDP_0380"
FT                   /product="pepC2 Aminopeptidase C"
FT                   /EC_number="3.4.22.40"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09057"
FT                   /db_xref="GOA:D2Q8C1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C1"
FT                   /protein_id="ADB09057.1"
FT                   /translation="MMAEITPLNNDALASLDASFEASEHNRMAMNAVTAAGIDKVARNY
FT                   DRARLLQRRFSTIVDNGTATHQDRSGRCWLFSSLNVARFVAKKNMGLKEFEFSQNYAMY
FT                   FDKLERVNYFLNDMAALIEAGEPADSRLVQHLLHDVMGDGGQWTMAMNVYKKYGAVPKD
FT                   LFPETESSKNTGEMNTQLRRMLHTAVAHMYADPASIESVIDSATAAGHRILTIHLGEPP
FT                   KSFDWEWTDQDGEFHRDGEITPVEFWNKYVGSADLESYVCLVDDPRQEHAKGRKIGIEH
FT                   LGNVAGGDPTEYLNVPNQFMKDCVRRILEEQGIPVWFGADCHPMMDRENGAWATDLFEY
FT                   GRVYDVDFDLDKEARVRYADSAMNHAMAFVGVDVADDGRTTRRWRVENSWGDKIADKGY
FT                   FTMSDDWFTEYVYEVAVPKALLPDEYLKALEGPAQMLPAWDPMGALAQ"
FT   gene            475077..476249
FT                   /gene="aroG2"
FT                   /locus_tag="BDP_0381"
FT   CDS_pept        475077..476249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG2"
FT                   /locus_tag="BDP_0381"
FT                   /product="aroG2 3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09058"
FT                   /db_xref="GOA:D2Q8C2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C2"
FT                   /protein_id="ADB09058.1"
FT                   /translation="MHTQIRQGGVEAMSGLRGPDSSQDARLLDDHAVFPETVDVNIRQL
FT                   DPIPAPRYFLKELPLTDEMSDLVLTSRQEIRDVLHGRDDRLLAIVGPCSIHDPKAAHEY
FT                   AEKLAAVKRELEDRLVIVMRVYFEKPRTTIGWKGLINDPDLDGQFNIRKGMWLARKVLT
FT                   DVLSLGLPAATEWLDPITPQYICDLISWGAIGARNTESQVHRELASGMSMPIGFKNATD
FT                   GSIKPAADSCFAAAFEHHFLSINLDGRVISAETKGNPDCHLVLRGSSHGPNCDAASVAQ
FT                   ALVDLKGSKASGPSEHGLIIDAAHGNCGKNEVREAEVVEDVAARIASGEQGILGIMMES
FT                   FLKAGNQKPAPLSQLEYGKSITDACVPWERTDQLLHTLADAVTARRNLTK"
FT   gene            476446..477648
FT                   /gene="aroG1"
FT                   /locus_tag="BDP_0382"
FT   CDS_pept        476446..477648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG1"
FT                   /locus_tag="BDP_0382"
FT                   /product="aroG1 3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09059"
FT                   /db_xref="GOA:D2Q8C3"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C3"
FT                   /protein_id="ADB09059.1"
FT                   /translation="MTKERHMQQQLNTPEELRAIRQAMDEGKNPLVATDVPRWEDQVGI
FT                   SRIVNRRVLEFEVLPTPAQVLGELPLSEKAQEIVAYSRDEIRACLYGQDDRLLVIVGPC
FT                   SVHDPAAALDYARRLAGLKDELGGELLIVMRVYFEKPRTTVGWKGLINDPDIDGSCNIK
FT                   KGLLLARHTLLGVLDEGLAAATEFLEPTSPQYISDAVSWGAIGARNTESQVHRQLASGL
FT                   SMPIGFKNATDGSIKAPTDSCFASAQTHTFFGIDHLGRAAVVKTLGNPDCHVVLRGSSS
FT                   GPNYDAASIAKAMETIRGEMPADSAAAHGLIVDCSHGNSGKDEHRQAEVVCNIAGRIAQ
FT                   GEEGITGIMMESFIEGGNQKAAPLDQLVYGRSITDKCLSWDTTERLLRELAHAVSERRW
FT                   K"
FT   gene            477714..478421
FT                   /gene="pfs"
FT                   /locus_tag="BDP_0383"
FT   CDS_pept        477714..478421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="BDP_0383"
FT                   /product="pfs 5'-methylthioadenosine
FT                   nucleosidase/S-adenosylhomocysteine nucleosidase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09060"
FT                   /db_xref="GOA:D2Q8C4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C4"
FT                   /protein_id="ADB09060.1"
FT                   /translation="MTAIAIIGAMDEEVAHIAAALDDVAVTDEAGLTITRGTLTTDRGA
FT                   ECDIIATVGGMGMVNIAATTQHLIDVGHPDAVIFSGIAGNLNPSLHVNDVVLGGTLRYL
FT                   DTDMRLVGQWKPGTADAPVQEFHSDERLIAFADQALTDLGITHIVGIIATGNYFVDDPA
FT                   KVEQVVRETGADAVEMEGAAVAHVAARNDVPALVIRALSDNADTDYEEFKAFDISEYAD
FT                   TAARLTVNIIRRM"
FT   gene            complement(478432..478566)
FT                   /locus_tag="BDP_0384"
FT   CDS_pept        complement(478432..478566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09061"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C5"
FT                   /protein_id="ADB09061.1"
FT                   /translation="MPSEVSPSFIFMESAVPEYEMARLPCRYAGQESGLATMPRIGGT"
FT   gene            478645..480015
FT                   /gene="phoR"
FT                   /locus_tag="BDP_0385"
FT   CDS_pept        478645..480015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="BDP_0385"
FT                   /product="Phosphate regulon sensor protein phoR"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09062"
FT                   /db_xref="GOA:D2Q8C6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C6"
FT                   /protein_id="ADB09062.1"
FT                   /translation="MTSGQWVLLAVAAVMVIAAVASVAYRFGRAFEDGPAPNDPSTFGA
FT                   SKNTSLFGPRVPVQQTERQLIAVMPEALIVTDALATVQYVSPGAQRFGLIEDSAMTLAE
FT                   IRDILKLVSADSVVRERELAIPLDRAARAAAKNTNGKGLEAGKTLPADTLYLHVRVGQI
FT                   ADDSFAIFISDMSEQRRFEIMRRDFVTNVSHELKTPAGAISLLAETIGDAADDPDAVRY
FT                   FSGRISKESERLTELVHRLIDLQKAQSAAAMLNAERLSVLRIAREAIGENQVKAESKRI
FT                   GLALSLNGRPVPLRAGMAGDATASSGGEADVFVDADHETIKTAVKNLVENAVNYSPMNT
FT                   TVAVGIGHEGGKVTIRVVDQGIGIPAPSLDRIFERFYRVDPARSRETGGTGLGLAITKH
FT                   CVQDCGGTITVWSREGEGSTFTITLPEAGDAPESRGNAETKTEEKHPNTTENTEENH"
FT   gene            480015..480719
FT                   /gene="vicR"
FT                   /locus_tag="BDP_0386"
FT   CDS_pept        480015..480719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="BDP_0386"
FT                   /product="Response regulator protein VicR"
FT                   /EC_number="2.7.7.65"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09063"
FT                   /db_xref="GOA:D2Q8C7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C7"
FT                   /protein_id="ADB09063.1"
FT                   /translation="MTRILIVEDEESYREPLVYQPTREGYDVSAAATGEDGLELFTQGG
FT                   VDLVLLDLMLPGLDGTALCRRIREQSRVPIIMLTAKSAEIDKVVGLEIGADDYVTKPYS
FT                   FRELLARVRAVLRRNQMVAESDSASDDDIPLVCGDISMKIGQHEVSVRGENVFFPLKEF
FT                   ELLEYLMQNKGRVMTRHQLIDRIWGSDYVGDTKTLDVHVKRVRSKIEEDPAHPKYLTTV
FT                   RGLGYKIDAPIE"
FT   gene            480882..482009
FT                   /gene="pstS"
FT                   /locus_tag="BDP_0387"
FT   CDS_pept        480882..482009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BDP_0387"
FT                   /product="pstS Phosphate-binding protein"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09064"
FT                   /db_xref="GOA:D2Q8C8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C8"
FT                   /protein_id="ADB09064.1"
FT                   /translation="MRNSILVRSIAAVSGIVMLASVAACGDNTAATDSSSAKSSTTTEA
FT                   VSGNFQGAGASSQQAAVEAWIAGFQGTNPDAKVAYNPSGSGAGVSTFLTGATAWAGSDA
FT                   ALSDDEVEQSKSVCASGNAFDIPVYISPIAVVFNLNGISGKGKTLNMDAETIAKIFDGK
FT                   ITKWNDDAIKQQNPKVDLPDLDITVVHRSDKSGTTKNFLSYVKDAAGDAWSYELGENWP
FT                   NEVGQGAKGTSGVISTVQQADGTIGYADASQAGELGTVAVKVGDDYVPFSAEAAAKVVD
FT                   ASPLDESATGDNRVVVKLDHNTTEKGAYPIVLVSYDVACPAYKDANTAKFVKSWLTYVV
FT                   SDEGQQTAASAAGSAPLSDTMRQKVLKSIDAIETK"
FT   gene            482157..482630
FT                   /gene="pstC"
FT                   /locus_tag="BDP_0388"
FT   CDS_pept        482157..482630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BDP_0388"
FT                   /product="pstC Phosphate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09065"
FT                   /db_xref="GOA:D2Q8C9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8C9"
FT                   /protein_id="ADB09065.1"
FT                   /translation="MSSQSKTAQQPVSGKNADKVFKGVAYACGILILVVLAAVALFLLF
FT                   RAWPLIGGDQKANSATISNFTGGKATNFWGYVGPLLFGTVLISALALLISFFVSVGIAL
FT                   FISHYAPKKLATALSYVVDLLAAIPSVIYGLWGGLILVPAIYPFWNWVAKYLG"
FT   gene            482682..483110
FT                   /gene="pstC"
FT                   /locus_tag="BDP_0389"
FT   CDS_pept        482682..483110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BDP_0389"
FT                   /product="pstC Phosphate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09066"
FT                   /db_xref="GOA:D2Q8D0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D0"
FT                   /protein_id="ADB09066.1"
FT                   /translation="MAVVLAVMILPIITSMSRDIFMQTPRLQEEAALALGATKWEMVKL
FT                   AVLPFGKSGVVSASMLGLGRALGETMAVLMILSPGLNYSIKLLQASQNQTIAANIAAQY
FT                   PEANDLGVSVLIGTGLVLFLITFVVNFIARKLTEKASA"
FT   gene            483107..484105
FT                   /gene="pstA"
FT                   /locus_tag="BDP_0390"
FT   CDS_pept        483107..484105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BDP_0390"
FT                   /product="pstA Phosphate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09067"
FT                   /db_xref="GOA:D2Q8D1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D1"
FT                   /protein_id="ADB09067.1"
FT                   /translation="MMSAAQNNASPMDGAPVIDFDKFKPTRSFTAARKRKDLVMRVLIA
FT                   LAFIVALIPLISVLLTTIINGVKRLNLNFLSYNMTGVVGGNPTPSGGYGGILHAIIGTL
FT                   EITFGAMVISIPIGLMCAVYLVEYSNRGKLARVITLLVDVMSGIPSIVAGLFAFSMFTI
FT                   LIGPGTINGFEGSVALSLLMLPTVVKSSEEMLKIVPHDLREASYALGVTKQRTITKIVL
FT                   RTALPGIVSGAILAVARVIGETAPLLMTAGYIASTNVNLFSGQMTTLPVYVYQEYSKLN
FT                   ANCPASADASCVTTIPMERAWAAALVLILIVLILNLIGRLVAKVFAVKSER"
FT   gene            484177..484956
FT                   /gene="pstB"
FT                   /locus_tag="BDP_0391"
FT   CDS_pept        484177..484956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BDP_0391"
FT                   /product="pstB Phosphate transport ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09068"
FT                   /db_xref="GOA:D2Q8D2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D2"
FT                   /protein_id="ADB09068.1"
FT                   /translation="MGQRIDVNHLNIYYGDFLAVEDVNINIEANKVTAFIGPSGCGKST
FT                   VLRTLDRMHEIIPGAHCEGEVLLEGKNLYDKDIDPVAVRRDVGMVFQRANPFPTMSIRE
FT                   NVLAGVRLNNRKISKSDADDLVEWALRGANLWNEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLINELKNDYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFTDTTTMFNNPQNEEAERYVSGRFG"
FT   gene            485297..486202
FT                   /locus_tag="BDP_0392"
FT   CDS_pept        485297..486202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0392"
FT                   /product="Solute binding protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09069"
FT                   /db_xref="GOA:D2Q8D3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D3"
FT                   /protein_id="ADB09069.1"
FT                   /translation="MKRMVQRAVSVVAAITMLSALGACGGGQSANGSDEDAINVVASVN
FT                   QWGTVAKALGGGNVNVTSIINSTNVEAHDYEPTTADIAKLQKAQVIVVNGADYDSWAVK
FT                   AAKSTKANVVNAAEVSGKKSGDNPHVWFSAQVREDTAKAITAAYKKAVPSKADDFDKLY
FT                   EQWQSKENDLAKSIAEVKKTADGLTYAATESVADYLASDLGLKDVTPTGYAQATANESE
FT                   PTPTDIKQFTDALESGEIKLLVVNTQEETDLTGKITDAAKSANVPMVELTEQMPDKYDS
FT                   LTAWMEGLIDEFSAAIQQAG"
FT   gene            complement(486387..487775)
FT                   /locus_tag="BDP_0393"
FT   CDS_pept        complement(486387..487775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0393"
FT                   /product="Guanine-hypoxanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09070"
FT                   /db_xref="GOA:D2Q8D4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D4"
FT                   /protein_id="ADB09070.1"
FT                   /translation="MEKFFHLKENGTTVSTEIVAGLTTFFAMSYIIIVNPQILSQTGMP
FT                   WGGVFLATIIAAIIGTLVMGLFANVPYAQAAGMGLNAFFTYTVCFGLGFSWQQTLCMVF
FT                   LCGLINIIITVTKIRKMIIKAIPEVLQNAIGGGIGLFVAYVGFLNVGFFTFTTKADAKS
FT                   GDTVQATPGLAVMNNTTIWLFLIGLLLAVAFTVLKVRGGMLLAIALTAIIGIPMSQTTM
FT                   ANSVSISETFAQLPQTFGVIFTADGFPALFSDVAKLPMIILTIFAFSMSDTFDTIGTFI
FT                   GTGRRTGIFSAADEEALENGSGFSSKMDKALFADSIATSIGAICGTSNTTTYVESSAGI
FT                   AAGGRTGLTSVVVAVCFALSAFLSPVISAVPSAATAGVLVVVGCMMASSLKEIEWGDIS
FT                   EAIPAFFASVFMAFSYSISYGIAGGFITYCIVKTCKKQAKDVHPVIWVVAILFILDFVV
FT                   TAIL"
FT   gene            488236..488757
FT                   /gene="rplJ"
FT                   /locus_tag="BDP_0394"
FT   CDS_pept        488236..488757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BDP_0394"
FT                   /product="rplJ LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09071"
FT                   /db_xref="GOA:D2Q8D5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D5"
FT                   /protein_id="ADB09071.1"
FT                   /translation="MKRPEKEAVVAQLTDKFRDADAIYLTEYRGLTVPQISELREKLGR
FT                   DTSYTVAKNTLIRIAAKEAGIEGLDEILAGPTAVTFVKGDFIEAAKTLRDFAKTNKALI
FT                   IKGGYADGTVYDAEGAQKLADLKSRPQLLAEFAGDIKATMSKAAYLFNALPTKAVRTID
FT                   ALREKQEKAA"
FT   gene            488869..489249
FT                   /gene="rplL"
FT                   /locus_tag="BDP_0395"
FT   CDS_pept        488869..489249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BDP_0395"
FT                   /product="rplL LSU ribosomal protein L12P (L7/L12)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09072"
FT                   /db_xref="GOA:D2Q8D6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D6"
FT                   /protein_id="ADB09072.1"
FT                   /translation="MAKYTNDELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPAAVAVA
FT                   APGAAAPAEEEKDEFDVILSAVGDKKIQVIKAVRAITSLGLAEAKALVDGAPKAVLEKA
FT                   KKEDAEKAKSQLEEAGATVELK"
FT   gene            489435..490808
FT                   /locus_tag="BDP_0396"
FT   CDS_pept        489435..490808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0396"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09073"
FT                   /db_xref="GOA:D2Q8D7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D7"
FT                   /protein_id="ADB09073.1"
FT                   /translation="MNSKQSQKTKTKKDADAEYAEMTQGPLRSLIIRLAVPAIISNLVT
FT                   TIYSLSDTFFIGRLGTAQSGAMGIAFSVMTVIQAMGFFFGNGAGNSMSRELGKHNDARA
FT                   ARLLSVGFVGALASGLVITVVGLATLHPLVRMLGATPTIEPYAVTYLIPLLVAAPMMCG
FT                   SFALNCLLRYQGLASLAMIGLVTGSVLNLVLEPVFIFLLHMGMFGASLATAICQTISFV
FT                   ILAALGMTYGVVHFSLRQCRITVPLAREIAGGGLPSMIRNAAGTLAVTCVNIAANPFGD
FT                   AAIAGMAIVMRIMLGANSIMIGLGQGFQPVCGYNYGAGLHQRVMKGFWFCVKVATIAML
FT                   AFAAIIWITAPDLVRVFRDDAAVVTVGTAALRFQCCTLALNGYNMMANTMQQTIGKTVA
FT                   ASFLAFCRLGLFLAPTVLILPHVFGITGVECAQCVSDVLTLICTIPVHRRILDGLKQS"
FT   gene            490936..492429
FT                   /locus_tag="BDP_0397"
FT   CDS_pept        490936..492429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0397"
FT                   /product="HA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09074"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D8"
FT                   /protein_id="ADB09074.1"
FT                   /translation="MCERKAGTVSEDQRTAQQWIVGVGESDLKTVKSGESVELGRKPLR
FT                   PLADDGYSRLDIADSNKSMSKRHAVFAVDDNGTATIRDLNSTNGSFVVRPNGELMRLPS
FT                   DVDFMLPSSPITMQFGDVKVTFRRERVAADAEAKPAVADLFDYALADEGPQEPDAADMS
FT                   VDDILNLRAGEPTALFNARNVASRVDALHKAERQSFAPVRAGEAEYEVLPSVSLVQPQD
FT                   EAHDDAPRDLFADAQAEADARAERDREDVELTDAIDRAKAQAATVQGVNEALAADAAKS
FT                   DALAQLKSDTIAVNDLFGARNADRQQDESDARQDSLNLPEHGQDEEQSEPTQERQEEPV
FT                   EPVEQSQPVQETVAERAEQAESSDRSDDERPQVSADDERFRPSASQNDIEPSIDATVTF
FT                   TPVFEPGSVFDRVSKGGFVKQEQTIEVDGLTSDEAKRTDDFTVQFEMARHPQLLPFLAM
FT                   NPSLYDDLYAWLSALGNQDIDAALSRNPGYAEYRKAVGK"
FT   gene            492438..496061
FT                   /locus_tag="BDP_0398"
FT   CDS_pept        492438..496061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0398"
FT                   /product="DNA and RNA helicase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09075"
FT                   /db_xref="GOA:D2Q8D9"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8D9"
FT                   /protein_id="ADB09075.1"
FT                   /translation="MSESNERSTTALDRIRGWREQYRLGLSPSPLEDVTQLTAQLDLTH
FT                   AHPSGIAQLFASGHVTLDSLFRDNGMLRAAGRRVERVIDDRETKSRISGVGELSLVVGV
FT                   ATWKGNQVPVLMYPVEVRRTGKTAESGTTIAFTGRVRLNASFAAVMREHNVALDEAKLF
FT                   DGSNYESGTPETSAVFSAITARATSAFPDFEIERHIILGCFMDPSTQMLVESQKIIDQL
FT                   AQGPTGNTVLDALAGDKAARDALNNADIAEYSPFDGDPHGEYEVGDVSNTVRYAAQIAA
FT                   SGHSLFVDSSIGNNTAEQAAAIASRCVMSGRSVLYVPCVTNQRRRFAQAINANEMGGQL
FT                   LDIADDGANAAIDRQLIAAVGFQSGVATSRFDQLADELVGVRSRLTRYLGDLHGVSQEW
FT                   GVSAYQTIQNLAQIAVLPTRPTTHVRLSKQAAHAISDKMEDWAVKMQRAGELGEYSITE
FT                   KDTAWFKASIYSEEEAVSAHQRVVELLRKVLPATREQVASTVQTCGFPIPTTAQEWGRQ
FT                   VMVLKNLRRVLDVFQPEIFERDIVSMIEATKPKAERKAEGSSMGFWERRRHIKEAKGLL
FT                   RVGAQVENLHDALQVVAKQSEQWHMFVPHGGWPVLPAKLDDILETQDELTRDMTALNTI
FT                   LATTPMGGSLETVDFNQVEERLKALYDDHQSLDTLPERARLEREFHDIGLDELVEDLRN
FT                   RGIDDNAVAGELQLAWWTTVFEDIVRSSAIISNQDGSALQAAADRFAQVDVEHVRSVGP
FT                   MVAQESMRRLCDMLFSRTQEANLLHTTLAGSRSVSLNRLHKEHAQILAAAKPILMATPA
FT                   TLAAVTDPAPLADVVIVDAGAHIPSVELMSIVCRAQQVVVIAHRETVTSDSVRSLIALL
FT                   PSVKIADRPVRRAPKLGAFLESEGYGSLSLDVAREGSQGEVAYHYIEEANGVPVMTSGL
FT                   VESSQQEIDEVVRIITQRAASFTIVPASYTLTVVALTHTFRTRLGAELKAMATKNKAMG
FT                   LFLRHVRIVDITDVAGAHTTDAIVAMCYAKTSHGRLLQQFGALEAEGGRGMLLDALAVA
FT                   DRHVDIVSAFSSTDMDDERLHQSGPKMLKTVLRWAEQLDDRPVRPSENESGTNILFNDL
FT                   ADRIRARGLKVAVDYGFDRGTRLPLVVGLPDKPFSLAVLTDDAQFMGLQSTRQRHRVLL
FT                   QDIESLGWSVMTVWSVGAFVNPDKEVDRIVARLSDIYQEGK"
FT   gene            496058..496330
FT                   /locus_tag="BDP_0399"
FT   CDS_pept        496058..496330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09076"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E0"
FT                   /protein_id="ADB09076.1"
FT                   /translation="MSEAASDKERSGQESVDGPAVRVVSGYCASRRTPRKHKRVVRQGT
FT                   ELFDADGVKLEPSDVLTDRQRAADDDKRILTELPPHWGVFSERGH"
FT   gene            complement(496388..497029)
FT                   /locus_tag="BDP_0400"
FT   CDS_pept        complement(496388..497029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0400"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09077"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E1"
FT                   /protein_id="ADB09077.1"
FT                   /translation="MMTCLHNLTNQPSMRRLARNPLRSARLRRLLAALCAGLAVFLGLQ
FT                   CLRSTVETRPAVVTTQRIRRGDTITASVVAVRDIPYDAAWNNAFHTIDDVTGMVAQIDI
FT                   PDGGIVTATMARASPMIPQGHTAVDVRLASSIDELDVGDEVTLSGAVPAQGDAGDDGGA
FT                   LRELASRATVIGKPAKDANGMATATFAMSPDEAAAVLQVQEYAAIIAVTR"
FT   gene            complement(497143..497325)
FT                   /locus_tag="BDP_0401"
FT   CDS_pept        complement(497143..497325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09078"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E2"
FT                   /protein_id="ADB09078.1"
FT                   /translation="MPTYHYRCKNCNYDFTEQQSFSDDPITVCPKCGEEQVRKVYSAVP
FT                   IEFKGSGFYRTDKSK"
FT   gene            complement(497456..498100)
FT                   /locus_tag="BDP_0402"
FT   CDS_pept        complement(497456..498100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0402"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09079"
FT                   /db_xref="GOA:D2Q8E3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E3"
FT                   /protein_id="ADB09079.1"
FT                   /translation="MDTTEATEPPEAAERLRSMKQAMRHQAIAARKRTTPEERLEAGRR
FT                   IALHACDEGLIHPFATVAAFVSMGSEIAMAPLLQALLDAQCRVLVPRLGSGMTIGWSEL
FT                   DDLEGLRSVRGDDGSPNTRRPQEPDSPSGGPDTLSDAELIIVPAFAVDPSGIRLGRGGG
FT                   WYDRALEYKAAKARVVAICWPWETTSTPIPHEPHDVPVDAALTPDGYMAIR"
FT   gene            498169..498822
FT                   /locus_tag="BDP_0403"
FT   CDS_pept        498169..498822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0403"
FT                   /product="Ribosomal-protein-S5-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09080"
FT                   /db_xref="GOA:D2Q8E4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E4"
FT                   /protein_id="ADB09080.1"
FT                   /translation="MTVFQAFRDMICPIRANAIAVPQFIQSQALQVPIRLRPLTADDDD
FT                   EWNEVRWRNDAWLRPWESGDPLHGQSMSFDMWIRRLRSNERDGTGVVFVMEHQRRIVGQ
FT                   ISLGAICYGAMRTGVVGYWVDERCAGRGFAPMAVTLLADWAMFDPDGPHLHRLEIALLP
FT                   ENARSRRVAVKVGAHFEGVRRAYMYVNGRWRDHETYAMTSEDAPNGFTARLMTA"
FT   gene            498884..500083
FT                   /locus_tag="BDP_0404"
FT   CDS_pept        498884..500083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0404"
FT                   /product="Narrowly conserved hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09081"
FT                   /db_xref="GOA:D2Q8E5"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E5"
FT                   /protein_id="ADB09081.1"
FT                   /translation="MGYESLSTVVVLAIVVILMVGWLPRRTVKGMKRVIEHREDRFSPS
FT                   LHLVDADSGTRFSDVSTPQAKGAIMQSSEAQGGRMSEEHIAQVRTLRRAAIRRRRIIVV
FT                   ALAVTTIAVIVAAVALHFSAWFALIPAVMLVAVMALGVRAAKQARDWEQKVARYRSRMR
FT                   KQAAAERERARAEQAERRRLHDAELAEARRIAETQVPTDVMPEGEIRQAVERGKADRDR
FT                   ALNKRKQEAAAKVEVAPEATPDRRNAGLSIHDERDKQQDMAEHAEDKPVSKEISVPDQS
FT                   SQDLISFSLGAPRNGVEVRQAVPESMEIKSTRQVAKAIPPVRPVEQAEPVEPLIVPSDA
FT                   MSDMDEDESGARVEAGVQLNEVSVKDFHDTEVSAEVTAPDATSDSLGTGLEAILARRGA
FT                   "
FT   gene            500300..500593
FT                   /gene="hsp10"
FT                   /locus_tag="BDP_0405"
FT   CDS_pept        500300..500593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp10"
FT                   /locus_tag="BDP_0405"
FT                   /product="Hsp10 10 kDa chaperonin GROES"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09082"
FT                   /db_xref="GOA:D2Q8E6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E6"
FT                   /protein_id="ADB09082.1"
FT                   /translation="MSISLTPLEDKIIVKQAEAETQTASGLFIPDNAKEKPQQGEVLAV
FT                   GPGRRNDAGERIPVDVKVGDKVLYSKYGGTEVHYQGEDYLIVAARDILAILG"
FT   gene            complement(500699..501943)
FT                   /gene="metB"
FT                   /locus_tag="BDP_0406"
FT   CDS_pept        complement(500699..501943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="BDP_0406"
FT                   /product="metB Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09083"
FT                   /db_xref="GOA:D2Q8E7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E7"
FT                   /protein_id="ADB09083.1"
FT                   /translation="MTSELVHHGQSFDDQPLGFGTKSIHLGNGVDKETGAIRRPITLAN
FT                   AYALPYDPSDINWSSSDVNLYTRNGHPNQRYLEAKLANLEGAEDAVVLASGVAALAATF
FT                   TTFLNRGDHAIFSDTTYIAAYRLLNQILPEKYGIETSIVDTSDPANVLNAIKPNTKLVH
FT                   LETPANPTLKVTDIASVTSIAREAQERLGHDILVSVDNTFNSPYNVRPLELGADIVVES
FT                   LTKYINGHGDALGGMIATTKARTDEIRFTAQVNYGGIISPFNAWLINRGTVTLPLRMKQ
FT                   HNASAQAIAEHLERIDAVRFVSYPGLESHPGHTVATSQKAHPAAGYGGVLAFGLNTDHE
FT                   GHNRFVSKLNVITSAVSLGHDESLIVFLGEDDERQYLYPQEFHQGFFRLAVGLEDTDDL
FT                   IRDIDHALTEAGLME"
FT   gene            502123..502204
FT                   /locus_tag="BDP_tRNA13"
FT   tRNA            502123..502204
FT                   /locus_tag="BDP_tRNA13"
FT                   /product="tRNA-Tyr"
FT   gene            502206..502277
FT                   /locus_tag="BDP_tRNA14"
FT   tRNA            502206..502277
FT                   /locus_tag="BDP_tRNA14"
FT                   /product="tRNA-Thr"
FT   gene            502283..502359
FT                   /locus_tag="BDP_tRNA15"
FT   tRNA            502283..502359
FT                   /locus_tag="BDP_tRNA15"
FT                   /product="tRNA-Met"
FT   gene            502408..502578
FT                   /gene="rpmG"
FT                   /locus_tag="BDP_0407"
FT   CDS_pept        502408..502578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BDP_0407"
FT                   /product="rpmG LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09084"
FT                   /db_xref="GOA:D2Q8E8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E8"
FT                   /protein_id="ADB09084.1"
FT                   /translation="MASKSADIRPGITLACTECKERNYITTKNRRNTPDRLELKKFCSR
FT                   CGKQTVHRETR"
FT   gene            502639..503838
FT                   /gene="murB"
FT                   /locus_tag="BDP_0408"
FT   CDS_pept        502639..503838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BDP_0408"
FT                   /product="murB UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09085"
FT                   /db_xref="GOA:D2Q8E9"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8E9"
FT                   /protein_id="ADB09085.1"
FT                   /translation="MTSFADLTTIGVGGPIAIFLEPTSRVGVIEAVEDADAKGLPLCVI
FT                   GGGSNMLVADTPFNGVVVRDARRSINVLDEAAPVENGERIVHVNAEAGCNWDDFVDFCV
FT                   ELGLEGVEGLSGIPGTVGASVVQNIGAYGQEVGSSVRSVEVWDRKEKRTCDLTAEDLRF
FT                   GYRMSALKASMYAAPATPADEFFPTPRYVVLSVTFALHHSDTGVVGYGQLAKALGVEVG
FT                   DRMNTKDIRNAVLAVRAAKGMLEDSHRYLAEPMRGTKKAGLVAIAHDAQRTQAGNDELD
FT                   FNRHSCGSFFMNPILTIEQAAALPEDAPRFDATLPDGEPSVKTSAAWLIDHAGFHKGFK
FT                   TAATATAGLSTLHTLALTNRGGASAADIADLAKTVQDGVEAAYGIRLVPEPVVIGMDLK
FT                   "
FT   gene            503922..505421
FT                   /locus_tag="BDP_0409"
FT   CDS_pept        503922..505421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0409"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09086"
FT                   /db_xref="GOA:D2Q8F0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F0"
FT                   /protein_id="ADB09086.1"
FT                   /translation="MNVFRKKSVEQTIAETGESGRSLKRDLTWWDLAIMGVAVAVGAGI
FT                   FSIGAQAAAFHAGPAVIISFLIAGIVCGAAVMCYAEFASMIPVAGSAYTFTYTTVGEII
FT                   AWVIGWDLILEMLMAGSVVSKYWGVYLNDFFRLIGWNINTNIAIGSFNFDVAPLIIVAF
FT                   FTALLVLGTKIGARVDGALTVLKIAIVLFVVVVGFFYIKADNFTPFIPPSEPAASSDSG
FT                   VSAVMNQPLWQWATGMTPSIYGVAGIISGAALVFFAFLGFDVVATTSEEAINPKRNVPL
FT                   GIGVGMGLIIVLYTLVAIVTTGMVSYKDLAKQASPSLATAFEMVGANWAAKIISFGIVI
FT                   GLATVVMVLLLGLTRVVFAMSRDGLLPRGLSHTGKHGTPVRLQVIVGVVMALIAACSDV
FT                   DVLADMVNIGTLSAFTLVAISVPIMRRKRPDLKRTFRMPGNPWIPILIALANVWLMLNL
FT                   SVLTWIRFVVWLLVGFAIYFGYGYRHACLGTGELDVAREQE"
FT   gene            505454..505774
FT                   /gene="fdxC"
FT                   /locus_tag="BDP_0410"
FT   CDS_pept        505454..505774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxC"
FT                   /locus_tag="BDP_0410"
FT                   /product="fdxC Ferredoxin"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09087"
FT                   /db_xref="GOA:D2Q8F1"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F1"
FT                   /protein_id="ADB09087.1"
FT                   /translation="MPYVIAQPCVDVKDKACVDECPVDCIYEGSRSLYINPNECVDCGA
FT                   CEPVCPTEAIFYEDDLPDEWAWYKDAAVSFFAEVGDLGGASAAGPIGKDPEQVAALPPQ
FT                   NQ"
FT   gene            505882..507030
FT                   /locus_tag="BDP_0411"
FT   CDS_pept        505882..507030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0411"
FT                   /product="Aminotransferase"
FT                   /EC_number="2.6.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09088"
FT                   /db_xref="GOA:D2Q8F2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F2"
FT                   /protein_id="ADB09088.1"
FT                   /translation="MGFHEFSSPYDWSRIASFKRTAKAAFGGMVDLSVGSPVDPVPDSV
FT                   RKALGAASNDPNAYGYPVTAGTADLRSAIAEWFAAARNVDLTAIDADVVPTVGSKEGVA
FT                   LMASLLHLGAGDVVVQPKVSYPTYEIGTQLAGAKVLKVDDVADVESWKDVPGVKAIWVN
FT                   SPCNPTGAVLAAEQMAAIVAAARGIGAVVLSDECYALMQWGNVDVEADADTLASTPCAL
FT                   RPDVCGGSAQGVLVLYSLSKQSNMAGYRTAFIAGDKSLIVPMTAYRKQIGQIIPGPVQA
FT                   AMAVGLRDLESVKAQRKRYANRLGILVSALRAYGYCTDMPDGALYVWVKAKSGDCWKDM
FT                   EQLARIGIIASPGEFYGAPEYLRFSATAGDAAIADAAERLAR"
FT   gene            complement(507027..508370)
FT                   /locus_tag="BDP_0412"
FT   CDS_pept        complement(507027..508370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0412"
FT                   /product="DNA-damage-inducible protein P"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09089"
FT                   /db_xref="GOA:D2Q8F3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F3"
FT                   /protein_id="ADB09089.1"
FT                   /translation="MFEHLFQSAAEIAYHGTMSTAPRIAAAKRDWGHDETGCTVLHIDM
FT                   DAFYASLEVARHPEYTGKPVIIGTGNRSVVSAASYEARACGINSAMASSRAHQLCPNGI
FT                   FLPVDMQYYRAMSRRIFTEVFSRITDRIEQVSVDECYMDVSGALLRWRTASAIGAWIRE
FT                   QVAARYHVTCSVGIAANKLVAKMASTNAKPNGMLMIPLARHAEFVQMMPLRGIPGIGPS
FT                   LERRLRTWGINSVADVARMDETTLAEATGSTIAAHGLYMASHGLDDRPVTPYTPEKSIG
FT                   SERTFDTDTQDMRQVCSMLRHCCDEVASTLRRRGLMARKVMVKLRFPDLSYATKGRTME
FT                   RPTDTASMLYPQCVDLLLRMMGMESGSAHAISLPRPIRLAGMSASGLVEAGSAIIQPSL
FT                   EDLLEEEDTAQDCDARRKEPKTERLRGAEQALDAVRRKYGDDIASFGI"
FT   gene            508455..509372
FT                   /locus_tag="BDP_0413"
FT   CDS_pept        508455..509372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0413"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09090"
FT                   /db_xref="GOA:D2Q8F4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F4"
FT                   /protein_id="ADB09090.1"
FT                   /translation="MTALNRLPIVVIAICEAVMIYTATGVAKVAFTQLDAVYAAWYRVG
FT                   FMALMLLAWRKPWKADRRDSLPGTRRDWTLLAGFGAALVLMNTMYYVAISNMDIGIATA
FT                   IEFIGPLGVAVITGHSWRERVGIGIAACGVVLLAGISLGGENGGSFLIGLIAILIGGSM
FT                   WGCYIVLGGKVATKGHPIDMLCWGTVLGWLMQSVFLAPGAIAHLARPKADATWVHASWG
FT                   VAALLALLFLVSLFGSFLPYLTDQVVMRRIPSARYSVVQSINPAMATFIALAFGEVPTL
FT                   GECAGIALVIVAVIVTFSGDENPA"
FT   gene            509554..509644
FT                   /locus_tag="BDP_tRNA16"
FT   tRNA            509554..509644
FT                   /locus_tag="BDP_tRNA16"
FT                   /product="tRNA-Ser"
FT   gene            509681..511210
FT                   /locus_tag="BDP_0414"
FT   CDS_pept        509681..511210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0414"
FT                   /product="Narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09091"
FT                   /db_xref="GOA:D2Q8F5"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F5"
FT                   /protein_id="ADB09091.1"
FT                   /translation="MPKRRNINVFRLWNASGDRPSHSTEVNVSGTPTPRFAALFDILEQ
FT                   ERISKKKGTAMRIRKDALHASNPELLTAGRRRIAMVAAIIIAVLAVGGWFVVQQVRSQE
FT                   TTHVADPATTSTRQSQAKATAKQTEATEHHGNSPDCPDTDCIAMLVNGDLLFHEGLWNN
FT                   FASANTAATDGTAFDFTSLFEPMRKYIDASDIAVCEFETPIAQRGGPYTGYPVFNIPPE
FT                   VADAAKNVGYRACTHASNHSWDQGADGISRLWDTLEADGIAQTGSYKTEEDSTKPLVID
