(data stored in ACNUC7421 zone)

EMBL: CP001778

ID   CP001778; SV 1; circular; genomic DNA; STD; PRO; 6841557 BP.
XX
AC   CP001778; ABUS01000000-ABUS01000010;
XX
PR   Project:PRJNA19713;
XX
DT   08-MAR-2010 (Rel. 104, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Stackebrandtia nassauensis DSM 44728, complete genome.
XX
KW   .
XX
OS   Stackebrandtia nassauensis DSM 44728
OC   Bacteria; Actinobacteria; Glycomycetales; Glycomycetaceae; Stackebrandtia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-6841557
RX   DOI; 10.4056/sigs.47643.
RX   PUBMED; 21304662.
RA   Munk C., Lapidus A., Copeland A., Jando M., Mayilraj S.,
RA   Glavina Del Rio T., Nolan M., Chen F., Lucas S., Tice H., Cheng J.F.,
RA   Han C., Detter J.C., Bruce D., Goodwin L., Chain P., Pitluck S., Goker M.,
RA   Ovchinikova G., Pati A., Ivanova N., Mavromatis K., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Stackebrandtia nassauensis type strain
RT   (LLR-40K-21)";
RL   Stand Genomic Sci 1(3):234-241(2009).
XX
RN   [2]
RP   1-6841557
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Munk A.C., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Jando M., Mayilraj S., Goker M., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Stackebrandtia nassauensis DSM 44728";
RL   Unpublished.
XX
RN   [3]
RP   1-6841557
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Munk A.C., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Jando M., Mayilraj S., Goker M., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (01-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ca1e4d23aaa7d5d0bbfda847ebb1fe20.
DR   BioSample; SAMN02598427.
DR   CABRI; DSM 44728.
DR   EnsemblGenomes-Gn; EBG00001268540.
DR   EnsemblGenomes-Gn; EBG00001268541.
DR   EnsemblGenomes-Gn; EBG00001268542.
DR   EnsemblGenomes-Gn; EBG00001268543.
DR   EnsemblGenomes-Gn; EBG00001268544.
DR   EnsemblGenomes-Gn; EBG00001268545.
DR   EnsemblGenomes-Gn; EBG00001268546.
DR   EnsemblGenomes-Gn; EBG00001268547.
DR   EnsemblGenomes-Gn; EBG00001268548.
DR   EnsemblGenomes-Gn; EBG00001268549.
DR   EnsemblGenomes-Gn; EBG00001268550.
DR   EnsemblGenomes-Gn; EBG00001268551.
DR   EnsemblGenomes-Gn; EBG00001268552.
DR   EnsemblGenomes-Gn; EBG00001268553.
DR   EnsemblGenomes-Gn; EBG00001268554.
DR   EnsemblGenomes-Gn; EBG00001268555.
DR   EnsemblGenomes-Gn; EBG00001268556.
DR   EnsemblGenomes-Gn; EBG00001268557.
DR   EnsemblGenomes-Gn; EBG00001268558.
DR   EnsemblGenomes-Gn; EBG00001268559.
DR   EnsemblGenomes-Gn; EBG00001268560.
DR   EnsemblGenomes-Gn; EBG00001268561.
DR   EnsemblGenomes-Gn; EBG00001268562.
DR   EnsemblGenomes-Gn; EBG00001268563.
DR   EnsemblGenomes-Gn; EBG00001268564.
DR   EnsemblGenomes-Gn; EBG00001268565.
DR   EnsemblGenomes-Gn; EBG00001268566.
DR   EnsemblGenomes-Gn; EBG00001268567.
DR   EnsemblGenomes-Gn; EBG00001268568.
DR   EnsemblGenomes-Gn; EBG00001268569.
DR   EnsemblGenomes-Gn; EBG00001268570.
DR   EnsemblGenomes-Gn; EBG00001268571.
DR   EnsemblGenomes-Gn; EBG00001268572.
DR   EnsemblGenomes-Gn; EBG00001268573.
DR   EnsemblGenomes-Gn; EBG00001268574.
DR   EnsemblGenomes-Gn; EBG00001268575.
DR   EnsemblGenomes-Gn; EBG00001268576.
DR   EnsemblGenomes-Gn; EBG00001268577.
DR   EnsemblGenomes-Gn; EBG00001268578.
DR   EnsemblGenomes-Gn; EBG00001268579.
DR   EnsemblGenomes-Gn; EBG00001268580.
DR   EnsemblGenomes-Gn; EBG00001268581.
DR   EnsemblGenomes-Gn; EBG00001268582.
DR   EnsemblGenomes-Gn; EBG00001268583.
DR   EnsemblGenomes-Gn; EBG00001268584.
DR   EnsemblGenomes-Gn; EBG00001268585.
DR   EnsemblGenomes-Gn; EBG00001268586.
DR   EnsemblGenomes-Gn; EBG00001268587.
DR   EnsemblGenomes-Gn; EBG00001268588.
DR   EnsemblGenomes-Gn; EBG00001268589.
DR   EnsemblGenomes-Gn; EBG00001268590.
DR   EnsemblGenomes-Gn; EBG00001268591.
DR   EnsemblGenomes-Gn; EBG00001268592.
DR   EnsemblGenomes-Gn; EBG00001268593.
DR   EnsemblGenomes-Gn; EBG00001268594.
DR   EnsemblGenomes-Gn; EBG00001268595.
DR   EnsemblGenomes-Gn; EBG00001268596.
DR   EnsemblGenomes-Gn; EBG00001268597.
DR   EnsemblGenomes-Gn; EBG00001268598.
DR   EnsemblGenomes-Gn; EBG00001268599.
DR   EnsemblGenomes-Gn; EBG00001268600.
DR   EnsemblGenomes-Gn; EBG00001268601.
DR   EnsemblGenomes-Gn; Snas_R0001.
DR   EnsemblGenomes-Gn; Snas_R0002.
DR   EnsemblGenomes-Gn; Snas_R0003.
DR   EnsemblGenomes-Gn; Snas_R0004.
DR   EnsemblGenomes-Gn; Snas_R0005.
DR   EnsemblGenomes-Gn; Snas_R0006.
DR   EnsemblGenomes-Gn; Snas_R0007.
DR   EnsemblGenomes-Gn; Snas_R0008.
DR   EnsemblGenomes-Gn; Snas_R0009.
DR   EnsemblGenomes-Gn; Snas_R0010.
DR   EnsemblGenomes-Gn; Snas_R0011.
DR   EnsemblGenomes-Gn; Snas_R0012.
DR   EnsemblGenomes-Gn; Snas_R0013.
DR   EnsemblGenomes-Gn; Snas_R0014.
DR   EnsemblGenomes-Gn; Snas_R0015.
DR   EnsemblGenomes-Gn; Snas_R0016.
DR   EnsemblGenomes-Gn; Snas_R0017.
DR   EnsemblGenomes-Gn; Snas_R0018.
DR   EnsemblGenomes-Gn; Snas_R0019.
DR   EnsemblGenomes-Gn; Snas_R0020.
DR   EnsemblGenomes-Gn; Snas_R0021.
DR   EnsemblGenomes-Gn; Snas_R0022.
DR   EnsemblGenomes-Gn; Snas_R0023.
DR   EnsemblGenomes-Gn; Snas_R0024.
DR   EnsemblGenomes-Gn; Snas_R0025.
DR   EnsemblGenomes-Gn; Snas_R0026.
DR   EnsemblGenomes-Gn; Snas_R0027.
DR   EnsemblGenomes-Gn; Snas_R0028.
DR   EnsemblGenomes-Gn; Snas_R0029.
DR   EnsemblGenomes-Gn; Snas_R0031.
DR   EnsemblGenomes-Gn; Snas_R0032.
DR   EnsemblGenomes-Gn; Snas_R0033.
DR   EnsemblGenomes-Gn; Snas_R0034.
DR   EnsemblGenomes-Gn; Snas_R0035.
DR   EnsemblGenomes-Gn; Snas_R0036.
DR   EnsemblGenomes-Gn; Snas_R0037.
DR   EnsemblGenomes-Gn; Snas_R0038.
DR   EnsemblGenomes-Gn; Snas_R0039.
DR   EnsemblGenomes-Gn; Snas_R0040.
DR   EnsemblGenomes-Gn; Snas_R0041.
DR   EnsemblGenomes-Gn; Snas_R0042.
DR   EnsemblGenomes-Gn; Snas_R0043.
DR   EnsemblGenomes-Gn; Snas_R0044.
DR   EnsemblGenomes-Gn; Snas_R0045.
DR   EnsemblGenomes-Gn; Snas_R0046.
DR   EnsemblGenomes-Gn; Snas_R0047.
DR   EnsemblGenomes-Gn; Snas_R0048.
DR   EnsemblGenomes-Gn; Snas_R0049.
DR   EnsemblGenomes-Gn; Snas_R0050.
DR   EnsemblGenomes-Gn; Snas_R0051.
DR   EnsemblGenomes-Gn; Snas_R0052.
DR   EnsemblGenomes-Gn; Snas_R0053.
DR   EnsemblGenomes-Gn; Snas_R0054.
DR   EnsemblGenomes-Gn; Snas_R0055.
DR   EnsemblGenomes-Gn; Snas_R0056.
DR   EnsemblGenomes-Tr; EBT00001800719.
DR   EnsemblGenomes-Tr; EBT00001800720.
DR   EnsemblGenomes-Tr; EBT00001800721.
DR   EnsemblGenomes-Tr; EBT00001800722.
DR   EnsemblGenomes-Tr; EBT00001800723.
DR   EnsemblGenomes-Tr; EBT00001800724.
DR   EnsemblGenomes-Tr; EBT00001800725.
DR   EnsemblGenomes-Tr; EBT00001800726.
DR   EnsemblGenomes-Tr; EBT00001800727.
DR   EnsemblGenomes-Tr; EBT00001800728.
DR   EnsemblGenomes-Tr; EBT00001800729.
DR   EnsemblGenomes-Tr; EBT00001800730.
DR   EnsemblGenomes-Tr; EBT00001800731.
DR   EnsemblGenomes-Tr; EBT00001800732.
DR   EnsemblGenomes-Tr; EBT00001800733.
DR   EnsemblGenomes-Tr; EBT00001800734.
DR   EnsemblGenomes-Tr; EBT00001800735.
DR   EnsemblGenomes-Tr; EBT00001800736.
DR   EnsemblGenomes-Tr; EBT00001800737.
DR   EnsemblGenomes-Tr; EBT00001800738.
DR   EnsemblGenomes-Tr; EBT00001800739.
DR   EnsemblGenomes-Tr; EBT00001800740.
DR   EnsemblGenomes-Tr; EBT00001800741.
DR   EnsemblGenomes-Tr; EBT00001800742.
DR   EnsemblGenomes-Tr; EBT00001800743.
DR   EnsemblGenomes-Tr; EBT00001800744.
DR   EnsemblGenomes-Tr; EBT00001800745.
DR   EnsemblGenomes-Tr; EBT00001800746.
DR   EnsemblGenomes-Tr; EBT00001800747.
DR   EnsemblGenomes-Tr; EBT00001800748.
DR   EnsemblGenomes-Tr; EBT00001800749.
DR   EnsemblGenomes-Tr; EBT00001800750.
DR   EnsemblGenomes-Tr; EBT00001800751.
DR   EnsemblGenomes-Tr; EBT00001800752.
DR   EnsemblGenomes-Tr; EBT00001800753.
DR   EnsemblGenomes-Tr; EBT00001800754.
DR   EnsemblGenomes-Tr; EBT00001800755.
DR   EnsemblGenomes-Tr; EBT00001800756.
DR   EnsemblGenomes-Tr; EBT00001800757.
DR   EnsemblGenomes-Tr; EBT00001800758.
DR   EnsemblGenomes-Tr; EBT00001800759.
DR   EnsemblGenomes-Tr; EBT00001800760.
DR   EnsemblGenomes-Tr; EBT00001800761.
DR   EnsemblGenomes-Tr; EBT00001800762.
DR   EnsemblGenomes-Tr; EBT00001800763.
DR   EnsemblGenomes-Tr; EBT00001800764.
DR   EnsemblGenomes-Tr; EBT00001800765.
DR   EnsemblGenomes-Tr; EBT00001800766.
DR   EnsemblGenomes-Tr; EBT00001800767.
DR   EnsemblGenomes-Tr; EBT00001800768.
DR   EnsemblGenomes-Tr; EBT00001800769.
DR   EnsemblGenomes-Tr; EBT00001800770.
DR   EnsemblGenomes-Tr; EBT00001800771.
DR   EnsemblGenomes-Tr; EBT00001800772.
DR   EnsemblGenomes-Tr; EBT00001800773.
DR   EnsemblGenomes-Tr; EBT00001800774.
DR   EnsemblGenomes-Tr; EBT00001800775.
DR   EnsemblGenomes-Tr; EBT00001800776.
DR   EnsemblGenomes-Tr; EBT00001800777.
DR   EnsemblGenomes-Tr; EBT00001800778.
DR   EnsemblGenomes-Tr; EBT00001800779.
DR   EnsemblGenomes-Tr; EBT00001800780.
DR   EnsemblGenomes-Tr; Snas_R0001-1.
DR   EnsemblGenomes-Tr; Snas_R0002-1.
DR   EnsemblGenomes-Tr; Snas_R0003-1.
DR   EnsemblGenomes-Tr; Snas_R0004-1.
DR   EnsemblGenomes-Tr; Snas_R0005-1.
DR   EnsemblGenomes-Tr; Snas_R0006-1.
DR   EnsemblGenomes-Tr; Snas_R0007-1.
DR   EnsemblGenomes-Tr; Snas_R0008-1.
DR   EnsemblGenomes-Tr; Snas_R0009-1.
DR   EnsemblGenomes-Tr; Snas_R0010-1.
DR   EnsemblGenomes-Tr; Snas_R0011-1.
DR   EnsemblGenomes-Tr; Snas_R0012-1.
DR   EnsemblGenomes-Tr; Snas_R0013-1.
DR   EnsemblGenomes-Tr; Snas_R0014-1.
DR   EnsemblGenomes-Tr; Snas_R0015-1.
DR   EnsemblGenomes-Tr; Snas_R0016-1.
DR   EnsemblGenomes-Tr; Snas_R0017-1.
DR   EnsemblGenomes-Tr; Snas_R0018-1.
DR   EnsemblGenomes-Tr; Snas_R0019-1.
DR   EnsemblGenomes-Tr; Snas_R0020-1.
DR   EnsemblGenomes-Tr; Snas_R0021-1.
DR   EnsemblGenomes-Tr; Snas_R0022-1.
DR   EnsemblGenomes-Tr; Snas_R0023-1.
DR   EnsemblGenomes-Tr; Snas_R0024-1.
DR   EnsemblGenomes-Tr; Snas_R0025-1.
DR   EnsemblGenomes-Tr; Snas_R0026-1.
DR   EnsemblGenomes-Tr; Snas_R0027-1.
DR   EnsemblGenomes-Tr; Snas_R0028-1.
DR   EnsemblGenomes-Tr; Snas_R0029-1.
DR   EnsemblGenomes-Tr; Snas_R0031-1.
DR   EnsemblGenomes-Tr; Snas_R0032-1.
DR   EnsemblGenomes-Tr; Snas_R0033-1.
DR   EnsemblGenomes-Tr; Snas_R0034-1.
DR   EnsemblGenomes-Tr; Snas_R0035-1.
DR   EnsemblGenomes-Tr; Snas_R0036-1.
DR   EnsemblGenomes-Tr; Snas_R0037-1.
DR   EnsemblGenomes-Tr; Snas_R0038-1.
DR   EnsemblGenomes-Tr; Snas_R0039-1.
DR   EnsemblGenomes-Tr; Snas_R0040-1.
DR   EnsemblGenomes-Tr; Snas_R0041-1.
DR   EnsemblGenomes-Tr; Snas_R0042-1.
DR   EnsemblGenomes-Tr; Snas_R0043-1.
DR   EnsemblGenomes-Tr; Snas_R0044-1.
DR   EnsemblGenomes-Tr; Snas_R0045-1.
DR   EnsemblGenomes-Tr; Snas_R0046-1.
DR   EnsemblGenomes-Tr; Snas_R0047-1.
DR   EnsemblGenomes-Tr; Snas_R0048-1.
DR   EnsemblGenomes-Tr; Snas_R0049-1.
DR   EnsemblGenomes-Tr; Snas_R0050-1.
DR   EnsemblGenomes-Tr; Snas_R0051-1.
DR   EnsemblGenomes-Tr; Snas_R0052-1.
DR   EnsemblGenomes-Tr; Snas_R0053-1.
DR   EnsemblGenomes-Tr; Snas_R0054-1.
DR   EnsemblGenomes-Tr; Snas_R0055-1.
DR   EnsemblGenomes-Tr; Snas_R0056-1.
DR   EuropePMC; PMC3072421; 21490938.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001778.
DR   SILVA-SSU; CP001778.
DR   StrainInfo; 400963; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082381
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Stackebrandtia nassauensis LLR-40K-21, DSM
CC                            44728
CC   Culture Collection ID :: DSM 44728
CC   GOLD Stamp ID         :: Gc01107
CC   Funding Program       :: DOE-GEBA 2007
CC   Number of Reads       :: 81931 Sanger, 851638 pyrosequence
CC   Assembly Method       :: Newbler version 1.1.02.15, Phrap
CC   Sequencing Depth      :: 11x Sanger; 29x 454
CC   Gene Calling Method   :: Prodigal 1.4, GenePRIMP
CC   Isolation Site        :: Soil sample from Nassau Bahamas
CC   Isolation Country     :: Bahamas
CC   Latitude              :: 25.066127
CC   Longitude             :: -77.339025
CC   Oxygen Requirement    :: Aerobe
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6841557
FT                   /organism="Stackebrandtia nassauensis DSM 44728"
FT                   /strain="DSM 44728"
FT                   /mol_type="genomic DNA"
FT                   /country="Bahamas:Nassau"
FT                   /isolation_source="soil"
FT                   /db_xref="taxon:446470"
FT                   /culture_collection="DSM:44728"
FT   gene            64..1764
FT                   /locus_tag="Snas_0001"
FT   CDS_pept        64..1764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: sat:SYN_02051 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39724"
FT                   /db_xref="GOA:D3PTW6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTW6"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADD39724.1"
FT                   /translation="MTAELGDESLSGQQRAWLAVTQPLGLFEDTVIIAAPHQFAREAFE
FT                   SRLRPMLTEALARRLGRAVQIAVTVRAAETPPPPAPAHPPVPAPPALPPLTGPSRPQPE
FT                   PQPQPEEQPTQQRLYRAHTENMRAENSGHIPSQATPPAEDPRSAPATPPALFDTSALSP
FT                   PQSPNPRPRPTPTSPHSSPQPPVPRPSGPLVSPPPASDPAPERTGFRSDPKPVPPQPAT
FT                   ATRLNPKYSFDTFVIGSSNRFAHAAAVAVAESPAKAYNPLFIYGDSGLGKTHLLHAIGH
FT                   YAQNLGNAKSVRYVSTEEFTNDFINSLRDDKRQAFQRRYRDVDILLIDDIQFLERAERT
FT                   QEEFFHTFNTLHNANKQLVITSDRSPKQLSTLEDRLRTRFEWGLLADIQPPDLETRIAI
FT                   LQKKAAQERLDAPPDALEFIASRINHSIRELEGALIRVTAYASLTNKPADLALAQEVLR
FT                   DFIPEGESPDITTEAIMHATADYFGVSDADLRGHSRSRVLANARQVAMYLCRELTELSL
FT                   PRIGQAFGGRDHTTVMYADRKIRKQMAEKRALYDQIAELTNRLKNQSGS"
FT   gene            2246..3388
FT                   /locus_tag="Snas_0002"
FT   CDS_pept        2246..3388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rpc:RPC_0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39725"
FT                   /db_xref="GOA:D3PTW7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTW7"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADD39725.1"
FT                   /translation="MKLRVDRDALADAVAWTAKSLPVRPSVPVLAGALMTVSDGQLTIS
FT                   GFDYEVSSQVTLPVTSDASGSALVSGKLLAEIVKALPAKPVDVAAEGSHVEITCGSARF
FT                   TLPTMPVEDYPSLPDMPEAVGTIDAAAFAAAVAQTAVAAGKDDTLPTMTGVQLEFTGTG
FT                   LALLATDRYRMAIRDLPWRPDSNDLNVTTLIPAKALSDTAKALGSRGGEVTIALPDPSN
FT                   GPIGMVGFAADGRRTTSRVLDGQLPPLRSLIPVTYAAELRVNAAELASVARRVSLVTER
FT                   NSPLRLNVDGDGLVVEAGGAEDATASEAMDCEYSGDAMKVAFNPQYLLDGLSAISAPVA
FT                   VFSFTEPGKPVTLKGDKANADDDGDFSGYTHLLQPLRYDS"
FT   gene            3420..4298
FT                   /locus_tag="Snas_0003"
FT   CDS_pept        3420..4298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: mno:Mnod_7446 6-phosphogluconate
FT                   dehydrogenase, decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39726"
FT                   /db_xref="GOA:D3PTW8"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTW8"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADD39726.1"
FT                   /translation="MQLGIVGLGKMGGNMRTRLREAGHEVFGFDRDASLTDVADLPELV
FT                   SRLDAPRAVWVMVPAGDPTRDTVHALGELLSEGDVVIDGGNSRFTDDAEHAEHLAGKGV
FT                   GYIDAGVSGGVWGRENGYALMVGGAKGDVDKLMPIFDALKPPGEYGFVHAGGVGAGHYA
FT                   KMVHNGIEYGLMQAYAEGYELLRASEYVDDVPAVFKSWREGTVVRSWLLDLMDRALDED
FT                   PNLDKLAGYATDSGEGRWTVEESIRLAVPLNAITASLYARFASRQDDSDAMKAIAALRN
FT                   QFGGHAVKPEK"
FT   gene            4365..5501
FT                   /locus_tag="Snas_0004"