FT                   SPTGGGKLGLISGTVSLNAQTPDFDWRVDRLREASDPNHQADIDKAVAKAKAAREQGAD
FT                   VVAIAMHSVQEYLDYADSWQQSEAHELADTGAFDVIYGAGCHCAQPIENYNGTWIIYGL
FT                   GNAVTVTSYIPGNEVNNQGVTARVQFAGKKGVAGSWRVSRIDWIPTANMRQGQYQWCSL
FT                   ASDHPDGTCWNDAEDANQRQRIWNVIYSMGADQNVVREWNITTEQTTSSGK"
FT   gene            511289..512278
FT                   /gene="serA2"
FT                   /locus_tag="BDP_0415"
FT   CDS_pept        511289..512278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA2"
FT                   /locus_tag="BDP_0415"
FT                   /product="serA2 D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09092"
FT                   /db_xref="GOA:D2Q8F6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F6"
FT                   /protein_id="ADB09092.1"
FT                   /translation="MVEIVETQPERTDLPLVVMPVVVASMIEPFKRCFGLLENVARVRM
FT                   YEDFTLDEDTIVARCDGADAVMVIGFHCTDSILERTHAKCYAFGGTGVASYINLEKAKA
FT                   QGIRVCNVVHYGDHAVAEHTMALLMELTRHVGQLDREVKAGDWAGNDGYELFGKKLGII
FT                   GLGGIGQTVARIANAYGMKVSAWNSHVPEQVLTDCNVTPVDDMNELIAGSDVVSIHMPL
FT                   LDSTRGIITAENLEALRPGTLFVNTARAEILEPGALLKRLERGDIPAALDVFEHEPLGA
FT                   DDPLCRIPGIVLTPHTAWRTDGAYVGITEQVVQSVAAFFRGEDFNVVV"
FT   gene            512313..512951
FT                   /locus_tag="BDP_0416"
FT   CDS_pept        512313..512951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0416"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09093"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F7"
FT                   /protein_id="ADB09093.1"
FT                   /translation="MQTILDSADRPAHDAFVEKKSEFIGDACHIDSLDDALAFVAMIRE
FT                   KHPKARHVAYAAVCGGSDGRLAERMSDDGEPSGTAGKPILDVLRANEMTDCVVAVTRYF
FT                   GGILLGSGGLIRAYSTGASIAVKAASKARIVPCGEYRIVLDYPQLGSFQNLLASVQGEQ
FT                   VDAQYTDRIAMRAIVPQEHAATFESRMIETFNAAVTPELVGTTNRPVKL"
FT   gene            512986..513657
FT                   /locus_tag="BDP_0417"
FT   CDS_pept        512986..513657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0417"
FT                   /product="Narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09094"
FT                   /db_xref="InterPro:IPR004830"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F8"
FT                   /protein_id="ADB09094.1"
FT                   /translation="MTDAENIEHAEHAGNDTAERADVQAVPADFEPLTATYERLRHSTD
FT                   AAELSEFARRPLPDRAEQAAFSRATALLEAVAGNPHTPLEDRIFLAETMPFPNILVKLS
FT                   TDESVEVRKAVAGNADDKNWLVGRLTKDESAEVRDIALRNKRTSWKMRLEGAQDPNMDT
FT                   QTLDFLGALGTELEPKAPAVLASMVRRAVALNPNTSPAMLAKLAEDPSGEVVRAAQSRR
FT                   A"
FT   gene            513735..515897
FT                   /gene="malQ2"
FT                   /locus_tag="BDP_0418"
FT   CDS_pept        513735..515897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ2"
FT                   /locus_tag="BDP_0418"
FT                   /product="malQ2 4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09095"
FT                   /db_xref="GOA:D2Q8F9"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8F9"
FT                   /protein_id="ADB09095.1"
FT                   /translation="MTEQTENATRLARPLIRLAKLVGVATSYVGMSHDYHEIEDDVLVA
FT                   VLKALGIDASNDGAIEQSMESILRDCRSRLVAPTVLHTVGKPSKVLVNVGVLEAPQASI
FT                   TLEDGSEFAGKIAYGAGDGSIHEIDDTFVSTSSVILPEGLPAGYHTLHVRVGERTQDAT
FT                   VISAPEKIELLDDMKEGSLWGWMSQLYSIRSNGSWGVGDYEDLKTLLVESKRRTGADFM
FT                   LINPMHAAEPVPPLTPSPYLPISRRFINFSYIRPESVPEYATLNPDGKKQVDELHARVE
FT                   PLNGDAQVIDRDAMWRAKMHALWIIFTSGRTAERQAQFKEYLAGCGDELESYATWCLCY
FT                   DKWGAPNGRPDNWERMFNRDSVEIRELRDRFPDTLEFYRWLEWVATEQLHAAQQAAREA
FT                   GMKIGIVADMAVGVHPSGSDVWWNPERFAKGATVGAPPDMFNQQGQDWSQPPLNPIALE
FT                   RTGYKVYRDMVHGMFANAGAVRIDHILGLFRLWWIPEGKKATDGTYVYYDSDVMLGVLA
FT                   LEASRAGGVVVGEDLGVVPPYVSKSLSAHGILGCAVEWFEQFDGEFRAPHDWRPYALAS
FT                   VNTHDMPPAAGYLEYGHVKLREQLGLLSGPVEEFRASATAEHNAMLNMLVEEGYLDKAA
FT                   LRDELANENEIVDALYRGLKGSPCKLMAASIVDAVGEKRTQNQPGTNNEYPNWRIPLAD
FT                   GKGNLVPLEELFDQPRLQEIAAIMRG"
FT   gene            516166..516615
FT                   /gene="rplM"
FT                   /locus_tag="BDP_0419"
FT   CDS_pept        516166..516615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BDP_0419"
FT                   /product="rplM 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09096"
FT                   /db_xref="GOA:D2Q8G0"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G0"
FT                   /protein_id="ADB09096.1"
FT                   /translation="MKTFTPKPADLTHDWYIIDATDVVLGRLSSQAAILLRGKNKPTYA
FT                   PHADSGNHVIIINADKIALTGNKMGKELYKHSGRPGGLRRDSYAELLEKDPERIIRSAI
FT                   KGMLPKNRLAKVQLGRLRIFRGAEHPHTAQQPQVFEIAQVSQQAK"
FT   gene            516636..517127
FT                   /gene="rpsI"
FT                   /locus_tag="BDP_0420"
FT   CDS_pept        516636..517127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BDP_0420"
FT                   /product="rpsI 30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09097"
FT                   /db_xref="GOA:D2Q8G1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G1"
FT                   /protein_id="ADB09097.1"
FT                   /translation="MAENTNNSAVLETEEELTSYTTETNAGAGTGTSAIAPGYGTGRRK
FT                   EAVARVRLVPGTGKWTINGRTLEEYFPAKLLQREVNSPIVLLKLEGKFDAIVLVDGGGT
FT                   TGQAGAIRLGVARALNAIDRDANRATLKKAGFLTRDARVVERKKAGLHKARRAPQFSKR
FT                   "
FT   gene            complement(517198..519648)
FT                   /gene="glgX2"
FT                   /locus_tag="BDP_0421"
FT   CDS_pept        complement(517198..519648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX2"
FT                   /locus_tag="BDP_0421"
FT                   /product="glgX2 Glycogen operon protein glgX"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09098"
FT                   /db_xref="GOA:D2Q8G2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G2"
FT                   /protein_id="ADB09098.1"
FT                   /translation="MRNPPLHRYATRPGLYFTDDGGADAVVRSETADQVWFCVLEPLDQ
FT                   PSAFYAEAVRLFNEPDISFIEQAQSQKICTRRIPSLNLRETLFMMDGPNYGLWYVHIPK
FT                   AWDGMHYGYRVNGPWDPNHGVSFNPYKLLLDPYAKGIDGSMKLNPGAFAYACEIMNGKV
FT                   KGSPFGPMSTVDSLGHMPVSVAIDDRDANKHEGEPSHPHVAWSKTIIYELHVKGFTANA
FT                   PWLPKELRGTYAGLAHPSTLSYLQDLGVTSIELMPIQAKQPELFLQERGRTNYWGYSTL
FT                   GYFAPEPSYATRAAQEAGAAAVRKEVIDMVRALHEAGFEVIMDVVYNHTCESGPEGPTI
FT                   CWRGLDNLSYYRRNKEKISRLYDTTGCGNTLDFTNTHVVTFAVDSLRYWAKRIGIDGFR
FT                   FDLAATLARLDGDFTSYHPFLYALRSDMLLGNLKMIMEPWDVGPGGWRTGQFGIPFAEW
FT                   NDRFRDTTRKFWLTDVKRNRGGESGVVTMQEMATRLCGSADLFATDPGRGSTASVNYVA
FT                   CHDGFTMADLTRYRHKHNERNGEDNRDGTNDNHSVNFGYEGPSDDPIIIQQRERAMANM
FT                   LGMLLLSLGTPMLLSGDEFGNSQNGNNNAYMQDNPTTWLDWDWLYSTEQTPELKQFDLV
FT                   SRLIALRKSRDLYDHEDFFTRLSKIGLLKRSDRVHWFLPSGHAPHDADWTNPAVRTFAM
FT                   QLLSPDGSSLMILINGSDEISRFHLPADKEWEMVWSSAEVSGEYPGQGTSVDRVAELNE
FT                   ESENKPAGRFSDHLHRLNMMYWHADVNDGAVPEDIYDAEGADDPTLWTIPALSISVMRQ
FT                   ISAD"
FT   gene            519915..520919
FT                   /locus_tag="BDP_0423"
FT   CDS_pept        519915..520919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0423"
FT                   /product="Putative dehydrogenase"
FT                   /EC_number="1.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09099"
FT                   /db_xref="GOA:D2Q8G3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G3"
FT                   /protein_id="ADB09099.1"
FT                   /translation="MKALVLTGVKEFEIQDLATPEILPNEVLINTAYAGVCGTDHDLYA
FT                   GRPGSAAAVPPIVLGHENSGVVAAIGAEVTNVKVGDRVAVDPNIYCGQCEYCLTQRPEL
FT                   CDHLSAVGVTRDGGLAEQFTAPATVVYALPDNVSLRDAAAIEPVSCAVHGLDLLKLHPY
FT                   QKALVIGDGFMGQIFAQLLQAYGVHRVDLAGIFDEKLERNKSQFGVTETYNTTREQIPS
FT                   EAYDVIIEAVGLPATQAQAISAAKKGAQVLMFGVGPQEAHFEMNTYDIYKKQLTIQGSF
FT                   INPLTFRDAISLVSSGKMNIGGLISHELGLEEVQDFLDGKISGVSKAVVAIGD"
FT   gene            521110..522441
FT                   /locus_tag="BDP_0424"
FT   CDS_pept        521110..522441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0424"
FT                   /product="Hypothetical membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09100"
FT                   /db_xref="GOA:D2Q8G4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G4"
FT                   /protein_id="ADB09100.1"
FT                   /translation="MIGILERLGVPRSLMLGFLAVAIFMTGDGFELTFLSKFMVDQGFA
FT                   SSQASLLVTIYGLFAALGGWSAGVLAEMFGARRVMLFGACWWIGIHLLFLGVAIPSHVY
FT                   LLILGLYALRGIGYPLFIYSFVVLMAQYISPARLASATGFFWTCFSLGIGVFGAYLPSF
FT                   IMPVFGEYKTFWFALPFSVVGTVMCFFFVPKNKIVKGEGLSRKKQLKELTEGATILVTN
FT                   RKILICAIIRIINNLLLYGFPVIMPLYLCTAHNGGINIFKTEEWMRIWGFVFVVTLIFN
FT                   TFWGWFMDRFGWVWPMRWFGCAVLAVGSVAFYYIPQWFGANALMMIVAAIIVGIGTCAF
FT                   SSLPTIMTLYAGEGKQGAALSAYNLAAGLTTFAGPGIATILLPTIGYGGVCWTYAALYV
FT                   LAFVLTLCIRPKQPGFDGHGHRIRHTASPRVLVEEIEKVAQAAA"
FT   gene            complement(522450..523586)
FT                   /locus_tag="BDP_0425"
FT   CDS_pept        complement(522450..523586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0425"
FT                   /product="Transcriptional regulator, ROK family"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09101"
FT                   /db_xref="GOA:D2Q8G5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G5"
FT                   /protein_id="ADB09101.1"
FT                   /translation="MKTTPPASVKELNKRAITAYLYSKGPATKQMLERELNLSLPTITQ
FT                   NLRTLEVEGLIRKGEQLESTGGRKAQTFAFVCRAKIAIGVTMRANGLTLCAVDLGGNVI
FT                   SRKFKLLPYHNTDIYYQQMGVIINAFAAGVERNDDNVLGVAFSIQGIVSADGQTITFGN
FT                   IMGNTGLRLDVIAQNVKFPCIMIHDSDAAAMAELWFDHSLTDAVCVYLEMRPGGAVIVD
FT                   GQLYQGPNLCNGTIEHMTLVPDGGECYCGQRGCMDVYCSPEALTEDGESLSGFFSVLEQ
FT                   GEQEHRQRFNGWLGNVAQAIRNIRSMLAGDIIIGGEAAHYLDDDDVTTLKRLVEERSAF
FT                   HTDHFTLRKSLCLDNQNEIGAALRFVQIFIDEICGHAA"
FT   gene            complement(523859..523993)
FT                   /locus_tag="BDP_0427"
FT   CDS_pept        complement(523859..523993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0427"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09102"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G6"
FT                   /protein_id="ADB09102.1"
FT                   /translation="MKSSSILGFAKRYSFIPHPSVSDGYITGHRCDLSHNLPKLSALV"
FT   gene            523994..526726
FT                   /gene="adh2"
FT                   /locus_tag="BDP_0426"
FT   CDS_pept        523994..526726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh2"
FT                   /locus_tag="BDP_0426"
FT                   /product="adh2 Aldehyde-alcohol dehydrogenase 2"
FT                   /EC_number="1.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09103"
FT                   /db_xref="GOA:D2Q8G7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G7"
FT                   /protein_id="ADB09103.1"
FT                   /translation="MADAKKKEEPTKPTPEEKLAAAQAEVDELVNKGLKALDEFEKLDQ
FT                   KQVDRIVAKASVAALNKHLVLAKMAVEETGRGLVEDKATKNIFACEHVTNYLAGQRTVG
FT                   IIREDDVMGIDEIAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQNCS
FT                   VAAAKIVRDAAIEAGAPENCIQWIEHPSIEATGALMKHDGIATILATGGPGMVKAAYSS
FT                   GKPALGVGAGNAPAYIDRNVDVVRAANDLILSKHFDYGMICATEQAIIADKEIYAPLIK
FT                   EMKRRKAYFVNDEEKAKLEQYMFGCTSYSGQTPKLNSVVPGKSPQYIAKAAGFDIPEDV
FT                   TILAAECKEVGENEPLTMEKLAPVQAVLKSENKEQGFEMCEAMLKHGAGHTAAIHTNDQ
FT                   ALVREYGQRMHACRIIWNSPSSLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLL
FT                   NIKRIARRNNNMQWFKIPAKTYFEPNAIKYLRDMYGIEKAVIVCDKVMEQLGVVDKIID
FT                   QLRARSNRVTFRIIDYVEPEPSVETVERGAAMMREEFEPDTIIAVGGGSPMDASKIMWL
FT                   LYEHPEISFSDVREKFFDIRKRAFKIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKT
FT                   GYKYPITDYALTPSVAIVDPVLARTQPRKLASDAGFDALTHSFEAFVSVYANDFTDGMA
FT                   LHAAKLIWDNLAESVNGEPGEDKIKAQEKMHNAATMAGMAFGSAFLGMCHGMAHTIGAL
FT                   CHVAHGRTNSILLPYVIRYNGSIPEEPTSWPKYNKYIAPERYQEIAKNLGINPGKTPAE
FT                   GVENLAKAVEDYRDNKLGMNKSFQECGVDEDYFWSVLDQIGMRAYEDQCAPANPRIPQI
FT                   EDMKDIAIAAYYGVSQEEGHKLRVQRQGEAATEEASERV"
FT   gene            526959..527765
FT                   /locus_tag="BDP_0428"
FT   CDS_pept        526959..527765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0428"
FT                   /product="Narrowly conserved hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09104"
FT                   /db_xref="GOA:D2Q8G8"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G8"
FT                   /protein_id="ADB09104.1"
FT                   /translation="MTDISNRRPAQSRRRGGLRLWLPGQPGALMMVLSPAVAGIVAAWA
FT                   YRGFAWTPWWLLICWLLCYCVQFSAARWFKSHGAHRWMLQPLVYCIVLCAVGLPFVVLH
FT                   PGILAWAPPFAVLAAISFRASWVRKERSLWSNAAAVSASCLMPMLTFCYGVDTPDIPYL
FT                   SIPGISLFLTFFMVQFGSVLFVKTMIRERGRRSYIVASWIWHAVMLAWWTFVGNGYLIA
FT                   LAAMLLIRAVALPMIARRRTVRPLAVGITEFVTSTASLILNICALL"
FT   gene            528027..528335
FT                   /gene="rpsJ"
FT                   /locus_tag="BDP_0429"
FT   CDS_pept        528027..528335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BDP_0429"
FT                   /product="rpsJ 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09105"
FT                   /db_xref="GOA:D2Q8G9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8G9"
FT                   /protein_id="ADB09105.1"
FT                   /translation="MAGQKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTE
FT                   KNVFVVIRSPHKYKDSREHFEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL"
FT   gene            528353..528994
FT                   /gene="rplC"
FT                   /locus_tag="BDP_0430"
FT   CDS_pept        528353..528994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BDP_0430"
FT                   /product="rplC 50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09106"
FT                   /db_xref="GOA:D2Q8H0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H0"
FT                   /protein_id="ADB09106.1"
FT                   /translation="MSNRTALLGKKLGMSQVWDENGFFVPVTLVDVSTNVVTAVKSEES
FT                   DGYKAVQLGYGQVDPTKVTKPLAGHFAKAGVTPRRHLAEVRTDNAEEFEPGQELTAELF
FT                   PEGTLVDVTGTTKGKGFAGTIKRWGFKSYRRTHGSHKNERRPGSVGACATPSRILKGKR
FT                   MAGRMGHVTNTAQNLTIVSSDVENGVLAIKGAIPGPKGGIVLVRSAVKGA"
FT   gene            529001..529666
FT                   /gene="rplD"
FT                   /locus_tag="BDP_0431"
FT   CDS_pept        529001..529666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BDP_0431"
FT                   /product="rplD 50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09107"
FT                   /db_xref="GOA:D2Q8H1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H1"
FT                   /protein_id="ADB09107.1"
FT                   /translation="MANVTLNVTDKQGKAAGTVEAPAEIFGFSAEEVQSRIPLIHQVVV
FT                   AQLAAARQGTHATKTRGMVSGGGRKPWKQKGTGRARQGSIRAPQWYHGGTVFGPQPRDY
FT                   SQRTPKKMKAAALKYVLSDRANAGHVAVVDFGVAEAPSTKAAIAALTPVTENKFTTVVL
FT                   SRENVNEWLSVRNIPTVHPIFADQLNTYDVVTAQYVVFSKEGFDAFIAAKTEPAAKEA"
FT   gene            529672..529968
FT                   /gene="rlpW"
FT                   /locus_tag="BDP_0432"
FT   CDS_pept        529672..529968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpW"
FT                   /locus_tag="BDP_0432"
FT                   /product="rplW 50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09108"
FT                   /db_xref="GOA:D2Q8H2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H2"
FT                   /protein_id="ADB09108.1"
FT                   /translation="MVAIHKPAHDIILKPVVSEKSYALSDRGQYTFVVAPNANKVQIKQ
FT                   AIEEIFNVKVTNVNTLNRAGKRQRTRNGFGQRVNQKRAIVTVAEGQTIDIFGN"
FT   gene            530005..530835
FT                   /gene="rplB"
FT                   /locus_tag="BDP_0433"
FT   CDS_pept        530005..530835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BDP_0433"
FT                   /product="rplB 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09109"
FT                   /db_xref="GOA:D2Q8H3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H3"
FT                   /protein_id="ADB09109.1"
FT                   /translation="MAIRVYKPTSAGRRNASVSDFSELTRSTPEKSLVRKLSKTGGRNS
FT                   YGRMTSRHRGGGHKRQYRLIDFKRWDKDGVPAKVAHIEYDPNRSARIALLHYADGEKRY
FT                   IIAPEGIKQGDVIETGAQADIKPGNNLPLRNIPTGTVVHAIELRPLGGAKIARSAGAAV
FT                   QLVAKDGAYAQLRMPSGEIRNVDARCRATVGEVGNSDHANIQLGKAGRARWMGKRPITR
FT                   GESMNPVDHPHGGRTRGGKPPVSPWGKGEVRTRRPKKASNKMIVRRRPNGKNRK"
FT   gene            530851..531129
FT                   /gene="rpsS"
FT                   /locus_tag="BDP_0434"
FT   CDS_pept        530851..531129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BDP_0434"
FT                   /product="rpsS 30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09110"
FT                   /db_xref="GOA:D2Q8H4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H4"
FT                   /protein_id="ADB09110.1"
FT                   /translation="MTRSIKKGPFVDAHLQKKVDEQNEKGTHNVIKTWSRRSMITPDFI
FT                   GHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTKTFKGHVKDDKKARR"
FT   gene            531146..531505
FT                   /gene="rplV"
FT                   /locus_tag="BDP_0436"
FT   CDS_pept        531146..531505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BDP_0436"
FT                   /product="rplV 50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09111"
FT                   /db_xref="GOA:D2Q8H5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H5"
FT                   /protein_id="ADB09111.1"
FT                   /translation="MEAKAIARHVRVTPRKARRMVDLIRGKKATEAITILKFAPQDASL
FT                   PVRKVLESAIANARVKADKAGEPFRENDLVVKETYVDEGVTLKRFRARAQGRAARINKR
FT                   TSHITVVVASKEGNR"
FT   gene            531508..532311
FT                   /gene="rpsC"
FT                   /locus_tag="BDP_0437"
FT   CDS_pept        531508..532311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BDP_0437"
FT                   /product="rpsC 30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09112"
FT                   /db_xref="GOA:D2Q8H6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H6"
FT                   /protein_id="ADB09112.1"
FT                   /translation="MGQKINPFGYRLGITENHRSKWFSDSNKAGERYRDFVLEDDAIRK
FT                   AMSKDLERAGVSRIVIERTRDRVRVDIHTARPGIVIGRRGAEAERVRAKLEKLTGKQVQ
FT                   LNIFEVKNAALDAQLVAQGIAEQLTNRVTFRRAMRKAQQDAMRAGAKGIRIKLSGRLGG
FT                   AEMSRSEFYREGRVPLQTLRALIDYGFFEAKTTYGRIGVKVWIYKGDMTEREFEEQQAQ
FT                   QGNNRPGRRGDRRPRRGQRNAAPQQNAAAEAPAAAEAPAATETKE"
FT   gene            532320..532739
FT                   /gene="rplP"
FT                   /locus_tag="BDP_0438"
FT   CDS_pept        532320..532739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BDP_0438"
FT                   /product="rplP 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09113"
FT                   /db_xref="GOA:D2Q8H7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H7"
FT                   /protein_id="ADB09113.1"
FT                   /translation="MLIPKRTKYRKQHRPVRRGMSKGGNEIAFGDFGIQALAPAYVTNR
FT                   QIEAARIAMTRYIKRGGRVWITIFPDRPLTKKPLGTRMGSGKGTPEFWIANVRPGRVMF
FT                   EIGGVSEEVAREALRRAIDKLPMKCRVIAREGGDI"
FT   gene            532739..532996
FT                   /gene="rpmC"
FT                   /locus_tag="BDP_0439"
FT   CDS_pept        532739..532996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BDP_0439"
FT                   /product="rpmC 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09114"
FT                   /db_xref="GOA:D2Q8H8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H8"
FT                   /protein_id="ADB09114.1"
FT                   /translation="MAVGTADYTMKNLNEKTNEEIEGFLKKSKEELFNLRFQSATGQLE
FT                   NTARLKAVKHDIARMYTILRERELGISQAPEATETKAEEK"
FT   gene            532996..533256
FT                   /gene="rpsQ"
FT                   /locus_tag="BDP_0440"
FT   CDS_pept        532996..533256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BDP_0440"
FT                   /product="rpsQ 30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09115"
FT                   /db_xref="GOA:D2Q8H9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8H9"
FT                   /protein_id="ADB09115.1"
FT                   /translation="MAEERNFRKVRRGYVVSDKMDKTISVELEQRSTHPLYGKVVRSTR
FT                   TVKVHDEHNDAHIGDLVSIMETRPLSKTKRWRLESIIERAK"
FT   gene            533344..533712
FT                   /gene="rplN"
FT                   /locus_tag="BDP_0441"
FT   CDS_pept        533344..533712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BDP_0441"
FT                   /product="rplN 50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09116"
FT                   /db_xref="GOA:D2Q8I0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I0"
FT                   /protein_id="ADB09116.1"
FT                   /translation="MIQQETRLHVADNTGAKEILAIRVLGGSKRRYAGIGDVIVASVKD
FT                   AIPGGSVKKGDVVKAVVVRTVKEHRRVDGSYIKFDENAAVILGSGREPKGTRIFGPVGR
FT                   ELRDKRFMKIVSLAPEVI"
FT   gene            533714..534049
FT                   /gene="rplX"
FT                   /locus_tag="BDP_0442"
FT   CDS_pept        533714..534049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BDP_0442"
FT                   /product="rplX 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09117"
FT                   /db_xref="GOA:D2Q8I1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I1"
FT                   /protein_id="ADB09117.1"
FT                   /translation="MVAKIKSGDLVKVIRGKDRGKEGTVKQVLKDDRLIVEGVQIVKKH
FT                   VRATQQGQQAGIVAVEAPIHRSNVMVIDPETKQPTRVGVIVKEEARDGKVKTVRVRVAK
FT                   KSGKELA"
FT   gene            534046..534618
FT                   /gene="rplE"
FT                   /locus_tag="BDP_0443"
FT   CDS_pept        534046..534618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BDP_0443"
FT                   /product="rplE 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09118"
FT                   /db_xref="GOA:D2Q8I2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I2"
FT                   /protein_id="ADB09118.1"
FT                   /translation="MTDTTVEAPATPRLKQKYIEQIVPELEKEFNYSNPMQVARVQKVV
FT                   VSMGVGAAARDSKLIEGAVKDLTLITGQKPKITKAKKSVAQFHLREGQAIGAYVTLRGE
FT                   RMWEFLDRLLTLALPRIRDFRGINGNQFDGQGNYNFGLTEQSMFHEIDPDSIDHQRGMD
FT                   ITVVTSTKDDKEASALLKHLGFPFKEN"
FT   gene            534620..534805
FT                   /gene="rpsN"
FT                   /locus_tag="BDP_0444"
FT   CDS_pept        534620..534805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BDP_0444"
FT                   /product="rpsN 30S ribosomal protein S14-1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09119"
FT                   /db_xref="GOA:D2Q8I3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I3"
FT                   /protein_id="ADB09119.1"
FT                   /translation="MAKTALKNKAAAKPKFKVRAYTRCQVCGRPHSVYRKFGLCRICLR
FT                   EKAHRGELPGVTKSSW"
FT   gene            534890..535288
FT                   /gene="rpsH"
FT                   /locus_tag="BDP_0445"
FT   CDS_pept        534890..535288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BDP_0445"
FT                   /product="rpsH 30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09120"
FT                   /db_xref="GOA:D2Q8I4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I4"
FT                   /protein_id="ADB09120.1"
FT                   /translation="MTMTDPIADMLTRLRNASAAKHETVDMPYSKFKANIAEILKREGY
FT                   IKDFTAKEAKVGQTLEVTLKYGPNGERSIQGIKRISKPGLRRYAKSDALPMPLGGLGIA
FT                   IISTSSGLLTQKECLDRGIGGEIVAFVW"
FT   gene            535306..535845
FT                   /gene="rplF"
FT                   /locus_tag="BDP_0446"
FT   CDS_pept        535306..535845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BDP_0446"
FT                   /product="rplF 50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09121"
FT                   /db_xref="GOA:D2Q8I5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I5"
FT                   /protein_id="ADB09121.1"
FT                   /translation="MASHIGKLPVAIPAGVEVKIDGQSFSAKGAKGSDSYEIPEGITAN
FT                   VEGNEIVLVPVDDLRPTRAKHGLARSIIASMVKGVHEGYAKTLEIVGTGYRAQMKGKGI
FT                   EFSLGYSHTITVEPPAGIEFELPNPNQVIVKGIDKQAVGQCAANIRKLRAPEPYKGKGI
FT                   KYSDEHILRKAGKAGK"
FT   gene            535847..536218
FT                   /gene="rplR"
FT                   /locus_tag="BDP_0447"
FT   CDS_pept        535847..536218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BDP_0447"
FT                   /product="rplR 50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09122"
FT                   /db_xref="GOA:D2Q8I6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I6"
FT                   /protein_id="ADB09122.1"
FT                   /translation="MSVQIFGKGKKVALQRRHARLRKRISGTPERPRLVVSRSNRHMVA
FT                   QIIDDTKGVTLVSESTLMSDFAGFQGTKTEAAKKVGELIAKKAQDAGITAVVFDRGGNK
FT                   YHGRVAAVAEGAREGGLAL"
FT   gene            536215..536946
FT                   /gene="rpsE"
FT                   /locus_tag="BDP_0448"
FT   CDS_pept        536215..536946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BDP_0448"
FT                   /product="rpsE 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09123"
FT                   /db_xref="GOA:D2Q8I7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I7"
FT                   /protein_id="ADB09123.1"
FT                   /translation="MSDNEKETQVAEETQNTQATAETNNEDRKSRRGQRGEGRRGERRN
FT                   RREESHENEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAI
FT                   AKGQLDAKKHMFTVPRVKGTVTHPVIGHDAAGTVLLRPAAPGTGVIAGGAVRAVMECAG
FT                   ITDVLTKSMGSATAVNVVRATVDALKKLEEPEEIAARRGMSLEEVAPDALLRARAEGIA
FT                   EARKAREEAQAKAAAAQKDGE"
FT   gene            536943..537128
FT                   /gene="rpmD"
FT                   /locus_tag="BDP_0449"
FT   CDS_pept        536943..537128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BDP_0449"
FT                   /product="rpmD 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09124"
FT                   /db_xref="GOA:D2Q8I8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I8"
FT                   /protein_id="ADB09124.1"
FT                   /translation="MMTNLNIKLHHGLVNSTPKQRAAAQTLGLNKIGKTVTREDTPALR
FT                   GQLLVLRHLITVEEAD"
FT   gene            537131..537577
FT                   /gene="rplO"
FT                   /locus_tag="BDP_0450"
FT   CDS_pept        537131..537577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BDP_0450"
FT                   /product="rplO 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09125"
FT                   /db_xref="GOA:D2Q8I9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8I9"
FT                   /protein_id="ADB09125.1"
FT                   /translation="MADILQMHDLKPAPGAKRDRIRVGRGEGSKGKTSGRGDKGTKKRY
FT                   QVRPGFEGGQLPLYMRLPKLRGFKSPFKKEYQVVNVAALAELFPQGGEITVADLVAKGA
FT                   VRKGQPVKVLGDGEISVAFTIKGVKASASAKAKIEAAGGSISED"
FT   gene            537769..539142
FT                   /gene="secY"
FT                   /locus_tag="BDP_0451"
FT   CDS_pept        537769..539142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BDP_0451"
FT                   /product="secY Protein translocase subunit secY"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09126"
FT                   /db_xref="GOA:D2Q8J0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J0"
FT                   /protein_id="ADB09126.1"
FT                   /translation="MRGRARRWKESQLRTLIQAFKTKELRNKILFTLGIIIIYRVGSFV
FT                   PTPGVDYTVVQQCVGKMSSTSENFIGLVNLFSGGAMLQLSIFALGVMPYITASIVIQLL
FT                   RVVIPRFEALHKEGQSGEAKLTQYTRYLTIGLAVLQSTTILVTARSGALFNYQCSQVVP
FT                   DGSVWNLLVMVLIMTGGTGLIMWMAELITDKGLGQGMSILIFMSICSGFLPQLWEIGWG
FT                   TKGTDGNWGKFATVVGVLLVIMILVVYVELSQRRIPVQYTRRMIGRKMYGGSSTYLPLK
FT                   INMSGVIPPIFASSILAIPTLIAQFGNSDQSWVKWINSNLANTTSVWYIALYALMIVFF
FT                   CFFYTEITFNPDETADNMKQYGGFIPGIRAGSATSRYLNYVMNRLNTVGAVYLLFVALI
FT                   PTVLIMALNLNTKLPFGGTTILIIAGVGLDTLRQAKAQTEQFQYAGFLFEGTDHQEGK"
FT   gene            539164..539724
FT                   /gene="adk"
FT                   /locus_tag="BDP_0452"
FT   CDS_pept        539164..539724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BDP_0452"
FT                   /product="adk Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09127"
FT                   /db_xref="GOA:D2Q8J1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J1"
FT                   /protein_id="ADB09127.1"
FT                   /translation="MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNIKNKTEL
FT                   GVEALTYINKGELVPDELTNKIVKDRLAMDDAKNGWILDGYPRNASQVEALDAILADLG
FT                   TPLDAVVALDADHDVLMERMKKRAEIEGRSDDTPEAIAKRLDVYAKETAPLLSTYGERG
FT                   LLKTFNGVGSVEDIQATIVAELG"
FT   gene            539870..540088
FT                   /gene="infA"
FT                   /locus_tag="BDP_0453"
FT   CDS_pept        539870..540088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BDP_0453"
FT                   /product="infA Bacterial Protein Translation Initiation
FT                   Factor"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09128"
FT                   /db_xref="GOA:D2Q8J2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J2"
FT                   /protein_id="ADB09128.1"
FT                   /translation="MAKDGVIEVEGQVVEALPNAMFRVELENKHIVLATISGKMRKNYI
FT                   RILPQDRVVLEMSPYDLNRGRITYRYK"
FT   gene            540111..540224
FT                   /gene="rpmJ"
FT                   /locus_tag="BDP_0454"
FT   CDS_pept        540111..540224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BDP_0454"
FT                   /product="rpmJ LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09129"
FT                   /db_xref="GOA:D2Q8J3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J3"
FT                   /protein_id="ADB09129.1"
FT                   /translation="MKVSPSVKRICENCRVIRRHGRVMVICINPRHKQRQG"
FT   gene            540361..540738
FT                   /gene="rpsM"
FT                   /locus_tag="BDP_0455"
FT   CDS_pept        540361..540738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BDP_0455"
FT                   /product="rpsM SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09130"
FT                   /db_xref="GOA:D2Q8J4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J4"
FT                   /protein_id="ADB09130.1"
FT                   /translation="MARLAGVDIPNEKRIEIALTYIFGVGRTRAKETLAATGINPDIRV
FT                   KDLTDEQLITLRDYLEGNYKIEGDLRREIDADIRRKIQINCYQGQRHRKGLPVRGQRTK
FT                   TNARTRKGPKRTVAGKKKATK"
FT   gene            540825..541223
FT                   /gene="rpsK"
FT                   /locus_tag="BDP_0456"
FT   CDS_pept        540825..541223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BDP_0456"