FT   CDS_pept        4365..5501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gsu:GSU0002 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39727"
FT                   /db_xref="GOA:D3PTW9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTW9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADD39727.1"
FT                   /translation="MHVRRLELTDFRSYGHVDVELPEGPSVFVGPNGHGKTNLIESLGY
FT                   LATGSSHRVTSDAPLVRAGCESATARAAIVHEGRELLAELTITPGKANRARLNRSPLPR
FT                   SRDLIGALKAVVFAPEDLNLIRGEPEQRRRLLDELLIARHPRFAGVRADYDRVVKQRNA
FT                   LLRTAYLARKTGGRGNTDLHTLDTWDAHLAQHGADLLAGRLALIEDYTPYVVKAYEAVS
FT                   AGRGRPRLSYHSALGENEPLSPDRDLLTARLSAALATARSREVERGTTLVGPHRDDLKL
FT                   VLGDLPAKGYASHGESWSYALALRLGAAELLRDNGTAPVLILDDVYAELDSQRRERLAE
FT                   LVARAPQVLVTCAVAEDVPAQMSGGRYDIHDGEVRRVI"
FT   gene            5491..5895
FT                   /locus_tag="Snas_0005"
FT   CDS_pept        5491..5895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   geo:Geob_1482 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39728"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX0"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADD39728.1"
FT                   /translation="MSYEPRRKRRRPTGAWSGPGPDGRDPQPLGEVLGKLIKDRGWRDP
FT                   AAKAGLFANWPQIVGPEIAEHCRPVSCADGELIIEAESAAWATQLRLFKTQILARLASH
FT                   SGPQVVTRLRIQGPSQPSYVTGPRRVRFRS"
FT   gene            6164..8134
FT                   /locus_tag="Snas_0006"
FT   CDS_pept        6164..8134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gsu:GSU0003 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39729"
FT                   /db_xref="GOA:D3PTX1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX1"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADD39729.1"
FT                   /translation="MAAAEKKQDDYNAGSLTVLEGLEAVRKRPGMYIGSTGERGLHHLI
FT                   WEVVDNAVDEAMAGHCDTIDVTILADNGVRVIDNGRGFPVDLHPKLKKPGVEVALTVLH
FT                   AGGKFDSKSYAVSGGLHGVGISVVNALSTRIEMEIQRDGFVWTQSYKHSVPGPLEQGEK
FT                   SRKTGTSVSFWPDDTIFETTVYNFETIYRRLQEYAFLNKNLKIVLRDERPRPESEEDTK
FT                   PREVVFQYAEGIADFVRHLNATKSPLHKSVVMFEAKSEEDGSSLEVAMQWNESYGESVY
FT                   TFANAINTHEGGTHEEGFRAALTTCVNKYGTDRKLLKGTDRLSGDDIREGLAAIVSVKL
FT                   VEPQFEGQTKTKLGNTEVKSFVQRVCNEWLVDWFDRNPSEAKTIITKASAAAQARKAAA
FT                   QARKLARRKSLLETSSMPGKLADCQSTDPSESEMFVVEGDSAGGSAKQGRDPRTQAILP
FT                   IRGKILNVEKARIDKILKNNEVQAMITALGTGIHDDFDIEKLRYHKIILMSDADVDGQH
FT                   INTLLLTLLFRMMRPLVEMGHVYMSQPPLYKIKWNRKGDQVEYAFSDRERDGLIEMGMS
FT                   QGKPDPRKYDGIQRYKGLGEMNYTELWETTMNPATRALLQVTLDDAATADELFSVLMGE
FT                   DVETRRNFIQRNAKDVRFLDI"
FT   gene            8248..10743
FT                   /locus_tag="Snas_0007"
FT   CDS_pept        8248..10743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: dol:Dole_0673 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39730"
FT                   /db_xref="GOA:D3PTX2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX2"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADD39730.1"
FT                   /translation="MSDPNQPELEVPEVGAGRIEPVGVEVQMQRSYLDYAMSVIVGRAL
FT                   PDVRDGLKPVHRKILYGMYDGGYRPDRGYVKCSRVVGDVMGQYHPHGDSAIYDSLVRMA
FT                   QPWSMRYPLIDGQGNFGSPGNDPAAAMRYTESRLDPLAMEMLRDIDEDSVDFGPNYDGK
FT                   TTEPEVLPARIPNLLVNGSEGIAVGMATKIPPHNLREVAAAVNWCLDNTEADEEETLEA
FT                   LIKLVQGPDFPTSALIVGRAGIEDAYRTGRGSIRMRAVIEVEEDRKGRPCLVVTEMPYQ
FT                   VNPDNLAERIAELVKDGKLNGIADIREESSGRTGMRLVLVLKRDAVAKVVLNNLYKHTQ
FT                   LQETFGANMLALVDGVPRTLNLAQFVRHYVAHQIEVIVRRTKFRLRKAEERAHILRGLQ
FT                   KALDQLDAVIALIRSSPSAEESKTGLMNLLEVDEIQATAILDMQLRRLAALERQKILDE
FT                   LAEIEAKIADLEDILAKPERQRQIIKDELGAIVAKWGDERRTKIVPFEGEVNMEDLIAR
FT                   EDVVVTITRGGYAKRTKVDLYRSQRRGGKGVSGATLKQDDLVSHFFVCSTHDWMLFFTN
FT                   KGRVYRAKAYELPEASRTARGQHVANLLAFQPDEQIAQVMQISGYDVAPYLVLATRRGL
FT                   VKKTKLTDFDSPRTGGVIGINLRDGDEVVGAALINPDDDLLLVSKKAQAIRFMASDESL
FT                   RPMGRATSGVIGMRFVEADELLTMEVVRGGMDILVATSGGYAKRTPVEEYPQQGRGGKG
FT                   VLTAKITERRGNLVGALSVTPDDELFAITSEGGVIRTPVKPVRRTTDRNTMGVKLMDLP
FT                   EGVSLLAMARSADEPDEQD"
FT   gene            10749..11357
FT                   /locus_tag="Snas_0008"
FT   CDS_pept        10749..11357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GNAS; GNAS complex locus"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39731"
FT                   /db_xref="GOA:D3PTX3"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39731.1"
FT                   /translation="MTDAQAGGGTAAGRATVAADTSEGAAPTQGGATTYTRPPGMAAPP
FT                   TSPDQIGGRSGAPEGPARVADAVRAARAAVSAAAGRGPRRARLHLKRVEPWSVMKFSFA
FT                   VSIVLFIVMIVATTVLYIALDAMGVFDSVNELLVSLVGGGGGSDEPFQLTAKGVILVSA
FT                   LLGLVNMVLFTALSTLGAFIYNVCADLVGGIEVTLAEKE"
FT   gene            11445..11521
FT                   /locus_tag="Snas_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            11445..11521
FT                   /locus_tag="Snas_R0001"
FT                   /product="tRNA-Ile"
FT   gene            11687..12403
FT                   /locus_tag="Snas_0009"
FT   CDS_pept        11687..12403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amc:MADE_03575 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39732"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39732.1"
FT                   /translation="MSDKASEFITLMTAVKELLNEAGQQSNSAAGIADEAAELFAQGGN
FT                   ANSHTMMTQAAESARKVLTQVAGLVSTTDEAIAQAQQAKGNLHTSSSGSSGVREPVAKI
FT                   GDPIEAPQGGPDDTSDHRAELKSADDDDEEMTRADRALRVMARNAGDVETVTKDIVQTA
FT                   SSMFRTYKEDKPGSGQPSRMATGQSEAQTQVPQPKISSDTPQGPSFEGMAVATVLGGVA
FT                   AIQGIKALRSRQPKEK"
FT   gene            12407..12853
FT                   /locus_tag="Snas_0010"
FT   CDS_pept        12407..12853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39733"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39733.1"
FT                   /translation="MNARTKYRAMLRAGLVGDFDAAEQLGTELGEVAWNDSGLLVNALF
FT                   VLAVQRKFDDDTDRDVIREFVRETLDDYKSADPPFKPLMTEGLIRSVLGEEELYPEIPK
FT                   NEAIPVQTAIINKIVADARTSPDKVDELLDKAEKLADRWIQQSK"
FT   gene            complement(12924..14750)
FT                   /locus_tag="Snas_0011"
FT   CDS_pept        complement(12924..14750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0011"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ara:Arad_3241 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39734"
FT                   /db_xref="GOA:D3PTX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD39734.1"
FT                   /translation="MFRRLGDLADPFLPDPPHNPPTRVWPFLKLQLRPLRHIITASLLF
FT                   SAASAAVEVWLIFYTGQLVDTLAATTPARLWAEHGLELVLVAALFLILRPLLWTGRESL
FT                   DDIAFRPNAATGTRWRLHRHVLGQSVGWFRKDLAGRIASRVTELTTAATGAAYTVLHTL
FT                   SFVGMYIVGSFWLMSAQDIRLAIPLALWIGLYFAVMAYVVPRYRRASQRHQSTQSALTG
FT                   LLVDTYANIDTIKMSATGTDDPESRRRFADNHTAHLRLQRVEVTINASMMALGTILTVG
FT                   LVGYSIALWQTGAAPLGLVAASLALSLRVNGIAEWLLDAVTALFGCLGAMREHLPTIAQ
FT                   PLEITDAPTATDLTITGGAIRLHDVSHHYGKETGGLDRVCLNIPAGQKIGLVGRSGAGK
FT                   STLVNLILRFFDAESGTITIDDQNIRAVTQDSLRHHIALVSQDASLLHRSVAANITGGV
FT                   DNIDRTRITEAARKAAADGFIPTLRDATGRTGYDAHVGERGVTLSGGQRQRIALARAFL
FT                   TEAPILVLDEATSALDSESEAAIQETLSEIMADKTVIAIAHRLSTIAHLDRIVVLDEGR
FT                   IVEDGSHDQLLTTGGIYADLWKHQSGGFLSST"
FT   gene            complement(14936..17722)
FT                   /locus_tag="Snas_0012"
FT   CDS_pept        complement(14936..17722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0012"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG: pol:Bpro_3193
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39735"
FT                   /db_xref="GOA:D3PTX7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX7"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD39735.1"
FT                   /translation="MLATRSRPETSGPEADTVSHMLFGRTQETAHIERLLDEARQGRSQ
FT                   ALIVRGEAGIGKSALLGHALTAADDFRQLRAIGIEAESELPYAHLHMLLHPVLHRIDAL
FT                   PKRQASALRGSLGLSDETSGDRFMIGLAVLTLLAEIADEGPVLCVVDDAHWIDRESADA
FT                   LLFAARRLEAEGVVVLFGARDQHAPAFPSHGIAELDLSNLDDEAAAQLLAEYASDLSEP
FT                   ARRQVIAEAVGNPLALRELPVAQREGQLTLDPYRVSALPTHSRIQRTFADRIATLPDST
FT                   RTLLLVAAAHGSCDAPPILAAATKLGSTMEDLELAERKQLLSMVDGHLCFRHPLVRSAT
FT                   YQEASTAERITVHTALAEAITSPAHAERRAWHLAAAATGPDEKIAAALEEVACAGQARG
FT                   GRNAVASAYERSAQLSPDPDEKARRFQAAAAAALAAGQLDRADALAAEAASNTTDPKLL
FT                   GRLAHINAHVAYGHGNTMASYHGWVSAAREVAPHANLQASYMLFHAVEAAWMAGNFAAV
FT                   DEVAELATSMKLRNAPRVLAMARVAHGLGDRHGDVADGVAALRELIATTGRSHEPTLQD
FT                   RATIAWWHLLLGDHTTALDLTASLVADCRATGAMGVLPRALALQAKAQLYSGHHRDAAA
FT                   SATEALRTAEESGNQPIMIGVPLSTLAYLAAIGGDEKRCLELLSKLPGADDGRGILLLD
FT                   GALGVLDLTLGRNESTVDRLAELANRRNRMDMLPTVTDLVEAASRSGQPERAREPFGWF
FT                   TAFAEHIDQPWAMALVERGRALLGPDAEAEQHFIRAVEFHNQPGDRPFERARTELLYGE
FT                   WLRRSRRRSDARGHLRSALDTFERLGVTPWAERARTELRAAGDSQGPAALRPEALSQLT
FT                   PQELQVVRLAATGMTNRDIGAQLFLSPRTVGYHLYKAYPKLNIASRGELATLDLQAA"
FT   gene            complement(17859..18845)
FT                   /locus_tag="Snas_0013"
FT   CDS_pept        complement(17859..18845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0013"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mll2594 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39736"
FT                   /db_xref="GOA:D3PTX8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX8"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADD39736.1"
FT                   /translation="MRAIRQYEFGPAENLLYEELPDPVPGPGQLRIAVEAAGVHLLDAA
FT                   IRSGDAGSHPFGNPELPMTPGREVAGTVDALGPDVDESWLGRRVVAHLGIASGGYAELA
FT                   VREAEAVHPIPDGLSSEAAVAMIGTGRTAVGVLDVAAPTADDVAVVLAAAGGIGSLLVQ
FT                   ALRASGATVVGAAGGEAKTRLVRGLAGGVIAVDYTEPGWPKRVTEALAGRQPTVVFDGV
FT                   GGDNGRAALELLGVGGRFVMFGWSAGEITELSGQDIVDRGLSVTSALGPRMLSRPGGLR
FT                   GLEIEALAKVADGTMSPPVRTFPLKDASGAHEALVNRDTVGKVVLVP"
FT   gene            complement(18872..19444)
FT                   /locus_tag="Snas_0014"
FT   CDS_pept        complement(18872..19444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0014"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   hch:HCH_01442 flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39737"
FT                   /db_xref="GOA:D3PTX9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADD39737.1"
FT                   /translation="MSTEPLNLAVIIGSTRKGRFGPVPANWFADQARKHGDYNVDVIDL
FT                   LDADLPMHIEVDDHPHVEAVSERLHKADAVVIVTPEYNHSFPASLKAAIDWYQAEWHAM
FT                   PVGFVSYGGMVGGQRAVEQLRQIFPEVHALTIRNTLNFVNFWDKFDDQGQPRELDATNK
FT                   AAKELLDQLGWWARALKQAREASPYPG"
FT   gene            19648..21021
FT                   /locus_tag="Snas_0015"
FT   CDS_pept        19648..21021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0015"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rme:Rmet_3984 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39738"
FT                   /db_xref="GOA:D3PTY0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD39738.1"
FT                   /translation="MTHTPETSTGEKTRWAPIVALAMAMVVITSDMTIAAVTLPSLGED
FT                   MDVGAAATAWVLLGYSLPMAAIAIPAGRWADRADLRAVFVLSMTGVAVASVAAALAPTF
FT                   WVLVVARLLQGFTGALTMSVYMPIVAAAVKTEQRGRAIGYIITIMTLGGLIGAPLGGLV
FT                   AGGLGWRAVFLLKLPIVAVAIVLALKSVPSNGKRLPLPDAALWRDTLVVGGAVGSLLLA
FT                   FDRIERQPLAATGLIALAVVLAVLWLRFRSSRPMVAVLGRRVLGLPMLGLFLMSFMIGL
FT                   ISFLLPYYFTDELNTGPEAMGVAMLFFSGAMAPISPLAGGLADRFGALRIASAGAVVSI
FT                   LGLGSMLTLGPDSSMVDVIWRLVLLGVGAALFNGPINAALMAATPADMLGTAGGMFATT
FT                   RTLASTIGPAVTAFVWSTAGGGMPGFTTATAVLTALSVLGLGFVLAGRSRQPALATAA"
FT   gene            complement(21038..21350)
FT                   /pseudo
FT                   /locus_tag="Snas_0016"
FT   gene            complement(21366..22034)
FT                   /locus_tag="Snas_0017"
FT   CDS_pept        complement(21366..22034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0017"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: net:Neut_0085 transcriptional
FT                   regulator, MerR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39739"
FT                   /db_xref="GOA:D3PTY1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY1"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADD39739.1"
FT                   /translation="MMRIGELSNRSNVPVATIKFYVREGLLPSGQRAKANQVSYDESHL
FT                   RRLRLIRALVDVGKLSIATARRVLAILDDPSTSAFTGMGKAQYALSGHPDLDPDTPPPP
FT                   AAAPEDLAEVDDLLARHGWSIRPGNPARAQLATAMATARALGLADGLELLDTYADAAQT
FT                   VAEADVGLVVSPQAEQGTSPEATTLEESIERMLVWTVVGGQALAALRLLAQEATATKRL
FT                   "
FT   gene            22138..23130
FT                   /locus_tag="Snas_0018"
FT   CDS_pept        22138..23130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0018"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bra:BRADO6558 putative short-chain
FT                   dehydrogenases/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39740"
FT                   /db_xref="GOA:D3PTY2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD39740.1"
FT                   /translation="MNDGTHPDDHADEPAATDDTPTAPKPGRRYTRRRLLTTSAVAAGA
FT                   AAVAVGTTAVLTNDGTPPTIKPSGRNRFDGKVVIVTGATSGIGRAAAKLFAAEGAKVGF
FT                   CGRREKLGAEVEREIRSDGGEATYIRADVRKESQVRKFVDRVADEYGGLDVCFNNAGIT
FT                   LQKPLHEYTAAEWDDVVDTNLRGTFLCMKYEVPHLIERGGGSVVITSSSNVHSTGEERS
FT                   AYTASKHGLLGLANCAAYDYAEHNIRVNTLIPGTTNTELVRRVAGAMDLPDAVWEEMAA
FT                   AYGRANAPTMKRLATPEEIAVGALALASPDFSYMTAGSLTLDGGDSNRG"
FT   gene            23187..24437
FT                   /locus_tag="Snas_0019"
FT   CDS_pept        23187..24437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0019"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bxe:Bxe_B2976 putative
FT                   beta-lactamase class C and other penicillin binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39741"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY3"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADD39741.1"
FT                   /translation="MTNLNSTEIKTDNDSGFSDAGLRRLRGVLERHVDSGKIPGLVALV
FT                   SRDGHTHVETLGTMRHDGGAPMRRDTIFRVASIAKPVTMAAAMILLDECRMRLDEPVDE
FT                   WLPELANRRVLKRPDGPLDETVPANRPITVRDVLTCTFGLGVDFELMTAPIRAAIFEAT
FT                   DYGVGSGPAPGFDEWMRRLGELPLSYQPGERWQYDLPSEVACVLVSRVAGQPFGQFLRE
FT                   RVLEPLGMKDTGHHVPDGEIHRLPPLYGPDPQTGEFLVWDEAEGGRVSQAPEFEGTALV
FT                   STVDDYHAFFRMLLNGGTHQGRRILSRPAVELMTTNRLTPEMNSARDDMYRAILHLSNG
FT                   QGLHGGWGLGMAVRTRRGDYAPVGQFGWDGGTGTSVYADPHHRLTGMLFTQVGMSTLDS
FT                   VRLIQDFWTTTYQAIDA"
FT   gene            24604..25716
FT                   /locus_tag="Snas_0020"
FT   CDS_pept        24604..25716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0020"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: ank:AnaeK_4268
FT                   ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39742"
FT                   /db_xref="GOA:D3PTY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD39742.1"
FT                   /translation="MATVTYKGASRIYPGTKKPAVDKLDLQIEDGEFLVLVGPSGCGKS
FT                   TSLRMLAGLEEVDEGSIFINDTDVSNLPPKARDIAMVFQNYALYPHMSVFDNMAFALKL
FT                   RRTPKNVIKEKVAEAAELLDLTEYLNRKPKALSGGQRQRVAMGRAIVREPQVFLMDEPL
FT                   SNLDAKLRVQTRSQIASLQKRLGVTTVYVTHDQVEAMTMGHRVAVLKDGLLQQADTPRA
FT                   LYDSPANVFVAGFIGSPAMNIKTVPLTEDGAKFGEVIMPLSRETREAASEGISGDKTVT
FT                   VGIRPENCTLGSGENGGIAIEVDLVEELGSDAYVYGHAVYSDGEERFVVRTDGRTVPSL
FT                   GETVHVIPEVGREHVFHATTGERVGKTVTK"
FT   gene            complement(25785..26558)
FT                   /locus_tag="Snas_0021"
FT   CDS_pept        complement(25785..26558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Eln; elastin"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39743"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39743.1"
FT                   /translation="MNKWLQRTVGTASIACGIALAASGIAQANQPIEIGDPLGSVSSLS
FT                   SVADPGSVTGLAGGVPTDGLPAGGLPTDNPVGMVPDATQLTGQVGGVTKDLPGKKVVGS