FT                   /product="rpsK SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09131"
FT                   /db_xref="GOA:D2Q8J5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J5"
FT                   /protein_id="ADB09131.1"
FT                   /translation="MAAQKQAARKPRRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVV
FT                   SWASGGDVGFKGSRKSTPYAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQ
FT                   SAGLEVGSITDVTPQAHNGVRPPKRRRV"
FT   gene            541304..542299
FT                   /gene="polA"
FT                   /locus_tag="BDP_0457"
FT   CDS_pept        541304..542299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BDP_0457"
FT                   /product="polA DNA-directed RNA polymerase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09132"
FT                   /db_xref="GOA:D2Q8J6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J6"
FT                   /protein_id="ADB09132.1"
FT                   /translation="MLIAQRPTLTEESLNPQRSRFTIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVRISGVPHEFTTLPGVEEDVTEILLNIKGIVLTSEYDEPVVMYLRKSGKGE
FT                   ATAGDITPPAGVTIANPDMHIASLADDGELEIEFTVERGRGYVPAQMNKQDNAEIGRIP
FT                   VDSIYSPVLKVSYRVEATRVEQRTDFDKLILDVETKPAISPRDAVASAGSTLVELFGLC
FT                   RELNTQAEGVEVGPAPVAEETNPEMAVPIEDLNLTQRSYNCLKREGIHTIGELVAHTEQ
FT                   DLLDIRNFGMKSIDEVKEKLQALGLALKASPLGFDANNLEGGTFFSPEDE"
FT   gene            542446..542886
FT                   /gene="rplQ"
FT                   /locus_tag="BDP_0458"
FT   CDS_pept        542446..542886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BDP_0458"
FT                   /product="rplQ 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09133"
FT                   /db_xref="GOA:D2Q8J7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J7"
FT                   /protein_id="ADB09133.1"
FT                   /translation="MLANMATSLFQHGRITTTLPKAKRLRPLAERLITLAKRGDLHNRR
FT                   RVMRVIRNKSVVHKLFTEIAEQMEQREGGYTRIVKIAPRRGDAAPAAIIELVTEPVSPK
FT                   QAVVKEAEAATKVAAEEAPVAEAPVVEAPEAAVEEAPAENAE"
FT   gene            542987..543877
FT                   /gene="rplQ"
FT                   /locus_tag="BDP_0459"
FT   CDS_pept        542987..543877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BDP_0459"
FT                   /product="rplQ 50S ribosomal protein L17"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09134"
FT                   /db_xref="GOA:D2Q8J8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J8"
FT                   /protein_id="ADB09134.1"
FT                   /translation="MAYDGGGFFGWAKQPDRRTVQGEIERILHTVLRVPVDDAGEPLRL
FT                   TVAGRTDTGVHASHQVCHLDISETILARCVGHMNVPPVVALTRRLQRMLPNDITIHGIN
FT                   EAPQGFDARFSALERTYVYRIADRSSEIDPRMRGFVLHVDDDLDLETMNQAAAMTIGLH
FT                   DFGSFATPNPGGTTIREVKTAYWRRIPQRPLVDGEMTMGERYRTPSMESGLACFTIVAD
FT                   AFARNMVRSLVNGCVQVGIGKRSLDWFADKMATPLREGSTGPIAPQGLTLEHIEYPDDD
FT                   QLAIRAETIRAKRTL"
FT   gene            544058..546256
FT                   /locus_tag="BDP_0460"
FT   CDS_pept        544058..546256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0460"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09135"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR007302"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8J9"
FT                   /protein_id="ADB09135.1"
FT                   /translation="MKERGKMIESAARKLATELVNRRESINRELSRNGVRFGIYKNGEY
FT                   HDRLFPYDPVPRIIESDEFDEMEAGLKQRVNALNAYLRDIYSDKHAIKDGVVPEEYVYT
FT                   SAGYFPQVNGVTPPGGVFAHIAGEDLVQGQDGKWWVLEDNLRIPSGASYPLFARDIERR
FT                   ITPRLFRDVHVRDNRDYPRLLRKSMDFVSTEGIAVVLTPGRYNSAFFEHAYLAEKTGAA
FT                   LAFPEDLEVVDNKLFFLDYSGKRHRVGVVYRRLSDEYLDPFAFNPDSVIGVPGILSAYR
FT                   AGNVAIVNAPGNGAADDKAIYYFVPAMIRYYLGEEPILQNAPTYMPMFEQDRKEVLDRL
FT                   GELVIKDVAEAGGYGVIFGSSLDKAQREEMADRIKAEPRRFIAQEVIQFKDIDVVDPET
FT                   GEMSPRKCDLRAFVVTGKNTHVWYSGLTRYSSVPGQMIVNSSQGGGFKDTWVLAKDTGV
FT                   EHDSAPGSESINLLAQSRKHSLALVTASKADNLYWLGRYTERVFTTLNQFFPFYDRVMD
FT                   TDVDAFRPFARALDLPEDFQDFDAFIHSFLYDEKNPDSVRSAIVYAFNNAVILRPELSS
FT                   RLLQYVELAMSSIVEAADRAAFDEDIYKHRDIADNMLAFWGGVENSPVDPTLKSFIFVG
FT                   KYLERVDLYTRFGYSMEELKAPLGKLASYIMPLNGLPVPQCFADGLRWLVGQLPSRGYA
FT                   DLADTLGTLLDDFDERICTNDLKDLGMLNAMNMDAKRV"
FT   gene            546356..547156
FT                   /locus_tag="BDP_0461"
FT   CDS_pept        546356..547156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0461"
FT                   /product="Conserved hypothetical protein in
FT                   transglutaminase family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09136"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K0"
FT                   /protein_id="ADB09136.1"
FT                   /translation="MKKLVFDYEMKLSFSSPVTDHRFQLRCIPTTGPRQQVVDVEVRIE
FT                   PEVELDTTVDSFDSVVMTGFIPEPHTMFNYSVTGIAFVDNEHIKPEIHKPLYRFNSALT
FT                   IPGPAVNALIDVCKARIAALPAGGSPIDQAREVMDEVFKSFVYTPASTTIRTTAEEALA
FT                   QHKGVCQDYAHVMLSVCRHVGLTARYIAGLLGGEGATHAWVEIYHGNRWIGFDPTHNRM
FT                   VDDNYITIAHGRDYRDCMLDIGIFSGCNVEQSQWVNASVHEQEL"
FT   gene            complement(547229..547317)
FT                   /locus_tag="BDP_tRNA17"
FT   tRNA            complement(547229..547317)
FT                   /locus_tag="BDP_tRNA17"
FT                   /product="tRNA-Ser"
FT   gene            complement(547422..548201)
FT                   /locus_tag="BDP_0462"
FT   CDS_pept        complement(547422..548201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0462"
FT                   /product="Narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09137"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K1"
FT                   /protein_id="ADB09137.1"
FT                   /translation="MGASACSTPRVAGRAESERRLSACESAYLSASSNSDRMNDTSTHI
FT                   VERYLSARQASYDWIETATQCSARFGEGTMRGAQARHIVRTLATRLGIAVDPVTPSRLD
FT                   DVSSLDLDDDSLSTMAEAEDAAGFATEILAARSDGNVSLDLSDRHKTTSQRLISLAGND
FT                   DDHRDKVYDAATLLANPDTMVDGATGLKAPTGAVIEMNCARSEISAVAASSNATGEGTS
FT                   SNASRKASLGTLAALIADRAELALYWGYPAFDEALFD"
FT   gene            548361..549401
FT                   /gene="nusA"
FT                   /locus_tag="BDP_0463"
FT   CDS_pept        548361..549401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BDP_0463"
FT                   /product="nusA N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09138"
FT                   /db_xref="GOA:D2Q8K2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K2"
FT                   /protein_id="ADB09138.1"
FT                   /translation="MELDLAGMHQLAAGQGIDPETLDAALSEALRLAYLKTPHAAKHAR
FT                   IELDPRAGSFTVWAQDEIPGEPTEEDPHPAPTLGEEYDDTPHDFGRLAAATARQVISQL
FT                   FRKAEDDKVFGAFSGQKGKLITGIVQQDAKDTANVHVAVGDVEALLPRREQVPGERYRH
FT                   GERIRVYVVNVARGLKGPEIVVSRSHPELVRRLFEREVPELVSGAVSIMAIAREAGART
FT                   KIAVRANTEGVNPKGALIGPGGARVRAVMENLGPEKIDIVDWSADPAKFVAAALSPAVA
FT                   TGVQVISEKNNTAIAFIHDDQLSLAIGKEGQNARLAAKLTGWKIGIESAEAHAKKMQES
FT                   AGESAE"
FT   gene            549612..552431
FT                   /gene="if2"
FT                   /locus_tag="BDP_0465"
FT   CDS_pept        549612..552431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="if2"
FT                   /locus_tag="BDP_0465"
FT                   /product="translation initiation factor IF-2"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09139"
FT                   /db_xref="GOA:D2Q8K3"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K3"
FT                   /protein_id="ADB09139.1"
FT                   /translation="MPKARVYELAKEFGVDSKTVLSKLEAMGEFVKSASSTVEPPVARK
FT                   LRSAFSNNASGNASESKKPAAPVKKPASPTHTAPSEVRPAAPKPVPAARQTPRAEAPKP
FT                   GSPSAPKPGQRSAHAGRPGDQRQHGNRQQGGNAPRPQSSAGMRGGKSAPVPGPHAPRSN
FT                   NQQQGGGNNAKPHTPGPRPGNNPFSRKQGMHTPTPGDIPRPHPMARPNANGNEGRRGGR
FT                   PGQGGGQRGGFRGRPGQGTGAKPGQWGQHRPGQGGGQRPAGGGNRFGGSGNTGGYQGNS
FT                   APSSSPARGGGRGRGGAAGAFGRQGGKSSKARKNRLAKRQEFQEMKAPVIGGVRIPTGN
FT                   GQTVRLRQGSSLADLAEKINVNPAALVTVLFHLGEMATATQSLDESTFQILGEEIGWDI
FT                   KIVSAEEEDKELLQQFDIDLDEEELQEDEDLRPRPPVVTVMGHVDHGKTRLLDTIRSTN
FT                   VIAREAGGITQRIGAYQVTVDLEGEPRKITFLDTPGHEAFTAMRARGAELTDVAILVVA
FT                   ADDGVMPQTVEAINHAQAAHVPIVVAVNKIDKQGANPDKVRGQLTEYGLVPEEYGGNTM
FT                   FVDISAKQGTNVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVATVLVQ
FT                   SGTLHIGDAIVAGTSYGRVRAMLDENGTAMKEATPSTPVQVLGLTSVPTAGDLFLVASD
FT                   DRTARQIAEKRQATERAAQLAKRRKVVSLESLKEQFAKSEVDMLNIVIKGDSSGSVEAL
FT                   EDSLMKIEVSDEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFNVRPNRQVADLAEREG
FT                   VEIKYYSIIYKAIEDIEASLKGMLKPEFEEVVTSHSEIREIFRSSKFGNIAGVMVQDGE
FT                   VKRGTKCRILRNGIATVNDLEISSLRRFKDDVTSVKEGYEAGINLGSFNDIEIGDIIET
FT                   FEMQEVERK"
FT   gene            552536..553045
FT                   /gene="rbfA"
FT                   /locus_tag="BDP_0466"
FT   CDS_pept        552536..553045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BDP_0466"
FT                   /product="rbfA Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09140"
FT                   /db_xref="GOA:D2Q8K4"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K4"
FT                   /protein_id="ADB09140.1"
FT                   /translation="MAGTNPRAARIAALIQRVIASSMEAQLHDKRLSNVTITEVRVTND
FT                   LQIAKIYWTQLGHEGREQGERRRAQQALNQAKGRLRSLVGSKAGLRLTPQLEFIFDEVP
FT                   GEAHEIEDILAIARKRDEELAKARETAQYAGDADPYKHDEPNDDDDFDEDDDIEVEDWD
FT                   DDDEEA"
FT   gene            553026..554114
FT                   /gene="truB"
FT                   /locus_tag="BDP_0467"
FT   CDS_pept        553026..554114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="BDP_0467"
FT                   /product="truB tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09141"
FT                   /db_xref="GOA:D2Q8K5"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K5"
FT                   /protein_id="ADB09141.1"
FT                   /translation="MTTKKPEISGLLVVDKPQGVTSHDVVAAIRGALHMKRVGHAGTLD
FT                   PMATGVLVIGFGNATRLLNYIVDHSKTYLATIRLGQRTATDDADGELLEPSAPIAEAFP
FT                   SRETVERVIAERFTGRIEQVPNSYSAIKINGQRAYDLAREGKQVELKARPVTVEEFRVD
FT                   AVRYGYASTRFADAPLTDAQDIGAGERWHPVSAAPDVRPVMELDVAVSCSAGTYIRALG
FT                   RDLGEALGLGGYLTMLRRIRIGDFTETMPNIVTAHTESKTFTNREGAEVTRNRAVIDDA
FT                   EHLTDRALGMVDSAKASMPMLRISDQEATDLRFGRRIAHDIRETTAAYVPETGDLVAII
FT                   ERAKRGEAKPVAVFVQQQEGQR"
FT   gene            554111..555328
FT                   /gene="ribF"
FT                   /locus_tag="BDP_0468"
FT   CDS_pept        554111..555328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="BDP_0468"
FT                   /product="ribF Riboflavin kinase/FMN adenylyltransferase"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09142"
FT                   /db_xref="GOA:D2Q8K6"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K6"
FT                   /protein_id="ADB09142.1"
FT                   /translation="MKIITLTPDESGMVDWPTLSNDKKSVLTIGSFDGMHQGHQAVIRR
FT                   VVELARKERSFSVVVLFEPRPAMVHGYAAKHDGQEPPVGMLDTQALTSVDERLRSINAL
FT                   GVDYTIIVHYTLEFAAKSYRFFLGQMVGKLGMRALVLGADAALGANRAGDVKAIENLAL
FT                   ATGVFQLDVVDDHGPGETRVPANAKPVMPADHGEPADPLEGATKAERRAWSKKHQAKAV
FT                   RVWSSTNVRYLLGQGRIKDADAILGHMHAVEGTVVHGEERGRTIGFPTANLSQDVFGYL
FT                   PVDGVYAGWLVDLGKAGDEAGKPADGIATAYDSSSMDARLAPHSPYRWPAAISIGTKPT
FT                   FNEATGMHERVVEAYAITDDWLDLYGHQVRVEFAGFLRPQIRFASADDLAAELRRNVEE
FT                   TKRLTA"
FT   gene            complement(555420..556166)
FT                   /locus_tag="BDP_0469"
FT   CDS_pept        complement(555420..556166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0469"
FT                   /product="Amino acid transport ATP-binding protein"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09143"
FT                   /db_xref="GOA:D2Q8K7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K7"
FT                   /protein_id="ADB09143.1"
FT                   /translation="MSNANTPVLRLDGIRKSFNGNEVLRGISFDVNQHEVVAVLGPSGS
FT                   GKSTLMKCVNLLERVDDGQIWLADTDITDPRVRQDEIRSRIGVVFQQFNLFPHMSVMNN
FT                   VTLAATKVHHWSKAKAEARALELLDRIGMRAKAGAYPDQLSGGQQQRVAIARALMTNPE
FT                   LLLLDEITSALDPMLVGEVLDMVAELKEQGTTILMATHEMSFAHDAADRIVLLRHGVIA
FT                   ENGTPQQVMDESQDPETREFFSHFRS"
FT   gene            complement(556163..557041)
FT                   /gene="gluA"
FT                   /locus_tag="BDP_0470"
FT   CDS_pept        complement(556163..557041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluA"
FT                   /locus_tag="BDP_0470"
FT                   /product="Putative Glutamate transport ATP-binding protein
FT                   gluA"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09144"
FT                   /db_xref="GOA:D2Q8K8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K8"
FT                   /protein_id="ADB09144.1"
FT                   /translation="MSISDNRPDDLAGHQTSEVELSRRAYRKRQQLKSVITSLISTIVL
FT                   AAIIVVGLEMSPGWPRVKETFFSPEYFAASLPEVLAGLWLNVKVLVVALIGVAIFATLI
FT                   ALVRTSNNPVLFPLRVLAALYTTIMRGVPMIVVLYLIGFGIPGLGIFGRIDPSLLGTIA
FT                   VVMGYSAYVAEVLRAGFNDVHPSQRASARSLGLTAGQTTRMIVIPQALRKVAPALMNDF
FT                   ISMQKDVGLISVLGAVDAVRAAQIEVASTYNFTPYVVASLLFILMSVPFILLNDWYTAR
FT                   LRKRELSGGTV"
FT   gene            complement(557066..557932)
FT                   /locus_tag="BDP_0471"
FT   CDS_pept        complement(557066..557932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0471"
FT                   /product="Solute-binding protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09145"
FT                   /db_xref="GOA:D2Q8K9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8K9"
FT                   /protein_id="ADB09145.1"
FT                   /translation="MAFSGKHLMRAAAAIVSVAAVALSAACGSGNGSGSASASSDSSDI
FT                   TQQTVNPGKLTIATGDPAYEPWVMNDKPESGEGYEAAVAYAVAEKMGFKKSDVVWTRTT
FT                   FDTAIAPGAKDWDMNIQQFGVTDERKKAVDFTSSYYNDSQAIIVKKNGKYANAKSLDDL
FT                   KDATIGAMVGTEGYKYAKKIKSDVQTFNDDAAVAQALDANQIDALVTSTVECVYMVQSE
FT                   QVKDAKVVGRIAGSTDPNGMGIVLPKDSKLTSAASKAVDELQSDGTLQKLQDEWLAEYT
FT                   TDLTELK"
FT   gene            complement(558083..558547)
FT                   /locus_tag="BDP_0472"
FT   CDS_pept        complement(558083..558547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09146"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L0"
FT                   /protein_id="ADB09146.1"
FT                   /translation="MSVALEDMSEYARSVVSRLGLEAHPEGGWYIRDWQSPHIDGGSAR
FT                   PLASLIYFLLPQGDASAWHKVDADEIWLWHGPAPVTLQLGGDGDGPAADDRLETIVLGS
FT                   DLASDRHDAAVCGHAVVPAGVWQRTVPGSGDALVSCVVSPGFVFEGFTLE"
FT   gene            complement(558616..560016)
FT                   /locus_tag="BDP_0473"
FT   CDS_pept        complement(558616..560016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0473"
FT                   /product="Putative hydrolase"
FT                   /EC_number="3.5.4.28"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09147"
FT                   /db_xref="GOA:D2Q8L1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L1"
FT                   /protein_id="ADB09147.1"
FT                   /translation="MSLDSPLHLAAHPQPLDSVTVYSSPMVIPVTGPVVLDGAVAVAGS
FT                   RVVHVGTRRWVFNELKHDMATNGRVVEHHWNGIITPGLINAHTHLQYTDMAEVGRGTYD
FT                   RFRAWEIGFNTVYAKLQETRPWKESAYRGARMMVQSGTTAAADIVTDPEAVGALASQGM
FT                   HGIAYWEVMGWHNGDWKSEGIPELIDNLGHMHQEGLPSIGISPHAPYTLESGPFVDLPD
FT                   IARQLDMRLHIHLAETPMEAGERDTTLTTYSAADWRDGQWASYKQLRAAGKGASAIQFV
FT                   DQLGSLGPDVHIAHGVWADAEDRRILRQRGVGVALCPRSNRITVTGRDAPIREYLEEGN
FT                   LLAVGTDSLSSSPSLDVLDDAAMIYDLAREQGYTRDDLTHRIIRMITIGGAEEMGMHVG
FT                   AGRIGQINAGATADLAFFDIPVGIDSPYAIERTLEDFVRHGAGTNRATIISGNVVHNDG
FT                   IFDIRQER"
FT   gene            complement(560021..561487)
FT                   /locus_tag="BDP_0474"
FT   CDS_pept        complement(560021..561487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0474"
FT                   /product="Putative S-adenosylhomocysteine hydrolase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09148"
FT                   /db_xref="GOA:D2Q8L2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L2"
FT                   /protein_id="ADB09148.1"
FT                   /translation="MEPFRFSAWAEAYSQKTNRSLAGTRLYIGHDGGASCGIDQADLAQ
FT                   AQDWGMVPSRDSAEMQTGHAIDATMPLGDVVDARELTGAEAMRFAQEHMLVLDALMRQM
FT                   RKDVDFTGIRIAVCLILEPKTAVLLRQLKAAGAIVGAYCGSEANDERVAAQLRTEGIPV
FT                   AYDPDWTPAQAHQGALDLLDEIQPNIIIDDGASFARLAAMERPELMGHIIGVAEETTSG
FT                   IRAFQAMQDAGALTFPVIAVNDSMLKTGFDNAHGTGETCITTLQRILGSDCFAGSNVSV
FT                   VGYGPVGRGFAHRVRALGANVTICDTDPVVALQAVFDGFRAYDIDQAIGESDIVVSATG
FT                   VRHTITLQHMRRMKPDAVLSVIGGIANEIALDQIDGFHAENKRELRDLAVPDGPVIRLI
FT                   SEGDGVNYTVGGGNPIEIMDLSFAVQASAVAHLLRHRGTLQPGLQRLGRDIDRHIADIA
FT                   LRTRGYRASHAVADNGYDWTLTRFAENEKE"
FT   gene            complement(561538..562947)
FT                   /gene="radA"
FT                   /locus_tag="BDP_0475"
FT   CDS_pept        complement(561538..562947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BDP_0475"
FT                   /product="radA DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09149"
FT                   /db_xref="GOA:D2Q8L3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L3"
FT                   /protein_id="ADB09149.1"
FT                   /translation="MAKTSVQFLCSECGWSGPKWYGRCPECGQWGTIEEFHEARPSAAS
FT                   RTAAPGRTSRTQSGAVPSSAARPITEIGTENMSRIPTGFSEFDRVLGSGIVPGSVTLIA
FT                   GEPGIGKSTLLLETAGNVAREVANHRDRNVVLYVSGEESQAQVRMRASRINAIEPNMLL
FT                   AATTDLATVLGLIEQVRPALAIVDSAQTIVSQDVDGISGGSTQVREVASALIDTAKTLD
FT                   VPVLLVGHVTKDGSIAGPRTLEHLVDVVCQFEGDAQTALRMLRAVKNRFGPTDEVGCFD
FT                   MSGEGIEEVSDPSGLFLSSNGSVPVEGTCVTFTLDGHRSLPIEVQSLVTKSVLPTPRRA
FT                   ANGVDSNRIAMLVAVLYRHGGINLLANDLYISTIAGGLAKEPGCDLAIVAALASAAKSK
FT                   AIARTTCAIGEISLTGQVRPVPRLEYRLREAARLGFTTAVVPTLRKHVTVPGLTIVQAD
FT                   TLKDALGVLLK"
FT   gene            563011..563625
FT                   /locus_tag="BDP_0476"
FT   CDS_pept        563011..563625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0476"
FT                   /product="Narrowly conserved hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09150"
FT                   /db_xref="GOA:D2Q8L4"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L4"
FT                   /protein_id="ADB09150.1"
FT                   /translation="MSNTQTSSSHGKLIAAVVAAAVVVVLALVSAFVWPGWALNKNDAA
FT                   TSSQSSSQNAESNAKPTIDAVALPDGSSELLKAMPDTVLNFARTKADASNTWSGASPVE
FT                   EYTLTYSTGDASKDVTLVVAQWTQQDAAKTQYDALASAMTGKELGSGNVKVSGEQTGSY
FT                   SFKSDPDDENKAVALWQNDTVVFQATGSKESVQRFYQQFPL"
FT   gene            complement(563908..564606)
FT                   /gene="rpi"
FT                   /locus_tag="BDP_0477"
FT   CDS_pept        complement(563908..564606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpi"
FT                   /locus_tag="BDP_0477"
FT                   /product="rpi Ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09151"
FT                   /db_xref="GOA:D2Q8L5"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L5"
FT                   /protein_id="ADB09151.1"
FT                   /translation="MDKAQQDALKKAAGIEAAKLIQSGMIAGLGTGSTVRFLVDELGRR
FT                   VKEEGLEFTGVTTSRRTQEQAEGYGIKIVDIDDVDHIDVTIDGADEVDKDFNGIKGGGA
FT                   ALLWEKIVATNSNKIVWIVDESKVVDTIGKFPLPVEVIPFGAGQVIKKFESRGYKPVLR
FT                   LDAEGQPVRTDENNYVVDLHLERIDHPEDLAEDLITTVGVVEHGLFLHMVDQVIVGDPN
FT                   GPRVMTNSNK"
FT   gene            complement(564747..565949)
FT                   /gene="rnh"
FT                   /locus_tag="BDP_0478"
FT   CDS_pept        complement(564747..565949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnh"
FT                   /locus_tag="BDP_0478"
FT                   /product="rnh Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09152"
FT                   /db_xref="GOA:D2Q8L6"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L6"
FT                   /protein_id="ADB09152.1"
FT                   /translation="MTITVSTDGSALGNPNGPMGWGWADHDLNAGGTPGHDHAGDCDAG
FT                   GATNGTNQIGELCAVLEALRAHPGSEPLVIETDSQYAINCSTKWVHGWKKNGWKNSQKK
FT                   PVKNAALIKAIDAEISQRPGPVKFVWVKGHAGNAGNEKVDELARTYADDCRSKVRKGYL
FT                   PLEGWQSLLASEYSQGTDVPEDARMLLDGAIGTKEYHLGRGESGTTPLPRKSAKSIADM
FT                   LVEPEGYPAPEPVEEPTETLAIEEPTRPLETTEATDAPRKSLAELLVRPDCFPKDDDET
FT                   PAAKDDDIAATTVLQHTADGMTDGGTADDGTQTVSQSPKADDADTSSGPADRNLPKLPH
FT                   RPSPSGLAVSGTVRFTPPPESSPTFDGKPRLIRGYIAVEGYVMGDGTLVLDEAPFAVKH
FT                   A"
FT   gene            complement(565987..567354)
FT                   /locus_tag="BDP_0479"
FT   CDS_pept        complement(565987..567354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0479"
FT                   /product="Putative histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09153"
FT                   /db_xref="GOA:D2Q8L7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L7"
FT                   /protein_id="ADB09153.1"
FT                   /translation="MNLIELVAATAPSDMFFAIGEQINALMGLILCLMAMWNRMENPKL
FT                   TGGIILAAGTIWFILSGFICGMFRIPTLWTVFPTGIVAVLVFSKVTNLTVSKVMLLCST
FT                   AAYVVAIIYYLSLVMDVAVLGEQSVNLRVGWPGFINQLILDILAPLCLWHPLRDSIPST
FT                   LNSPAISPSFWQLIWLFPFISTAIVVWCLPADNDSVMKEHVRALAFTIAIAYSCFMALA
FT                   YLLIWYMIRQSERLLEATKREHYAAMQTLQLQHMNERIREARQIRHNTRHHIQTLQTLA
FT                   AANDVDGIRDYLEQMAKHRLLAPEHPMQYCEHASLNAVLVYYCDWARHKGADVDVKAAV
FT                   PSYISINNAELCSLVGNLLENAVEAIMIQSDGDKKLRVRIRYNDGPPASLFIVVDNSYD
FT                   SSVTQVDGDFASSKHGGNGLGTMTVRETAERYGGTVAFEYDGEMFKASVMLCLDKV"
FT   gene            complement(567354..568151)
FT                   /locus_tag="BDP_0480"
FT   CDS_pept        complement(567354..568151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0480"
FT                   /product="Putative response regulator of two-component
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09154"
FT                   /db_xref="GOA:D2Q8L8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L8"
FT                   /protein_id="ADB09154.1"
FT                   /translation="MMRVAIVEDHPAERQLVKTMCTAYFRDKHDLDIDCGTFTGTDDFI
FT                   ESWKSNRFDLVLLDCYLTDDETDATAPTGLDIARFLRRQRDDCPIVFITSSSDFAVLGY
FT                   EVQATGYILKPISRANFDATMDRAYETLSERPRVTHLSTDKPSHAADAAWQVAFGNPAI
FT                   NMDRRLIVYCLSNAHYVEFTFADGTCSKIRTNFSDVERRLTVFDNFYRTARGVLVNFDY
FT                   VTGISNAEFVMKGGKRIPITKTAVTTTCRKYAEYTFTRMRSEQ"
FT   gene            complement(568360..570036)
FT                   /gene="pgm"
FT                   /locus_tag="BDP_0481"
FT   CDS_pept        complement(568360..570036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="BDP_0481"
FT                   /product="pgm Phosphoglucomutase"
FT                   /EC_number="2.7.1.106"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09155"
FT                   /db_xref="GOA:D2Q8L9"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8L9"
FT                   /protein_id="ADB09155.1"
FT                   /translation="MVANNAGMPATPEDLINVDEVIGKYYDVVPDPSVPEQRVSFGTSG
FT                   HRGSSLKTSFNEAHIVAITQAIAEYRKKAGVTGPLYIGRDTHALSEPAWKTAIEVLVAN
FT                   GVTVRIDSRDDFTPTPVVSQAILTHNRAADGTQRFTGEGLADGIVVTPSHNPPTDGGFK
FT                   YDPVTGGPAPSDVTNAIADRANELLGDFRNVKRVPFDQAVKSDLVERFDYRDHYVSDLE
FT                   NVIDFDVIRSSGVRLGIDPLGGASVNYWPLMNEKFNLTIDVVRPQVDPTWSFMTIDHDG
FT                   KIRMDPSSPYAMKGLVDSLNNGAWDKYDLVGGTDPDADRHGIVCPNWGVMNPNHYIAVC
FT                   VEYLFGGNRPGWPEGAGIGKTLVSSSLIDRVAASINAKLVEVPVGFKWFVDPLFKGEVA
FT                   FGGEESSGMSFLRKDGRVWTTDKDGLIPDLLAAEITAKTGKNPAQLHQEQVERFGESWY
FT                   KRVDTPTTLEQKIKFGKLSGDDVEATQLAGEDITAKLTEAPGNHAKIGGLKVTTKNNWF
FT                   AARPSGTENIYKVYAESFESPEALDKVLAEATEVVDKALAD"
FT   gene            570329..572464
FT                   /gene="ptsG"
FT                   /locus_tag="BDP_0482"
FT   CDS_pept        570329..572464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG"
FT                   /locus_tag="BDP_0482"
FT                   /product="ptsG PTS system, glucose-specific IIABC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09156"
FT                   /db_xref="GOA:D2Q8M0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M0"
FT                   /protein_id="ADB09156.1"
FT                   /translation="MADSLASQIIAAIGGPENIRSLTHCATRLRFELVDAGKVDQNALE
FT                   HMKGVLGAVPQSGDRFQVVIGGAVATVYEDIMHLPEMANAGGAVASGNAAGDGGKPMSN
FT                   AEVKAAARSKARGKVAWLDSFFEYLSDSFRPILGVLLGASIIIALVNLLISLGVIPNDE
FT                   ASAGWVFVKAIWKGVFYFLPIMVAYNASKKLKVDPWLGGSIMAMLMTPQFISLMNTKTF
FT                   GSTVCVENSALGTTSCTANIFGLPMQLSDYSGNVFVPLLMAAVLALVYHGLKRIIPDSV
FT                   QLVFVPFFSMIIVGALTAFIIGPIGVWAGNALGIGLAWLNNYALFVFAVLIPLLYPFLV
FT                   PLGLHWPLNALMLMNIQTLRYDFIQGPMGVWNFACFGATAGVLFLSIRDKDKDMRATSL
FT                   GALAAGLLGGVSEPSLYGIHLRYKLVYKRMLIGCGLGGIVIAVLSWFFPSVTASGQVVH
FT                   GVTTTAFAFTSLLTIPVFNQMWVYAVSIAVAFLTSFILIITLNYRTPEQKAEVLARAAA
FT                   ESKVESAPAAAAPKGTPAAIKVAEATADAEAGSDEAAAAIAQASADTVNAPIAGHVITL
FT                   DDTGDPVFASRALGEGVGIEPTASTVVAPVSGVLQTVAETGHAFGIKTDDGIEVLVHVG
FT                   IDTVKMNGEGFAVAVKANQHVHAGDLLVTVDFDKVKEAGYSTTTLMTVLNTVAFASVTP
FT                   KTGIDVEAGDAVIDIQR"
FT   gene            complement(572473..573084)
FT                   /locus_tag="BDP_0483"
FT   CDS_pept        complement(572473..573084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09157"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M1"
FT                   /protein_id="ADB09157.1"
FT                   /translation="MLVERHVVGVFDDRQHLLNHAGHGVGVRQISGGEAGIDQMQGKRH
FT                   GLAFWQRPTQIIVHGVDQRLTFGVFARIQRTHFRLERVFDGLPFLRPLDRAADMVGQCH
FT                   DQCGLRLDLLGKPGTGHGIGNQSNDLRRDPGQQFGHMVGIPAVRRNESADDLRIVDMLA
FT                   RFGLEAYATTGENHLTVAILGQHDIVVEYTKNVHIDPFLQ"
FT   gene            complement(573297..574550)
FT                   /locus_tag="BDP_0484"
FT   CDS_pept        complement(573297..574550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0484"
FT                   /product="Conserved hypothetical secreted protein with
FT                   presumed diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09158"
FT                   /db_xref="GOA:D2Q8M2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M2"
FT                   /protein_id="ADB09158.1"
FT                   /translation="MPQADSEHVPSVFACNVQFSSILSRRIHIFDLFSVTMGDMPMPVI
FT                   ISLLIVIGVAAVCGAAFFGVRAYRHHKLARQLDQRSDDQVHYVFVINPSKPQADQRKRH
FT                   IREFCEAKGLTQVDFIDTQLDKDGRVCALEALNRGADVVVAVGGDGTVRTVASALSGTG
FT                   HALGIVPIGTGNLFARNMGIPVDDIDAALTVATSHGSRQVDVGRLTLLDDETTDHGHAF
FT                   LIIAGIGFDALMIDDTDPELKKNISWLAYFVSGVKNLFAPKYHGDVTITSEDGSTHTTR
FT                   GLSFRTFMAGNCGQIPMFSLMPDAVYDDGILDYEIIDTSGGILGWANLFGDVLHQTITG
FT                   KAQQSPLSTNSTVDQIQGVSAEITLEKPVLAQVDGDMLPETKHIRFSVERQALCVRVPE
FT                   VVSSDDDSLAASAVTREM"
FT   gene            574564..575850
FT                   /gene="serS"
FT                   /locus_tag="BDP_0485"
FT   CDS_pept        574564..575850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BDP_0485"
FT                   /product="serS Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09159"
FT                   /db_xref="GOA:D2Q8M3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M3"
FT                   /protein_id="ADB09159.1"
FT                   /translation="MLDIQFIREHADVVKESQRKRGESVELVDEVLRSDEVRRSSLKEF
FT                   EAARAQQKEIGKKVAAAPADEKAKLIAETKELSQKVSEYKAAADAAAEEYTTAMWKLSN
FT                   IVEPEAPEGGEDDYVVVKKVGQIRDFAAEGFEPKDHLTLGRGVAGIDMERGVKVGGSRF
FT                   YFLRGQVARMQIAMLTMAVDQAEEHGFTLAITPTLVRPEVMRGTGFLNSHADEIYRLRE
FT                   PDEQYLVGTSEVALAGMHENEILDLSDGPLRYCGWSSCYRREAGAAGKDTSGIIRVHQF
FT                   DKVEMFVYTKQEDSYKEHEHLLAMEQEMLGKVEVPYRIIDTAAGDLGSSAARKFDCEAW
FT                   VPTQGRYRELTSTSNCTEYQARRLNIRERMEDGNTRAVSTLNGTLATTRWLVAILENHQ
FT                   QKDGSIVIPQAMRAYMGGKEVIEPTKWEA"
FT   gene            576086..576173
FT                   /locus_tag="BDP_tRNA18"
FT   tRNA            576086..576173
FT                   /locus_tag="BDP_tRNA18"
FT                   /product="tRNA-Ser"
FT   gene            576303..576623
FT                   /locus_tag="BDP_0486"
FT   CDS_pept        576303..576623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09160"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M4"
FT                   /protein_id="ADB09160.1"
FT                   /translation="MVSFSNDAFIGNHDYNPQIVDLGLQIRAGNDEGEELSRDAFRYTY
FT                   SDTNFLDRTLSVTTDGGALVFGNWDSPGLGQGAVSWGVAPNIDKIVFYPIVAGEVVGRS
FT                   LG"
FT   gene            576923..579061
FT                   /locus_tag="BDP_0487"
FT   CDS_pept        576923..579061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0487"
FT                   /product="putative glycosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09161"
FT                   /db_xref="GOA:D2Q8M5"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M5"
FT                   /protein_id="ADB09161.1"
FT                   /translation="MERQYMWGNDSVSLAFEVNADEHVSLSRIVFGMVEKVFAQRLPLA
FT                   EIILSGTGHWIACDRLIHTTIGRDLVLLSFDERTKGESRCLDVKMRDEQHALDVVVTYV
FT                   ISPGTSVVCAYATVINRGAGHVFLESVTSAVLPMGSMSNDETWKKEWILLEGHYDWLGE
FT                   GRWSYTKCSDLFPVLRQELTNHNPRSEHAVVSTGTWSTGGSVPMAFLESRETGNVWAFQ
FT                   VEHNGAWRWEIGDNTVDGYFALSGPTSVNHSWMKDLGEGESFATVPASFVMGGDMQTTV
FT                   EEMTKYRRIGRLVDESSAVSQVIFNDYMNTINGDPTTEKLLPLISSAAQVGCEVFVIDC
FT                   GWYDDSGDWWPSVGEWKPSKTRFPGPRGIGEVIDAIKEAGMVPGLWLEPEVIGIKSPVA
FT                   QELPDSAFFQRNGQRVVEQERYILDLRDESARRYLDGVVDRLIGDYGVQYFKMDYNVSP
FT                   GAGTDYHADSVGDGLLGHNRAFLDWVDGLHRRYPKLILENCSSGGMREDFAQTSRFQVQ
FT                   STSDQQDYRLYPVIAATAPLMVLPEQAASWAYPQAEMDAEQTAFNINTTFLGRFFLSGY
FT                   INQMEEWQKNIIQQGIQAYREHVQPMIGESVPLWPLGLPSWDSAVVALGVKASRRTIVT
FT                   VWARNAPETVKEVALFLPHLHGEGVQCRTIFPVGPAFDEWDAKWSEADSSLIVSIPHGM
FT                   YASRSFELVEKGGETLLS"
FT   gene            579130..580488
FT                   /locus_tag="BDP_0488"
FT   CDS_pept        579130..580488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0488"
FT                   /product="Sugar-binding lipoprotein of ABC transporter
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09162"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M6"
FT                   /protein_id="ADB09162.1"
FT                   /translation="MKMFTKAHVATAVAMGAALSMVLSGCSNPTAGDGNGDVDTSAKDY
FT                   WPSATQKLDGVELTMWVAQNSNKIPVKVVNDFEKATGAKVKLETIPDPYEQNIQTKITT
FT                   GDTPDLAFWQPTQSMLAGFIAQDKLQKLDNAPWVDDYTDGIADAGGVVDGTRYAALVST