FT                   VSKLGKTGTQAADTAAPKTEGLPVGDGVPVVGGVTHGGLPVVGGNPITGGSAGQDLVNG
FT                   VPVVGNMVGSAMNPNTVPAAAAKPAKAEKFGMGSDLVGSTMLGKGAVGGLHGDVTRPAE
FT                   DLPLVGQLPVVDGLTQGGLPGATPLGADAPAPKKK"
FT   sig_peptide     complement(26472..26558)
FT                   /locus_tag="Snas_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            26946..28607
FT                   /locus_tag="Snas_0022"
FT   CDS_pept        26946..28607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0022"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: mxa:MXAN_5903 TrkA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39744"
FT                   /db_xref="GOA:D3PTY6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY6"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADD39744.1"
FT                   /translation="MAFRLVEELVFRHRENVTVILPSRRRNHGPQISRVPTVRVVENDQ
FT                   LDADAFSSARITQAKALALMAQDDVGNIHAALRALEITEIRVVVRCFNTNLGNRIEPLL
FT                   GDCTLLSDASMASPSFVAAALGEVAPRYSQVLGRTLYVTASASDRGDRLTWPIAGGPDE
FT                   GVLLPGEEVEPSLFVTVATRRPRRALVTASKHRVRSLATRLWDELREILDRKLRFITLF
FT                   LVAVIVLGSFLIWNSHKGDGQSFGWLESAYVVILAAAGGIDPVTGAEFAEKFAHVLVAI
FT                   SGVLLVPIFTASIVENMVGRRLAAEAGRLRGPISDHVIVVGLGNVGTRIAVQLRNLGVP
FT                   VVAIERNARCHGVDVARSQDIPVVYGDASQLETLHAAQVRTCRSLVAVTSNDIVNLEAA
FT                   LHARSIRQDLRTVLRLFEQDLAERVQKHFDISASLSVAGVAAAEFAAAMTDRNVKGTIP
FT                   VGRHLVLIGEFTVEDGSELAGQPLSQIDADESLRVLAISKVDETDWAPDPQRLMDPGDT
FT                   VLVLATRRGLAATVRRAAPSTGPEEPRLGQPSPFRP"
FT   gene            28682..29839
FT                   /locus_tag="Snas_0023"
FT   CDS_pept        28682..29839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0023"
FT                   /product="PKD repeat-containing protein"
FT                   /note="KEGG: hch:HCH_06922 PKD repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39745"
FT                   /db_xref="GOA:D3PTY7"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY7"
FT                   /inference="similar to AA sequence:KEGG:HCH_06922"
FT                   /protein_id="ADD39745.1"
FT                   /translation="MRRVATVAALGLLAAAVPLLLGPGAGAEQQDKAPSPSRDVNTVEI
FT                   AEIESADVDMSYLAGRRKVLSYPGARFVKLHFSRLELAPNDYITISDPYGGQETRYTGQ
FT                   PGALWTTSVTGDSAVVRLHSEEGPLSDAMTKFGAEIDKVSKGLSPDEVRKRERAERRPE
FT                   SVCGDDDQRDAVCYESTEPEVYANAAPVARLLIDGSTMCTAWRVGSKNRLLTNNHCFET
FT                   SEQARDTEVWFNYACSGCGGQALKKAVKVRGESVIETNAEYDYTLFTVDDFDAIRRFGQ
FT                   LELADRAPREGEKLYIPQHPGGEPAKVALESDADSGACVVDKPSFDGYVDGSDVSYYCD
FT                   TEFGSSGSPVLSRETHEVIGLHHFGGCPNSGVRSDKIHDRVKGDI"
FT   sig_peptide     28682..28765
FT                   /locus_tag="Snas_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 28"
FT   gene            complement(29910..30440)
FT                   /locus_tag="Snas_0024"
FT   CDS_pept        complement(29910..30440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_2508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39746"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY8"
FT                   /inference="similar to AA sequence:KEGG:Sde_2508"
FT                   /protein_id="ADD39746.1"
FT                   /translation="MPTKKLPSPVYAAAGAGEALVEQLKKLPSKAEELRDRTKLDERAT
FT                   KLRETVTENVKQGVDTLKHLDREKLREVALETASTLGEKAREAREKAAETYSEFVERGE
FT                   HVVAGERGPIKVISTVAKEDAKADTEAKVEQAKAEATEKAEAKPATRKPAAKKSTAKKT
FT                   TTKKATTKAEGAK"
FT   gene            complement(30455..31006)
FT                   /locus_tag="Snas_0025"
FT   CDS_pept        complement(30455..31006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0025"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bam:Bamb_4279 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39747"
FT                   /db_xref="GOA:D3PTY9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADD39747.1"
FT                   /translation="MAERDIGGFIRDLRRNAKVSLRQLADQAGVSNPYLSQIERGLRKP
FT                   SAEVLQQIANALKVSTPLMYLRAGLLKTKDGQGTLATIAGDPLLTARQKQTLTEIYEAF
FT                   RRENARDAGLDLDDEASEPAVTDDEVAAAADGIPEEMGIDEPVDVSPSPKVKPAPQRRG
FT                   ARTRTRRTPAAPPTTNDTSE"
FT   gene            complement(31080..33551)
FT                   /locus_tag="Snas_0026"
FT   CDS_pept        complement(31080..33551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0026"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: sfu:Sfum_2279 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39748"
FT                   /db_xref="GOA:D3PTZ0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ0"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADD39748.1"
FT                   /translation="MNEDALNTGSAAEPTAFPPVPPPASPADSPPRWRGLALAYVIIAG
FT                   VAVVGIALVALTGGWVADQLKLYMDETISRGSWPMLTLITAVVAALFCAPLPFLRRLPR
FT                   VAAVGWAWLGGCAAMAVLGATRVVPVAAGEWQLLVQAVAFSIVAGALWLVARWGDRRES
FT                   PADDHNHAGDNEADVAPPAPGAFWLALSLGGLTILPWAWFGALGGLWETLLAAAVALAF
FT                   AAVAAFVVGDRYWSTFAPSPTDAETGSSRTGVSAAARIWGGGSAAGVALLLLSSGVGAA
FT                   GLQIPIMITLAAMGFAIAAVMSRPRRCGRVVAAAVAPAVFGPLAFADGDEFVLALLNPE
FT                   IGQWAGIALATAVVTAWIVGLVYGVAQRRIVAYPSAAAALAVVVAAACVAANGVSQPGL
FT                   HGEKLFVVMEKQADLSGVDGDREQRLTEVHKRLIDTAKSSQKSLRAELDDRGLEYQSFY
FT                   LVNAIEVDTDQFSRSWLESRDDVAKVLLSPQLRPLRTPAGPDTGTKLDSTDPQPNIEKV
FT                   GAPKVWDKADGEGITIGISDSGVDGDHPAFADRFRGGDDSWADPVNDTAKPNDPNGHGT
FT                   HALGLALGGNGVGVAPGAEWIGCTNLPRNAANPADYLSCLQFMLAPYPHGGDPVADGDP
FT                   TRAPHVLNNSWGCPGIEGCDATVLGGAVRAFDAAGVFFVVSAGNSGPTCGSAKTPPANY
FT                   RYAYSVGAVNSDDELASFSSRGPVTADGRKVAKPEISAPGVDVISAMPGGGYGPNTGTS
FT                   MAGPHVAGAVALLWSANPELVGDIENTKDILNRTAAEVTKAEAGSSLDDCGENAAGAGI
FT                   VDVAKAVSEKS"
FT   gene            33595..35343
FT                   /locus_tag="Snas_0027"
FT   CDS_pept        33595..35343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0027"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vei:Veis_2018 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39749"
FT                   /db_xref="GOA:D3PTZ1"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADD39749.1"
FT                   /translation="MRADRTQSRYQAGALSPQRRAADLERMRTEHFDVLIIGGGVTGTG
FT                   AALDAASRGLKVALVEARDYSSGTSSRSSKLIHGGLRYLEQFEFGLVHEALTERGLLCH
FT                   RIAPHLVHPLAFLAPLSGRVWQRAYYGAGLALYDTLATALGGSSGRLPLHRHLSKRRTR
FT                   RLFPGLSSQKVLGSIKYFDAQTDDARFVTTMARTAASYGAAMATSARVVGFQRDARQVT
FT                   GARVADMETGDEFDVSATTIIAATGVWSNDLSGMLGSQVGLRVRASKGIHLVVKRSAIN
FT                   GDSAIILRTSSSVLFILPWGGHWVIGTTDTDWSLDRDHPAASAIDVAYLLELANGILER
FT                   PLSIDDVEGVYAGLRPLLSGEDEDTSSLSREHAVVEPMLGLLLVAGGKFTTYRIMAKDA
FT                   VDRAARRLHGVPASRTADIPLLGADGYRQAWAGRERLASRTGVHPGIVEHLLRRYGTLA
FT                   QEVLALIAENPKFGEPLAGAPEYLAAEVVYAVRNEGALHTDDVLTRRTRVSIETSHRGE
FT                   KSVEHVVALMGDELGWDKATRDNEISHYLSRVAAERDSQRQPDDATADAARLGAEDVRV
FT                   GLNTPV"
FT   gene            35423..35498
FT                   /locus_tag="Snas_R0002"
FT                   /note="tRNA-Arg1"
FT   tRNA            35423..35498
FT                   /locus_tag="Snas_R0002"
FT                   /product="tRNA-Arg"
FT   gene            35568..36209
FT                   /locus_tag="Snas_0028"
FT   CDS_pept        35568..36209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39750.1"
FT                   /translation="MNRTYVRLMPIVYGGIRECAPYSPPRVGVVDAVAARTRSRSMPGA
FT                   GKTTVTGLASQRLPRAARLLGDVITRLIVSGRVGFNEEPAEEATRQVELGNRNLCALAA
FT                   NFADTGFTSFIDTVIPTREQLNLFVELLAPRPILLVVLAPGIAACQYRNTIRDPEDRFD
FT                   FDGYDELDAQMRRELGGLGWWFDTSALNPETTATRILSEASKRAQLTAQA"
FT   gene            complement(36691..37593)
FT                   /locus_tag="Snas_0029"
FT   CDS_pept        complement(36691..37593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39751"
FT                   /db_xref="GOA:D3PTZ3"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39751.1"
FT                   /translation="MNELKPRAFWWAAAVGVLLTTVVATTLSTIALASGNTETAQLWID
FT                   IVTRSLTVTAGLGGAFALWLAFRRQRHTERDAVNRRTTELRIQAIEQLGSDKPIVRIGG
FT                   LHNLEALAQGNSGLQEIVLEEICTYLRMPFYEPHDTENYDIKELWGVTQEREARRTAQH
FT                   ILERHLKPDGPYEYWDHDQLNLRQAALNDLNLRGCRLNNADFAAAELGGITDFRDAAFR
FT                   GDTTSFTMTEFDAAWFDNALFTAVARFHDTIFTQPPNFTGAAATRDDSVEHVWPNGWHL
FT                   DPNSDSTGFHQITKDELAE"
FT   sig_peptide     complement(37492..37593)
FT                   /locus_tag="Snas_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.984 at
FT                   residue 34"
FT   gene            complement(38185..38565)
FT                   /locus_tag="Snas_0030"
FT   CDS_pept        complement(38185..38565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcs:BCAN_A1922 protein GntX"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39752"
FT                   /db_xref="GOA:D3PTZ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39752.1"
FT                   /translation="MTVPSSDGRENHPLQEIAGISTIRQLVPTINPAYSAKNRRFQLDA
FT                   FRPFENDLTGSKVLVIDDTWVSGSTVQSLAHRVKRDGASTVVILTLGRWAVWDKPVWKS
FT                   LIEQSINSATAFDVETCALNHV"
FT   gene            complement(38946..39869)
FT                   /locus_tag="Snas_0031"
FT   CDS_pept        complement(38946..39869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0031"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: glo:Glov_3267 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39753"
FT                   /db_xref="GOA:D3PTZ5"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ5"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADD39753.1"
FT                   /translation="MQPASTSARSAVVALLGRRGIKRREVVNAILERDDPAAGIEILEQ
FT                   HLRETEGLFHESSLSELLEYAEQQIVAWEDAGIGVHTCFDPDYPQQLRDIREMPLVVFT
FT                   RGSLADDARAVAVVGTRRASDEGIQRTRHIAQMLAHNGITVVSGLAEGVDTAAHQTALD
FT                   LGARTVAVIANGVDQCYPRSNLGLQAEITQTGLILSEYLPHVRPAKWQFLERNAIMSGY
FT                   AAATIVVEANERSGTRTQVQRALEHGRPVILLDNVLSVSWAKDAATRPNVQVATNLTDL
FT                   QDVINELLTVPPLATEHLPSASPIFA"
FT   gene            40068..40156
FT                   /locus_tag="Snas_R0003"
FT                   /note="tRNA-Arg2"
FT   tRNA            40068..40156
FT                   /locus_tag="Snas_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(40179..42224)
FT                   /locus_tag="Snas_0032"
FT   CDS_pept        complement(40179..42224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_2004 extracellular repeat protein,
FT                   HAF family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39754"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39754.1"
FT                   /translation="MTRPPRRWWALSVVIAVVAGLATAAYAIVTGGIDLSGRGEPEDCE
FT                   YNAFDAPMRITGMSPNGKYIVGIPTDMDSDTTFGVWHDGEYFETTVAADRYSELLDIND
FT                   SGDVLGYSTVDSVIWRHIDGEFQYLKAPDGSSEVIPEAIGADGTVVGSTSDETAPRPVK
FT                   WSPGSVKATELDLDGHDRGTAVDITENGTIVGHVGDGDTATDAWRWDADGKGRKIFGIK
FT                   TIPGLPGVDVAGDSEAVSVTGDWVLFTAGASQYRAHLDDPDRPQKLKVRLAFLDEYGRA
FT                   YGSKKGDPAVYDEKVTKLPGLTAPPEPAEDDPDELFNEILAVSGDGGRIAGRTWDDKEV
FT                   LWICDGSRLPKTVKASAPDSEADGPSKEPKACEVKALTTLEGKDFATETHVSPDGAYAA
FT                   IGIAYFEEEKSDSFGLWHDGEYTEVDGVPRLGNVNVYGVNSSGTVIGESSTTGDGEDRS
FT                   TYWRYQGGKVQTLDMPAGAASSRPSAIGEDGTVVGTFQDLESRSGPVMWKPGRSTPTKL
FT                   DNGGHHEGEASDVSESGVIVGSLPEKKDYAGKAWMWDKDGKATQLPDVGTKDDYSAAVA
FT                   IAGDWVLLTTQDNGNYTHYRYNLKDKGEPEKVKLTEANDIDAKGRVYGTNGSSLAVYDG
FT                   AFNEQPGLDDGSGEAPVTDDQINSASTDGSTFAGVSADEPALWTCD"
FT   sig_peptide     complement(42141..42224)
FT                   /locus_tag="Snas_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.712 at
FT                   residue 28"
FT   gene            complement(42427..43995)
FT                   /locus_tag="Snas_0033"
FT   CDS_pept        complement(42427..43995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_4175 general secretory system II
FT                   protein E domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39755"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39755.1"
FT                   /translation="MGTSYEGLNLDQIHQIASADNDSAVEIDEQADGARVLAEAVACAV
FT                   DRLAEAHRYIGQEDLEQVSKALMVDGDRAASSGSLAGLVSGAVTGFEGEAARAAIDRVV
FT                   RLTEVSESGREQLEPQHKAFSAVADLVRRNHLRITELREEREKWLSVARADPENSRLRE
FT                   EFADAVGVWGLDQGRLIQAINDRYDADGRSAMQSSAEAYLRHVESLAPPRPYDGPRRSR
FT                   GGSGGGSGDGGSATSSPGPTLASLPGAEAPLPAASASAPASSSGVGGPPLLQTGPVAGP
FT                   VLPPVTGPTVPPSASTPGPFGPSGYYVPSVRVTPPVIGARSARPFGATGTPPLRPNPNG
FT                   VVRPVIGQRPGPVASGTTRPVVRPVINGAANTVGRGTPAGAGGRGAPKPGSRPIVPSRH
FT                   GRPPQPGTRVASDRPVKAEGKVIRAGTERLRVESPEFSRTPRNIHGGNENLNRAVIRGS
FT                   RALTPSPAERIEPKPAPAADPDWCAEATVVRPVIRGFRDKRDEPVFDPGPIVTPHSLGR
FT                   GTGSA"
FT   gene            complement(43979..44374)
FT                   /locus_tag="Snas_0034"
FT   CDS_pept        complement(43979..44374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39756"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39756.1"
FT                   /translation="MTSEIRLDKRALREFISLMDQTAEEMADIQDGTTPRYARSGGGGE
FT                   AAYRNGVKVTVGSVDFAHPGRVAGELMADRIAETLEFVRSLEEGSRALARIVRSVLDDM
FT                   GARDSIAASDLARINNSMEGRSRGDQL"
FT   gene            complement(44403..45365)
FT                   /locus_tag="Snas_0035"
FT   CDS_pept        complement(44403..45365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39757"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39757.1"
FT                   /translation="MASDFAAQIDAKLDEIVDAYLSRYAQISIKGIAAHAQAGGKGPGP
FT                   TTRSVQADSDAMDQALLQMLELQRPVWRSWFMGLGEPGPEGANEAAQSMRTVFDSMDLN
FT                   SENHPGHPVHRIQTNKMSGWKAAASTAFATYLGKLAHAMDNQRAIAEVIKGFPEVRGKL
FT                   TDAAQEHALDIAEATIAALKQRAKEAAKERRQAFGEFIKGFAEIVGAVLTAPAGGVAVA
FT                   AAAGAIKGMGGVISKQVENMGGTEPPQIIDSMEEALRKAKEGLNEDRAKLRASMMDVLS
FT                   HRVNQPDNEDYLLRPPELGYLSPARTRRVRSEVAGSTTR"
FT   gene            complement(45355..45720)
FT                   /locus_tag="Snas_0036"
FT   CDS_pept        complement(45355..45720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39758"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39758.1"
FT                   /translation="MTKIVDEVIDAYPDYIRSIADDDVAQMSRKAGATAEALRTCQGSA
FT                   EAAFGGGFSDMAEIWGELVGGLANHLSDTRDRLQVTTKALHRVAADYLDTDETNADDTN
FT                   RAASGLPQTDGRLSDGF"
FT   gene            complement(45756..46277)
FT                   /locus_tag="Snas_0037"
FT   CDS_pept        complement(45756..46277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39759"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39759.1"
FT                   /translation="MSLLSKLDRLNVTARSADQSVRVTVSPKTGMRVEIDPKRAQSHTD
FT                   SLLARQVSTAVRGALRATHQASKQILDTWQAPESIAVDWDEVADRAREFNELTEEIDVS
FT                   AESGRGLVNVTLRGNTGVDIAVKPRSLDNFGLATVAAEISDGLSRASRLRTQEVRRAHR
FT                   TAYLDKTARA"
FT   gene            complement(46412..47410)
FT                   /locus_tag="Snas_0038"
FT   CDS_pept        complement(46412..47410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_3324 protein of unknown function DUF6
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39760"
FT                   /db_xref="GOA:D3QC40"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39760.1"
FT                   /translation="MDEPTPARGRLKAAWTLIILVPICAELTFTAVAVPLTWLALPLLI
FT                   PIYGAGVLLIREATVRVGGGWPSLVVLGLAYELAEDGLGLQALTSPNMYDVSDWSLRVL
FT                   GLNLTYWESQIGIHVVFSVLLPLMLMDLLFPHHKNRPYLRTGGLITTAVTAILGVALLR
FT                   FTIAAAQDPGYQTPTSALIGFTLTIATLAFIALKLLPGRTPSAKPLPIAPVPVGVLAAA
FT                   ATIGFLGLLMPFGLAPGGPVFGDTIPLWLPLIGSALIAIATTWLIRRWTAAPTWSDTHR
FT                   LWLAGGALVAHTAFMMPGQPLPGQLTGAATIAVEIVALFLLSRILKRRTTL"
FT   gene            complement(47442..48047)
FT                   /locus_tag="Snas_0039"
FT   CDS_pept        complement(47442..48047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0039"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: csa:Csal_1516
FT                   transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39761"