FT                   PPVMGVFYNKKVFEKAGITEIPKGWDEYVAVAKKIKDANIDGVESPLFEMGGSQWGTQY
FT                   SVQIQLAEAAQDGLWDRVNSGKEKFTDKTIQTAIDNYKHLFDEGLYNKNAGSAKDTDEA
FT                   QALWEGKAGMIVCVNSLFNQIAALADNDKAALDENIGFFPLSAKGNIGTVIPEQNNSVV
FT                   AFKTSDSKKEAAARQFINYWMTEDYETFVKDQGIVSVIKNVDTPDNVPQALLDSADSIK
FT                   DSVGSMQSLAVANPDLYINLADMINGTKSATDVAKATQDQFAQLAKAQGIKGF"
FT   gene            580509..581510
FT                   /locus_tag="BDP_0489"
FT   CDS_pept        580509..581510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0489"
FT                   /product="Sugar-binding protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09163"
FT                   /db_xref="GOA:D2Q8M7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M7"
FT                   /protein_id="ADB09163.1"
FT                   /translation="MGHRKSGAPHPSATIDRGRTMSAQAVARAVPRPEKKKRNKSQKVL
FT                   MRQNYPVRYLIPAYVMLLIFFFVPTILNLIYAFTNWSAYSKTISFVGLSNFVDLFRSGN
FT                   LLRDLRITLIYALLVAIFQNTFGLMLAVFLEEDTRINRFARTMFFIPVIMSALAVGYIW
FT                   QAVLKSDGALNQILSFLLGANIDVAWLGSTIWTIIVVAAIHGWKWMGLSMLIFLAGLKT
FT                   IDSDVIEAAAIDGATRRQTFWRIKFPLLAPAFTFNVATSLLGSMNGFDIVQATTQGGPG
FT                   STTEIINIFIWRTFGQGLYSQSTTMSLVLFIMVMIIAVPLIWYLRRREAKIL"
FT   gene            581507..582388
FT                   /locus_tag="BDP_0491"
FT   CDS_pept        581507..582388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0491"
FT                   /product="ABC transporter system, sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09164"
FT                   /db_xref="GOA:D2Q8M8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M8"
FT                   /protein_id="ADB09164.1"
FT                   /translation="MTSATYGAAPKTNDSVTVNRPSKGHAIFHAIMVFVVMIVLLGIPF
FT                   WLLVVTAGKTQAEAVVPNMSLPSQWHLLENFKTVLVDGKMIAAFFGSIVVTVPSVFLAL
FT                   LFGSMASWILARRTTKLLAVVYALGISGLILPPAVVTVMMLLKIIGLSGTAVGMVGVYV
FT                   GIYMSTVIFFVTGFIRTIPVSLEEAARVDGAKPIRIFFTIILPLLGPTLATATILVTLY
FT                   IWNDVFYSLFILSGKMDLLPLNLYNVASAGLYLNNWHLIFAYIILMSLPLLIIFALAQK
FT                   KIISGITGGAVK"
FT   gene            582524..583561
FT                   /locus_tag="BDP_0492"
FT   CDS_pept        582524..583561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0492"
FT                   /product="LacI-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09165"
FT                   /db_xref="GOA:D2Q8M9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8M9"
FT                   /protein_id="ADB09165.1"
FT                   /translation="MARGARQTKAASIKDVAALAQVSVPTVSRYLNDRERVSDEKCEKI
FT                   AKAIEMLGYRPNPIARALVKERTKSIAVLSTNTTLYGQSHCIEGIEESARAAGYSLAIE
FT                   ILSDTSRSKLRASVQSSLDQNPAGVILLNFDQVGNDAFAYLPSDLPTVLIAGGREKETA
FT                   QISLCERESGYELTKYLLSLGHRTVYHVAIPGDGGDYTRLSGWRRACEEAGVPTTVPIE
FT                   AGWNPESGREIGRKLGADPEVTAIFAGNDELAMGIIRGLNDAGRKVPEDVSVAGFDDHP
FT                   IGSIWNPELTTIRQDFRLVGMKSFELLEAKINDLVEGNGHTENWNRYVEIPGELIVRES
FT                   TRSVR"
FT   gene            583988..585028
FT                   /locus_tag="BDP_0493"
FT   CDS_pept        583988..585028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09166"
FT                   /db_xref="GOA:D2Q8N0"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N0"
FT                   /protein_id="ADB09166.1"
FT                   /translation="MLSLGYCILGVMLCIATFFLAKKHPNRISNGFILELAVILLLESL
FT                   LGLMAAHMGASPWLMGVAYVLAYIRPVLFVILGFALLVNGIIGVRREGFSLTSALPFAW
FT                   GIMLLFSGYWFLWGPGQGMSGSEFYVRVMTFVSMMVNYIPIALFGVWFSNDICYKSGKA
FT                   PETEYIIVLGCSILDDGTVTPLLRGRLDAAIAAWEQGGRRATIITSGGQGHDEVISESR
FT                   AMANYLLSQGVPESSILLEDKSSTTEENLKFSHAIMDARGGAAHCTIATSSYHCLRAAM
FT                   FARRLGINASCVGGHTAAFFYPAAFFREYIALIMRNRPAVIIFFGLVVVRFALMLMDIV
FT                   PEGVFF"
FT   gene            585091..585195
FT                   /locus_tag="BDP_0494"
FT   CDS_pept        585091..585195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0494"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09167"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N1"
FT                   /protein_id="ADB09167.1"
FT                   /translation="MACNVVGKSIGLSIWNINDESDKTMPMHKFHHPA"
FT   gene            585446..586516
FT                   /locus_tag="BDP_0495"
FT   CDS_pept        585446..586516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0495"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09168"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N2"
FT                   /protein_id="ADB09168.1"
FT                   /translation="MAQQITSLLDDPTQTVSLDTFSGLTKGCPAPFWLFQGVCGAWGID
FT                   HSRAQLNLITVSENATFLLLLDGEPQGVVRVSQPGYVGGPEAVASEISWLNALHDIDGI
FT                   SLINPVPTVRGTFVTKINDLNGIGWTVISTKYVEGTVLEDLDNPAPYYETIGQWAAKFH
FT                   EQSRNWNKPYGFTRFNWDLSNMVGPAPRWGRWESANLTDDERALCDTALWKAMDVVMKV
FT                   PRTNDTWGLIHADLRPSNVIRGDDGRLTVIDFDDAGYSWYLYDYASSLSFIEHESYAPD
FT                   LAKAWVKGYQAVAGTFTDDELHIMSALSMIRRLQMLGWTTNHREDALPDGLAAQQAPGS
FT                   VMCAKRYLDDPLWLLH"
FT   gene            586634..588127
FT                   /locus_tag="BDP_0496"
FT   CDS_pept        586634..588127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0496"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09169"
FT                   /db_xref="GOA:D2Q8N3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N3"
FT                   /protein_id="ADB09169.1"
FT                   /translation="MTASTVSGSSIGSVTYVETDKDYFKKRQLKRTAGAFGLWAIGIAA
FT                   VVSGDFSGWNGGIAQAGWGGMLVAALVVYLMYVLMLNSISEMASAMPHTGGAYSFARAA
FT                   MGPWGGFFTGLAETVEYVMTAATIVYFSSAYADAILSDLTGYSLDDHGLRWIWWLGLYV
FT                   IFVVVNWLGAETSFRFAEVVSIAALAIVALFGIGAFVTGKADFSTLLNITPTDGNSAFL
FT                   PFGPGAIFYAMPFAMWLFLGIEQLPLAAEEVREPEKNIPKSSRLCIFTLGLSALIIVFL
FT                   NPAVVGSEALAGSDEPLLDGYRAILPGNLAAVLSAFALIGLLASIQGIMFAYGRNLYSL
FT                   SRAGYYPAFLSLTGKKKTPYWGLIVGAIIGFAALFIIAYGGSGAGSVVLNIAVWGAVLA
FT                   YLLQMVSYVLLKRNMPDIKRPFTSRFGVPGAVIAGLLAFCIFVAVLLNPDYRLAVYTMV
FT                   AIYILATIFFAVYGRKHLVLSPEEEFAASGGKAEYKTED"
FT   gene            588336..589700
FT                   /locus_tag="BDP_0497"
FT   CDS_pept        588336..589700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0497"
FT                   /product="aminotransferase"
FT                   /EC_number="4.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09170"
FT                   /db_xref="GOA:D2Q8N4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N4"
FT                   /protein_id="ADB09170.1"
FT                   /translation="MATRSTIMDTNSFRPEMADALDPATRKLTEERDVLGPAYRLFYRN
FT                   PVHLVKGVGSHLWDADGEEYLDVYNNVASVGHCHPRVVEALSKQASMLNTHTRYLHENI
FT                   LHYAEDILSTMPDELDRIMFQCTGSEANDLAIRVAQTYTGGEGVIVTHEAYHGNSALTS
FT                   KLSPALGTAQTLGLTMRMIPTPDTYRLEIDGKAASECTAEEFGNWMAGEVRKAVADMER
FT                   HGIKFAALLADSIFSSDGVYPDPVGYLKPVIDTVHELGGVWIADEVQPGFTRTGDAFWG
FT                   FGRQGIVPDLVTSGKPMANGLPTSLMAARHEVLEPFAGSIPYFNTFGGNPVCMAAAQAV
FT                   LDVMRDEDTMGNAKKVGKVFKDAVASLMPSHPCIGDVRGAGLYIGCEIVKPGTKEPDQK
FT                   AALDILETLRDNHILTSVCGRYGNILKLRPPLVFSESDVDWFMDGFTKTLETLKL"
FT   gene            589734..590510
FT                   /locus_tag="BDP_0498"
FT   CDS_pept        589734..590510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09171"
FT                   /db_xref="GOA:D2Q8N5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N5"
FT                   /protein_id="ADB09171.1"
FT                   /translation="MEDRIDAGQGRLATSELVYRIRALIRDRELQPGERLGSERALAQS
FT                   LGISRSDLRMALAVLEASHEVIRKIGRAGGIVVSDGRLERNINTVESLPTIARRQGMRV
FT                   SSKVLQAVIAPASPSDIRLLKLPGEHPMVYDITRLRYIEDQPLSLERSHLPAYLFPMFL
FT                   TRDLTTPFYTMFERDYDVRPYSVDETLESVVGDAQENELLEIEPETPLMRIHRIAFTAE
FT                   GTPFERAIDVYVADRMRFTMHHSGYVRLSATHGSAK"
FT   gene            complement(590785..591477)
FT                   /locus_tag="BDP_0499"
FT   CDS_pept        complement(590785..591477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0499"
FT                   /product="Two-component response regulator"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09172"
FT                   /db_xref="GOA:D2Q8N6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N6"
FT                   /protein_id="ADB09172.1"
FT                   /translation="MNEQQEQPIRIAVVDDHEMFRAGVIATLQPHFNIVGQAPDVEGSV
FT                   AMIAQTKPDVVLLDVHVPGGEGGGGAEILTRSRAYSPNTVFLALSVSDSPQDVGSVIRA
FT                   GAQGYVTKTISGDDLISSIKQVHEGYAVFSPKLAGFVLSAFQSAPSGGMAAGGANGPIH
FT                   DDELDRLSNREQEVMRLIARGYTYKEVAAELFISIKTVETHVSSVLRKLQLSNRTELTR
FT                   WAADRRIV"
FT   gene            complement(591474..592958)
FT                   /locus_tag="BDP_0500"
FT   CDS_pept        complement(591474..592958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0500"
FT                   /product="Histidine kinase sensor of two component system"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09173"
FT                   /db_xref="GOA:D2Q8N7"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N7"
FT                   /protein_id="ADB09173.1"
FT                   /translation="MKSYGAPRYTQYEYDYASSVYARYCLANRDPHESAPIRPARLPLM
FT                   RPQYGRWFAGVCKGISMHLGVSVGLIRLIAIASTFAFGSGVIAYVFLWLTVPLGDPVQQ
FT                   AYWLAEQQPISRSPLSHGNAPYAGIARHTTRAMTDESQFDGMQTDDVDDVEHTRSSGES
FT                   LEHLLKNAPKPALIALTGLMLLAISCAMLLSGIDRMLILPLLFGAIGIGVSWLRYNAEE
FT                   GQLWTMLGGIALIFIGYVVYIFGQVRYLPGSSHPTWTFIIAGLALLVGGMLAIVPWIVA
FT                   LIRDLGTERALKEREEERADMTAHLHDGVLQTLALIQLHADDQQTVFSLARSQERELRE
FT                   WLYQERTTSDRSVNAGLKEIAAQVEDTHGKPIEVVTVGDAQPSAQTDALLDATQQALIN
FT                   AVTHGGEPISVYCEAGDDMVEVFVRDHGEGFDIATIPANRLGIRESIIGRIKRRGGTVE
FT                   IVSRPKWGTEVRMHMPIVARQSKAGEPDASQIKEQQ"
FT   gene            593072..594946
FT                   /locus_tag="BDP_0501"
FT   CDS_pept        593072..594946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0501"
FT                   /product="Narrowly conserved hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09174"
FT                   /db_xref="GOA:D2Q8N8"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N8"
FT                   /protein_id="ADB09174.1"
FT                   /translation="MSNVHHDPRSNQWNAPQRPAGQPQPSSSNRFFAWIRKSQLKRGRD
FT                   RWVGGVCDGLARRLGWNVALVRALVILTSLFFGCGAAFYGMAWFLLPDETDDRILCEEL
FT                   IAGHWDWSCIGVFVCMAIAICLPGAGWVAFAVAALILWLIVNRQTYVPAWQQQAQYGPV
FT                   PHNSYVLGAQGAAGPMPPQAPPFVATMDGPKPVSPWYQRGMPQQQGVPPYDSVYRQGPA
FT                   GGTGDVPPQAHVSQQPMNGPAAFATANVPPTFTAPAAPIEPQPRYGRRKPAGPFLVLMT
FT                   FGLALLAVAGLYWYDTFDGSKTSQNIIADKLQVTTLVAGGFCLLMGVIIIILGSMGRRA
FT                   GGLHPLTWLAATMAVIMVICTGTYSICWYRFKQNDTYQTVALAGTKVMGSSAAQMKRYG
FT                   NGIAVVGNDYDSDILHIDLSQYGKNNGSHKVRLNDGTMGDSTCPTGTINMTVSSAQVVV
FT                   TIPDGCWWTLGGYEDEDYDEYSVLDHIGGPSEINMMDAGGAIDGTLSFGSDYRSDAMAG
FT                   QRAFDTTDRDTGCRFMHPDDSTDSDDSDDSADATSGQRFDSPFKDADTDKALNKVYAQH
FT                   WYWPCLAGESKAPKPDLTINPHVTIGGSVTVQYASQNTLPTFNGKETK"
FT   gene            594943..595452
FT                   /locus_tag="BDP_0502"
FT   CDS_pept        594943..595452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0502"
FT                   /product="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09175"
FT                   /db_xref="GOA:D2Q8N9"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8N9"
FT                   /protein_id="ADB09175.1"
FT                   /translation="MTDDDTRVMPVNDTAPEDEPTTVLPTDAQTTTMPTMEDTPDSAAT
FT                   VPTFEQPMEPAGHPMGQTAMPVSITKSNGDLVIRPSGPSGATIALGVCIALIGVVTVIW
FT                   GLQSPMNLWGVDPQLFVVGTIGGLGLILIAVAFAWAIVKLVQEAKAERKASESADGAAD
FT                   PHDSRA"
FT   gene            complement(595461..597125)
FT                   /locus_tag="BDP_0503"
FT   CDS_pept        complement(595461..597125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0503"
FT                   /product="Narrowly conserved hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09176"
FT                   /db_xref="GOA:D2Q8P0"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P0"
FT                   /protein_id="ADB09176.1"
FT                   /translation="MHALLKRIGVTVAATAMASVVLFVLLGALGRDMTPQWRVGPFTDH
FT                   IAVESADTAIRATDLQTPQEGTYQTKETHITVPLAANVTVNAIVREPIGAPDGHPACLL
FT                   MHGSGTGKSAEAYGDIANAMASAGITTLVPDKRLDNYSALHRDYVSSAHDYARSLETLR
FT                   QWPGVDPAKTGLYAESEGTWIATVLTQEHQDIAFAILTSSPVVSGRQQMTLAATSYLTT
FT                   VGAPDAVKGIIPRLTSLSLKSIGLEYADFDAAQYRTSLTMPLLINYGVRDSAMPIEQGA
FT                   RLLMQAANEAGNDNVTLRYFDANHQMRTGSNATVPGLPLEEHYTHDLEDWINAVAAGTT
FT                   ADGWATPMIAGAQPNQRIAAPLSTKPALIKTLDVLVGGIASCLLLALAAIVGALILLIV
FT                   GMSRSPQDSRRFAGPLRMALAVNTILAAGMTGIFLAYLFAVVRDAITLTNDSTLLARYW
FT                   QYIVIGAIVSLIAFAWLLVECVFAVRARRRQESAWPLHAHLVDTHEDTHDGHRNMAGIR
FT                   NDHGKAGVGFGHVAVATCVMLSAALSLALLAFWGLFG"
FT   gene            complement(597192..598898)
FT                   /locus_tag="BDP_0504"
FT   CDS_pept        complement(597192..598898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0504"
FT                   /product="ATP-binding and permease protein of ABC
FT                   transporter system"
FT                   /EC_number="3.6.3.44"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09177"
FT                   /db_xref="GOA:D2Q8P1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P1"
FT                   /protein_id="ADB09177.1"
FT                   /translation="MAGHVGGFDKAMLLSVMSGVVTGLTFAAIIPAAQTLGGASTVMGL
FT                   GFWQWVAVLAILAVLSGVIDYFKSVISYNSALDFLAIALHGIGDKIASLPLGWFAKGTA
FT                   GRLSRFATHDLMSIGQSFAHLISPMVTGAASTVTLCVAMLLWDWRIGLTLIIPLPLLWG
FT                   AGKLSSMMLHRGDDAMLALDFEASSRLVEFATCQGALRSCGASHPYQPLTDALDARTAG
FT                   QRRSLRWGVAANLLNGMASQLLPVSMIMACAALTLQGALSPLVGIACMGVSLRFSNTVN
FT                   DMFAMLLGIEESRKSLDYYLSVMRERPLPEPADPKPVTRPGAVEFDRVRFGYTASAPVL
FT                   HDVSWTARPGSMLAVVGPSGSGKTTMAKLIARFYDVDAGTVRVGGLDVRDQRASDVVAQ
FT                   LSMVFQDVYLFHGTLIDNIRLGRPEASDDEVMRAAELAGVSEIAQRLPDGWQTNVGEGG
FT                   KSLSGGERQRVSIARAVLKQAPIVLFDEATSALDVENEAHINECMAQLRATSTVIVIAH
FT                   KLETIRNADTIIVMGRDGGMLQRGTHDQLIAEPGMYREFYEARCRAESWSL"
FT   gene            complement(598930..600747)
FT                   /locus_tag="BDP_0505"
FT   CDS_pept        complement(598930..600747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0505"
FT                   /product="probable permease protein of ABC transporter
FT                   system"
FT                   /EC_number="3.6.3.44"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09178"
FT                   /db_xref="GOA:D2Q8P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P2"
FT                   /protein_id="ADB09178.1"
FT                   /translation="MADDVADESTAQTGDKAKAVEGKAALNRAMKPIQGRLNCGRALAA
FT                   ISGLLSVAPYAALVSIGDVLLRAWQQHTQPDANTVWRYVFILVGAYMLRSFLYFAALSI
FT                   THFADCTLGAGIRRAMADSLGRAPLSTFNASTSGMIRKSIHDDVETLHALVAHWPVEGT
FT                   AATVTPLALFAYIVVLDWRLALLSIATLPLYFGIQMFSMAGMSEKTALMDTKISNVSST
FT                   MVEFASGIAVVKAFGRSGHSLRQYERAADDFIKQYNDWCGPLVRWCAIAEAFIAPALLT
FT                   AINLAVGMLLVQAGYVTAPQVLAATLTAMMLPSTITTIGNMQWSYQLAGAAALRIERNL
FT                   RVTPLAETTQPKHPNGYDVAIDHVTYAYGPTTALDNVSLNVAAGTMTALIGPSGSGKST
FT                   LATLIARFDDPAEGSISIGGVDLRDITSEELYRTVGFVLQDPQLIRASIRDNIALGRPD
FT                   ATLEQIRTAAKAAFIDDEIMALEHGYDTVIDGRVGLSGGQEQRIAIARALLKDTPILIL
FT                   DEATASVDPESEAQIQQALNALVAGRTVIVIAHKPSAVVGADQMVVMDRGEIVACGTHE
FT                   QLADETHVRALDAVARHNRIAAQEGAYHA"
FT   gene            600914..601033
FT                   /locus_tag="BDP_0506"
FT   CDS_pept        600914..601033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09179"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P3"
FT                   /protein_id="ADB09179.1"
FT                   /translation="MERLPENCRHGKTVTMFIVAMLAQKVNTLVSKTMKNSEW"
FT   gene            complement(601070..602257)
FT                   /locus_tag="BDP_0508"
FT   CDS_pept        complement(601070..602257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0508"
FT                   /product="AraJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09180"
FT                   /db_xref="GOA:D2Q8P4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P4"
FT                   /protein_id="ADB09180.1"
FT                   /translation="MKRSILALASGAFILGAAEFVMMGILPQTAAAMNVSIPAAGHYIS
FT                   AYAIGVCFGTLILVFGRKVPPKNLIILFMIIALVGNTLSTVAVNSPMLLTARFISGLPH
FT                   GAFFGTATLIAKTLADKGKEAQSVSMMVTGQTVANMLGVPAGTLLAEMLSWRVAFGLLA
FT                   AWAAMTMLLTLAWVPFVPPIKDAGIKGQFRFLTHPGPWFVLLAVFCGNSGIFCWWSYIS
FT                   PWLQKTGGWSSSAVPLLMVLAGFGMVLGGIAGGRLTDLWKPAATAALSQSIAVVGLLLV
FT                   FLIPGNRMSTAMLTFVLGFALFFNSAPQQLLMVQAGQGGGELIAGAAVQIAFNFGNAVG
FT                   SIVGGAALTATAMNYHYTGLSGMPIAIIAVMFLITYTRRYETDTQAMERMREVHV"
FT   gene            602435..603166
FT                   /locus_tag="BDP_0507"
FT   CDS_pept        602435..603166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0507"
FT                   /product="Two-component response regulator"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09181"
FT                   /db_xref="GOA:D2Q8P5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P5"
FT                   /protein_id="ADB09181.1"
FT                   /translation="MDQVMHIAVVEDDDECAQAVTQCLERFSSEHGEPIETTVFRDGAA
FT                   IVEDYRPVYDIVLMDIEMPGMDGISAAREIRKTDRDVVIIFVTNMAQYALKGYTVQARS
FT                   YILKPVNYYGLSMELQEAIDYINRNRRQNGRALLLPSGGGIDRVNLSDITYIESQRHNL
FT                   FIHTTGGVLRIRESMNAMEANIDDPAFVRCGVSFLINLAWVSGITEGREVLVGGDRVPI
FT                   SRQKYKDFMAALSAYLGGIHD"
FT   gene            603159..604514
FT                   /locus_tag="BDP_0509"
FT   CDS_pept        603159..604514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0509"
FT                   /product="Two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09182"
FT                   /db_xref="GOA:D2Q8P6"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P6"
FT                   /protein_id="ADB09182.1"
FT                   /translation="MIDVLNLPSLLLCGIAVEMALTPAVLPTIGPRDMRQRNGVRLEPP
FT                   AGSRMVWYMGIVIGLALSMAVVIWAKETLVDFDTNSTALEAPICLAVLVAFAVVPLRSG
FT                   VAQGIYEAIWAQVIASLSFECMDCATMWLPDPMRVIALGMLTPIVGVALFAAVRMRLLP
FT                   QLRGGRGGVVGKRKLLFAVTLCIMFLLLSNYQIIFLLLGSREHTYMIPAFRIMVELLSL
FT                   ITLYLQNDIEQRQHAQMELNLVQRLWQSKQRQYEISKETIDLINRKCHDLKYQLAAFRT
FT                   MQDDAETDRRLGEVERSVMIYDSAIQTGNRVLDVVLTEKSLYCEAEHITLTCMVDGAKL
FT                   GFIDQADLYALFGNALDNAIESVMKQRDPAKRVIQVSVYPDNGFLMIRIRNYCDEPITL
FT                   VDGLPATSKKTDKGYHGYGLRGIRYTAEQYGGTMSVKIAPDSFTLQVVLPLN"
FT   gene            complement(604579..604854)
FT                   /locus_tag="BDP_0510"
FT   CDS_pept        complement(604579..604854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09183"
FT                   /db_xref="GOA:D2Q8P7"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P7"
FT                   /protein_id="ADB09183.1"
FT                   /translation="MNAQHNLKDSPILNLIWLLLIVASSSIGILAGVVYVLAVANVQIL
FT                   SWSIGYILTSGTNETVMGPCLTAFIVCLVIFVACMLKNVMLKAIKR"
FT   gene            complement(604881..607730)
FT                   /locus_tag="BDP_0511"
FT   CDS_pept        complement(604881..607730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0511"
FT                   /product="Putative Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09184"
FT                   /db_xref="GOA:D2Q8P8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P8"
FT                   /protein_id="ADB09184.1"
FT                   /translation="MMKRKFFHPISKRFGVFGLVLTVLLTMVMIVANVALSRYSNTISS
FT                   TLDLNKQISAGGDEATYQKARNLTQEIAGEGATLLKNTNGALPLDTKKINVFGYGSVNL
FT                   VYGGSGSGSTSGASYNDTLKQSFEAEGLSINEDLWNYYTKQSQSAGSWNVFSPNGGDYN
FT                   IYDAKCTDVLDMMDSAKRYSDTAVVVFSRAGGEGGDLPMDMGVTDSESGEGLIGGDAGK
FT                   SYLELQSAETDLLKAVEKNFEHVIVLVNSSHAMELGFLEDAGVDAALQIAGPGATGMRG
FT                   VADVLLGKVNPSGHLVDTYAYDVKSAPSYYNMGDCYYTDYQQQMSDKYFYFEENIYTGY
FT                   RWYETAAADKAVITASDGTVYDYGDYDSIVQYPFGYGLSYTTFDWQLEDYQVDGQGGEV
FT                   TATVKVTNTGDVAGKDVVQLYYSAPYTKGGIEKSAVDLGAFVKTKELKPGESDEVKLTM
FT                   TFDDMASFDYKGTGAYVMDKGDYTFTLRTDSHTVKNDDATFTYTVENTITYDDAHDGKR
FT                   STDKVAATSQQEFQDAGSLETNVTYLSRADLAGTFPKVERRLNPTSIPAKVKERLEANG
FT                   PGSTVLTSDNADASDNATPTTGADNGLKVDDMTGVDYNDEKWDKLVQQMSVDELVELTG
FT                   NAGWQTSAIESVGKKATTDIDGPQGLNGFNFSGTKMNAYASEVLMGMTWNVELVKQMGS
FT                   TYADEALSWGIVGMYAPAMNTHRSPFGGRNFEYFSEDPTLSGLMGAAEVSGMQGEGAYV
FT                   YAKHYMLNTQDTNRDGAANWCNEQALREVYARPFELAIKNADCTGLMTELSRIGTSWSS
FT                   ATKALCTELPRDEWGFTGKIITDGVGPGGSYYMLPDYAIMAGNDMMLTRASGDCGYTDA
FT                   ILKSDAGIRNMQRAAKNILYVYANSKASEVSGKYDVNWEWMWIVGDVVLAVVTLALFIC
FT                   LPVRAWCAPGQPIVTTSGK"
FT   gene            complement(607939..608015)
FT                   /locus_tag="BDP_tRNA19"
FT   tRNA            complement(607939..608015)
FT                   /locus_tag="BDP_tRNA19"
FT                   /product="tRNA-Pro"
FT   gene            608111..609787
FT                   /gene="lysS"
FT                   /locus_tag="BDP_0513"
FT   CDS_pept        608111..609787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BDP_0513"
FT                   /product="lysS Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09185"
FT                   /db_xref="GOA:D2Q8P9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8P9"
FT                   /protein_id="ADB09185.1"
FT                   /translation="MTETNESQEHQNEEAPVPVMTTVERAEMLLRQDAAIRAKINDGAT
FT                   LDEAVDPSNKEFGSLAHPEQVQMRVAKRAMMLKEGIAPYPVTLDVTDTIEAVRAKYDGK
FT                   LEAGDETEDVVGIAGRVLFLRNAGGLCFVQLSAGDGTKIQGMISKKEIGADSLKQFKQL
FT                   VDLGDHLFIKGRVIASKTGELSVFATEWAIAAKALQPLPALHKDLNEDTRTRKPYIGMI
FT                   ADEKIRNMVRNRSKAVASLRKTFADHDFIEVETPMLQTVHGGAAARPFTTHMNAFDLDL
FT                   YLRIAPELFLKRCLVGGIDRVFEINRDFRNEGADATHAPEFTMVEAYQAYGNYDTIGAL
FT                   VKQLVQDTAMDVFGSHKVTLLDGTEYDLGGEWKTISMYDSLSEALGEEIVPNGGPDNPG
FT                   TSVEHLGEIADRLGVERDDVENHGKLVEHLWEHFYEDKLYEPTFVRDFPVETSPLVKGH
FT                   RSKAGVVEKWDLYVRGFELATGYSELNDPVVQRERFVAQAKAALAGDEEACDIDEDFLE
FT                   ALGVGMPPAGGMGMGIDRLLIALTGATIRETITFPLVKPLN"
FT   gene            610939..612024
FT                   /gene="menA"
FT                   /locus_tag="BDP_0515"
FT   CDS_pept        610939..612024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="BDP_0515"
FT                   /product="menA 1,4-dihydroxy-2-naphthoate
FT                   polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09186"
FT                   /db_xref="GOA:D2Q8Q0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q0"
FT                   /protein_id="ADB09186.1"
FT                   /translation="MALMKMSIWIRGARLKTLPLAIAPVIIGTALSWKGVFVYSQGGDI
FT                   LHEPCPFFGGQHDLRETKLGSMVGTCQTSLSWFVLVAVLCGCVALFLQIAANFANDYSD
FT                   GVRGTDEGRGADMEPGRSSAGTLPTRDTPRGPARLVASGMNPRAVLAAAGINALIACLC
FT                   GLVVCALTGYWWFILVGFACLVAGWCYVGGKHPYGYRCLGEVFVFVFFGLVATCGTMFA
FT                   LSGTVSLSGVWGGCAEGFVAVTVLCVNNLRDIESDHDHGKHTWMTALGRSKGAVLTISL
FT                   LTMASAMAILFLLVLWRSTFVAKSVPAVSIVPIAATLIMCAIHAAAIAAIAKERYKAAL
FT                   PLCSLGSLVLAVTFAVSSMFM"
FT   gene            612181..612921
FT                   /gene="pmg2"
FT                   /locus_tag="BDP_0516"
FT   CDS_pept        612181..612921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmg2"
FT                   /locus_tag="BDP_0516"
FT                   /product="pgm2 Phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09187"
FT                   /db_xref="GOA:D2Q8Q1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q1"
FT                   /protein_id="ADB09187.1"
FT                   /translation="MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGVEEAKNGGRLLK
FT                   EKNVLPDIVFTSMLRRAINTANVALDEADRLWIPVQRSWRLNERHYGALQGKNKTQIRE
FT                   EYGDEKFMLWRRSYATPPPEIDPNDEYAQNGDPRYTGDPVPEAECLADVVKRVEPYFKS
FT                   DIEPQLKAGKTVLIAAHGNSLRAIVKMLDNLSEEEIAKVNIPTAMPLLYELDENFKPIK
FT                   PRGEYLDPEAAAAGAAAVAAQGQK"
FT   gene            complement(613117..614997)
FT                   /locus_tag="BDP_0517"
FT   CDS_pept        complement(613117..614997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0517"
FT                   /product="Linoleic acid isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09188"
FT                   /db_xref="GOA:D2Q8Q2"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q2"
FT                   /protein_id="ADB09188.1"
FT                   /translation="MYYSNGNYEAFARPKKPEGVDSKNAYIIGTGLAALSAACYLVRDA
FT                   QMPGDHIHVFEKDAVPGGACDGANIPGVGYVMRGGREMDNHFEVMWDLFRSIPSIETEG
FT                   VSVLDEYYWLNKEDPNYSLCRSTRARGIDAGTNGKFALTDKASMEIMKLFFTPNEELYG
FT                   KKISDFFDDEVFDSNFWMYWRTMFAFENWHSALEMKLYIKRYIHHISGLPDFSALRFTR
FT                   YNQYESMILPMITYLEGFGVQFHYNVKVDNVEFKIGGGMGPARPHTGVGQDTILKKQAE
FT                   SGTFVRNPHSSPTRKMATRIDLTEADGATRSIALSDNDLVFITNGGCVENSSMGSQTEP
FT                   AKWDPQIRPGGGWDMWRRIAKQDPSFGHPDVFCGDPEHSKWMSATVTTLDMEIPPYIQK
FT                   ICKRDPFTGHVVTGGIVTVEDSNWLMSWTLNRQQQFRDQPKDQLCVWVYGLFPDKPGNY
FT                   VKKPMQDCTGEEICEEWLYHMGVPTDKIEDLAHNHANTVPVMMPYIDAFFMPRSAGDRP
FT                   DVVPDGAVNFAFLGQFAETPRDTIFTTEYSMRTGMEAVYTLCDVDRGVPEVWGSVYDVR
FT                   NLLNATVMLRDGKPITDMNLNVIEKTVLKQILKKLEHTDIAMLLKEYGVV"
FT   gene            complement(615169..615849)
FT                   /locus_tag="BDP_0518"
FT   CDS_pept        complement(615169..615849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0518"
FT                   /product="Pho-related response regulator of two-component
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09189"
FT                   /db_xref="GOA:D2Q8Q3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q3"
FT                   /protein_id="ADB09189.1"
FT                   /translation="MRVIFNEELKAVADDLDRMVHGVRKAINGAGDALLNQNLEAAQAV
FT                   IDGDIEIDALESSVIDQCVKLLAKQNPVATDLRVVVSTLRLAATFERMGDLARHIAEAA
FT                   RRTYPASPLPENAQPLFAEMQAFLNETADRVVSMLSDRDTQVAEQIILSDDKLDALHKK
FT                   TFELAQSEDWQGTNQQLIDVVLIGRFMERLGDHAVSAARRVVFIVSGFDPTKEPSRDEG
FT                   TDID"
FT   gene            616008..617240
FT                   /locus_tag="BDP_0519"
FT   CDS_pept        616008..617240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0519"
FT                   /product="Pho-related sensory transduction protein kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09190"
FT                   /db_xref="GOA:D2Q8Q4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q4"
FT                   /protein_id="ADB09190.1"
FT                   /translation="MSGDLRGVCENESMLESLSTWWRSLPHRDDNTRNTDEDTLDDSTN
FT                   ALLSMLPLASIVVDDADEVVRAHPSAYTLGVVRDDAIVEESVLRAVREVRREGGKKQFD
FT                   LTTTTAHVAQSAPRAGKPTTREAARQALIGQRKDEPAASVSRPNWLKVIVGRLNEKFVV
FT                   VLISDVSETIRFSQVRDSFITNVSEQLLKPTQSLERLADTLERDGANQDGVRENAAQLR
FT                   RSCTHLEHMVSDLLLLIKAQEPILPTSDNRINVMAQLEAVAASHKEEAARRGITIDVSG
FT                   DESLETNGEAEQIQTALAKLVENAIIYSPDGASVNMTAKPDEDGERVVIRVLDRGIGIA
FT                   DKEQERVFERFYRGGNQNGHSQDGIGLGLAIVKHIALTHHGSASVWSSPGQGSTFTLTL
FT                   PLARAARNVRN"
FT   gene            complement(617247..617501)
FT                   /locus_tag="BDP_0520"
FT   CDS_pept        complement(617247..617501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0520"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09191"
FT                   /db_xref="GOA:D2Q8Q5"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q5"
FT                   /protein_id="ADB09191.1"
FT                   /translation="MKLAPIIDPSVRKPSPKPVRVDLRKVFMVGTSLWAVGLVICMILL
FT                   ALGFDVERGQTMCAAGTVIGVLMLLWEHFDRWDYRRLGE"
FT   gene            617567..618952
FT                   /locus_tag="BDP_0521"
FT   CDS_pept        617567..618952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0521"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09192"
FT                   /db_xref="GOA:D2Q8Q6"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q6"
FT                   /protein_id="ADB09192.1"
FT                   /translation="MFSISPVPKRYAWGSKTRLQDLFSLPANGEPLAEMWFSGHEESPS
FT                   EVALGPGVHVPLPHAIRNAPGMMVGPTCSERFGPVLPYLFKVISARIPLSMQVHPVGFQ
FT                   ARAGFNAENVAGIPLNSPLRSFKDVNEKSEMVVALTSFQASVGFAPRAFALRNLHAVDH
FT                   PLTRRMEHALGGHPRHHEHLEAADFSEADSRMPLASVVWPTSYMRTFRAFHAAITADGD
FT                   QAAGLLQALVHARGSVASTKSRMAFDYAIAAARAFPDDASVLTLLMMNPISLDEGGSVF
FT                   IPAGTPHAYIQGTGAEIMTNSDNVLRAGMTVKHRDIDNLLQCLNCASAGPIDPSDARLG
FT                   TFVMRDIVLYRPPVDEFMLAYGHVDGARRPWPILDRMVQRYGRLADYVRATRQPLPHRG
FT                   PRVVLCTEGRVLCDSERDSRVLAAGEAVFVPAGEGRLSVDAVQATKKPEDSSGSFIVAS
FT                   TPF"
FT   gene            complement(618949..620091)
FT                   /locus_tag="BDP_0522"
FT   CDS_pept        complement(618949..620091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0522"
FT                   /product="serC Phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09193"
FT                   /db_xref="GOA:D2Q8Q7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q7"
FT                   /protein_id="ADB09193.1"
FT                   /translation="MTNTVTIPSKLLPEDGRFGSGPSKIRPEQIQALDDGARHLLGTSH
FT                   RQTPIKQIVASIREGLSEFFQVPDGYEIVLGNGGASAFWDIACASLITRKAAFGTYGSF
FT                   STKFAKSAQSAPFLEEPEIFAGQPGTYRLPELTEYVDAYCWAHNETSTGVSAPVRRITG
FT                   SKEQGALTLIDATSAAGALPVDISQTDAYYFSPQKAFGSDGGLWVAVLSPAAIERAYGI
FT                   AKSVDLPGVRRWIPPFLSLTSAIENSRKDQTLNTPAVATLVMMENQIRWLNDNGGLAWA
FT                   STRCAKSASLLYTWAEHSDYASPFVADKAARSNAVVTIDLDESINASQVVAALRENGIV
FT                   DTNGYRKLGRNQLRVGVFPSVEPADVTALIHCIDYVVEHL"
FT   gene            620300..621256
FT                   /locus_tag="BDP_0523"
FT   CDS_pept        620300..621256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0523"
FT                   /product="Surface antigen"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09194"
FT                   /db_xref="GOA:D2Q8Q8"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q8"
FT                   /protein_id="ADB09194.1"
FT                   /translation="MRHAAHKAARVSDERFSAAKALFTSSRGSHTAKAVRMVQLANGGG
FT                   AVVGLDPAVAEKLNEVAPMTRRAMREAARAAERRSTIVTSASLAALVGTAATAVALTQQ
FT                   NSMNLLVADAATTTTQLKRVSDTSAASRSEERTALDSLVDSSDASQTSNNGEWQLGDAN
FT                   TIADVSQLSKSKASNPNVAVLMDQDSESLPAGFDSEHATGDSGNAYEFSQCTWWAYVRR
FT                   HQLGLPAGSHFGNGCQWAASAKALGYWVDNTPRHVGDIIVFAAGQEGSDSYYGHVAIVE
FT                   KINDDGSIVTSECGSVMNGKTYSRTLTNVNDFQYIHY"
FT   gene            621297..622061
FT                   /locus_tag="BDP_0524"
FT   CDS_pept        621297..622061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0524"
FT                   /product="Hypothetical NLP/P60 protein"