FT                   /db_xref="GOA:D3QC41"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC41"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39761.1"
FT                   /translation="MPKDDATSFIQLARRGQLVECAIELIAEVGLAQASTVRIAQRAGV
FT                   SRGVLTYHFRDRADLVEQVIARVYDLGAEFLLPRMRAATSPRESLLLFIGGSVELYAAH
FT                   PVHMAALAAIFGASTGDAGVERARHQRHSQEMLDLGRILHEGQQRGQFRQFDVTVMSRT
FT                   IRGALDAALAHIAAGGDVEPYATELRTIFDAATRTEPS"
FT   gene            complement(48074..48532)
FT                   /locus_tag="Snas_0040"
FT   CDS_pept        complement(48074..48532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39762"
FT                   /db_xref="GOA:D3QC42"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC42"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39762.1"
FT                   /translation="MLTPMRSGTLTITLACGGALAYTISKIDLALRERIGMPGFPAPPS
FT                   SYEDIPNVAAAQLGNAALGFVLVLLTAALFRPPKHTLTRRLLLGANWLGVAMVGAGVVG
FT                   FTLRATGLAPALGEPASGAAAWISLTVGAVWTVSWALASHGARRTPSV"
FT   sig_peptide     complement(48467..48532)
FT                   /locus_tag="Snas_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(48601..50070)
FT                   /locus_tag="Snas_0041"
FT   CDS_pept        complement(48601..50070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39763"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39763.1"
FT                   /translation="MVTFQQLRTAKLDTIQDQVDTWQNVSTKLTSLQTTATNVGTKISG
FT                   GTWEGLSGFAAVGRTTTLSAELKDAASEVNTVKGLLDWSKGQFVAQKNSLDQTVTAVNN
FT                   DPRLTISDTGHVKPDVEAITRQTGAPSVLELLEAQKAADTHNGNIKKILAWVSYVDAQS
FT                   SDKLRAAVNLDSPKELDFNGEAAKDADAVDFPGPADPAIAAAQSAAFEKTLGRPPVTET
FT                   DWKLAAALDPTSRLDKNGGKDAVVAVGRITPRPGEGLVRIGLYIPSKEVFNLPNYDLGD
FT                   NRGMDPNFNPEDARVTLYVDYETGTVLARQNPSVDTSGEVRVATPSVQVQESTNGAVRI
FT                   QYDASNPFAPPGSDQTGHTVKGDITVSPGQPPRVDGAIGDYPAFEAYHDSNNGPTTTLV
FT                   QDRADNEGNFGPLLELPTDHEIGAGRGGPPAQFKEWRHLSGDDWIAHGEAPSTNLGDPG
FT                   NPPTVTPYKPYGGSEFHPNAPGVPPTEGEFV"
FT   gene            complement(50080..50436)
FT                   /locus_tag="Snas_0042"
FT   CDS_pept        complement(50080..50436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39764"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39764.1"
FT                   /translation="MTVQISKPEMETIAGSCDDVKDGIVGTGTTVTGQAKPTLDGFLMQ
FT                   AAIGDVNQHWKKKADNSGRQWKYFGSAVRATAATITATDKEIAFTLPKVGKDETDIPVP
FT                   LPFRLFTPNPPNGN"
FT   gene            complement(50433..50879)
FT                   /locus_tag="Snas_0043"
FT   CDS_pept        complement(50433..50879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39765"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39765.1"
FT                   /translation="MTAEGGITVSLELGCLARHDTRSLAREVRAAVSGVLAAWRRAGDQ
FT                   VLLRELEPDALDQAWQTPAGRRLRPFVDALERLEVTGVGRRGVAKVGMTDGKLRVAFRP
FT                   EALELRESELGAEIDSALISMYDHRSTEAARLYDELVATEKAEA"
FT   gene            complement(51060..51950)
FT                   /locus_tag="Snas_0044"
FT   CDS_pept        complement(51060..51950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0044"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: atc:AGR_pAT_685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39766"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC32"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADD39766.1"
FT                   /translation="MVREDPTVADQPALWTDYACELGEGARWVDGRLIHVDILGGFLFT
FT                   VDGSRPHTGEPEVLVDAGLPLGAVAPVADRPGTWIAAVGHGIALLTESGTEWLAEFGTP
FT                   EAMRVNDAVADPGGRFWAGTLSYDNTPGAGALYRVDPDGTVVTALSDLTIPNGPAFSAD
FT                   GTLMYLSNSAHGSVDVYPVDPATGYLGAPDPFARLESGLTPDGLTVDDEGCVWVAVWDG
FT                   SQVRRYRPDGSLDRTLSLPTSRPTSCCFGGPAMNRLFVTTAAYDLRDDAAGKVYAFDLD
FT                   VTGRAADTFRPREVR"
FT   gene            complement(51944..53089)
FT                   /locus_tag="Snas_0045"
FT   CDS_pept        complement(51944..53089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0045"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bte:BTH_I0611 DgoA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39767"
FT                   /db_xref="GOA:D3QC33"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC33"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ADD39767.1"
FT                   /translation="MKIDRIETFLVPPRWLFCRVETDEGHVGWGEPVVEGRAATVRTAV
FT                   TELGEYLVGRDPLPIEDHWQVLTKGGFYRGGPVLSSAVAGLDQALWDIAGQVRGAPVHE
FT                   LLGGPVRDQVRVYGWIGGDDPSEVGEAAAAQAEAGLTAVKMNACGRLPHIASKSELDAV
FT                   VARVASVREALGDERDVAIDFHGRVSAAAARQLLPRLAPLSPLFVEEPVLPEHRHLLSS
FT                   IVACSPVPIATGERLYHRSDFLPALEAGIAVAQPDVSHAGGISELRRIAALAEVWNVAL
FT                   APHCPLGPISLAASLQVAFATPNFLIQEQSLGIHYNERADLLDYLVDTEVFSFADGHVA
FT                   RPTRPGLGITIDEAAVRAAAEHGHAWRSPVWRHPDGSFAEW"
FT   gene            complement(53090..53797)
FT                   /locus_tag="Snas_0046"
FT   CDS_pept        complement(53090..53797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0046"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: ilo:IL0306
FT                   FadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39768"
FT                   /db_xref="GOA:D3QC34"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC34"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADD39768.1"
FT                   /translation="MTNYTRRGLHGQTVREVARRILTGELPPGATIAVTELEAEMDVSR
FT                   TAMREALKVLSAKGLVGARQKRGTFVRERSDWNLLDADIIRWQFADRSDEAFLDNLHEL
FT                   RGIVEPAGVRLAAERRTEADLRAIDAALAKMATAQAEGDTTLAVTADLEFHRALLTATH
FT                   NELLERMEVLIETGLATRDRLVHGAHPHDDPVPSHRAVAEAVRRGFPAAAEQAMRELLD
FT                   KAKNDQRRTTGGS"
FT   gene            complement(53814..54560)
FT                   /locus_tag="Snas_0047"
FT   CDS_pept        complement(53814..54560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0047"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oan:Oant_2067 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39769"
FT                   /db_xref="GOA:D3QC35"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC35"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD39769.1"
FT                   /translation="MTMTKPMAQRFSGRLAVVTGASSGIGAAVCHRLTDEGARVLALDV
FT                   NAPRPQLAATVEFVRTDVASTEAWQRVAAVAAERGGADILVSNAATVDVAAAHETDDVS
FT                   WDRQLSVNLSAAFKGVRALLPQLRPRRGNVVIVSSVHAHMGLPGRPAYAAAKGGLCALG
FT                   RQLAAEYGPDLRVNSVIPGPILTPAWDWVSEADRHRSAAQTTLDRMGTPEELAACVAFL
FT                   ASDEASYVTGSELVVDGGWSITKDST"
FT   gene            54675..55979
FT                   /locus_tag="Snas_0048"
FT   CDS_pept        54675..55979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0048"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_PB00150 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39770"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC36"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADD39770.1"
FT                   /translation="MPSLSRRTALRLAAAALLPTSLAACGGGGSGRRQPGETIELTFWN
FT                   WVPGVDKAVNLWNKQNPEVQIRLSNIPSGPSGGYAKMFAALKAGDPPDLAQVEYYQIPA
FT                   FLMEQGLEDLTQHGFADHKDKFVDWQWDQGAFGDGVYAVPQASGPMAMYYRADLLEQWN
FT                   LEPPATWAEFEETAAKIREHDAYICSFPPNDAAMFTSLCWQAGARWFGTSGGEWTVDMD
FT                   NEPTRKVAEYWQRLIKKDLVLAQPMMANAWYKAVQDGKEVLWVGPQWGDALIKGNAPKT
FT                   SGKWKVTGMPQWKEGEFASANWGGSSTALFKGGDFPAEALEFAIWLNTDPTAVDLLIEG
FT                   GYGWPAAAGVFKGSKLDRDDEFFGGRYNDVFAEADKAVDTKWRWTPITLEINENLNAGF
FT                   QAAFGSGGSFTDVVATAEKQAIAGMKAKGLPVASP"
FT   sig_peptide     54675..54749
FT                   /locus_tag="Snas_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.509 at
FT                   residue 25"
FT   gene            55992..56885
FT                   /locus_tag="Snas_0049"
FT   CDS_pept        55992..56885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0049"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mlr6436 ABC transporter
FT                   sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39771"
FT                   /db_xref="GOA:D3QC37"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC37"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD39771.1"