FT                   /EC_number="3.4.19.11"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09195"
FT                   /db_xref="GOA:D2Q8Q9"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Q9"
FT                   /protein_id="ADB09195.1"
FT                   /translation="MKNLTKRCSMLTAIVAATVLFSGVAPVALAADDAAGQGSVVATRS
FT                   FPKVSAVKKNILAESTSTEVEQDSDWGGVESLDVPQTKSQAEKDAEERAAAEQQAREQA
FT                   AAAAQQQASRSSDRSDLTTDNSSNSTSTVTVTPPDGTSVSSLLSFAGQFVGKVPYVSGG
FT                   NTPSGWDCSGFVQYVYGQMGVSLPHYSGAQATAGRAVGSLAEAQPGDIIANSQHAAIYV
FT                   GNGMVINSQLNGTRYDPIAWVFPGSYSIRRIF"
FT   gene            622233..623267
FT                   /locus_tag="BDP_0525"
FT   CDS_pept        622233..623267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0525"
FT                   /product="Universal stress protein family member"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09196"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R0"
FT                   /protein_id="ADB09196.1"
FT                   /translation="MINDKAILVGVDGSHASYKATWWAANYAKHAGLTLQIVCAYSLPS
FT                   YAAVSFDATYTAMGDDNAAHSDAQEILSKAKAIADEQGVEAATLIVTGDPASVFVELSR
FT                   NYNLIVIGNRGKGGLAERLLGTTSSSLPAYAYCPIVVVPYTDDDGNLMHLNNTITKVAV
FT                   GSDESKWGLKALEIAADFADAWGAELDVISAVPNMKGSEDEGVMASFKEDLDVRIKPLE
FT                   ESHPNLTINKQIVPGPAVGALTKASYDHDVVVVGSRGRGGFTGLLLGSTSQGLLQHAVG
FT                   PVYVVPRKYVEAAESRLDTVPSSPADVAPKSLDDIKGVEEVPVTKAEPEVVEAIETKID
FT                   PERQ"
FT   gene            complement(623390..623803)
FT                   /locus_tag="BDP_0526"
FT   CDS_pept        complement(623390..623803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0526"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09197"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R1"
FT                   /protein_id="ADB09197.1"
FT                   /translation="MGKRLWVERNKDGSWDAFSEDGAHIKFGKGRGQFTPGDLMKIALA
FT                   GCAALSSQFAIEHTLGEGEGAKIVVDGTYDADNDAYIGFDEQVEIDATAAGLSDEDADK
FT                   LKERVTRHIDKGCTVKHTYVEPTPVRMNVTVKH"
FT   gene            623976..624848
FT                   /gene="thyA"
FT                   /locus_tag="BDP_0527"
FT   CDS_pept        623976..624848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="BDP_0527"
FT                   /product="thyA Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09198"
FT                   /db_xref="GOA:D2Q8R2"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R2"
FT                   /protein_id="ADB09198.1"
FT                   /translation="MALTSEQLADIRTRIPARPDTDIPMPYEDLVRRIMTEGTLKSDRT
FT                   GTGTISLFGQQIRFDLKDGFPLLTTKTVFFKGLAYELLWFLKGSTNVRWLQEHNVHIWD
FT                   EWADENGDLGPVYGAQWRSWPAPTPDDPNRTIDQITNVLDLIKHHPDSRRMVVSAWNPA
FT                   EVEHMALPPCHALFQFYVADGRLSCQLYQRSCDMFLGVPFNIASYSLLTLMMAQQAGLE
FT                   PGEFVWTGGDCHVYDNHVDQVLEQLGREPYPYPKIRIHEAESLFDYDYSDFEIVDYRHH
FT                   PTIKAPVAV"
FT   gene            624897..625571
FT                   /gene="dfrA"
FT                   /locus_tag="BDP_0528"
FT   CDS_pept        624897..625571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfrA"
FT                   /locus_tag="BDP_0528"
FT                   /product="dfrA Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09199"
FT                   /db_xref="GOA:D2Q8R3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R3"
FT                   /protein_id="ADB09199.1"
FT                   /translation="MNEMEHDSSRSGYHEPEPGHAGLEDEEDWGDDFPKTFSVNLIWAQ
FT                   ARDKEGRDGAIGFEGGMPWRLPEDMKHFTELTVSHPVIMGRRTWEALSPKFRPLPNRDN
FT                   IVISHDPAYSAPGATVVDTLDDALDLARQEAIPDDGLDRSEIWIIGGAQVFRDALPFAD
FT                   KAYVTQISMHVDADTYAPDIASLAESGAWRMAEEGVWQGTQKGSDDIAGFRFVTYEKNR
FT                   EE"
FT   gene            625580..626077
FT                   /gene="ptpA"
FT                   /locus_tag="BDP_0529"
FT   CDS_pept        625580..626077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BDP_0529"
FT                   /product="ptpA Protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09200"
FT                   /db_xref="GOA:D2Q8R4"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R4"
FT                   /protein_id="ADB09200.1"
FT                   /translation="MYTVMTVCTGNICRSPMAEIILRTEFERRGLADKVNVESSGVSDE
FT                   EYGNPIDRRAVKVLKERGYELPVHHFAHRITRDEIERTDLFLPMTASHMRALLRQLPQA
FT                   KCDEVHMYRSFDPNLPKPAAGYESEIDLVDPWYGGAHEFEVAIDQIEEVAPYIADWVER
FT                   QL"
FT   gene            complement(626121..626196)
FT                   /locus_tag="BDP_tRNA20"
FT   tRNA            complement(626121..626196)
FT                   /locus_tag="BDP_tRNA20"
FT                   /product="tRNA-Phe"
FT   gene            complement(626233..626309)
FT                   /locus_tag="BDP_tRNA21"
FT   tRNA            complement(626233..626309)
FT                   /locus_tag="BDP_tRNA21"
FT                   /product="tRNA-Asp"
FT   gene            complement(626404..626997)
FT                   /locus_tag="BDP_0530"
FT   CDS_pept        complement(626404..626997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0530"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09201"
FT                   /db_xref="GOA:D2Q8R5"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R5"
FT                   /protein_id="ADB09201.1"
FT                   /translation="MSDYQNSPAPQQPQDQPTEAIPQNFQTMPSQPDVPQPPQTEYGQP
FT                   AFGQSAYAQNPYQQAPQPGQSYPPQGVYQPYEQPVDQRWNNLCIVGFVLAFFIPLAGLI
FT                   ISIVAMVQINKSGERSKGMAVAGIIVSAAIMLINIIVVMLFVNAFINLMQREFGSVDFN
FT                   SSSYSDDNYDSPFDNQDRQELEDLLNQLESEQQS"
FT   gene            complement(627162..628172)
FT                   /gene="galE"
FT                   /locus_tag="BDP_0531"
FT   CDS_pept        complement(627162..628172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="BDP_0531"
FT                   /product="galE UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09202"
FT                   /db_xref="GOA:D2Q8R6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R6"
FT                   /protein_id="ADB09202.1"
FT                   /translation="MTVLVTGGCGYIGAHVVHALHQAGEQVVVVDDLSYGKPTRIEGSR
FT                   LYGMDIAAPGAGERLAEIMKAEGVDSVIHFAARKQVGESVEKPLWYYQQNINGMLNVLI
FT                   GMRDSGAKKLVFSSSAATYGVPPVDVVPEDVVPMLPINPYGQTKLFGEWMARACEEPYG
FT                   IRFCGLRYFNVAGCGPVELEDPAILNLIPMLFDRLKKGKAPAIFGDDYPTPDGTCVRDY
FT                   IHVSDLADAHIAALKYLDRDERKYDAFNVGTGEGTSVRQIVDEVKKVTGLPFKEAVMGR
FT                   RAGDPPHLIGSPKRINEEMGWHAKYDVEDIVKSAWDAWQANPEHHIDVETWKQAD"
FT   gene            complement(628169..628306)
FT                   /locus_tag="BDP_0533"
FT   CDS_pept        complement(628169..628306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09203"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R7"
FT                   /protein_id="ADB09203.1"
FT                   /translation="MFTCYTQIVQKVTNLSKSEQRSCFRRIRRNRMPAHSQLNIGKART
FT                   "
FT   gene            628355..629212
FT                   /locus_tag="BDP_0532"
FT   CDS_pept        628355..629212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0532"
FT                   /product="tRNA (m(7)G46) methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09204"
FT                   /db_xref="GOA:D2Q8R8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R8"
FT                   /protein_id="ADB09204.1"
FT                   /translation="MQEVMNTPTDGRESDANAHNEHRPALYGRKVLSFVRRSARLDARL
FT                   QRAWDAYSDAYLLDVNAGEGSLDVRKGFVLDEAYIRETWGNGNPLVVEIGSGQGENIVA
FT                   AAAADPQTNFLALEVYDPGVAHTMLLAGKQGLGNLRIAQVNAPELFKVAADGAIAEVWT
FT                   FFPDPWPKMRHHKRRIVQPELAGEIHRTLQGGGVWRIATDIEDYALHVHEVMDGLESFR
FT                   NDGDVTVSLPVEHVGKGNADEAAGLEHADFTESARFDGRVLTNFEKKGLAAGRVIHDFT
FT                   YRKV"
FT   gene            629346..629417
FT                   /locus_tag="BDP_tRNA22"
FT   tRNA            629346..629417
FT                   /locus_tag="BDP_tRNA22"
FT                   /product="tRNA-Glu"
FT   gene            629443..629516
FT                   /locus_tag="BDP_tRNA23"
FT   tRNA            629443..629516
FT                   /locus_tag="BDP_tRNA23"
FT                   /product="tRNA-Asp"
FT   gene            629548..629623
FT                   /locus_tag="BDP_tRNA24"
FT   tRNA            629548..629623
FT                   /locus_tag="BDP_tRNA24"
FT                   /product="tRNA-Phe"
FT   gene            629934..633047
FT                   /locus_tag="BDP_0534"
FT   CDS_pept        629934..633047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0534"
FT                   /product="Hypothetical sortase-anchored surface protein
FT                   with Cna protein B-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09205"
FT                   /db_xref="GOA:D2Q8R9"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8R9"
FT                   /protein_id="ADB09205.1"
FT                   /translation="MHVAKADDDASAASVTPTAYAANYGQLVNAINGSQSAVIAITGNI
FT                   AFTGQITLNQGKKITLVSDASACGTACELNYASASDFSLFNVIGDSSLTFGGGTEDTNK
FT                   LSFSNHSNGRLVQVGSASDKGTVTINGGTYNKNGSISNTTGDGNIAYVFKNGNLTINDG
FT                   DFKNNYASAASGSTTIGVTRSGGAVVRSSGSVTINGGTFYQNSSAGPNSERNDENNLDF
FT                   HGGGAIWSDGTLIVNDGLFSANKSYAKHYKKSGKRPIGGGAIWAAGRLVVNGGTFQDNW
FT                   QMDNNTELYATGGGAIYFGDGTKGKSYNGSMVINGGTFDSNRSMQDGGAIFMAWDCSAV
FT                   FQQGTFMNNWSNRLGGAVYTEEDSTSYVTNAAAYENHAGHFGGGLWLCPSGKGLTSEHG
FT                   GMALFANEANVKYDRTETGVLVANDKSGKNYDNPNSYQYGTTGAGDDFSIMYPSKSGQT
FT                   NYFQLSVEWFTGDIITWHDDGQPTSKANGYLYTADALSVNAMSRPDGGVGYTSDTKLDP
FT                   GGSNDFGYGLKVTASMHAQQNAIHQAFITFTKNTARLSGGAFGSNGVVDFVKVYDVNWS
FT                   KVSSVGTSKNLAGSKWVLAANAGSGPHNLDFGNVANCSADDSGSLTPSEGVWCFVPTDT
FT                   TDSYYAAFKGKYVTIVSDNGILDKNNANGQFRVKGLRVGTYLMKEYQAPDWYEQSGKTY
FT                   TFTIIADTQVTISVYEDDGKDTGAVNGNAIANKPYGAVSWGKVDSTDQLTVLAGSKWKL
FT                   QDANGNDIQGADNITDCTDQCSSSLDNPYHDVDSGEGTFRLTYLPLGTYRLVETKAPDG
FT                   YDLPDGATVYYTFTIKENDDRMNAKLYKADGVTEVTENKVPNDHTKGSVIWYKTDSTKE
FT                   GKGDDARLKGSEWSLTQTKDWNRDIATEERTVITVTDCSRDTGCSAASKDQAKEAGKFQ
FT                   LKDLDWGTYELVETKAPAGFYRSETIYTFVIDKDHTAPAEIQIKNGTDPVTGNIITNTP
FT                   VTVSSLPFTGTGSQTPRMFLPYVLGTVGAGLAVGLGLHVARRRMARQG"
FT   gene            633132..634952
FT                   /locus_tag="BDP_0535"
FT   CDS_pept        633132..634952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0535"
FT                   /product="Hypothetical sortase-anchored surface protein
FT                   with Cna protein B-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09206"
FT                   /db_xref="GOA:D2Q8S0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S0"
FT                   /protein_id="ADB09206.1"
FT                   /translation="MKKEGSETMTFRKLLAGVAAAATLLSGMAFGAGSAMAGEVEPATI
FT                   TLNGETGAVKGHTYKAVRIGSYDHASFVEKDDGVTYVESLTVNTEAAVATGATTALNAA
FT                   VAEGTTWNTGDYQDNPVGYVASESGYFTSSPNKPWSGNLRNFVSSLVRQADFQAVLATA
FT                   TAYTAGTDSDTLTISGLEEGLYVVVDTTVSNAENVDHTQTDSIPMLVGTKVSGKDFEGQ
FT                   TLGVVNVKNQTTYIDKVIVKNNKEWVGTTERVGDTVTFKLTSRVPLTVGYLNTDEKPYR
FT                   FSIGDTMSKGLTFQQVTSVTIGKKTLTEADDGATATADQYQLTTTANQKYDTTDTERKA
FT                   TSLKFDLSNAVYAAGQNAVDSKVDAKAEDTITVVYTAILNKDAVHAVNGANPNKVTLDY
FT                   THNPDDNTEHHVPGPEVKVYTYDFGFLKVKADGQTSLDGAKFVIKQGDQYFRFNTTTGL
FT                   WENGTKGADPVDADKFTGTDGVFEFKGLAEGTYDVVETDAPAGYLSTTKAKFQVVITST
FT                   NKDEDGNVRGTGHEIKFVNGNTGFNLLTNLNEDGTAKDGGAKVKNLKSITQLPLTGAAG
FT                   IAIFGVMAALVIGAGLAVGMKRRGIASRLA"
FT   gene            635080..636123
FT                   /locus_tag="BDP_0536"
FT   CDS_pept        635080..636123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0536"
FT                   /product="Sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09207"
FT                   /db_xref="GOA:D2Q8S1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S1"
FT                   /protein_id="ADB09207.1"
FT                   /translation="MAQQEPVRRYDTLSFDEALDVSDVMRERRTLRRISQVLAVLTVLL
FT                   IGGGLLLGAYPLALQWKSSRELASQSEQVSEKVDGWPFPQARDQLRAATEYNAKLAASG
FT                   QPVLGEAVDPFDIANGSSQASSQSDSKASKDAEYQSLLDTGNGVMGAVEIPKIDVDLPI
FT                   YHGTGEDQLAMGVGHLYGTSLPVGGTSTHTVITGHRGLVRSPMFTRLDEMVKGDFIYLK
FT                   VMGETLAYQVDDISVIKPDDTSKLRVVDGQDRITLMTCTPYGVNTHRLLVSGHRVDIPE
FT                   PAPDPTDLHDWRTIGIWSCAGILTVGWLLVWLVGRLRHGVWRRMRHATRIYVRIQRSGR
FT                   QASAKHR"
FT   gene            636133..636564
FT                   /locus_tag="BDP_0537"
FT   CDS_pept        636133..636564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09208"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S2"
FT                   /protein_id="ADB09208.1"
FT                   /translation="MSKDFTRKEVEYLRSVPAVKKVAKNRITYARAFQLYCMARYLRGD
FT                   GPTAIFRSVGLDPDVVGRKRIERCIARWKQDEQLMAEAQQMNPDAAPDVRDRIILVQCS
FT                   QIKELTQQLSELQKRLADLIYEVNAQDAGALPTDDSDSL"
FT   gene            636761..637912
FT                   /gene="fucO"
FT                   /locus_tag="BDP_0538"
FT   CDS_pept        636761..637912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucO"
FT                   /locus_tag="BDP_0538"
FT                   /product="fucO Lactaldehyde reductase"
FT                   /EC_number="1.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09209"
FT                   /db_xref="GOA:D2Q8S3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S3"
FT                   /protein_id="ADB09209.1"
FT                   /translation="MVYRMIFNQTAYFGRGAIKEIPGVAKSHGFTKAFIVTDPVLLETG
FT                   TAKKVTDVLDEAGMPYEVFSNVKPNPPVECIQDGVAKFAASGADFLIGLGGGSPQDTCK
FT                   GIGIITANPEFSDVLSLEGVADTKNPSVPIFGVPTTAGTASETTINYVVTDTANKRKFV
FT                   AVDPHDIPIVAFVDPDLTDSMPRGLKVATGLDALTHAIEGYITPGAWSLSDCLSMQTIR
FT                   MIAKNLAKSADGDIPAGEQMAYASYITGMAYSNVGLGLVHGMAHPLGGRLGVAHGVANG
FT                   ILLAPVMEYNKDFTGEKYRDIADAFGVEDAYTGDLDKVREEAVQAVHQLTVDLKNPTTI
FT                   SEVGATEADLDALANDAFHDVCTPGNPRQATQEDILAIYKSLM"
FT   gene            complement(638112..639035)
FT                   /locus_tag="BDP_0541"
FT   CDS_pept        complement(638112..639035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0541"
FT                   /product="probable glycosyltransferase"
FT                   /EC_number="2.4.1.212"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09210"
FT                   /db_xref="GOA:D2Q8S4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S4"
FT                   /protein_id="ADB09210.1"
FT                   /translation="MLNVSIIIPAWNEAERINDCLLNATRQTVMPHEVIVVDNRSTDST
FT                   VAVVEQFMKDHPEAPVRLLHQDEEQGLIPTRDYGLNHATGDVLGRFDADCMIRPDWVEV
FT                   VAGIFTEDPEAMGATGPVMYYDMPSRHFGLRSDNSTRKRIYKADDGQPLLFGSNMALRA
FT                   SAWHAIAGEVCRDKSDVMHEDIDISLHLLGKDMKTVYCPRMIAGISARRMDTSPTSFLN
FT                   YMRRFKNTFNAHPQHSRKHKPEILITALYPVMHMLYPVWQKVLDTADINPAEAAWINEQ
FT                   MELAEQEGRELYDDTPTDEEWSEKHE"
FT   gene            639092..640591
FT                   /locus_tag="BDP_0542"
FT   CDS_pept        639092..640591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0542"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09211"
FT                   /db_xref="GOA:D2Q8S5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S5"
FT                   /protein_id="ADB09211.1"
FT                   /translation="MSERVRHMNETTDDTMAAEDTTNTATTMADDGQRWDLGTLFPAKG
FT                   DSRRPPEWLGRALLYIAIAIVVFSFCWRSWGQIAYLVMDIVVSLFLALAVEPVVVPLVK
FT                   HGWKRAFASLFALVLLAVILCTLFGLFGNMFVQQVIAMINGLPDLYKQICDFVSQYTNF
FT                   ELPEINSLGSEILKNIQTSWVTDFAGTALSTVSGLFSFLLNLMTIVMTTYYISAAGPKL
FT                   RRAACQWMAPAAQRRFLFVWTVSQGQISSFLFSRAILALLNATFTAICLEVLHVPYWLP
FT                   LALFCGVTSQFIPMLGTYIGGALPVLFAWGNRGIWYGIAVLAFICVYQQIENLIFAPKI
FT                   SQRTMNINDAVAFLAVLAFGSLFGALGAFLALPVTASIQTIFRTYTKRYDLVDSPLMND
FT                   PVPEKKSKVVEGAEAISERVLHHIPRAVQGSTAHVPISDEVRQLQEQAYNISPSDGSDE
FT                   ADDSQTVAIPKNALSAQGGRPLKGTADADDASDDNPRSRWR"
FT   gene            640592..641815
FT                   /locus_tag="BDP_0543"
FT   CDS_pept        640592..641815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0543"
FT                   /product="N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09212"
FT                   /db_xref="GOA:D2Q8S6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S6"
FT                   /protein_id="ADB09212.1"
FT                   /translation="MVLLSVLDIILIVVGGAGMVYQAVCILISLFTKPVRFPEAPMDKR
FT                   YAVLISARNEENVIGNLITCIQTQTYPKELIDIWLVADNCTDATAEVARGMGCHVIERF
FT                   DQRLIGKGYALTYLLDRMNESGASDPYDAFFVFDADNKLDRNYFEEMNKAFQSGFKILT
FT                   SYRNSVNLSDNWVSSGSALWFIRESRFLSASRMWLGNSCHVGGTGFMFSQEIMRRNNGW
FT                   KFHLLTEDLEFTMDSVLHGDRIGYCGTAILYDEQPVTFSQSWRQRLRWSKGFLQVFRYY
FT                   GPALIKRAIRERDFSAVDFTLLLCPFTVLGIARILLGLLFALCGFVTWQSQLNSLTGWT
FT                   SGIVMSVVGMMGLAALTIIVERDHVGATNKELFAYVLSFPIYMFSYVPISFQAVFSKAE
FT                   WKPIEHKG"
FT   gene            641963..642781
FT                   /locus_tag="BDP_0544"
FT   CDS_pept        641963..642781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0544"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /EC_number="3.6.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09213"
FT                   /db_xref="GOA:D2Q8S7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S7"
FT                   /protein_id="ADB09213.1"
FT                   /translation="MSLDNVSPSVGFAPAVPLDGSAAVSIRGLFKRFGQKVAVNGLSLD
FT                   IPVGSFYGLVGPNGAGKTTTLNMVTGLLVPDGGAAMILGRDVWRDLNAVKRSIGVMPQP
FT                   DQIFDRLTGLQLLVYAGMLRGMKRDESVKRANDLLGAFDLTGAANVMVADYSAGMTKKI
FT                   CLASAMIHSPRVLVLDEPFESVDPVSSANLRDILIEYASTGGTVIISSHVMALVEKMCT
FT                   HVAVINKGQVCAAGTVEQVAAGEDLEDRFLQLVGGRHAAARLSWLDGGAQ"
FT   gene            642778..644406
FT                   /locus_tag="BDP_0545"
FT   CDS_pept        642778..644406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0545"
FT                   /product="Conserved hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09214"
FT                   /db_xref="GOA:D2Q8S8"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S8"
FT                   /protein_id="ADB09214.1"
FT                   /translation="MNAVGTIMRLRWALMRATMRKSTMMLVSYIISAIFGAGAIVGSVA
FT                   LGLMLGPLIGGTDGMIWQILRMVMVLCGAFTTAIVIIVQIMYFGQGTAMNPQKFELYGI
FT                   DDHTLVSGLFLSGLTGLATIWGVLVMLGLVPIYQSAGAIGIVAGIVAVPLAIITMMVLS
FT                   KLVISLLTTLTNSSSGKSTISIITILLFVLLCQVPGMAMNSQDLDHFSLKPFMMVADVF
FT                   SWTPLGAAFQLPFDVVAGSWGFAALRLLILVATWVVCYLGCLWCLKKDRTIAGSTAHAV
FT                   SSKGIGLFSTMPDSPSGAISARLLTYLRRDPRQAPMMFMPLLFIVVFTIQSHGITAMVW
FT                   QSIIWAGLFLVLLEGNGLSYDGRGFTMEVISGVRGVDDRHGRVRVYMVMLIAYIAILMV
FT                   IVYAITGDWRSTEGLIMGLVFGCISLCLGFCGLGLAEVVSCVFMYPVPSISRPFSSPQG
FT                   RVGAQMLFPFLHMFGMILLLLPTGIVALALGLTGNWELYWLLAPVSLVNGIAALAIGTW
FT                   LGGKLLEARMPRILATLDSFASLQQ"
FT   gene            644442..645887
FT                   /locus_tag="BDP_0546"
FT   CDS_pept        644442..645887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0546"
FT                   /product="Conserved hypothetical secreted protein with
FT                   D-Ala-D-Ala carboxypeptidase 3 (S13) domain"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09215"
FT                   /db_xref="GOA:D2Q8S9"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8S9"
FT                   /protein_id="ADB09215.1"
FT                   /translation="MTRRAGAFQQRTIRRRVTVLLSVAVTAALCLGYVAGDLYDVLPGV
FT                   LTLNEVERATTAEPRTVMSASKVVGNLDSSIAVDATAARRLIDEFAATEGIGGDYSIAI
FT                   ADAKGEVVAESGIDETRVPASTMKTLTAYAVATTLDMGSTLATQTYVEQKQDGTANLVL
FT                   VGGGDMLLGAGNSDSAHVNGRAGLGTLASDTARALKQRGISEVTLRYDDSLFGDDRWPS
FT                   GIAELDTEHLYYAPVSSMAVDGARQWDGANPQNPDVFSTYPALSMQPALDAVQTFRQRL
FT                   EEQGITVQGDVEQGVAPAETSPIAQVQSASLSEIMAFMLRHSDNTLAEEFGRLLAIDRK
FT                   TGNSPAGAARAVKSVLEQAGISTNGLRMMNCSGLAEESKVTVRTLLEVQQRNLTAGTGA
FT                   AAAEGLSIVGFVGTAADRLNDASEAGLLRVKTGSLDGVTAMTGNVSRTRGGALTFAVIV
FT                   NDPDDMQAARDAIDTFIAGLPKL"
FT   gene            645894..646994
FT                   /locus_tag="BDP_0547"
FT   CDS_pept        645894..646994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0547"
FT                   /product="Putative lysidine synthetase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09216"
FT                   /db_xref="GOA:D2Q8T0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T0"
FT                   /protein_id="ADB09216.1"
FT                   /translation="MVYSPRLRKAIGHLNAALVDAGFGLQDARFARHGEHEPNADAPLI
FT                   MVACSGGRDSMALAAVCATVCASLGLRCGAIIIDHQLQNGSAEVAAKTARRCEALGLDP
FT                   VRVRAIEVHGNGQGLEAAAREARYAAIVEECSDAAAVLLAHTKNDQAETVLIGLLRSAG
FT                   LDAIAGMEGSFSRDGVTFLRPWLDVTREETTGICEDLGLEWWDDPTNGPDAIREDGLPP
FT                   NGPLPANYPLRSRVRHDLMPYLQRFAGGDVVSRLSIGAGLAQTDRDYLNKRAQEIAERA
FT                   VTFSEDQVRFSVGVLQSQHEAIRLRVIAHALGQAGIACSARHVRQIDRLITDWHGQHGV
FT                   ALPSGYSANRQKHVIRVCQDGGHANR"
FT   gene            646975..647544
FT                   /gene="hprT"
FT                   /locus_tag="BDP_0548"
FT   CDS_pept        646975..647544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BDP_0548"
FT                   /product="hprT Hypoxanthine-guanine
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09217"
FT                   /db_xref="GOA:D2Q8T1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T1"
FT                   /protein_id="ADB09217.1"
FT                   /translation="MGMRIADVQEDIDHELITKEQIEDIINRAAAQASEDYRGRNPLLV
FT                   CVLKGAVNTIAAFAQAMSIPVQMDFMSLSSYGSGTESSGTITVRQDLSTDVRGRHVLIV
FT                   EDIIDSGITLSWLVDELKRRGAASVEIFALLEKPARRKVDVDVKYKGYEIPDEFVVGFG
FT                   LDYDERYRNLDSIAVLKPAVYQGGQA"
FT   gene            647541..649607
FT                   /gene="ftsH"
FT                   /locus_tag="BDP_0549"
FT   CDS_pept        647541..649607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BDP_0549"
FT                   /product="ftsH Cell division protein"
FT                   /EC_number="3.6.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09218"
FT                   /db_xref="GOA:D2Q8T2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T2"
FT                   /protein_id="ADB09218.1"
FT                   /translation="MSFPSGQPPQNNGGNSNRPNNGNPFTNPFGHGNNDGGNGPRPFWQ
FT                   SPWLWVVVVALLAVTMFQLFAGTGSQTIDTKDGMQILNGGNVEYAQIVDNTQQVKLKLK
FT                   SDYSATDPTTGKVKNYGKNVQFYYTYAQSAAVVKAVQKADPTQGWTATMQQTSVWTYLI
FT                   TSILPFIIVFALFWFLMSRMGGAGGMFGMGGKKNSGKLLEGQTPTTKFSDVAGEDAAVQ
FT                   EVEEIKDFLKDPSRYKALGARIPRGVLLYGPPGTGKTLLARAIAGEAGVPFYSMAGSDF
FT                   VEMFVGLGASRVRDLFDEAKKNAPAIIFIDEIDAVGRKRGGSGMSGGHDEREQTLNQLL
FT                   VEMDGFNNDTNLIIIAATNRPDVLDPALLRPGRFDRQVAVEAPDLEGREAILKVHAKGK
FT                   PFVPDVDLHMIAVRTPGFTGADLANVLNEAALLCARAGAQLIDNRAIDEAIDRVQAGPK
FT                   RRSKGMALEELRNTAYHEGGHALVAAAMNDTDPVTKVTILPRGRALGYTAVMPTEDRYS
FT                   MSRNQLLDQMAYAMGGRTAEEVVFHDPTTGASNDIEKATNIARQMVLDYGFSSKLGAIK
FT                   WSDDEQGDLGSLNHKYSGRTAEIIDEEVLKLVETAHTEAWNVINENRDILDELVRQLLV
FT                   KETLNEKELAAIFANIKKAPKRDVWLSDNQRPDSDKPPVEIPESLKKSAGLTN"
FT   gene            649607..650245
FT                   /locus_tag="BDP_0550"
FT   CDS_pept        649607..650245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0550"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09219"
FT                   /db_xref="GOA:D2Q8T3"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T3"
FT                   /protein_id="ADB09219.1"
FT                   /translation="MSDTEAFDTMLDDKARAAHAAGPVGYDEEGVRQAVRLFLRSIGED
FT                   PDREGLLDTPNRIGRACRELFAGLGHGPEEVLKTKFKVDTDEMVLVRDIELFSVCEHHL
FT                   LPFHGVAHVGYIPSNGQVAGLSKLARLVELYARRPQVQERLTQQVADALMTGIEARGVI
FT                   VVTECDHMCMAMRGVKKPQSRTVTSAVRGCMRDAATRSEAMSLILSQHS"
FT   gene            650280..651158
FT                   /gene="folP"
FT                   /locus_tag="BDP_0551"
FT   CDS_pept        650280..651158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BDP_0551"
FT                   /product="folP Dihydropteroate synthase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09220"
FT                   /db_xref="GOA:D2Q8T4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T4"
FT                   /protein_id="ADB09220.1"
FT                   /translation="MVAQDMKAIHDSERTLVMGVLNITEDSFSDGGLWLDPAKAKAHGE
FT                   AMMKDGADIIDIGAESTRPGAKRVSEEDEKSRVLGAVDALVPEGAILSIDTTRASVASA
FT                   ALEHGAQIINDVSGGRLDAELPHVVADHPESLYIVQHWRGWLAGAAGNVPDADTSVYAN
FT                   GVLNDVYDELMAQVDAVLSVGVKPEQVIIDPGLGFSKPGIEHNLPLLAGLERFNATGHP
FT                   VLVGASRKRFIGAVLAAAGVSEPTMADRDNATAAISALSAEHGAWAVRVHDVARTRDAI
FT                   AIGSAWRAYSK"
FT   gene            651203..652663
FT                   /locus_tag="BDP_0552"
FT   CDS_pept        651203..652663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0552"
FT                   /product="Dihydroneopterin aldolase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09221"
FT                   /db_xref="GOA:D2Q8T5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T5"
FT                   /protein_id="ADB09221.1"
FT                   /translation="MDQIRLTGIRAAGKHGVLDFEHERAQTFVVDATLSLDLAPAGRSD
FT                   ALDDTVDYGAIAKGIVAIIEGEHADLIERLAARIADMILQYPAVQRAEVTVHKPNAPIV
FT                   VPFDDVSVTVERFRETGRAESADTHHAIIAMGGNQGDVLSTLRDAVRCIDGLDSTQVTG
FT                   ISPLYRTDAWGMPTGTPDFRNAVVSVNTKLTAPELLAGLQRIEASHGRVRTDHWTSRTL
FT                   DLDIIDFDGIVSDDPDLTLPHPRAWQRAFVLGPWLALDPDAELVGAHAGSVAQLLFESS
FT                   DREHINELAEDWMVADDAAASPVTGSCHEEPASLQTGSGQHRIESLARSRRAVISMDSP
FT                   STDAERRFRKAIVSIDGIPGNQVEGISPLYHVSQLDGKPDNMAAVMQISTRMGAAELIT
FT                   VLGSIETSVGGSLDLDLVDMEGVVSDEPNCQVPWPTARNHAAVLAPWLDMDPDARLGGD
FT                   PVSFLLAMAPDTSQVGLLTDNWIIGDTL"
FT   gene            652660..653214
FT                   /locus_tag="BDP_0553"
FT   CDS_pept        652660..653214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0553"
FT                   /product="Narrowly conserved hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09222"
FT                   /db_xref="GOA:D2Q8T6"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T6"
FT                   /protein_id="ADB09222.1"
FT                   /translation="MKARRTPWWHYVLAAMLGLLAGLGFAKYGEITGLPLVGAPWVVPV
FT                   VLIALGLMVLVLALQVHKYTTKDPLKRAQLKPLDPQKAFGTLVSCKAMGLAGAALTGWY
FT                   GGQILASLPHMEAEFYSQAVIECTVAAVACLIDMIIGIVGEWLCQLPPIDGPENPKIKE
FT                   AAQRQRYAAAATKSSHVQSSC"
FT   gene            complement(653251..654162)
FT                   /gene="tesB"
FT                   /locus_tag="BDP_0554"
FT   CDS_pept        complement(653251..654162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="BDP_0554"
FT                   /product="tesB Acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.27"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09223"
FT                   /db_xref="GOA:D2Q8T7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T7"
FT                   /protein_id="ADB09223.1"
FT                   /translation="MPQPEVTPLQRLTKVLKLGTPSTYRDHTYVNGESLYFPTGRVYGG
FT                   QVIAQSLIAASKTVDPSRLPNSIHGYFISAGDIHQDLLFDVENLRDGRSFSARRVNVTQ
FT                   AQGSILTAIASFQEHGQEGVEFADPMPEDVPDPETLTSAKEIMEPYAEQSSYAKYYAQK
FT                   SPFDIRHVTQTIMLGADTKSARRDSGKQMVWMRADGEVDVPQVMHRAMLAMGCDQVMLE
FT                   PVLRRAGLSIATPGISFASIDHSMWWYRDIDINQWHLYVQDTPTAAHGRGLGQAKVYTQ
FT                   DGTLVACMAQEAMIRVPQEDLR"
FT   gene            complement(654391..656067)
FT                   /locus_tag="BDP_0555"
FT   CDS_pept        complement(654391..656067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0555"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /EC_number="3.6.3.41"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09224"
FT                   /db_xref="GOA:D2Q8T8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T8"
FT                   /protein_id="ADB09224.1"
FT                   /translation="MAEFIYQMIKARKAYGDRVILDDVTLSFLPGAKIGVVGPNGMGKS
FT                   TLLKIMAGIDTVSNGEAYLTPGFTVGILQQEPPLDETKTVGENIKMAFGEIAEKVARFN
FT                   QIGEEMANPDADFDSLMEEMGKLQNDIDAANGWDLDSQLEQAMDALQCPDPDTPVTVCS
FT                   GGERRRVALCKLLLEAPDLLLLDEPTNHLDAESILWLEQFLHQYKGAVIAVTHDRYFMD
FT                   NVAEWICEVDRGHLYPYKGNYTTYLETKAKRMEIQGAKDAKLAKHLKNELDWVRSSPKA
FT                   RQAKNKARLERYDQMEQEARSNKKLDFSEIQIPAGPRLGSTVLEAEHIHKAFGDRVLID
FT                   DLSFTLPRNGIVGVIGPNGVGKSTLFKTIVGLEPLTSGSLKVGDTVQISYVDQNRAGLD
FT                   PNKNLWEAVSDGLDFIEVAGVEVPTRAYVASFGFKGSDQQKLTGVLSGGERNRLNLALT
FT                   LKQGGNLLLLDEPTNDLDVETLESLENALLAFPGCAVVISHDRWFLDRVATHILAWEGD
FT                   DENPAKWYWFEGNFQAYQENRVARLGEDAARPHRLHRKLTR"
FT   gene            complement(656242..657186)
FT                   /locus_tag="BDP_0556"
FT   CDS_pept        complement(656242..657186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0556"
FT                   /product="Conserved hypothetical secreted protein"
FT                   /EC_number="3.5.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09225"
FT                   /db_xref="GOA:D2Q8T9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8T9"
FT                   /protein_id="ADB09225.1"
FT                   /translation="MASKEILMDAVTIFNDFVNLVDSDDLPIEAVALADGERIVAERHF
FT                   TPDQSRNIYSHTKSYVSTAIGIAVEEGILSLDGKLVDAFPEYVPADAQPELGRITLRHL
FT                   LTMSSGFNHAYLMSPDRRGGVGAPDYLKYMFSRRIEVEPGGAFCYSSADSYLAGRMLER
FT                   ACGEHLGEYLHRTIFSRLEQGWPIWECDPQGHPIAGAGMFMTLADMLKLGQVYLNGGAW
FT                   HGTRVVGESWVSAASSQQIETPHDNIWTCGYGYQFWMSPYDGAYRADGAYGQITTVLPK
FT                   QGLVVAVQCPESGDFDNVMRPALHEHLFGPLTA"
FT   gene            complement(657357..657782)
FT                   /gene="fms"
FT                   /locus_tag="BDP_0557"
FT   CDS_pept        complement(657357..657782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fms"
FT                   /locus_tag="BDP_0557"
FT                   /product="fms Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09226"
FT                   /db_xref="GOA:D2Q8U0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U0"
FT                   /protein_id="ADB09226.1"
FT                   /translation="MQREIMTSIPFLEQPSRDAQNTDEDFAVAQDLKDTLDAHRNSCVG
FT                   MAANMIGVSKRIIAFVDEDFGGRIFIMFNPEITARDGAFDTSEGCLSLQGERHTVRHQR
FT                   IEVTYFDRKFRERHAAFTGFTAQIIQHEVDHCAGIII"
FT   gene            complement(657954..659435)
FT                   /locus_tag="BDP_0558"
FT   CDS_pept        complement(657954..659435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0558"
FT                   /product="Conserved hypothetical amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09227"
FT                   /db_xref="GOA:D2Q8U1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U1"
FT                   /protein_id="ADB09227.1"
FT                   /translation="MSKETSLKGLRFVGTDTSVDLEIEDGRIAKVNPSDDFSNTWVIPG
FT                   LWDRHTHFTQWSYTLGRLDLIEARSAEEALDMLREHLDARRAKGTLNPDQYVVGMRFRH
FT                   SLWADDAQPTLASIDAVTGNQPVALSSADMHCGWVNSAAAEKLGVHVDESGLVGELEWF
FT                   DAYCKLDKGPNAASELMGFLRNAELDAARKGVVGIRDYEMAENIGTWIDRFAQGLDGLR
FT                   VQAGVYPERLRQAIDDGWHTGDELPGSHGLGHVGAMKMISDGSLNTRSAYCSTPYSGVT
FT                   PETFGTLSYTPEQIESYMRLATEHGFDIACHAIGDKANTVVLDCAERTHAHGSIEHAQM
FT                   LKQSDIPRLAQLGLAASIQPQHAMDDRDVITRFWGNPTGVPYAFNALHEAGTKLLMGSD
FT                   APVAPLDPWLAISAAVFGTESSDREPFQPEQCLDFEHALASSTAQGRTDLRVGDNADLV
FT                   LLDRDPSIIDEPESMQAMPEHIVGTMLSGRWTYQR"
FT   gene            659574..660494
FT                   /locus_tag="BDP_0559"
FT   CDS_pept        659574..660494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0559"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09228"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U2"
FT                   /protein_id="ADB09228.1"
FT                   /translation="MGNGAQYSEELAMARARTVERCLAAQRRTGRQLVFALGTALDLQG
FT                   IERPRYPHGSGLADGLYAVIGSNGSRTVLRDVRLVLWPGPQNHVSAYLGRLRCTDPVTT
FT                   WAMHANRLEDEELVVLGDSMMRRNGRLKRAGLEDFQLYVDRLDDLERYADLKRTRAIRG
FT                   ITKMRRAIRLMREDTDSSQETRTRIALMRYGLPCPEVNHPIRIGRSSQMFLADMAYPDL
FT                   KVIVEYDGRHHASQWLADIKRREALEDEGWLYVQVTAENLADESSQEMLAERVAQRMSR
FT                   HSVKPVKLRDRMIVREIVDGRRKHG"
FT   gene            complement(660628..661908)
FT                   /gene="metY"
FT                   /locus_tag="BDP_0560"
FT   CDS_pept        complement(660628..661908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="BDP_0560"
FT                   /product="metY O-acetylhomoserine
FT                   aminocarboxypropyltransferase"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09229"
FT                   /db_xref="GOA:D2Q8U3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U3"
FT                   /protein_id="ADB09229.1"
FT                   /translation="MYENVDTTCVQGGYQPGNGESRTPPIIQATTFKYQSSEQMSRLFD
FT                   LSEAGYFYTRLQNPTNDTIAAKICEMEGGAAAMLTSSGQAANFFALFNICNNGDHIVAS
FT                   SAIYGGTFNLINVTMRKMGIECTFVSPECTEEELEEAFRPNTKAVFGESISNPALIVLD
FT                   FEKFASAAHRHGVPLIVDNTFPTPINCRPFEYGVDIVTHATTKYMDGHGSCVGGAIVDS
FT                   GDFDWMAHAEKFPGLTTPDESYHGVTYAKEFGKAAYITKATAQLMRDFGSTPAPISSWI
FT                   MGMHMESLGVRMERHCANALAVARWLDADSRISWVSYPGLEGDKYHALAEKYMPNGTCG
FT                   VISFGVPGGREKVSAFLDHLKMVSIATHVADARSCTLYPAGTTHRQLTDEQLEEAGVGI
FT                   DLVRLSCGIENAADIIADLDQALASIQ"
FT   gene            662132..663478
FT                   /locus_tag="BDP_0561"
FT   CDS_pept        662132..663478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0561"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09230"
FT                   /db_xref="GOA:D2Q8U4"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U4"
FT                   /protein_id="ADB09230.1"
FT                   /translation="MGLWDIDKIPYVGREKGPQEGLAFHYYDADKVVAGKKMKDWLRFG
FT                   VAWWHTFDQELVDPFGTGTSQRPWYGKYSNAMDQSLAKVDYAFEFFQKLGVEYFCFHDR
FT                   DIAPEGDTLRETDANLDKIVDKIEENMKSTGVKLLWNTSSLFTNPRFVSGASTSPFADI
FT                   YAYSGGQLKHSLEIAKRLGAENYVFWGGREGYENLWNTQMKREQEHMAKFFHMCHEYAQ
FT                   EIGLDAQFLIEPKAKEPTMHQYDFDASTAIAFLKTYDIDFMKLNLEGNHANLAGHTYQH
FT                   EIRTAREAGVLGSLDANQGDKLIGWDMDEFPTDLYETSTVMWEVLAAGQIGPHGGLNFD
FT                   AKPRRTSFYAEDLFRSHIAGMDSFAAGLLVAAKMHEDKFIENLQAERYSSYDSGIGATI
FT                   EDGTATLASLEEYALDIPQAKLIEATKSDHLESVKATINNYMVEALAEA"
FT   gene            663726..664754
FT                   /locus_tag="BDP_0562"
FT   CDS_pept        663726..664754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0562"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09231"
FT                   /db_xref="GOA:D2Q8U5"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U5"
FT                   /protein_id="ADB09231.1"
FT                   /translation="MTIAATTITNPILSGMYPDPSWIWDDLRGQVVLVNSSFECVPGLP
FT                   IHVSEDLSHWSHVADAIDADMARRLLIPFVEDSGGVYAPTLRSIAGKYVIASTVARIDM
FT                   DKAIAAGCARSELDDAIRSAGNFIIEADAIEGPWRGPFWISGAEGIDPDVFEDRDGNVY
FT                   WTQTRPAIHPQWEGQTEIWTQRIDADSWSLLEDGAPAGRGKTIIWRGYGMEAVWAEGPH
FT                   LYRIGDYVYLLTAEGGTGFEHSEMAMRMYAPNGLAEAFAKYERMAVEVGERIPSVREGE
FT                   RCYLGNAIRAFHVDRKNPILTHRHWGMSEPVQCVGHADLLQHPQFGWWMMAGFWPNSMR
FT                   GS"
FT   gene            complement(664855..665883)
FT                   /locus_tag="BDP_0563"
FT   CDS_pept        complement(664855..665883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0563"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09232"
FT                   /db_xref="GOA:D2Q8U6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U6"
FT                   /protein_id="ADB09232.1"
FT                   /translation="MVRKATEHGKQSIRLADIAKETGYSLATVSKALNGRADVSEATRR
FT                   TINAVLKKYGYSRKATTGKKQKLIEIVFQDFDNVWALEVMRGAIREAKLHDLSVITTEG
FT                   GDRRHPDSTWIDNMLRRQIAGAILVFSNLTRIERNKLHSRGIPFVLFDPFGDPDPATLS
FT                   VQADNWTGGVIATRHLLALGHQRIGIITGPEEMMCSKARLDGYTSALAEHGISADPELI
FT                   TEGDFTTPGGYAQAISLLENPHRPTAIFAGSDLQAMGVYEAARQLGLRIPEDLSVVGFD
FT                   DVQTASFLGPALTTVKQPLQDMARASVRMLVEALTTDDVLQPHVIMPTSLVVRNSTQQL
FT                   NQ"
FT   gene            666250..667530
FT                   /locus_tag="BDP_0565"
FT   CDS_pept        666250..667530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0565"
FT                   /product="Solute-binding protein of ABC transporter
FT                   system(lactose)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09233"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U7"
FT                   /protein_id="ADB09233.1"
FT                   /translation="MKFKTAAAAALAVATILGMGACGSTDSSSGGKTEIVVWENSTTGD
FT                   GKKFWEDAAAAYEKKNPNVHIKIEAIQNEDMDGKLQTALQDPDSAPDVFLARGGQKLRD
FT                   VVEAGQAMDLTDKISDTVKTQMKTALAADTIDGKIYGVPQSVLPGGIWYSKDLFAKAGI
FT                   TEVPTTWSEFATAVQKLKDAGITPIAVGGKDAWPAAHWWYWFALRECSADTFEKAQSTK
FT                   DFSDSCWTRTGDDVQKLLDLDAFNDGFLTTSAQQGASSSAGLLANHMAAMELMGGWEPG
FT                   VVRDLTPDKKDMADLGYFAFPTVEGGQGDPSAIMGGSDGMTVGAWAPEEAVDFLNFISE
FT                   KEWQEKFAKAFATIPASKEAQDAVTSDALKQVLSVYDNASSVSMWLDTVFGQNIGNALN
FT                   EGVVNMMAGKGSAEDIVKGVEKAAAKG"
FT   gene            667680..668597
FT                   /locus_tag="BDP_0566"
FT   CDS_pept        667680..668597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0566"
FT                   /product="Permease protein of ABC transporter system for
FT                   sugars"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09234"
FT                   /db_xref="GOA:D2Q8U8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U8"
FT                   /protein_id="ADB09234.1"
FT                   /translation="MLSIPALVMFLGFVILPVIMAAYYGFFRWKGYGKPQVNGQFVGFE
FT                   NYKIILTDPNFQEALGHTLFVVVASLVIQGPLAILFALLLNQKFKGRALIRTLIFVPYV
FT                   VSEVIVGTGWSLMLQPTGAVNAVLAKFGISGADWIADPKIAIWTLMFIISWKYIGFAVI
FT                   LMIAGMQSIPEDLYEAAKVDGAGFWRQQWSITLPLLGPTIRMWAFMSIIGSLQLFDLVY
FT                   IIWGQYVSSTAGTSTMATYMVREGRLANNYGYGSAVAVVIFVISLVIALTYQHIVMNRD
FT                   LDGALTDGKRGKRSHGTIVTSEVA"
FT   gene            668600..669496
FT                   /locus_tag="BDP_0567"
FT   CDS_pept        668600..669496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0567"
FT                   /product="Sugar-binding protein of ABC transporter system,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09235"
FT                   /db_xref="GOA:D2Q8U9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8U9"
FT                   /protein_id="ADB09235.1"
FT                   /translation="MTTVSQTSGPNARGDTHDPYALRKSSKTPWGHPIVYVLSLVLVLI
FT                   CVTPVVYIIIGGFRTNSQITRDPAGMPNPWNFENYKTVFASNTFWSELVNSLIVSLGTM
FT                   VGVVALALMVSFVIARYRFRLNKALYSLFAAGMMFPITVAITPLYLLLRNLHLINSHLG
FT                   IVLPQIAFGLPQAIIIMVPFLKSIPLELEEAAELDGCSRLGFFFRMVLPLSGPGVATVA
FT                   ILTFVSSWNAYMLPLFLLNDSSKYTLPLGVQMFSSQHSVDTAQVLAFTSLSMIPALICF
FT                   TIFQKKIVGGLAGAVKG"
FT   gene            669519..671150
FT                   /locus_tag="BDP_0568"
FT   CDS_pept        669519..671150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0568"
FT                   /product="beta-1,4-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09236"
FT                   /db_xref="GOA:D2Q8V0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V0"
FT                   /protein_id="ADB09236.1"
FT                   /translation="MQISNPVLTGFHADPSMIRVGDTYYIANSTFEWFPGVRLHESKDL
FT                   VHWNTLPSPLSRVSQLDMKGNPSSGGIWAPDLSYADGRFWLIYTDVKVVNGAFKDCVNY
FT                   LVTADDIRGPWSDPIRINGVGFDSSLFHDDDGRKYLVQQTWDFREYHHSFNGITLTEFD
FT                   VDAMRLKPETARTIWDGTAVKVVEGPHLYRKDGWYYLFAAEGGTQYEHQESVARSRTLD
FT                   DHSFEAMPDGPFIGNYDTPDFYLQKQGHGALVDTPSGEWYYASLCGRPWRHATEPSHGV
FT                   RGWCTLGRETSIQKVEWDEDGWPRVVGGRAGQRYVDAPKDAIETAAPLSRDEHDEFESD
FT                   MLGVNWNTVRVPFTEAMGRVGGGKLTLRGQGSLCNAFEQSMVARRWQAFDFDAETKVRF
FT                   DPNNYMQMAGLTNYYDDLCWSWAFVTWDEGRGTRVIEVAQNDFNQYTSFLKDNAIEVPR
FT                   DAEAVWLRTKVRTEYYSYEYSFDGEHFTEIPVRLDAKILSDDYVVQRYGGFFTGAFVGL
FT                   ACVDLSGYGLTAEFDYFDYKELPDCE"
FT   gene            671282..671911
FT                   /gene="lacA"
FT                   /locus_tag="BDP_0569"
FT   CDS_pept        671282..671911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="BDP_0569"
FT                   /product="lacA Galactoside O-acetyltransferase"
FT                   /EC_number="2.3.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09237"
FT                   /db_xref="GOA:D2Q8V1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V1"
FT                   /protein_id="ADB09237.1"
FT                   /translation="MARDAEALINSDEELSRLFGGRPTQYRKSKSLPKYTGEAARVCAR
FT                   INRIFFDDPGEAYRLFHELIPEAGEGVEFTPPFTVDYGIGLRIGRDTFINKDFMICGGG
FT                   YVTIGENCLIGPRCTIATPNHAKDAATRLAGWECASPVTIGSNVWFGANVTVTPGVTIG
FT                   SNSIIGAGSVVTHDIPENSIAVGNPARVIREIPDHDPAFREVEGII"
FT   gene            672278..673393
FT                   /locus_tag="BDP_0570"
FT   CDS_pept        672278..673393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0570"
FT                   /product="ABC transporter (substrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09238"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V2"
FT                   /protein_id="ADB09238.1"
FT                   /translation="MNKWTKAIAAVAATAMLIPLTACGSSRSSNSGSSSSKDASDVNIG
FT                   ISMPEQMLERWKIDGSNLKKQLEGYGYKVTLQYADGKTDLQTSQIQNMANNGMDYVVVA
FT                   SIDGTSTGAACEQAQSNGAKIIAYDRLIMNTDAVDYYATFSLEEVGKMQGEYIEKALGL
FT                   KDGKKGPFNVELMAGSPTDNNAGYYFKGAWSVLGKYYKSGVLQAKSGKVPADETEWQSI
FT                   GIDNWDRQKAQNEMENRINSFYNDGTKLDAVLAQNDAEALGTVNAVEGAGWDYYPVITG
FT                   QDAEKANVQAIVKGKQSETVYKDTRELAKATAQMIKDLVDGKEPEAKDTFNNGTKDVPT
FT                   QLLTPVSVDKTNLKEVLVDGGYISAKDAGLE"
FT   gene            673510..675078
FT                   /gene="rbsA1"
FT                   /locus_tag="BDP_0571"
FT   CDS_pept        673510..675078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA1"
FT                   /locus_tag="BDP_0571"
FT                   /product="rbsA1 Ribose transport ATP-binding protein rbsA"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09239"
FT                   /db_xref="GOA:D2Q8V3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V3"
FT                   /protein_id="ADB09239.1"
FT                   /translation="MATNNDVILQMNHIVKRFGPVTALKDVNITVKRGQIFSICGENGA
FT                   GKSTLMNVLSGVYPYGTYEGDIVYDGETCKFKTIRDSESKGIVIIHQELALVPYMSIQE
FT                   NIFLGNQIKKGIAIDTDAQRKEALRVMNLVGLNENPDTLIANIGVGKQQLVEIAKALTK
FT                   DVRLLILDEPTAALNDEDSFKLLDLIDQLRKEHGITAIIISHKLNEIAASADAVQVIRD
FT                   GQTISHIDIDAEHPLDQDALIRDMVGRPLTNRYPDHQSHIGAEMFRIENWRCHHPLDEN
FT                   RLVSKDVCMNVRKGEIVGVAGLVGAGRTETMMSMFGHQYGTHATGTLYLEGKEVHFPSV
FT                   RSAIDNGVAYATEDRKVYGLNLMDTIRGNTSLASLKALSRFGVIDETQEKKVAEKYRTE
FT                   FRTKAPTIEMPSGNLSGGNQQKVVLAKWVATNPKVLILDEPTRGIDVGAKYDIYEIIDQ
FT                   LADAGSAVIVVSSELPELLGICDRIYTMCNGTITANVDAKSTNQEELMRYMTAEVPIDP
FT                   SKVYA"
FT   gene            675149..676378
FT                   /gene="rbsC1"
FT                   /locus_tag="BDP_0572"
FT   CDS_pept        675149..676378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC1"
FT                   /locus_tag="BDP_0572"
FT                   /product="rbsC1 Ribose transport system permease protein
FT                   rbsC"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09240"
FT                   /db_xref="GOA:D2Q8V4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V4"
FT                   /protein_id="ADB09240.1"
FT                   /translation="MSAANSAAVKKGDDKVETQSLKELLLGNARSYGIFFALVVVIIVF
FT                   QILTGGRLLNPNNVVALFQQNAYVLIAAIGMLMVIIATHIDLSVGSVVAFIGGVGALAM
FT                   KNWGLNWFLAIVLMIVIGLAIGAWHGFWVAYVGVPGFVTTLGGMLIFRGLATVVAGESI
FT                   PVSDPTFRAISKDYLPNVLGFWGDFSSNAIIVGVVAIVLVIWMQLHKRNNAIKNGLPVQ
FT                   PMSFVVLKLVIAVAAIAYVTYLLACSGNATQGGIPIVMLIIGVLIGVYWFALNRTVYGR
FT                   NVYAVGGNRKAAILSGIDTKATDFKIFLNMGFLTSIAAVITLSRLASATAQTGMEFEMD
FT                   AIAACFIGGTAVTGGIGTIPGAMVGALIMGVLNQGLSIMGVDAAWVKTIKGLVVIAAVA
FT                   YDLVSKRKKG"
FT   gene            complement(676491..676820)
FT                   /locus_tag="BDP_0573"
FT   CDS_pept        complement(676491..676820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0573"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09241"
FT                   /db_xref="GOA:D2Q8V5"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V5"
FT                   /protein_id="ADB09241.1"
FT                   /translation="MTSPLSIAMAVVLGIICLASGLLLGAMPMQNSKMTERQRRVSSLL
FT                   CFIIAIVYIVLLFSGQDLATWTMLGGIFAGFGIGKIPPVHNFLVSKWDFLKPYEPKKSK
FT                   QRRRK"
FT   gene            complement(676845..677081)
FT                   /locus_tag="BDP_0574"
FT   CDS_pept        complement(676845..677081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0574"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09242"
FT                   /db_xref="GOA:D2Q8V6"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V6"
FT                   /protein_id="ADB09242.1"
FT                   /translation="MRLYALTCIACIAWLAQSVTSALKDGTLTTAPSIILIICIAVAVL
FT                   YTGFNAAQLWIAQGRQHDESKSEESDESSDDAE"
FT   gene            complement(677201..678721)
FT                   /locus_tag="BDP_0575"
FT   CDS_pept        complement(677201..678721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0575"
FT                   /product="xylulose kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09243"
FT                   /db_xref="GOA:D2Q8V7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V7"
FT                   /protein_id="ADB09243.1"
FT                   /translation="MTRKLVAGVDTSTQSCKVRVTDAETGELVRFGQAKHPNGTSIDPS
FT                   YWWDAFLQAAEQAGGLDDVEALAVGGQQHGMVILDRQGNVIRDAMLWNDVSSAPQAAAL
FT                   IEKMGAAPAVDGEPEDPIARGKQRWVKAVGSSPVASYTLTKVAWVAENEPENAKKIAAV
FT                   CLPHDWLSWRIAGYGPVAEGEDAHLDALFTDRSDASGTIYYDAASGEYRRDLIAMVLEP
FT                   AEGDQSAKAHADAIVLPTVLGPRDAAAVKASPAIAGGDVDGGCLIAPGGGDNAMASLGL
FT                   GMAVGDVSVSLGTSGVAAAISENPTYDLTGAVSGFADCTGHYLPLACTINGSRILDAGR
FT                   AALGVDYDELAKLAFASEPGAGGITLVPYFDGERTPNRPDATATLSGLTLANTTKENMA
FT                   RAFVEGLLCSQRDCLELIRSLGAEIKRILLIGGGAKSEAIRTLAPSIFGMDVTRPATDE
FT                   YVAIGAARQAAWVLSGETEPPAWKLTIDGVETGEPTPAVYEAYAKARG"
FT   misc_feature    678877..697366
FT                   /note="Bdent1; attR/attL site"
FT   gene            678877..680109
FT                   /locus_tag="BDP_0576"
FT   CDS_pept        678877..680109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0576"
FT                   /product="NagC/XylR-type transciptional regulator"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09244"
FT                   /db_xref="GOA:D2Q8V8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V8"
FT                   /protein_id="ADB09244.1"
FT                   /translation="MSMTSLRRINQDDLRNHNLSVVLDSLLRATDQLSRADLAKETGLT
FT                   KATMSVLVSLLMDNGVLEEGVPTGQSLYGRPSIPLLIRGGRLCGIGLQVNTDGYGIAVL
FT                   DINGTTVDEQWVDADMTNANADEVFRNLDELAKSQEASLDRMGYTLVGSGLALPGLVTD
FT                   DLRLLGARNLGWEHLDLKTFDVVRRLNPKVDNEANAAALAQIPGYATQRRGIGLVEPTD
FT                   SFIYLSTDVGIGGAVVRDGHVVRGDHGFGGELGHVSVDMRGPICRCGRRGCLEVYAGRR
FT                   SMVSAAGIASSDAAATRESINELIDHWRQRDSKAVAVVEKALEAMASVIASIINVCDID
FT                   TVMLGGLWAHFEPDLIRRIGRMVRPQALSYPEVQARVMMADVVARPALIGAAEVGLRNF
FT                   VDNPLEFLERE"
FT   gene            681010..681147
FT                   /locus_tag="BDP_0578"
FT   CDS_pept        681010..681147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09245"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8V9"
FT                   /protein_id="ADB09245.1"
FT                   /translation="MDVDEGESVDVSVSVSGSLTTDRADWLAHALRLAADHLDVLRRAV
FT                   "
FT   gene            complement(681148..681639)
FT                   /locus_tag="BDP_0579"
FT   CDS_pept        complement(681148..681639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09246"
FT                   /db_xref="GOA:D2Q8W0"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W0"
FT                   /protein_id="ADB09246.1"
FT                   /translation="MGIDLGSVAEWVAAIAAVAAVVVAGIALWHSSRIDELNSRLLHRQ
FT                   IGAEYVYWHVHADRENKRFVFRNIGTSTAHDVTAHVFIEGTEHIESQQLGDCGNGETLV
FT                   MPSTTFLTERTGVVSQYYAMYAYNRAIKADTNPMTVQVLVEWRDSLGFNDHQQIGIRYH
FT                   "
FT   gene            681757..681867
FT                   /locus_tag="BDP_0580"
FT   CDS_pept        681757..681867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09247"
FT                   /db_xref="GOA:D2Q8W1"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W1"
FT                   /protein_id="ADB09247.1"
FT                   /translation="MEISVAGACLSAFTGLYWLAVAFGIAAMAAGRIEGR"
FT   gene            681912..682016
FT                   /locus_tag="BDP_0581"
FT   CDS_pept        681912..682016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09248"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W2"
FT                   /protein_id="ADB09248.1"
FT                   /translation="MIVETDRGVTIRLPLTGVELEELERRIERCFSEV"
FT   gene            682570..682809
FT                   /locus_tag="BDP_0582"
FT   CDS_pept        682570..682809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0582"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09249"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W3"
FT                   /protein_id="ADB09249.1"
FT                   /translation="MIDSNLRSHANTSRRSLAKASGLDDNQVQAALRLAYESRGGRVPS
FT                   PVYRSPTAGKMYDSESLLRTLALWCGMWAYVIAD"
FT   gene            682826..683167
FT                   /locus_tag="BDP_0583"
FT   CDS_pept        682826..683167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09250"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W4"
FT                   /protein_id="ADB09250.1"
FT                   /translation="MLHYSAPADDPEAVERMAWHQRQLLKHFADEVDRVAANNGKTDLE
FT                   VWQLVKSFNEPNAVAIICLKADGLPLYRKGGWYLDSRDFRAWATAWRPATWKPERRQQQ
FT                   TKPVKGILF"
FT   gene            683208..683426
FT                   /locus_tag="BDP_0584"
FT   CDS_pept        683208..683426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0584"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09251"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W5"
FT                   /protein_id="ADB09251.1"
FT                   /translation="MTRIAMLTTAQTAERLGVSERTLKRWRGDIPVFGPPPIRLGGRVM
FT                   YAEADVNGWLLRQRGKGRDGDAKKTDR"
FT   gene            683404..684117
FT                   /locus_tag="BDP_0585"
FT   CDS_pept        683404..684117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0585"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09252"
FT                   /db_xref="GOA:D2Q8W6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W6"
FT                   /protein_id="ADB09252.1"
FT                   /translation="MPRRQTVDPLIRAQVIAAWGNQCWLGMPGCRITATEDDHIIPYAH
FT                   GGKDTVTNLRRACKHCNAARQDRVLSGYGATLHAVIGPPRADFTGYLTGLVGRDSVVVS
FT                   FDSLIRDIYPLPDPPDGVRLAAAMAWDGAYRALAKCGQPLDIWLVRTLPRSRRHPDMLG
FT                   EWLALDYDIHVVETPAEATFDLDLTPREYRAAQQWYAMRITQRMVDARALQRRQRLASL
FT                   GLRASDGQTAGRPTW"
FT   gene            684310..684561
FT                   /locus_tag="BDP_0586"
FT   CDS_pept        684310..684561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0586"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09253"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W7"
FT                   /protein_id="ADB09253.1"
FT                   /translation="MNLIKSFVEGKTLTPEATYICKSMLSIARNIDAQNSRGREISRNM
FT                   TSLLTWFQELKAMYPEQPQLDDELAGFLRAAKAGTEDK"
FT   gene            684564..686006
FT                   /locus_tag="BDP_0587"
FT   CDS_pept        684564..686006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0587"
FT                   /product="gp26"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09254"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W8"
FT                   /protein_id="ADB09254.1"
FT                   /translation="MPLRGGTERHAGRPTDGAVVARTAELLGKPLLPWQRYVADVAGEI
FT                   DPATGTYYYDRVILSTPRQCGKSTLIDTEDTRNAQLGPDRKIYYLAQTGKDAEKHFKDY
FT                   VQQLAKSRLAPIACRPRLSNGGMEQRFINGSFICPLAVTKVAGHGTQMDKFTIDEAFSL
FT                   DDETGKLILDGMAPTMNTRLHFTGVQPQIWITSTEGTADSTFLNGLLDGLRAGDVPRRT
FT                   CWFDFGIPADADPEDLQTILKWHPAAGLLWGLDQLRDFRGQFEGNAAGWARAFGNRRDT
FT                   GVADRVIDETLWQATVATPIGPDRLDGRPLVFAAAVDVDATHTSLAAGIRDADGTVTVQ
FT                   LLQVLDGTGRAPGEIMRLCERYKAPLVMDDRGPNADLHDRLRSQADDVGEPVIQFVPMQ
FT                   AGDYLAIGQAFVSGLHNRLIRHATDMQLDESAAQCARTWSGDAWRVTRRGSTGLTSPLE
FT                   ACMLAAWGVNHRPDTDTDLQIY"
FT   gene            686134..687225
FT                   /locus_tag="BDP_0588"
FT   CDS_pept        686134..687225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0588"
FT                   /product="phage-related portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09255"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8W9"
FT                   /protein_id="ADB09255.1"
FT                   /translation="MLTRGGDDVDMPDGVRPPACSTTYEPLQLSTVFRGVQVLQTAIAG
FT                   LPVYEMRNGVKLPDVSALVAQPDVTRSRRDFLADLVASLVLDGNAFTRLIRLDGEIVTC
FT                   EILPPQYVTVTDLGKDPASPDLRYGYLGRTYGPDDIVHSKFLNVPGRLRGLGPISAARE
FT                   EVEAAQMARDYKTRFYSDGSNLKGYLHTKKPVSEEAAKRAKAAWKTDGGAGDVKVIGDD
FT                   LEYVPLDLKPADLQFLETQKFDTTQIARLLGIPASIMLAAVDGSNLTYSNIEQSWIEFA
FT                   DYTLAAYAGEIEEVFNRLLPRGRTAEFDWDSSQRANMSDRYNAYKTAIEAGFLTVNDVR
FT                   GKIRMPSLSADESARIGAKHEQA"
FT   gene            687296..688774
FT                   /locus_tag="BDP_0589"
FT   CDS_pept        687296..688774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0589"
FT                   /product="prohead peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09256"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X0"
FT                   /protein_id="ADB09256.1"
FT                   /translation="MPYGDVIDTWDGPETFDRDCVFDDLDQAKLCYQHGEVIGRIIGGE
FT                   SREDGLHITARVSDTAKGRDAVTLVRDGVLDSFSVGFIPIESERDKAGITHRRRVRLLE
FT                   TSIVSWPAYQNARLTGQRDSDALKETKETRKETTMDDNEMMDLLKSMQDEQRGLKAAIA
FT                   KTAGGRETPRIVGGEYRSRGEYLQALARGDEAAAKIMEECRDLIVTGDTGDTATWIADD
FT                   LRLITERRKVSNLLTHDSLPATGMSMEYHVVTSDTTVADKQANEGDALTFGKLTFGTKS
FT                   ADINTYGGYTSLSRQVIERSTTPMLNTALRALQNAYAKVTEKAVRDHLYGEIKTQRDGT
FT                   NHIDTAKTLANMGINDWVGLIVDAAEMADDRNVALTRLAVSKDVLKALVGLKDTGDRFF
FT                   NLSGDGSDTIGSFDLTGVAGEFMRVPVVMLPKAEAGTAAFIDPASVTVWESGGPTQLTD
FT                   GSVTKLTNDYSVYGYLSVATTLADGLIPVKFAAA"
FT   gene            688819..689100
FT                   /locus_tag="BDP_0590"
FT   CDS_pept        688819..689100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0590"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09257"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X1"
FT                   /protein_id="ADB09257.1"
FT                   /translation="MPAGDDDRLTVKLTAAQRYVAAAVVGTQVEDELLADCIVACAADL
FT                   FNMRDARLGVMQVSDTTVEPFRISTDPLRSVWPKLKAAGILTGGMVIA"
FT   gene            689151..689486
FT                   /locus_tag="BDP_0591"
FT   CDS_pept        689151..689486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0591"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09258"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X2"
FT                   /protein_id="ADB09258.1"
FT                   /translation="MLDDLVSSVSTDSALVHPQPGKVAIYVEPPYVEYPTWDGVPDITW
FT                   TLDLVAGTPATQATALDDIIDAIDRLAAKGLNVNKAQPVGWNLAGAGTLAAYQVTLNPL
FT                   EIIETEE"
FT   gene            689501..689914
FT                   /locus_tag="BDP_0592"
FT   CDS_pept        689501..689914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X3"
FT                   /protein_id="ADB09259.1"
FT                   /translation="MTGKIRTLGPGIFKITDAANGHDFSADLTKAQLNPSNSSDDPTKY
FT                   LDGSEETNTSTTWTFEGTVGDDFSENGVSVWLFDHAGQTLAAEFVPNKDGKVKWTFNVT
FT                   ITPVAVGGDVKSKNTNDLSLPATNVAHAAYTKV"
FT   gene            689960..690301
FT                   /locus_tag="BDP_0593"
FT   CDS_pept        689960..690301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0593"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09260"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X4"
FT                   /protein_id="ADB09260.1"
FT                   /translation="MQTMRKAGADMDDLKGVNAQAAETALPAVRSLVPHGATGRLAASL
FT                   RTGATRRAGVIRAGRKAVPYAGPINYGWPAHHISPRLFVNTGVAQSEPQWQRLYLDFIN
FT                   RTLSRIQGA"
FT   gene            690305..690595
FT                   /locus_tag="BDP_0594"
FT   CDS_pept        690305..690595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0594"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09261"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X5"
FT                   /protein_id="ADB09261.1"
FT                   /translation="MANAKITYTDGSEDIVPVTMRATCKAEAHALEEGWGTVQQSPVRC
FT                   GAYAAYAALRMAGRSVPPFDKWLDGVERLDMLAAAPRNDDVEDTDHANPTD"
FT   gene            690761..692623
FT                   /locus_tag="BDP_0595"
FT   CDS_pept        690761..692623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0595"
FT                   /product="phage tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09262"
FT                   /db_xref="GOA:D2Q8X6"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X6"
FT                   /protein_id="ADB09262.1"
FT                   /translation="MGRSAIMSVRITGNADDAVKALERTTTKAAAFGSALGGLAVKGVT
FT                   ALWDTVKGFTSDVIAMSDGTDKFMNTMSFAGIDSSAVTAAAQAARKYADDTVYDLSTIQ
FT                   NTTAQLAANGIGNYTELTEAAGNLNAVAGGNADTFRSVAMMLTQTAGAGKLTTENWNQL
FT                   ADAIPGASGKLQEALLKNGAYTGNFRDAMADGQITADEFNQALLDLGMTDVAKQAATST
FT                   QTIEGAMGNLEAAVTGGLTDAFNLFKPTVTGAINTASGLVTDLATSGVANLQTFFNQVK
FT                   DTGAFDRLIAAGKSVGEGFKSLFDGVSAVASAMTGGQPAGTSFGNMLDTLAGAAATVGG
FT                   WLKTAGDWISRNTDLVTPLVAAIGGAVAVVTAVSTAMQAAAAAQALLNAVMAANPIMLL
FT                   VTAIAALVAGLVWFFTQTQTGRQIWSDFTAFISQCVTSIVGFFTSLGSSIGTAFTNAAN
FT                   GARNVWNGVVEWFGSIPGKIKGFFSNAGSILKDAGAAIINGFLNGLKGAWSNVTGWIGG
FT                   IGDWIKEHKGPPAYDAVLLTDNGRLIMQGFAKGLNQGFDTSVAAAIRRANGRLGKIDLH
FT                   MGTDGTAAGNTTIFNVTVQGEVLDKEGVAKAIRKLLDDYADRRR"
FT   gene            692635..694134
FT                   /locus_tag="BDP_0596"
FT   CDS_pept        692635..694134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0596"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09263"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X7"
FT                   /protein_id="ADB09263.1"
FT                   /translation="MLYVDRGQGWENLTGHAGSPAALSSFSIDWGSASPKEQPTVNVLH
FT                   FRLLDRTGMLAGNSTRLAGMKVLIQLSRRPAWRDLNEPSSWSRQADTLTWDGLHLAHRP
FT                   DPTEGPDPTALTIFTGNTATGGEIEQRADGTYLLDLYANAQLVRAGRTTQQGPVSTDAS
FT                   LTGLHWTGSAAQRVDEINRRLTTLGCPPLSDEAVTWLKTNAPTPAPYEADSHPDLSTIL
FT                   HSLAATHPDLPLYYERHRHGSENLDLVFAGRPAAITMHADGRLTVEGAGLEQEAAPADA
FT                   ITVDDTVLTMPAPICQVTLKTRAVKWDESGNRFAFEDDEVDITDRGRLPANLTETTAAA
FT                   TFSSDAITRDDSGGRWKGGVWAPTDTQRDQWAEWLAVQTLRLRPKSLTASSRRLDIDLF
FT                   EQALQPTASLWAFVSTRYTKLLSDDGTPATSGAWLATGGTLSFDWRDGMPVLSNELDVS
FT                   PLPMRPSTLSRWRDLEPIGIAWKDMPAFTWGEMSQITYFTD"
FT   gene            694180..695376
FT                   /locus_tag="BDP_0597"
FT   CDS_pept        694180..695376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0597"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09264"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X8"
FT                   /protein_id="ADB09264.1"
FT                   /translation="MPTTPRYGIRYPGATDLVRYASQQFKAMAESIDDKIDTLPASVTA
FT                   RVDQAATQAAASAQTAQAAAATAGTLADQNMAANLNNKDSKTSLALDKVLNNGPRWRNA
FT                   VIIGDSLCRGHYSSADHDGQGIGDVVCRILGIASVQNVAVSGSGFTVGGTNTFINQWNR
FT                   VTNKADVDLVLVIGGVNDNNNDCGAACTQLVNAIRTSAANARIYVFPVAGGLGLGLAGH
FT                   YTALHSINNAIIALPGQHRGVVLMQGCHRWGQMIAESQADGTIHMKKEGYEAWARIAAR
FT                   LMLSGQNTFWPEYARDLNVTSISGDPLFDQIQCKRFIEVNGTITLQIRAHTGRAIDTGF
FT                   TVFTADKYLCGDITTKYLQCGAGLDSYLTVESGGLKVQMAQLPKDKWVLIESSWIAGM"
FT   gene            695373..695621
FT                   /locus_tag="BDP_0598"
FT   CDS_pept        695373..695621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09265"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8X9"
FT                   /protein_id="ADB09265.1"
FT                   /translation="MTMTFDVLIALITTGGVIVGALLGFAGTSVRNRLDAYRIAQDMQQ
FT                   DNQKLWQWNRQLVDHIYKNLGPPPPRPPDDLFKHDND"
FT   gene            695634..696413
FT                   /locus_tag="BDP_0599"
FT   CDS_pept        695634..696413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0599"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09266"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y0"
FT                   /protein_id="ADB09266.1"
FT                   /translation="MADLNTLCARMRYWCQTANMGYSQTDRWHFDPAGGNCDCSSLVIH
FT                   CLQEAGFDTGSAGYTGDLSRNLTSRGWTRLPADGHPMAGDILLNDADHVAVYLGDGLLA
FT                   QASISETGGITGTAGDQTNGETNVSPYYDYPWDCYLRYEGETMPTAQEIAEAVWDFEQN
FT                   GVKCRDRLQGTDEAANAAAERVWTFLIQGVQARDRLYGLDNIQTPQLAATVAAQSAALE
FT                   TLAKSVGTDPDTIAASVEQAVKARLATLRITVEGDQS"
FT   gene            696410..696652
FT                   /locus_tag="BDP_0600"
FT   CDS_pept        696410..696652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0600"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09267"
FT                   /db_xref="GOA:D2Q8Y1"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y1"
FT                   /protein_id="ADB09267.1"
FT                   /translation="MSNTPNIADHASDTSQDTYRPVFNDTVRTGIYLLSLVCVIVGFGF
FT                   SRFGDPAIGDYITTAGGILAAGFGVAYNPLRMNAK"
FT   gene            complement(696632..697366)
FT                   /locus_tag="BDP_0601"
FT   CDS_pept        complement(696632..697366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0601"
FT                   /product="Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09268"
FT                   /db_xref="GOA:D2Q8Y2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y2"
FT                   /protein_id="ADB09268.1"
FT                   /translation="MKLWGFVHYLAGKPPENVTRADCEKWMGREGLSAETRKGIRATLT
FT                   SYFDWCVDHDLRSDNPAIGLPHVAGSKPHPRPCPETGIREAMDGLSERDRLMVRLGAEL
FT                   GLRRSEIAKVSGRDVVGPADNALLRVVGKGDKQRLIPLPQDLAVRIRQTGDGWLFPSRN
FT                   DHGISHLTAGRVGKIVGSALPQSYGTHSLRHRAATQAYLATHDLLAVSTLLGHSSVATT
FT                   QRYVAMPPEELRKVVSSLRVHA"
FT   gene            697529..697602
FT                   /locus_tag="BDP_tRNA25"
FT   tRNA            697529..697602
FT                   /locus_tag="BDP_tRNA25"
FT                   /product="tRNA-Met"
FT   gene            697896..698108
FT                   /gene="rpmE2"
FT                   /locus_tag="BDP_0602"
FT   CDS_pept        697896..698108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE2"
FT                   /locus_tag="BDP_0602"
FT                   /product="rpmE2 LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09269"
FT                   /db_xref="GOA:D2Q8Y3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y3"
FT                   /protein_id="ADB09269.1"
FT                   /translation="MQQGIHPDYHAVQVTCSCGNTFVTRSTAKSDHMTVDVCSSCHPFY
FT                   TGKQKILDTGGRVARFEKRYGKKAK"
FT   gene            698333..699355
FT                   /gene="pfrA"
FT                   /locus_tag="BDP_0603"
FT   CDS_pept        698333..699355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfrA"
FT                   /locus_tag="BDP_0603"
FT                   /product="prfA Bacterial Peptide Chain Release Factor 1
FT                   (RF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09270"
FT                   /db_xref="GOA:D2Q8Y4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y4"
FT                   /protein_id="ADB09270.1"
FT                   /translation="MAEPEVASDPDKMRKLGRRHAELGAIVSAYTAYKQTKDDLEAAKE
FT                   MASEDPDFAEEAKRLENELPEIEEKLRTALIPRDPDDARDTIMEIKAGTGGEEAALFAG
FT                   DLLRMYMRYAEKRGWAVTLQSENTTELGGVKDVQLAIRAKGTPAPEDGVWASLKYEGGV
FT                   HRVQRIPVTESQGRIQTSAAGVIVFPEADEDDDEIDIDPKDLKIDIFMSSGPGGQSVNT
FT                   TYSAVRMTHIPTGIVVSMQDEKSQIQNRASALRVLKSRLLAMKHEEEAAQAADMRHSQV
FT                   RSLDRSERIRTYNFPENRIVDHRTNYKAYNLDAVLDGDLQAVIDSDIQADEADRLANQK
FT                   "
FT   gene            699421..700317
FT                   /gene="hemK"
FT                   /locus_tag="BDP_0604"
FT   CDS_pept        699421..700317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="BDP_0604"
FT                   /product="hemK Peptide release factor-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09271"
FT                   /db_xref="GOA:D2Q8Y5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y5"
FT                   /protein_id="ADB09271.1"
FT                   /translation="MATIVRGAAAMLRAAGVDTPEHDAKLLCAEAFGVDLQSVNKAMLL
FT                   GDGLLGLAEDPVKPLEAFHAMIDRRARREPLQHITGHAPFRYLDLKVGPGVFIPRPETE
FT                   LIVQEGIDWITRNGGYHARVVDLCAGSGAIGLAVVTEVPGSEVWAVEKSERTAEWTRRN
FT                   LNETAQAHPSIIGNYHLEIGDATQMPTLHQLDGTIDIVLTNPPYVPLSEIPEQPEVRDY
FT                   DPDMALYGGSADGTLIPERIILRAGKLLRPGGLLVMEHDISQGERLAAYANAHGFANTR
FT                   VRNDYTGRPRYLISGKS"
FT   gene            700513..701577
FT                   /locus_tag="BDP_0605"
FT   CDS_pept        700513..701577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0605"
FT                   /product="Leucine-, isoleucine-, valine-, threonine-, and
FT                   alanine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09272"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y6"
FT                   /protein_id="ADB09272.1"
FT                   /translation="MITIGSVTTNSGAAAAYGESEVSGFKLAIKEINENGGIFGKQVKL
FT                   ESMDDKGDVIEASNAFNRLAGEKNVIAVLGPTISSTSGAVAPLADQNQMPSIAPAATAD
FT                   SVETGGYLFRTCFKDSYQGEIAAKYAAETLKVKKVAVLYGTGDPYSSGVGKAFVAAAKQ
FT                   AGLQVVAEENSSSTDDTEYSSQLQKIEASGAEFLYAPYYYSAVGPYIVPQARSVGYDGY
FT                   IMGPDGYDGLKTTGNKARYDKVLYTTHYSPDDKSNKKVQRFITSYKAANNGESPNTFTA
FT                   LGYDSVYMFKQAIEQAGEHATRTDIRNAIAGMNFSGVTGAFTLDKHGSPKKSVIVLEMK
FT                   NGSPTYKDTIQPAE"
FT   gene            701605..702534
FT                   /locus_tag="BDP_0606"
FT   CDS_pept        701605..702534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0606"
FT                   /product="Branched-chain amino acid transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09273"
FT                   /db_xref="GOA:D2Q8Y7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y7"
FT                   /protein_id="ADB09273.1"
FT                   /translation="MMGDQIIMFISQIFNGLKIGSVYSLVALGYTMVYGIIRLINFAHG
FT                   DFIMVGSYVLMLTIPFILACGLPAWLAVVPAILVCVAVGVIVEKAAYKPVREKGNNMTA
FT                   LITAIAMSLLLENGSQAIFGADYQTVPTVIQIPTLALGGLKIDGATILTVLLGLVIMVA
FT                   LQLFVTYTKQGKAMRAVSEDKEASILMGINVNSTITLTFAIGSGLAAVASLMYCVSYPQ
FT                   VSPMMGAMLGLKAFVAAVLGGIGSIPGAMVGGLVIGVVESLTKAYIGTITAGVITSAFS
FT                   DAIVFGILIIVLLVKPSGLMGEPESEKV"
FT   gene            702549..703628
FT                   /locus_tag="BDP_0607"
FT   CDS_pept        702549..703628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0607"
FT                   /product="Branched-chain amino acid transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09274"
FT                   /db_xref="GOA:D2Q8Y8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y8"
FT                   /protein_id="ADB09274.1"
FT                   /translation="MLSIKQSYLVCAIGVAVLFGLLMAVCETGVASLYVKGIIMTCCIA
FT                   VIMTTSLNLTIGVLGQLTLGCCGFEAIGAYSAALLSKLLVANGVQMDATLRFLLVTFAG
FT                   GVVACIFGILVGIPALRLHGDYLAIITLGFGEIIRVIIQNLKVAGGKGLSEGQQGQALI
FT                   GIDRLANLYVVFWITVVTVVLLFMFARSRYGRAVKAIRDDEIAAGASGINITYLKVMVF
FT                   AISAFFAGIAGGIFAQYIGALTPSMAGWLQSINYVIMVVFGGMGSLTGSIVAAVGLTIL
FT                   PELLRAFSEYRMLVYSVVLVLIMVFRPQGIFGNWEFSLPKLVNKLFYPSRIKAHGRSAT
FT                   VAKTDGKSSDGADDKEAKA"
FT   gene            703625..704425
FT                   /gene="livG"
FT                   /locus_tag="BDP_0608"
FT   CDS_pept        703625..704425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="BDP_0608"
FT                   /product="Branched-chain amino acid transport ATP-binding
FT                   protein livG"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09275"
FT                   /db_xref="GOA:D2Q8Y9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Y9"
FT                   /protein_id="ADB09275.1"
FT                   /translation="MSEPILRAEHLGITFGGLKAVSDFNMTINAGELVGLIGPNGAGKT
FT                   TVFNLLTGVYQPTEGEFFLDGRRMNGKKTYQVVRAGIARTFQNIRLFDKMTVEENVLVA
FT                   FDQSFTYRLGGAIFRTPKFWKQERDMHAKAIDLLRIFGLEGLANTEAANLPYGAQRKLE
FT                   IARALATGMKLLLLDEPAAGMNPTETEDLLHCINVIRDRFGIAILLIEHDMSLVMNVCQ
FT                   RIQVLDYGRTIASGLPEEIANDPQVISAYLGADDTDETAEGREA"
FT   gene            704425..705129
FT                   /gene="livF"
FT                   /locus_tag="BDP_0609"
FT   CDS_pept        704425..705129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BDP_0609"
FT                   /product="Branched-chain amino acid transport ATP-binding
FT                   protein livF"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09276"
FT                   /db_xref="GOA:D2Q8Z0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z0"
FT                   /protein_id="ADB09276.1"
FT                   /translation="MLEIKNLSVSYGAIEAVKDISLTVNDGEIVSLIGANGAGKTTTLH
FT                   TITGLTPAQSGSVMFNGVDLLKTHSNKIVTLGMAHIPEGRHVFTRMSVQENLEMGAFSL
FT                   KDRSHMAADLNMVFDYFPRLKERRNQLAGTLSGGEQQMLAMGRALMSHPNTILMDEPSM
FT                   GLSPKLVKEIFAIIRKLHDEGITVLLVEQNAKMALSIADRAYVLETGRITMEGDAQDLL
FT                   HDEQVRKAYLGA"
FT   gene            705178..705840
FT                   /locus_tag="BDP_0610"
FT   CDS_pept        705178..705840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0610"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09277"
FT                   /db_xref="GOA:D2Q8Z1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z1"
FT                   /protein_id="ADB09277.1"
FT                   /translation="MSEVRTITDESLAQAVEIIRDGGLIVIPTDTVYGVACDPRNVEAI
FT                   RKIYMVKQRPKYKPLQVLLASIDGLDALRLDLPVPLNRLAAMFMPGAFSPIAEARDNCS
FT                   LATIRRDPATGKTTQGVRIPNSAATLRILRAVGPLAATSANRSGEESAQTVDEAVEALG
FT                   DAVGLYLDGGATPGHVSSTVVAADPHGRDGISILREGVIREAVIRKALTLNGGALGI"
FT   gene            705837..706976
FT                   /gene="rfe"
FT                   /locus_tag="BDP_0611"
FT   CDS_pept        705837..706976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="BDP_0611"
FT                   /product="rfe Undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09278"
FT                   /db_xref="GOA:D2Q8Z2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z2"
FT                   /protein_id="ADB09278.1"
FT                   /translation="MRIYLFIAAIAGGVTYLITPLIRHVAIEIGAVGEVRARDVHTIPT
FT                   PRLGGLGMLMGFTVSMLFASKIPFIEVLFAQSKQAWVILAGAVMISLLGMADDLWDLDW
FT                   MLKLAGQLLISVFVAWGGLQIISLPLGSLVTASPSLSMAITAFLIVASINAVNFVDGLD
FT                   GLASGIVAIGGIAFAIYSYIIARNSPSYASMATLIDIAMVGMCVGFILHNWHPAKLFMG
FT                   DSGSMLLGYLITCASIVMTGRLDPATIHASIYLPVFMPILLPILVLFLPILDMCLAIVR
FT                   RVSKGQSPMHPDRMHLHHRMLRIGHSVQGAVLILWGWAALIAFGSIMTLFFKAQHVLIG
FT                   FLIATVLLTIATMYPYLKHRIPELREENARADAQHARHD"
FT   gene            complement(707220..708323)
FT                   /locus_tag="BDP_0612"
FT   CDS_pept        complement(707220..708323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0612"
FT                   /product="Integrase/recombinase (XerD/RipX family)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09279"
FT                   /db_xref="GOA:D2Q8Z3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z3"
FT                   /protein_id="ADB09279.1"
FT                   /translation="MAHCRMRMNDGSFRQLERSAPSKERARILLEEYCQQLKRRTFGAI
FT                   EPNTTLGDLAGLWLATQTGKAENTINAYTNAYRKYVSRLDSLTIAEATPLVLQTFLDGV
FT                   AGGSGSATVSMVKLVLSGMMEMAVAQGAILHNPVRDLKRMSRHREGSVAIPADKVQKFL
FT                   KAVETNEWLVSHDEADIIRLMLYTGLRVGEACGLCWDCVDFTAGTLSVERIAIRCKGEG
FT                   MTLQAHPKTEHSRRTITAPKSIMHMLELRRISLDTGGIPNPHNLVFPRPLSGGSCEYLV
FT                   RSPNVVASDLRREREALGFGKGESLSPHSLRKTCASLLHDAGLNTLDVADYLGHSDTAT
FT                   TENVYIARGRNSGKAANALETMIENAG"
FT   gene            complement(708395..708919)
FT                   /locus_tag="BDP_0613"
FT   CDS_pept        complement(708395..708919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0613"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09280"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z4"
FT                   /protein_id="ADB09280.1"
FT                   /translation="MHVEIGLTYSATENQMIISKCDFTGETWFGGLKVSNMHKLPIERI
FT                   VKDFPPDLYVIDDGTPCGILGDWDAVLSKVPFSEYREQGPCDNTLKWVARIYYVAQLFR
FT                   ESPAKSVSERFDIPMRTASHWVKLMKERVWPESIMDRNVEDLEQNFSSLKMETEEDIAQ
FT                   RFYRVTGVGGE"
FT   gene            709797..710021
FT                   /locus_tag="BDP_0614"
FT   CDS_pept        709797..710021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09281"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z5"
FT                   /protein_id="ADB09281.1"
FT                   /translation="MKDLRLIHCVDYDKFGVPTTQPELLRATRDNDTITIGIGADPLTR
FT                   KEFAMTAGEARRLADWIRQEIGRKIDERQ"
FT   gene            710008..711330
FT                   /gene="phiRv2"
FT                   /locus_tag="BDP_0615"
FT   CDS_pept        710008..711330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phiRv2"
FT                   /locus_tag="BDP_0615"
FT                   /product="phiRv2 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09282"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z6"
FT                   /protein_id="ADB09282.1"
FT                   /translation="MNGNEMGGVAAALSPKNVPHVPLGDTSRFSGVTSALHPVTRGTCV
FT                   ARENREVTPSGTCGTFSADSTERGDRLLYETRRFITQYVDFPSEDFATAVTLWIAHTWF
FT                   ADTLYTTPRLIFSSPEKRSGKTRAQEVTALLCPNPVNTINVSPAYLFRKLQPDEGDMLP
FT                   TIFLDETDALFTGKASENTEAIRGIINAGYKRGATVGRAEIRNKTVEVCDYPVFAPVCL
FT                   AGIGGLPDTIEDRAVIVPMKRRRPDTRLKPFRDRSATAEAAPLRERLERWGRVQASIVE
FT                   TWRDADYPRLPDAIQDRDADVWEPLFIVAGLAGGPWPGIAAAIAPKIIAGQHVEPTSAG
FT                   ERLLYDIRTVFDATGEQSLPTVTLIGRLKELEDSPWETMGDSGIGVRDLGRMLKPYDIG
FT                   IRHGHQHSIRWHGSPVRGYRREDFEDAWARYLQPAPAARTA"
FT   gene            711366..711605
FT                   /locus_tag="BDP_0616"
FT   CDS_pept        711366..711605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09283"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z7"
FT                   /protein_id="ADB09283.1"
FT                   /translation="MTNILHYIDDSTPDGTRTTTLCGSPLTADRAGAASIMATGSWTMC
FT                   PLCELRRTLIGMGLEADPYPERPARRRWEQPPLF"
FT   gene            712411..712524
FT                   /locus_tag="BDP_0618"
FT   CDS_pept        712411..712524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09284"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z8"
FT                   /protein_id="ADB09284.1"
FT                   /translation="MNDKQISPKAMLDWVDAMESVEYAEDVLRQADEAGIE"
FT   gene            712804..714810
FT                   /locus_tag="BDP_0619"
FT   CDS_pept        712804..714810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0619"
FT                   /product="phage prohead protease, HK97 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09285"
FT                   /db_xref="GOA:D2Q8Z9"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q8Z9"
FT                   /protein_id="ADB09285.1"
FT                   /translation="MHIKSNESHIAVKGDKTGRSLQEGQFTAYASTWTRTPDCYGDVVR
FT                   KGAFADTLRAWGETGDSIPILYGHNESDPDYNIGYVTEAVEDDHGLRVTGQLDIDTNPR
FT                   AMQVYRLLKGHRLNQMSFGYEVIDQGPADSMAGQCNELRAVKLLEVSIVPRGANPDTSI
FT                   EGVKQAPAETYTPNTSGMTSEQVKAAYAEQFQRNTTHLADAHRKLTKGVDDGSRERILD
FT                   ANRRILQYLEDQSPHTIFTKSAMDKQTEQAGTIRRRAQIEQRAITPEEQATLDNYELFK
FT                   EFRQDLEQRARKEDEKLRRMLAASVPSDDVSIHSLTATSKAGYEETMNDNINTKAYTFA
FT                   RNEDNGHAMNPTLRKGRVAIRSVKESMNAAWNGHNATNATKTAPALTGSAIFPVPIINA
FT                   NEPIRDAADEVPPQLLEYIPAFLCQSGDYDILMEKTPDNPGSAAVVPAGQEKPTFSIGL
FT                   EKQRRQLKVIAVLSDPIDKYVLLGGGEYGGLDVQEHITGRLYTEILRTLEREILTGDGS
FT                   DAHLLGLDHIEGVKTQAFAGGILDTIVNGIAQIERQGITVQTIAISPADWLAVCTAKDT
FT                   TGRYLTNNAIDPVNMRLWGNNVAVAAGLPEGTAWVIGSGSLQIATDATMALAWDAYGTL
FT                   FKTNAVQFRLEARYSLDALKPHALCKVSLSAGK"
FT   gene            714936..715316
FT                   /locus_tag="BDP_0620"
FT   CDS_pept        714936..715316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09286"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q900"
FT                   /protein_id="ADB09286.1"
FT                   /translation="MEGAKSAPPKLSFSCLGFMGPNHRQGCRHGVVFHGVVTSAPTVCI
FT                   AHMVAARAHEGELCVSYAQLGSGYSPREYPGYGDFPCSPGNESLTGSVFMKSPPLARSM
FT                   NLPNTEDTDSERVHVPSVPLKW"
FT   gene            715796..717253
FT                   /gene="guaB"
FT                   /locus_tag="BDP_0621"
FT   CDS_pept        715796..717253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BDP_0621"
FT                   /product="guaB Inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09287"
FT                   /db_xref="GOA:D2Q901"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q901"
FT                   /protein_id="ADB09287.1"
FT                   /translation="MLLLPNETDVIPSEVDTTTHLTRNITMKVPAISAAMDTVTESDMA
FT                   IAMARNGGIGVLHRNLSIDDQAAQVDVVKRSESGMINNPLTVSPDVTLADLDKLCGRFH
FT                   ISGLPVVDKDNKLVGIITNRDMRFIASEDYDHLKVSDVMTREHLITGPSNISKEDAHDL
FT                   LAKYKVEKLPLVDAEGHLTGLITVKDFVKTEQYPDATKDEQGRLRVAAGIGFLGDAYNR
FT                   ASALMEAGVDVFVVDTANGEAKLALDMISRLKSDSAFKGVDIIGGNVATRQGAQAMIDA
FT                   GVDAVKIGVGPGSICTTRVVAGVGVPQLTAVYEAAQACRAAGVPCIADGGIHYSGDIAK
FT                   ALVAGASSVMLGGTLAGCEEAPGEKVLLHGKQYKLYRGMGSLGAMAPRGKKSYSKDRYF
FT                   QADVTSNDKVVPEGVEGEVPYRGPLNAVLYQMIGGLHQSMFYIGAHNIAEMPERGRFIR
FT                   ITDAGLRESHPHDIVMTAEAPNYSGRQ"
FT   gene            complement(717879..718715)
FT                   /locus_tag="BDP_0622"
FT   CDS_pept        complement(717879..718715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0622"
FT                   /product="CTP synthase (UTP-ammonia lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09288"
FT                   /db_xref="GOA:D2Q902"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q902"
FT                   /protein_id="ADB09288.1"
FT                   /translation="MENEYWNTLDPAQRTIHQVRALQIQNPRIIFAGPSAVAVYGYEHP
FT                   WSIHASGIYRADCSRGNQKPTNHALGRIYMPRISERIINGIRVTTPERTLLDCSLMFPF
FT                   RKVLPIFDSAMAQDSELSEKITDLIPRIRRNTDALKKLLAYCNPLSDNGGESFTRATMI
FT                   EEGFQNPLIQHVIHDPSGGGKWYRVDFIWFLPDGRIIVAEYDGMAKYTDPMMTDRKNIQ
FT                   TIVNEQRDREQSLCSWGVTKIVRLYYEDAVNRTGLVSKLCQAGVPRPFVRMQPSLS"
FT   gene            complement(719424..720455)
FT                   /locus_tag="BDP_0623"
FT   CDS_pept        complement(719424..720455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0623"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09289"
FT                   /db_xref="GOA:D2Q903"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q903"
FT                   /protein_id="ADB09289.1"
FT                   /translation="MTRTTIADVAKAAGVSVSTVSRALRGLDRVNPETRERVEKEANRL
FT                   HFSFSKSASSLASGKTMRIAVLLPSEISSWFNSHAFEGIYEVMSKADYDVVPYIVWTQE
FT                   DLDRFFQNLPGNRNVDAIIEASFDFDEAKKRVLGELTIPVVGMNAPSTHGLDAGVAIDD
FT                   AAAMSAIVRFLKSLGHTLAYIGQPVNASPFICSDIVREKGFLDAAKECGYGDDDIIIVP
FT                   SLTHMDVQNEQDIYSGIVAQLLSAPKQPTGICVSVDAAAVPLLKELRRMGWRVPQDVSV
FT                   VGFDDDPSASIVDMTTMHQNPTEIGRIAARKTLALLAGETLEEPFSVISTSLVLRSTTE
FT                   RVH"
FT   gene            720788..722545
FT                   /gene="agl2"
FT                   /locus_tag="BDP_0624"
FT   CDS_pept        720788..722545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agl2"
FT                   /locus_tag="BDP_0624"
FT                   /product="agl2 Alpha-glucosidase"
FT                   /EC_number="3.2.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09290"
FT                   /db_xref="GOA:D2Q904"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q904"
FT                   /protein_id="ADB09290.1"
FT                   /translation="MTEVTDPALWWKQAVVYQVYPRSFKDSRGEGLGQIAGVTEKIDYL
FT                   KDLGVDAIWLSPFYPSQLADGGYDVDDYRNVDPKLGTMDDFDELAKAAHARDIKVVVDI
FT                   VPNHSSNLHEWFKAALAAEPGSPERDRYIFRDGKGPNGDQPPTNWENHFGGPAWTRVPD
FT                   GQWYLHMFTKEQPDWNWNNREVRDDFLRTLRFWLDHGADGFRVDVAHGLAKDLDRDDLD
FT                   DYVVWCTNDQPEDGSHPVIDRDEVHDIYHEWRKVFNEYNPPAFAVAEAWVRPSRQHLYA
FT                   SPDDLGQIFNFEFAKKDWIRDDMHLAIEEGLESAERSGSTATWVMSNHDVIRHATRYAL
FT                   PQVPTGEYHRLALDWLLRDGTTFEENRELGTKRARAAIMMEMALPGSAYVYQGEELGLF
FT                   EVADIPWDELEDPSAWRTSRSASTKGRDGCRVPLPWVAADAPKLDDPDDEFGHEGSFGF
FT                   SPAGATAEPHLPQPAWYKDFAVDVESADPDSMLNLYRRVLALRHDMQTTDLSVEWLPED
FT                   RPGKAHDGANGFPGGTIAYKRANGWASITNFGEEPVALPQGDVLLTSGPLTDDGRLPQD
FT                   TSAWLKLAD"
FT   gene            722574..723854
FT                   /gene="scrT"
FT                   /locus_tag="BDP_0625"
FT   CDS_pept        722574..723854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrT"
FT                   /locus_tag="BDP_0625"
FT                   /product="scrT Sucrose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09291"
FT                   /db_xref="GOA:D2Q905"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q905"
FT                   /protein_id="ADB09291.1"
FT                   /translation="MSKITTVASTVPVVTEEGSADSAKWRFTGGFLAFSVLSGAAFYMT
FT                   MSVLVPQRLRDIGIANSTAVLGTINAVGSIASIFIALFIGALSDRTATRWGRRTPWIFC
FT                   GAFIYGVCFWALSRPISAVIIGLVYVLALIGLNMVQAPIYARISDQVAPTSRATVSAAI
FT                   GAGGVIGQGIGTLVGSSLIEHMELGFICAGMCALAAGVLSVVIAPREPSSENMPKNTDE
FT                   PLWKVVAASLTPPLKNCADFYRAFICRTCLIVAYQMVFSYQLYILQDYIGQDKLSAAAS
FT                   IQVISVITMIVSIIASLVAGPIADALNRRKAPIIVACTFFAIGLAMPWIFPTQQGMFLF
FT                   GGIASFGYGMYLSVDQALNVDVLPNKETAGKDLGFMNIATCAGQAIGVAITSTLVSVLG
FT                   SYTVVFPVAIGMTAIAAISVLGIKRVR"
FT   gene            723976..724629
FT                   /gene="orn"
FT                   /locus_tag="BDP_0626"
FT   CDS_pept        723976..724629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="BDP_0626"
FT                   /product="orn Oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09292"
FT                   /db_xref="GOA:D2Q906"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q906"
FT                   /protein_id="ADB09292.1"
FT                   /translation="MVDAHDGETYTAEGSRLIWIDCEMTGLDIFGGDELVEVSVVPTDF
FT                   DLNVLDEGVDFVIKPSQKAVDHMNDFVRNMHTRSGLIKEWEHGLSLDEAQAKVVEYVKR
FT                   FTPDGVKPLLAGNTIGSDKKFLDHYMPELMEHLHYRTIDVSTFKELARRWYPAVYLNRP
FT                   PKNGGHRALADIIESLDELRYYRKAFMAPTPGPDEAEAKAIADDIKATSLIGEN"
FT   gene            724715..725608
FT                   /locus_tag="BDP_0627"
FT   CDS_pept        724715..725608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0627"
FT                   /product="Hydrolase (HAD superfamily)"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09293"
FT                   /db_xref="GOA:D2Q907"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q907"
FT                   /protein_id="ADB09293.1"
FT                   /translation="MSVADWTTIDQPQDIRLVVADMDGTLLDEHGRIPEGFWDMLARLR
FT                   ARGVEFVPASGRQYATLRNMFASKASEVLDGGELSYIAENGNVVAVDGKVVEVHGVDLG
FT                   ITRRTIDMVNASVSAGEYDMGLVICGLNTAYVQRTDTPFLDEVGKYYAALKIVDDLRKV
FT                   LDFAVEPDDYVPGEEIILKLAILDFGSSEQMTNNKLAHVRNDYQVVVSGQHWVDIMNPA
FT                   TDKKQGVEALQRALGVTPAQTAVFGDYLNDLLMLEAGDWSFAMSNGHPDLRAAARYLAP
FT                   SNASRGVLKVVDRLID"
FT   gene            725710..727116
FT                   /locus_tag="BDP_0628"
FT   CDS_pept        725710..727116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0628"
FT                   /product="Helicase"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09294"
FT                   /db_xref="GOA:D2Q908"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q908"
FT                   /protein_id="ADB09294.1"
FT                   /translation="MRQEEALAILGTGANVFLTGAPGAGKTYVLNEFIRQARADGASVS
FT                   VTASTGIAATHINGVTIHSWSGIGLANALSDKLVTTIRMRRKRKLQAADILIIDEVSML
FT                   HAWLFDMVDQVCRIIRKDSRPFGGLQVVLSGDFFQLPPVSVSGRDHDLIVPSPEFAASR
FT                   ERYARAGLNPEGFVTESLVWQELSPVVCYLTEQHRQDDGKLLGVLTDIREGCVSDEDRD
FT                   LLLTRLGRMPEPNQRAVNLFPVNRQADSLNDMRLFAIREEPHEYVAESSGPANLVERLK
FT                   RNMLAPEHLLLKTGAAVMAVRNDTDRQFVNGSLGTVRGFASDAKGGWPIVEFENGNIVT
FT                   MKPNCWQMQDGDTVLACVNQVPLRCAWAITIHKSQGMTLDRAVMDLRRTFAPGMGYVAL
FT                   SRVENLEGLYLAGVNERMFLVSPDAVRLDGELRLGSANASDALARYGASAFMPLPSSDA
FT                   DDEFAQDALF"
FT   gene            complement(727136..727522)
FT                   /locus_tag="BDP_0629"
FT   CDS_pept        complement(727136..727522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0629"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09295"
FT                   /db_xref="GOA:D2Q909"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q909"
FT                   /protein_id="ADB09295.1"
FT                   /translation="MRHITAHISIWNKLGWIGIICYFVFAAAAPEVLSEGNTWVGLSMA
FT                   LLCVVLISLPWKKLFNVLALVGMMAWLVVTRAIPGFTFLQHNPIWLLIGLACVIVSCWD
FT                   PDPEDVETEVELDPDLARSLQAMG"
FT   gene            727691..729508
FT                   /gene="proS"
FT                   /locus_tag="BDP_0630"
FT   CDS_pept        727691..729508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BDP_0630"
FT                   /product="proS Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09296"
FT                   /db_xref="GOA:D2Q910"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q910"
FT                   /protein_id="ADB09296.1"
FT                   /translation="MSTMFLRTLREDPADADVVSDKLLQRACYLRKAAPGIWTWLPLGL
FT                   TVLNKIENIIREEMASIDAQEVHFSGLLPREPYEATHRWEEYGDNIFRLKDRHEADYLL
FT                   APTHEEMFTLLVKDLYSSYKDLPVTLYQIQTKYRDEFRPRAGLIRGREFIMKDAYSFTL
FT                   DKEGLVKAYMDERGAYERIFDRLDLKYVPVHAMAGPMGGFESEEFLAPMEIGEDTFAQS
FT                   PSGKAWNVEALTTPEPEAIDCTDTPAAEKRPTPDAATIDKMVEFANANHPRSDGRAWQA
FT                   SDILKNVVIAVMHPQDDNHDEPWRELVVVGVPGDRSVDMKRLEAQFTPAEIEEATEEDL
FT                   KKHPELVKGYIGPMALGPQARDGKKAEAAEETGEALRYFVDAHIARGSAWFTGADEHEV
FT                   DYYDLVYGRDFEADGTVEAVEVRHGDMSPDGSGPLSFERGVEIGQVFQLGLKYSNALGL
FT                   KVLDQNGKTVPVWMGSYGIGVSRVMACIAETHHDDKGLAWPAVIAPAQVHVVATGKDAA
FT                   AFEAAEQLIAELEAKGIEVIFDDRKKVSPGVKFKDAELIGVPLIAVAGRDTVNNGTIEV
FT                   RDRNGENAEAVPVADAAQVIADRVAALLQ"
FT   gene            729990..730577
FT                   /locus_tag="BDP_0631"
FT   CDS_pept        729990..730577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0631"
FT                   /product="Single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09297"
FT                   /db_xref="GOA:D2Q911"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q911"
FT                   /protein_id="ADB09297.1"
FT                   /translation="MPHASSFRLASTRHYFDNRAQQWRDLPTTWITVKAYRTLSENICQ
FT                   SFKKGEPVIVTGVLATETWNGENGELRSRTVLEASNAGHDLNYGVTALRRFAKPNAANA
FT                   ESATQTPAARSNAGVQIGVDPYTNPQGATGTAVSQPVEVLPHDEPELQSAEVGADAPGD
FT                   SSGWPATDVQPDEYAKAAESVKEEGEFGGQEF"
FT   gene            complement(730590..732671)
FT                   /gene="pepO"
FT                   /locus_tag="BDP_0632"
FT   CDS_pept        complement(730590..732671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepO"
FT                   /locus_tag="BDP_0632"
FT                   /product="pepO Zinc metalloprotease"
FT                   /EC_number="3.4.24.11"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09298"
FT                   /db_xref="GOA:D2Q912"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q912"
FT                   /protein_id="ADB09298.1"
FT                   /translation="MSTTLTSGIDPASFSAVTAPAQDLFRYVNGPWIDMYRLPDDRSRY
FT                   GSFDKLAEDAENQIHDILEDDDCPAVKSRTLFRSFLDVNAIDASGLTAIADQLNAIDEA
FT                   TDKAGLVRALGAMNPIGGPDLFGIAVYGNPGAPETNIIHIEQAGLGLPDEAYYREDHYA
FT                   PIREAYVKMVAKQLTNAKLVEADDEAESQARRLLEVEATIASYHWDNVATRDSQKTYNP
FT                   TGHAELSTMLADYGLDAWIESWQEAYNTTTAAATQPIDFAGCFSRTIVHEPSFVKGLNA
FT                   FWAAADLDDLKLWARVHVIIGSTLELPHEFDDTNFDFYGKVLSGQKQQRDRWKRGVSLV
FT                   NSVCGEDIGREYVKRHFPESSKRRMEQLVANLIDAYRVSISNSAWLGEQTKAKALEKLS
FT                   KFVPKIGYTNHWRDYTALDVREEAGFAENMHAANLYETGYQLAKVGKAVDKDEWLMNPQ
FT                   TVNAYYEPTMNVIVFPAAILQPPFFNPDAEDAANYGGIGAVIGHEIGHGFDDQGSQYDG
FT                   DGKLNDWWTEEDKANFEALTRKLIGQYNEFVPTQLAEKYSDDPSQAPHVNGALTIGENI
FT                   GDLSGVNIALKAYAFALDDAAGREKDGSEEAIESSLAGAPEIDGFTGLQRFFLSYASIW
FT                   RTKNRDELAEQYLQIDPHSPAECRTNGIARNVDLFYKAFDVTADNGMWLAPEQRVRIW"
FT   gene            732847..733593
FT                   /locus_tag="BDP_0633"
FT   CDS_pept        732847..733593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0633"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09299"
FT                   /db_xref="GOA:D2Q913"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q913"
FT                   /protein_id="ADB09299.1"
FT                   /translation="MTDPNMHDPQEQPEYGAYDRSHYDRNRDEAQTPRYFNPYGNPYMA
FT                   GGNQGQDGSWQPVSPFKLVEEWLPQQAKNAIRGVYGVLGVVALILGLALLIWPGATLKV
FT                   AAIALGAYFVVSGVIRIVTAVVELGLPGGWRVLDILIGVLLTVGGVIVLKNAALSGATL
FT                   AVLITMVVGLGWMMEGVMALVESWRMPSSGWAVVYALLSIVAGFIVLFSPVSSTAWLIL
FT                   FGGCALIVLGVVAIVRAFTFGKPRRG"
FT   gene            733632..734408
FT                   /gene="map"
FT                   /locus_tag="BDP_0634"
FT   CDS_pept        733632..734408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BDP_0634"
FT                   /product="map Methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09300"
FT                   /db_xref="GOA:D2Q914"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q914"
FT                   /protein_id="ADB09300.1"
FT                   /translation="MIELKTPKEIEAMKPAGRFVGGILRDLKEFTKVGTNLLEIDEFVH
FT                   KRIVDRKGATSCYVDYAPDFGTGPFAHYICTSVNDAVLHGVPFDYNLKDGDLISLDLAI
FT                   NVDGWVGDSAISFVVGDHKDPEDLRLIKCTEEALEAGIAAAQPGNRLGDISSTVGDVAR
FT                   EYGYPINLEFGGHGVGHIMHGDPHVPNDGRAHHGYKLRPGLVIAIEPWFLKTTDEIYQD
FT                   PKDGWTLRSEDGSRGAHSEHTIAITENGPVILTVRD"
FT   gene            734549..735841
FT                   /gene="gltA"
FT                   /locus_tag="BDP_0635"
FT   CDS_pept        734549..735841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="BDP_0635"
FT                   /product="gltA Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09301"
FT                   /db_xref="GOA:D2Q915"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q915"
FT                   /protein_id="ADB09301.1"
FT                   /translation="MATAHLSVESKDFTLPVVEATAGADGIVVSTLRNDGWVTLDPGFL
FT                   TTAQCESKITYIDGKNSILRYRGYPIEQLCEKSDFLEVAWLLRHGELPNQEQYDRFISD
FT                   INHRTMVGEDFRTFMGSFPRTAHPMSVMASAINALATFYPDTTDITDSDQLDEAATIIM
FT                   AKARTIVSYIFRRRRDEPMLYPDYSRGYVDDFLRMCFAVPYEPFDSDPLYVHALGRLLI
FT                   IHADHEQNCSTSVVRIAGSAHANLYSAVAAGINALSGPLHGGANEAVLRQLKAIRDSGK
FT                   SVKEFVEDAKANGQRISGLGHRVYKSYDPRAAIAKTYLQKIMERADTLKLPADERALFD
FT                   VATELEEIALNDEYFITRHLYPNVDFYTGLIYRAIGFDPSMFTTLFALGRIPGWIAQYR
FT                   EMLADPNTKIGRPRQVYTGYTKRDYTPMDKR"
FT   gene            complement(735862..736236)
FT                   /locus_tag="BDP_0636"
FT   CDS_pept        complement(735862..736236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0636"
FT                   /product="SPOUT methyltransferase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09302"
FT                   /db_xref="GOA:D2Q916"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q916"
FT                   /protein_id="ADB09302.1"
FT                   /translation="MEVADEKTPEHAGEGLERQIKAKEGERIARYIRDDAFVIALAIEG
FT                   KQLTSEELAAKIDGLGLHGTSHIQLIIGGSLGLDPSILQRADYLLSFSRMTFPHQLMRV
FT                   ILLEQIYRAYKINAGEPYHK"
FT   gene            complement(736338..737327)
FT                   /gene="dapD"
FT                   /locus_tag="BDP_0637"
FT   CDS_pept        complement(736338..737327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="BDP_0637"
FT                   /product="dapD 2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09303"
FT                   /db_xref="GOA:D2Q917"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q917"
FT                   /protein_id="ADB09303.1"
FT                   /translation="MTDQRTAWGWGLASVDAAGNTLDVWYPELKLGEAPEEVSRPNHGF
FT                   GNLAHEGTDARGVRRIPVFTISKLDEPIENAADAYLRLHLLSMRLAQPNSLNLDGIFGA
FT                   LNNVVWTNYGPFAVEDFALRRLDVMNVANQAAPGLPKADVNVLSIDKFPRMVDYVVPTG
FT                   VRIGDADRVRLGAHLSEGTTVMHAGFVNFNAGTLGVSMVEGRVSQGVVVGNGSDIGGGA
FT                   SIMGTLSGGGKLKNSIGEHSLLGANAGIGISLGDNCVVEAGLYVTAGTKVTIYDKAKVA
FT                   AGEPLETVKGADLSGKDNILFIRNSVSGRIEARYRKTGIELNEKLHNN"
FT   gene            737534..737665
FT                   /locus_tag="BDP_0638"
FT   CDS_pept        737534..737665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09304"
FT                   /db_xref="GOA:D2Q918"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q918"
FT                   /protein_id="ADB09304.1"
FT                   /translation="MSDYQNNREQRERRRRTVVRAVGIIIAAAMLLSVVIPAIYAGL"
FT   gene            737835..738977
FT                   /gene="prfB"
FT                   /locus_tag="BDP_0639"
FT   CDS_pept        737835..738977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="BDP_0639"
FT                   /product="prfB Bacterial Peptide Chain Release Factor 2
FT                   (RF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09305"
FT                   /db_xref="GOA:D2Q919"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q919"
FT                   /protein_id="ADB09305.1"
FT                   /translation="MVYTMAEFDYSQAIGEARAKYESISKALDVDRLTAQAKELEVQAA
FT                   EPGLWDDPENAQKITSKLSAVQSQLKRLSSASQRIDDVETLVELGREEEDADTLEEAKN
FT                   EIEGIRHDLDDMEIQTLLDGEYDERSAVVTIRSGAGGVDAADFAQMLLRMYLRWAERNG
FT                   YKAKVMDTSYAEEAGIKSATFQVDAPYAYGRMSVEGGTHRLVRISPFDNQGRRQTSFAA
FT                   VEVVPLVEATDHIDVPDSEIRVDTYCSSGPGGQGVNTTYSAVRITHIPTGIVVTMQDER
FT                   SQIQNRAAAMAVLQSRLLVLRHEEEAKKKKELAGDIKASWGDQMRSYVLHPYQMVKDLR
FT                   TGYETSQTQAVFDGDIDAFIEAGIRWRHEQRRAAAEEAEA"
FT   gene            738995..740221
FT                   /gene="ftsE"
FT                   /locus_tag="BDP_0641"
FT   CDS_pept        738995..740221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="BDP_0641"
FT                   /product="ftsE Cell division ATP-binding protein ftsE"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09306"
FT                   /db_xref="GOA:D2Q920"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q920"
FT                   /protein_id="ADB09306.1"
FT                   /translation="MALISLDHVSKVYPKGTRPALDDINLSINRGDFVFLVGASGSGKT
FT                   TLLSLLLREEEATDGEIRVAGNDLRRLAPRQVPFYRRTIGFIFQDYKLLNNKTVWENVA
FT                   FALEVIGTSRSTIKSLVPKVLETVGLTGKENSYPHELSGGEAQRVAIARAYVNHPQILL
FT                   ADEPTGNLDPTTSLGIMEVLDAINRTGTTIVMATHNEEIVNSMRKRVVELHTGKIVRDE
FT                   QQGSYDSALYFPDAEVESKSHQALGTSDKDQRYRAPNAIETGSQVDVEGETRIETAANA
FT                   VDAITQTLSSGAGDEGIARLANSVHSGRTGRYGDAFASPEDTMTWGKGLKLDDIDGSEG
FT                   QAEAVSEPPAPPTAVKSETSAESEVTATTETATAAETPGENETLNPPAPPAPSGDAAQE
FT                   AEEVHKEDD"
FT   gene            740221..741144
FT                   /gene="ftsX"
FT                   /locus_tag="BDP_0642"
FT   CDS_pept        740221..741144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="BDP_0642"
FT                   /product="ftsX Cell division protein ftsX"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09307"
FT                   /db_xref="GOA:D2Q921"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q921"
FT                   /protein_id="ADB09307.1"
FT                   /translation="MRLRFILSETWTSLTRNVSMIISVMLVTFISFLFIGASALMQVQV
FT                   TEAKGEWYDKVEVVVWLCPDGTSQAASCAAGTAPTDQEIVDLENLIHQEAGKVVSKITY
FT                   VSREDFYKNTFLKQYPTGTYQGRTLTASDMQASLRLKLSDPTKYQVVSEILNGRTGVEE
FT                   VQDQRKIFDPVFSVLNRATAVTMVLAAVMIVVAIMLTGTTIRMSAASRKNETEIMRLVG
FT                   ASNWTIRLPFVLEGVFASFLGSLLAAGALSGIVKVFITDWLSQTVQWMPLITQKTVWLV
FT                   APALILGAVALSVVASSISLRRYLKA"
FT   gene            741251..742696
FT                   /locus_tag="BDP_0643"
FT   CDS_pept        741251..742696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0643"
FT                   /product="CHAP domain containing protein"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09308"
FT                   /db_xref="GOA:D2Q922"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q922"
FT                   /protein_id="ADB09308.1"
FT                   /translation="MSRKMVQRAHAVTGMLLASAMLCATGMAVMVAPAPQARAVSVSEY
FT                   QNKVADHAKLKAQLSGVSSDLADTILQLADLNDNQIPAAVEAADAAQQAAQQAQSLADA
FT                   TAERLEAAKQDKATLEEQIAQTGSDYDDAKAAVAQLARQSFHGSDVSDVLDVVTNSTTT
FT                   DEFVNKMQSEAAVTRSETNAASDAANDLNTSMNREERLSAIEDKITQLKTQADEQAASA
FT                   QQAASDANAKKEALQQLRDEGAAKREQLEAQKSQLTTQSAREAADIVAMKSQIDSWNNQ
FT                   YNSGNSATPNPGNNQQQSGGNSSGNTSSNNSGTNTGGNGQSTNTNTGGNTNSGSASGMD
FT                   YSVPGSCPSGSGYCYGHNTGNTVGGSAYPARQCTLWAYLRRSQLGLPVGSYMGNGAEWA
FT                   NTARSLGYLVNNTPHYGAVMVFARGQSVGGHWTADWQYGHVAVVERVNADGSVLISEGG
FT                   TGFSTFPAWETISNAGAYQYIHY"
FT   gene            742815..743294
FT                   /gene="smpB"
FT                   /locus_tag="BDP_0644"
FT   CDS_pept        742815..743294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BDP_0644"
FT                   /product="smpB SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09309"
FT                   /db_xref="GOA:D2Q923"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q923"
FT                   /protein_id="ADB09309.1"
FT                   /translation="MVKEQGTKPIAQNKKARHDYAIEDKYEAGLVLTGTEVKSLREGRA
FT                   SLAESFITIDRRGEIWLEGANIPEYLNGTWNNHAPKRKRKLLLHAEQIAKLARQSEAKG
FT                   YTIVPLSLYFKDGRVKAEIALARGKKEFDKRQALREEQDKREALRAMRYANRQVR"
FT   gene            743570..744355
FT                   /locus_tag="BDP_0645"
FT   CDS_pept        743570..744355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0645"
FT                   /product="Solute-binding protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09310"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q924"
FT                   /protein_id="ADB09310.1"
FT                   /translation="MKKDDDIAAMLPDSVTKDGKLSIGMDTSYAPAEFLAEDGKTPVGF
FT                   DVDIAKALANIFGLEADPETSNFDSIIPSVGSKYDIGISSFTITKERMEAVDFVSMFKA
FT                   GSTWVVKKDNPNKVDTSSLCGLKIAVQTGTTQEEEVNEAQEQCKADGKQDIQILSNKLQ
FT                   TDVTTNVATGKADVFYADSPVAGYAIAQTEDTLEALGEDVGVTKEAVAIKKGDSDTAKA
FT                   VQAALQKLMDDGTYMKILKHWGVESGAIDKAEINPTDLS"
FT   gene            744507..745433
FT                   /locus_tag="BDP_0646"
FT   CDS_pept        744507..745433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0646"
FT                   /product="Solute-binding protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09311"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q925"
FT                   /protein_id="ADB09311.1"
FT                   /translation="MAVKFKSMAALALSAAMLLSMAACGTTDSADSSASASSSNTTTGY
FT                   DVSGVQKDDELAKLVTEGTTVKDGELSSGMELSYAPAEFYAEDGKTPVGYDVDMTKAIA
FT                   QVLGLKPKIVSSMFDTIIPSIGTKYDLGITSMTITKERMESVDFVSYYRAGSTWAVQKG
FT                   NPKKLDASDMCGAKIAVQTGTTQEDDANDIAKGCKADNKAEVLSYKRQAEAATAVATGK
FT                   ADAFYADSPVAGYAISQTDGLEALGDVEGVAKQGIAIEKGNEKLDEAVQKALQKLMDDG
FT                   TYMKILKHWGVESGALDKAEINPTNLD"
FT   gene            745729..746451
FT                   /locus_tag="BDP_0647"
FT   CDS_pept        745729..746451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0647"
FT                   /product="Permease protein of ABC transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09312"
FT                   /db_xref="GOA:D2Q926"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q926"
FT                   /protein_id="ADB09312.1"
FT                   /translation="MVLAVMRKSINPVLRGVSWFYIWFFRGTPVYTQLVFWGLFAVLIP
FT                   RIGIGIPFTSIEFWSVDSQSVITAFNAAWLGLVLNEAAYLAEIVRAGLEAVDPGQTEAA
FT                   KALGMKRSLIMRRIVLPQAMRIIIPPTGNEFIGMLKTTSLVNAVPFTLELQFATTAIAT
FT                   RLYKPIPLLIVACIWYLVITSILMIIQSRLEKHFGKGFDARPAGARGKQTPLPGKTEGE
FT                   PQDDINKQNEATFAGMNA"
FT   gene            746558..747256
FT                   /locus_tag="BDP_0648"
FT   CDS_pept        746558..747256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0648"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /EC_number="3.6.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09313"
FT                   /db_xref="GOA:D2Q927"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q927"
FT                   /protein_id="ADB09313.1"
FT                   /translation="MTVMPGTVTVILGPSGSGKSTFLRLINQLETLTGGEIDVDGEMIG
FT                   YKYVDKGGRQVLQTLNDKEVSVQRSKLGMVFQRFNLFPHMTALENVMEAPVRVKHMGKK
FT                   EARKLAIQELERVGMGERLDHYPAQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPE
FT                   LVGEVLNVMRSLAKAGMTMVVVTHEIGFAREVADQVVFMDGGVVVEQGGPEIIDNPREP
FT                   RFKDFLQHVL"
FT   gene            747631..749409
FT                   /locus_tag="BDP_0650"
FT   CDS_pept        747631..749409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0650"
FT                   /product="Glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09314"
FT                   /db_xref="GOA:D2Q928"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q928"
FT                   /protein_id="ADB09314.1"
FT                   /translation="MALTAPGMGHVEVRKKAGRLANLVEDVERNPMPLATVGIGHTRWA
FT                   TNGVPNDVNAHPHTSRDGKVAIIHNGIIENASQLRLDLQTEGYHFASETDTEVAAKLLG
FT                   KITDKIIEEEGGPDLFKAVRRLARMLEGAFTILATDCRQPDIVVGARHDSPLVVGLGEG
FT                   ENFLGSDVAAFVAYTKRAMEIDQDQAVMVSANKVVVSDFMGNIVPDPKIYTVDWDASAA
FT                   EKGGWDSFMDKEIHEDPAAVQRTLLGRLDKDGNLNLDEVRIDEHDFKAIDKIIVIACGT
FT                   AAYAGMVAKYAIEHWVRIPVEVELAHEFRYRDPILTPRTLVVAISQSGETMDTLMALRH
FT                   AREQGSKVLAICNTQGASIPRESDAVLYTHAGPEVAVASTKAFVAQITAAYVLGLYLAQ
FT                   IKGAMFRDEIQQTLDSLKDMPRKIQWVLDTQTKAVHDAAAQMVDAKSFLFLGRHVGYPV
FT                   AMEGALKLKEIAYTFTEGFAAGELKHGPIALVDEGEPVVFIVPPARGRNVLHAKVISGI
FT                   EEVKARGAYIIAVAEENDPDVERYADVVFWRPACPTLMSPLVDVVPLQLFAMDMAKLKN
FT                   YDVDKPRNLAKSVTVE"
FT   gene            749419..750213
FT                   /locus_tag="BDP_0651"
FT   CDS_pept        749419..750213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0651"
FT                   /product="Ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09315"
FT                   /db_xref="GOA:D2Q929"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q929"
FT                   /protein_id="ADB09315.1"
FT                   /translation="MVPSEPGRASQEEVVLRQERRHRYVIAEPHIPFEYEVLYEDDGII
FT                   VIDKPHFLATTPRGMWYRETALIRLRERYGEPDIVPAHRLDRLTAGVVVFVRKPELRGA
FT                   YQMLFQEHRTVKTYECLAPLAPVVRPRYGTVTRIDRNQPFPLVRRSHIAKDRGRLQAYE
FT                   IPAAVNAESLIERGDNPRIIDGNVVINYVLHPKTGKTHQLRVHMNSLGLPILGDVFYPD
FT                   VIQRPYDDFSRPLELVARRLEFDDPVTGESRAFVSNALLGDA"
FT   gene            750337..751629
FT                   /gene="sstT"
FT                   /locus_tag="BDP_0652"
FT   CDS_pept        750337..751629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sstT"
FT                   /locus_tag="BDP_0652"
FT                   /product="serine/threonine transporter SstT"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09316"
FT                   /db_xref="GOA:D2Q930"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q930"
FT                   /protein_id="ADB09316.1"
FT                   /translation="MKHISGAAKAVIDKYNGTELIIRIIVGLIAGTILALIMPHMTWIG
FT                   EFGTLFVNALKAIAPILVFVLVASALAQGASKLDRRFGTVIFLYLFTTFLSAVVAVLTS
FT                   RAFPQTLSLGKAAKADVVPQGLAEVVQTLLTNIVSNPIQAMIDGNYICILMWACLFGLA
FT                   MKAIATESSKAFMANVADGVSQVIRWVINLAPFGIMGLVFTNVADNGLAAFTKYGSLLL
FT                   LLVGTMLLMVLVFGPLVIFIYLRRNPYPLVYRCFKESGVTAFFTRSSAANIPVNMQLCE
FT                   KLGLDKDIYSVSIPLGATINMNGAAVTITVMAMAAANTLGIQISLPAAILLSVVSALGA
FT                   CGASGVAGGSLLLIPMACSLFGINNDIAMQVVGVGFIIGVIQDSVETCLNSASDVEFAA
FT                   TAEYHSWLRQGRQLPAFMYSKKERQRLGIEA"
FT   gene            752294..752758
FT                   /locus_tag="BDP_0653"
FT   CDS_pept        752294..752758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0653"
FT                   /product="Solute-binding protein of ABC transporter system
FT                   for sugars"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09317"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q931"
FT                   /protein_id="ADB09317.1"
FT                   /translation="MNLRNVGTDTKEYYALDNAVEAGSGASDAAQIEYYAVPQYAIKDN
FT                   LLDITDKTPGYKDFYTLGPWASVQFAGKVYDLPMDSGPMAFHRNKEVFDRAGVDADSIK
FT                   TWDDYYEAAKKIHALGDSYYITSDSDDGGFYDSMVWLADIPSKPHPIVPR"
FT   gene            complement(753534..754103)
FT                   /locus_tag="BDP_0654"
FT   CDS_pept        complement(753534..754103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0654"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09318"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q932"
FT                   /protein_id="ADB09318.1"
FT                   /translation="MLISEEPANYCPTIDSDSYGCSTAAVDYFLSKGHKTVYHIAGPST
FT                   SRAAQSRIRGWRDALAQVGIPTPPMYVGDWEADSGYQAGLALAHEHDCTAVYAANDQMA
FT                   YGAMLGLRAAGKRVPEDVSIIGVDDSLKGVVPRLELTTLRLKFKVVGNEAFSMIERQCN
FT                   GEKVPSGIKTVIPPEFIDRGSVRELN"
FT   gene            754869..755705
FT                   /locus_tag="BDP_0655"
FT   CDS_pept        754869..755705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0655"
FT                   /product="Permease protein of ABC transporter system for
FT                   sugars"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09319"
FT                   /db_xref="GOA:D2Q933"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q933"
FT                   /protein_id="ADB09319.1"
FT                   /translation="MWPFALVFVFVFVIPIMYAVYISFFQNRMIGGTRFVGFDNYVRLL
FT                   HDRQFWSAVGRVALFTVVQVPVMLFLAAAMALALDSMKLHGTRFFRISTFLPYAVPAVV
FT                   STLIWGFMYGAKYGLVGSFNGFFGTHLDVLAPGVLLASIGNIVTWEFTGYNMLIFYSSL
FT                   STIPHSLYEAASIDGASEWQIVRSIKLPELRGSLAITVIFSIIGSFQLFNEPSIMQNMV
FT                   PGNAIGTYYTPNMYAYNLSFAGNQSNYAAALAITMAVITMAIAYAVQLRSMKEQMR"
FT   gene            755755..756747
FT                   /locus_tag="BDP_0656"
FT   CDS_pept        755755..756747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0656"
FT                   /product="Permease protein of ABC transporter system for
FT                   sugars"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09320"
FT                   /db_xref="GOA:D2Q6C4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q6C4"
FT                   /protein_id="ADB09320.1"
FT                   /translation="MSNASSAAAAGPKGREKAAWKAERERRRRVARDERAERARAARSG
FT                   FANVANPRRSALLTLVCAVFAVYCLFPFFYLLVNATKTQADFTSTFGLGFGKTFALWDN
FT                   VVTVFTYDGGIFGRWFLNTVLYVVAGAGGATLLAIMGGYGLAKFRFPGRRAVFVVVIGA
FT                   ISVPGIALAVPQFLLFAKLNLTNTPWAMVIPSLVSTFGLYLMWIFSDQAVPTELLEAAR
FT                   VDGAGEFRTFFQVSLPLLAPGIVTTALFAIVATWNNYFLPLIMLKDSDWYPLTIGLNQW
FT                   KDQASTAGGQAIQNLVITGSLVTIVPLVIAFLCLQRYWQSGLSAGAVKE"
FT   gene            756899..758830
FT                   /gene="lacZ5"
FT                   /locus_tag="BDP_0657"
FT   CDS_pept        756899..758830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ5"
FT                   /locus_tag="BDP_0657"
FT                   /product="lacZ5 Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09321"
FT                   /db_xref="GOA:D2Q935"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q935"
FT                   /protein_id="ADB09321.1"
FT                   /translation="MNLVSVGIFSWARIEPEEGVYDFGWLDRIIDKLGKAGIAVDLASA
FT                   TASPPMWLTQAHPEVLWKDERGDVCQPGARQHWRPTSPVFREYALRLCRAMAEHYRDNP
FT                   YVVAWHVSNEYGCHNRFDYSEDAERAFRQWCEERYGTIEKVNDAWGTAFWAQRMNDFSE
FT                   IIPPRFIGEGNFMNPGKLLDFKRFSSDALKAFYMAERDTLAEITPDLPLTTNFMVSASG
FT                   TGLDYDDWGGEVDFVSNDHYFTPGEAHLDELAFSASLVDGISRKNPWFLMEHSTSAVNW
FT                   RPINYRKEPGQLVRDSLAHVAMGSDAVCYFQWRQSKAGAEKFHSAMLPHAGEDSQVFRD
FT                   VCELGSDLNALADNGLLGTRLAKSRVAVVYDYESEWASEHTATPTQKVRHVDEPLAWFR
FT                   ALADNGVTADVVPVRSNWDEYEVAVLPSVYILSEETTRRVREYVAGGGRLIVTYYTGLS
FT                   DEKDHIWLGGYPGSIRDVVGVRVEEFAPLGDDWPGTPEYLDLDNGTTAHDFADVITSVG
FT                   EHATVIASFKDDPWTGMDGRPAIVGNAYGEGRTVYVGASLGRDGIARSLPMMFSSLGVE
FT                   VPEASDPGLLRVERVDEASGARFVFLFNRTHAVIEAMQDGRPVIASLADVGDGKVTVRP
FT                   NGVIVLRK"
FT   gene            complement(759000..760559)
FT                   /locus_tag="BDP_0658"
FT   CDS_pept        complement(759000..760559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0658"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09322"
FT                   /db_xref="GOA:D2Q936"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q936"
FT                   /protein_id="ADB09322.1"
FT                   /translation="MTPTTGRITVQADDAVADIPPRIFGSFVEHLGRCVYGGIYEPGHP
FT                   TADENGFRQDVIDLVRELGVTCVRYPGGNFVSAYNWEDGIGPRELRPVRRDLAWHSTET
FT                   NEVGIDDFYRWSRKAGTEIILAVNMGTRGLKAALEELEYVNGAPGTELADRRVGNGIAE
FT                   PMDIKMWCIGNEMDGPWQVGHMSPDEYAAAVDRVAHAMKLAESGLELVACGSSSAHMPT
FT                   FGSWERNVLTKAYDNLDFISCHAYYYERGAKSLQDYLASAQDMQRFIATVAECADEAKA
FT                   AHHGDHDIALSFDEWGAWYSDVWNRQEAEWKAQSGKNLHHESWPKAPHLLEDIYNAADA
FT                   VVEGSLMIMLLKHCDRVRSASRAQLVNVIAPIMAEENGPAWRQTVFYPFAEAARHARGT
FT                   AYSPTIDSPEVGTESFGPTSALDSVITWDDDSRTGLLLMVNRDAVDAHDVVISLAGLPG
FT                   FDIAACGVDKAIMLHDDDPHRRNTAYDPTAVVPRSLTVTVADGTISSTLPAISWAAVEF
FT                   HA"
FT   gene            760833..762188
FT                   /locus_tag="BDP_0659"
FT   CDS_pept        760833..762188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0659"
FT                   /product="Solute-binding protein of ABC transporter system
FT                   for sugars"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09323"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q937"
FT                   /protein_id="ADB09323.1"
FT                   /translation="MKFTALKKIIALTGTVAILASVAACGTSSNSSGSSKDDGKTEILV
FT                   WSWDSTLARTVKDFEAANPNIKVKVTNAGTNKTEYTALNNAISAGKGAPDLVQIEYYAL
FT                   PEYQIRDEIEDLSQFGADKFSDFYTPGTWASVNLDGGVYALPMDSGPMAWFYNKDVFDK
FT                   AGVDPTQVKTWDDFYDAAKKVRATGSYITSDSGDAGFFDSMTWLAGAKPFSTGSDGQSV
FT                   TINLSGDSKVKSFIDFWQKMIDDDLIDTKTAGWTDDWNKGLNDGSIASLLTGAWMPYNL
FT                   LSGAPDGEGKWRITQMPTADGSETNAENGGSSLALVKTDDKAKAEAAYKFAEYACHNAK
FT                   GIKTRVNGGAFPADNDTLKSDDFLNMTALTDSDGKAHEYFGGQKFNEELARAAANVSTG
FT                   YKFLPFEVYARGVFGDDAGAAYTDKSITLAKGVQAWEKNLKDYASQQGYTVK"
FT   gene            762380..763795
FT                   /locus_tag="BDP_0660"
FT   CDS_pept        762380..763795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0660"
FT                   /product="Solute-binding protein of ABC transporter system
FT                   for sugars"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09324"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q938"
FT                   /protein_id="ADB09324.1"
FT                   /translation="MRLKLVKRLVAVCCAGIMAASAAACGASQDTRTEITVWSWEPSMK
FT                   SVIAGFERENPDIHVIWKNTSGYDKLNNAIQDGYGTPDVVQLEYYALRQYAVSSQLVDI
FT                   TDRADNYQDFFTPGTWSSVQLNGRIYGLPMDSGPMAFFYNEDVFEQAGVDASKIRTWDD
FT                   YYEAAKKLKEIGVYITADSGDASFYDAMIWLAGGRPFSASNDGKNVSINLTDDSGTRRF
FT                   TEFWQKMIDEGLVNTSLSTWSDGWKEAVGNGTVASMFSGAWMPSLLMSDLPGTAGLWRV
FT                   SQMPTPDGKAATAENGGSALAVLQRSRKPEASYRFIEYACHEADGIKTRVDGGAFPADN
FT                   DTLSDAEFLSKTTVTDDRGIEVPYFGGQEYNRVLSQAAENVTTGYQYLPFEVYARSDFR
FT                   STVGKAYKWATLLRREQDRLNIIAAGGETDASGIGDALKNTDSSDRLKLKSGIALWQKD
FT                   LKEYGNNQGFTIQ"
FT   gene            complement(763871..764641)
FT                   /locus_tag="BDP_0661"
FT   CDS_pept        complement(763871..764641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0661"
FT                   /product="Tanscriptional regulator, Bvg accessory
FT                   factor-like protein"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09325"
FT                   /db_xref="GOA:D2Q939"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q939"
FT                   /protein_id="ADB09325.1"
FT                   /translation="MLLIAVDIGNTNVVLGFIHDGRIAGTYRITTKANHTSDEYGLMIT
FT                   QFLKLSGFAPGDVDDVIISSVVPKVMHSFRASIVKFLDIDPMIVGPGVKTGINIRIDNP
FT                   KSMGADCIADCAGAYYEYGGPILVADFGTATTFNYVTADASVICGLITTGIRTGAAALW
FT                   DATAQLPEVEITRPKSILATSTKPAMQAGLYYNFLGGIERTIMQFHREIDEDFRVVATG
FT                   GLSRVFADDTDMIDIYDPELIFKGMLHIYERNVR"
FT   gene            complement(764653..765948)
FT                   /gene="murD"
FT                   /locus_tag="BDP_0662"
FT   CDS_pept        complement(764653..765948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="BDP_0662"
FT                   /product="murD UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /EC_number="4.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09326"
FT                   /db_xref="GOA:D2Q940"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q940"
FT                   /protein_id="ADB09326.1"
FT                   /translation="MTTAHILLGVTGSIAAFKACHLASDWSKQGHEVRVVMTAAAQEFV
FT                   TPLTFTSLTHTPTRTAMFAAQRTDGDVSATAMHSTQINHVDDAKWADILVVAPASADSI
FT                   AKIACGIADDQLTSTILAYDEGPKVLCPAMNVHMYANAVTQRNLQTCRELGWTIVEPES
FT                   GMLACRDIGKGRMEEPAGIEAAVADLLHGDLPDNSLPLKGRNVLVTAGPTQEPLDPVRY
FT                   LTNHSTGKMGYAIAERARDMGAKVTLVSGPVSLQAPHGVDVVNVRSAQEMFRAVQDAFA
FT                   NADITIMAAAVGDFRPAERSAEKIKKNGRERITLELVSNPDILAWAGTNKRDGQTLCGF
FT                   AMETQDLEGNAAKKLASKHCDMLVANDLRTPGAGFAADTNVVTVLRPGSIPERPHIEHW
FT                   QKMSKRNLAERMLTELAGLHVDVAGEQGSQES"
FT   gene            766104..767738
FT                   /locus_tag="BDP_0663"
FT   CDS_pept        766104..767738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0663"
FT                   /product="solute binding protein of ABC transporter systemy
FT                   for peptides"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09327"
FT                   /db_xref="GOA:D2Q941"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q941"
FT                   /protein_id="ADB09327.1"
FT                   /translation="MSQPSGAHGETGATETKTNAASTDATLNARVKSPKPSGFNKWIPI
FT                   IIAAVVTLAVIIGIAVVRNGGKTDGSANTANTADTVTIGLKLAPVSLDIRHQSGSAIEQ
FT                   VLIGNVYEALLSRDSDNQVQPGLAKSWDISEDGKTYTFHLNKNMSFSNGDKLDAEDVAW
FT                   SINQLKEQQYYNANQVASLEKAIAVDADTVQLTLSSPDSNLLWYLTGRPGLVFDKQAKY
FT                   DAKTEAIGSGPYTVESFDSSSKMVLKANPKYWGTAHKAVTQNVILRFLTDDNAAVNALK
FT                   SGDVDVLSPVNATLAKSLDAKTYKVSAADGSDKYVLAFNCTNAKLSDKRVRQAIRYAIN
FT                   HKEIIASRGDVDYALGGPIPSVDPGYEDLTDLYPYDLDKAKSLMAEAGYSTDKPLTLTL
FT                   TYANTYGTELGDQLRSQLADIGIELNINYVEFSTWLQDVHANGDYELSLVDHAESHDFY
FT                   KWTTPDYYYHYDNKEVQSLYAKALAATDDASRDDYLRQAAKIVSEDAPADWLFGYRVSV
FT                   AYSRNISGFPEKLSQTVLPLWQISKAQ"
FT   gene            767885..768802
FT                   /locus_tag="BDP_0664"
FT   CDS_pept        767885..768802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0664"
FT                   /product="Permease protein of ABC transporter system for
FT                   peptides"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09328"
FT                   /db_xref="GOA:D2Q942"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q942"
FT                   /protein_id="ADB09328.1"
FT                   /translation="MFALLRILPGDVAAVVAGTNATAERLTSLRAQMGLDKSYAAQYGD
FT                   WVLGLLHGDLGTSVVSGKAVSAQVSSRASVTFPLIVLSLLIALAIGLPLGCAAVLTRNV
FT                   RLRGVFHAAAIVAGAIPALWGGLLLILLFSKGIGLMGLLPSQGFPDAGWAAPLSAMAAL
FT                   VLPALATGITAGASIMRYTRAAVGDMASSQAVAMAMACGMTRRQAVLRVALRLAIPQLV
FT                   SVIGLTFAQMVTGVMVVENLFALPGLGSMLVTDVGNRDLTAVQSELFLLAAFFLFLGLL
FT                   VDLLHRMLDPRLKNATIGSGEVLS"
FT   gene            768811..769668
FT                   /locus_tag="BDP_0665"
FT   CDS_pept        768811..769668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0665"
FT                   /product="Permease protein of ABC transporter system for
FT                   peptides"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09329"
FT                   /db_xref="GOA:D2Q943"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q943"
FT                   /protein_id="ADB09329.1"
FT                   /translation="MHALRVVLQSMWNRAGGRYALIVMGLWLLVSAISLAWTPYSLLAT
FT                   DGFNTWGSPSSAHLLGTDGVGADVLSWLMAGSRTNLMIAVLTVAVSAAFGLLLVAAMVS
FT                   RHGAFSSVSVVVVDALISIPTVLVALILSVPFGASVVVIVAACGFAYGLNLARILRPSA
FT                   LLAARSAYVESAIWSGAGPIRVFFTHIVPNTLPVLSVQLSMSAGTSLLAEAGLTYLGVG
FT                   VGAGVPSWGHSLATSVRFISIHPLAVVWPGLVVTLVVIALNLFGDALRDAIDPLVNPAL
FT                   REVA"
FT   gene            769665..770453
FT                   /locus_tag="BDP_0666"
FT   CDS_pept        769665..770453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0666"
FT                   /product="ATP-binding protein of ABC transporter system for
FT                   peptides"
FT                   /EC_number="3.6.3.32"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09330"
FT                   /db_xref="GOA:D2Q944"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q944"
FT                   /protein_id="ADB09330.1"
FT                   /translation="MSVTIRNLTIVIGGKAIVSHVDLDIADGERVGLIGSSGSGKSMIA
FT                   KAMMGLLPATAQVSGSIEMGGRRIVGATDADIADLRGRYVGMVFQNPAAALNPVMTVAQ
FT                   QIGLPLYLHYDLTAAERAERIRVMLAKVGLDEDVLRKYPHELSGGQQQRVGIATALVSS
FT                   PHLIIADEPTTALDSITQRQIVGLLTSLVDDAGASMLFITHDFAVLHHATTRCYVLERG
FT                   GIIESGATADLLASPHTGQAIRLVEAARELSLTTKESDRV"
FT   gene            770446..771207
FT                   /locus_tag="BDP_0667"
FT   CDS_pept        770446..771207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0667"
FT                   /product="ATP-binding protein of ABC transporter system for
FT                   peptides"
FT                   /EC_number="3.6.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09331"
FT                   /db_xref="GOA:D2Q945"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q945"
FT                   /protein_id="ADB09331.1"
FT                   /translation="MSDIVLQGRGIDRYFGSGKHRRQVLFGVDIDVYAGECLAVIGGSG
FT                   SGKTTLTRVLLGLESSDGGDITYQGVGIVGGAERLRRQSGLVFQDPFGSLDPRWRIERS
FT                   IAEPLRLHHPDWSDERVGARVAESLRMVDLDPKDFLNRFPMDLSGGQAQRAAIARAIVD
FT                   HPRILLADEPMSAIDVAARIRILDSFRRIRQAEPDMALIMVSHDLGVVRHIADRIMVLH
FT                   DGRVEESGLTGEVLDAPRRDYTRELIRAASL"
FT   gene            complement(771171..771500)
FT                   /locus_tag="BDP_0668"
FT   CDS_pept        complement(771171..771500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0668"
FT                   /product="signal transduction protein"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09332"
FT                   /db_xref="GOA:D2Q946"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q946"
FT                   /protein_id="ADB09332.1"
FT                   /translation="MSLQTVIEYMLLYGRTSKSGLHLTVSSWKERQYWYVQVMSDAPCT
FT                   RLKDDRQAIIDLSNVRERMRMLCGGDLVVQRDADHAMLMLTIAQRTGQPNRTGYSEAAR
FT                   ISSRV"
FT   gene            772615..773625
FT                   /gene="cysK"
FT                   /locus_tag="BDP_0670"
FT   CDS_pept        772615..773625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BDP_0670"
FT                   /product="cysK cysteine synthase"
FT                   /EC_number="2.5.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09333"
FT                   /db_xref="GOA:D2Q947"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q947"
FT                   /protein_id="ADB09333.1"
FT                   /translation="MTIHDSLAELIGNTPLVKLNHVTDGIKATIAVKVEYFNPGGSSKD
FT                   RIAERIIDAAERSGELKPGGVIVEPTSGNTGVGLALVAQQRGYRTIFTLPDKVSEAKRA
FT                   VLRAYGAEVVVTPTDAGPDDPRSYYQVAERLAKAIPGGYRPNQYDNPNGPESHYHTTGP
FT                   EIWQATDHKITHFVAGIGTGGTISGTGRYLKDVSDGAVQVIGADPEGSIYSNPDDVHQY
FT                   KIEGVGEDFYPKAFDRGLPDEIVQVNDAEAFEMTRRLAGEEGLLVGGSSGMAVVAAIKY
FT                   AREHDLDERQTVVVLLPDSGRGYMEKIFDDDWMRANGFADIVERTTKPSLAEQYL"
FT   gene            773698..774477
FT                   /locus_tag="BDP_0671"
FT   CDS_pept        773698..774477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BDP_0671"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09334"
FT                   /db_xref="GOA:D2Q948"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q948"
FT                   /protein_id="ADB09334.1"
FT                   /translation="MTISTNTAALNATALATRAIHAGQEPDPTTGAVVTPIYMTSTFKQ
FT                   DGVGGLRGGYDYSRSVNPTRNSFDEQLAAVEGARYALSFSSGLAAIDVLLRSTIRPGDN
FT                   ILLGNDVYGGTYRLLSKVFVPWGIGLDVVDITDTAAVSAALGKKQYKYIWVETPSNPLL
FT                   NITDIAATSAVAHAHGTKVVVDNVRLAGIAASIGRRCRRGRLLHHQVHRRPLRRGRRRR
FT                   GSQRQGDPRRGGLPAERSRCRAVPVRLLARHPRPEDP"
FT   gene            774302..774877
FT                   /gene="metB"
FT                   /locus_tag="BDP_0672"
FT   CDS_pept        774302..774877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="BDP_0672"
FT                   /product="metB Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09335"
FT                   /db_xref="GOA:D2Q949"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q949"
FT                   /protein_id="ADB09335.1"
FT                   /translation="MVVYSTTKYIGGHSDVVGGAVVLNDKETRDEVAFLQNAAGAVPSP
FT                   FDSWLDIRGLKTLDLRVKQHSRNALKVAQWLETRPEVERVWYPGLESHPGHEIAARQMH
FT                   GGFGGMISVQIAAGFEAAKKFAGATEVFTLAESLGGVESLIEHPGAMTHASVAGTTLEV
FT                   PANLVRLSVGLEDADDLIADLEQAFRQI"
FT   gene            774895..776856
FT                   /gene="recQ"
FT                   /locus_tag="BDP_0673"
FT   CDS_pept        774895..776856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="BDP_0673"
FT                   /product="recQ ATP-dependent DNA helicase recQ"
FT                   /db_xref="EnsemblGenomes-Gn:BDP_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADB09336"
FT                   /db_xref="GOA:D2Q950"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2Q950"
FT                   /protein_id="ADB09336.1"
FT                   /translation="MTAITDSRALDALKQYFGYEAFRPGQSGIVGSIIAGRDVLGVMPT
FT                   GAGKSVCYQIPATILPGVAIVISPLISLMRDQVDALNDAGIPAAFINTTQTPDEQSSVF
FT                   AQASAGFIKLLYVAPERLETERFRNFASRTPISLVAVDEAHCVSQWGQDFRSSYLGIGE
FT                   FIANLPARPTVAAFTATATERVRHDIVSMLGLRDPDVTVTGFDRPNLYFDVIKLETRHK
FT                   AFWVAKYVAEHADESGIVYCATRKETEALAASLNHAVAELRAADGADPGQAGPIAVAYH
FT                   GGMSPDVRERAQRDFVTDRVPVVVATNAFGMGIDKSNVRYVIHHNMPESIEAYYQEAGR
FT                   AGRDGEPSRCTLLWNESDIVTRRRLLDSDYENERLTPDEQEVVRRAKRRLLDAMVGYCR
FT                   TTDCLHIYMTRYFGENDTVGGTSDGKCAGGCTNCEHTFETVDVTETARAISRCVHDVNQ
FT                   NVGMGKIVKILRGSKAQDLSYLNPESMPTFGMLEGVSEARIRDVLSQMATDGFLFISEG
FT                   RLPIVKFGTRAAETVAPGFHYEIKKIERTSPTKRGGAAHGTSYEAGDEISSTAVGSYIP
FT                   DDDAEALFQRLRELRLDIAREIGKPPYIVFSDRTLRDMARIRPVTNAQFLAVNGVGDNK
FT                   LRLYGERFMNLIRSINAG"
FT   gene            comp