FT                   /translation="MSIKNRQARSGWGFLAPFLVLFVAFFILPILYAIYQSLFTVKRTG
FT                   ELGLGGQELSFSWFDNYTTALSDTAFVDSLWTVLIFALIQVPVMVLLALTLALLLESAS
FT                   ARGVGFFRTAYFLPHGVPGVIASILWGFLYVPGISPLYNLFESVGLSVDFISPDTILLS
FT                   IVNIVTWEFAGYNVLVLIAQLKAVNPNLFEAARVDGASPWRIIWHIKLPLARPAIVMAT
FT                   VFTIVGSLQLFAEPLVLRPVAASITYTYTPNLAAYNEAFFENNYQLAAAQAVVLAAVAM
FT                   VLSFGFLRIFGRGDKQ"
FT   gene            56882..57718
FT                   /locus_tag="Snas_0050"
FT   CDS_pept        56882..57718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0050"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xom:XOO_2040 ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39772"
FT                   /db_xref="GOA:D3Q0A8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0A8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD39772.1"
FT                   /translation="MTARAKIITTAVLTVVAVYFLLPVYWLIVAATKTTEDLFGSNGLW
FT                   FSSPRLWTNMVELFTFQDGIYLRWTLNSILYAGVGALCATFICAMAGYGLAKYRFAGRE
FT                   KVFNLVLGGVLLPATALTLPLYLLMSEFSMANTYWAVLLPAMVSPFGVYLCRIYAAAAV
FT                   PDELLEAARIDGASEFRVFLTVALRIMTPALVTIFLFQFVGIWNNYFLPLIMLSDSNLY
FT                   PITLGLTSWQGFASRQPILYQLTVGGAFVSVIPLMIMMVVLQRFWRTGLTQGSVKE"
FT   gene            57727..59718
FT                   /locus_tag="Snas_0051"
FT   CDS_pept        57727..59718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0051"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: esa:ESA_03417
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39773"
FT                   /db_xref="GOA:D3Q0A9"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0A9"
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /protein_id="ADD39773.1"
FT                   /translation="MARFNERLSRIAFGGDYNPEQWDEEVWAEDMRLMTEAGVSMVSLG
FT                   IFSWAKVEPRPGEYDFGWVDRIFELLSANDIAVCLATMTASPPPWLARLHPETLPMLPD
FT                   GSRLWPGGRQHYCPSSPEYRRYATRLVAKLAERYGDHPALAMWHIGNEYGCHVPECFCD
FT                   VSAVAFRGWLRERYGDLDTLNDAWSTSFWSQAYGDWDEIFPPRSVPAFHNPAQRLDFSR
FT                   FSSDELLACYLAETEITNRVTPNVPVTTNFVGAWRRINTMKWARHMDVVSYDSYPDPHD
FT                   PEAAADSALAYDLMRSLRDGQPWLLMEQAPSAVNWRERNGAKPRDVMRLWSWQAIAHGA
FT                   DSVLYFQWRASRGGAERFHSGMVPHAGENTRIHREIRQLGNELKGHSALVGTRQTCDVA
FT                   LVIDWDSGWAVEGTSHPSDDVRLMDAVAAHHRPLYDANVAVDFVRPGADLSKYKLVVVP
FT                   NLYLVSEADARNISDYVHGGGTVLMSFFSGIVDEYDRVHLGGYPAPFRELLGLWIEEFW
FT                   PLPRGGSTGISFDGDLSALGSDTATRWSEVIRTEGAETLATFAGGDLDGEPAATRHRFG
FT                   DGEAYYLGTRPSPERMRSLLDHLRQRTAVAPTLADLPDGVQARTRVGEDGTAHHILLNH
FT                   TARPVTVTVDGAAVELAAHDVAVVTAKA"
FT   gene            complement(59744..60304)
FT                   /locus_tag="Snas_0052"
FT   CDS_pept        complement(59744..60304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0052"
FT                   /product="putative signal transduction protein with EFhand
FT                   domain"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   SMART: Calcium-binding EF-hand-containing protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39774"
FT                   /db_xref="GOA:D3Q0B0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B0"
FT                   /inference="protein motif:PFAM:PF00036"
FT                   /protein_id="ADD39774.1"
FT                   /translation="MVVSEFQRRKLLRRFDTLDVNGSGYLELGDYLRITSRLSRAFPVA
FT                   ARDERVVALVAAYRRLWRELLTEGDSDGDHRVSRDEFVTLMGRELIDSPDNFDRLLRPT
FT                   IEAVFDICDVDADGVVDAGELRMMLEGYGVPDSAVDVAVARIAPDGTTLDRDAFVSTMR
FT                   QYYCGDDPAEPGSWMFGKLAPQT"
FT   gene            60375..61211
FT                   /locus_tag="Snas_0053"
FT   CDS_pept        60375..61211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_1235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39775"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B1"
FT                   /inference="similar to AA sequence:KEGG:Anae109_1235"
FT                   /protein_id="ADD39775.1"
FT                   /translation="MSLRRSISRSRLAPVALFPYRLARVFRHDRKVVGRSLKWLFTSRE
FT                   HHNFTYDLTKINRGHLAWFISAVCDVPVKKVREYLDEVENDTELVEHISSTTASSARRG
FT                   LTDRKARYARRMGWYALVRILKPQHVVETGVDKGLGTCVLAAALRRNAAEGHPGRVTAV
FT                   DINPEAGFLVRSGPYAEVVDLVLDDSIATIKNLDRPVDLFIHDSDHAAEHEKREFKTVE
FT                   NKLADNAVLLTDNASVTNVLARHADKTGRRFLFYREQPARHWFAGEGIGVAWWPGR"
FT   gene            61314..61547
FT                   /locus_tag="Snas_0054"
FT   CDS_pept        61314..61547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39776"
FT                   /db_xref="GOA:D3Q0B2"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39776.1"
FT                   /translation="MRKVLQVLGLYLVIAGISGTLDHVAIQPIMGVVFNAFNRFLLPHL
FT                   DALKGYEVPANLSLSVVGAVLLLAVGRREKTA"
FT   gene            61544..62539
FT                   /locus_tag="Snas_0055"
FT   CDS_pept        61544..62539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_0334 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39777"
FT                   /db_xref="GOA:D3Q0B3"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39777.1"
FT                   /translation="MNRREGRRTRWLAVLLLLVLSPVCAEYIQAYDDSTGNPVALLGAL
FT                   LVFVPLYGAPAVLIRELARRFDVRWPGILALTTGFGILQAGVIDQSMFDTGYRGIDYWD
FT                   DMIMPTWIEPLGISVNASLAFVLGHAIWSFGVPIALSEAISGRYSRTPWLRWPGLSVLV
FT                   VLYLAAAALIMVGEDSGGASSGQLVGALAVTAALALFAFTLGRRRRDRRDRRVPAPLLV
FT                   FAVAAPVSFGFNMLGYSISDTVIVVGLLVAVAAAVTYLSGSRAWTGRHVAALASGTLLG
FT                   RVGIGFLTDPLGDVSAVAHAGHSVFFLLMALGLWLLADRRSRATPATDVA"
FT   sig_peptide     61544..61621
FT                   /locus_tag="Snas_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.487 at
FT                   residue 26"
FT   gene            complement(62666..63208)
FT                   /locus_tag="Snas_0056"
FT   CDS_pept        complement(62666..63208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_3566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39778"
FT                   /db_xref="GOA:D3Q0B4"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39778.1"
FT                   /translation="MSAQRTEALALLGPATDRLIDTVRGLSDAQLRADSLLPGWSRGHV
FT                   LTHVARQADAMCNLLTWASTGVETPAYASQESRAADIEAGSGRSADELVADLRASAERF
FT                   LAKVAETSDDAWGAQVRVLNSELFPAEQTVSRRLAEVELHHVDLGLEYRAADWPKQFAD
FT                   IELPEPSATFRAERASW"
FT   gene            complement(63235..63921)
FT                   /locus_tag="Snas_0057"
FT   CDS_pept        complement(63235..63921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39779"
FT                   /db_xref="GOA:D3Q0B5"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39779.1"
FT                   /translation="MTAVTDNPFDRLDAETRRVDAFLSGLSPDEWRVESRCPGWDRKAM
FT                   LAHLSGIEDYIRAGLDGTVDAYANQAGQGVGYEQLNEFLIRRHAETPTDELLRRWREQV
FT                   AESHPRLRERGVDAVIDTQAGEYPLGRQTWFFACEYAIHADDIAVPVTEAERDDRLAWR
FT                   LEFARDALAEYGKGVTVEPSGDGYEVSFGDEKARLSTADLVEATSGRLDEDRLPERLRR
FT                   RLVVLA"
FT   gene            complement(63972..64622)
FT                   /locus_tag="Snas_0058"
FT   CDS_pept        complement(63972..64622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0058"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pna:Pnap_3478
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39780"
FT                   /db_xref="GOA:D3Q0B6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39780.1"
FT                   /translation="MECESRTDGRLERGNAKRRAILDRAVDLASISGLDGLSIGKLAAE
FT                   LGISKSGALLHFGSKLELQLDVITHAAERFGRAVIAPAAEQPVGLPRLWYLTDGWLHHI
FT                   EIETFPGGCFFSTVGAEFNSRPGRIHDALAKIHNRWSNLLEQQAVAAREAGQLRPDVVA
FT                   ERLVFELDALIRHANMHRQLHDSRKVLGHAREAVRDLLTRVGTEAAVRELFGE"
FT   gene            64712..65290
FT                   /locus_tag="Snas_0059"
FT   CDS_pept        64712..65290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39781"
FT                   /db_xref="GOA:D3Q0B7"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39781.1"
FT                   /translation="MDHRQQYRQAQLDLVDIVRNLKDEDLDAPTTCSGWTVRDILKHVT
FT                   QNAYSTAAKLRDEEYDPETDERLGNDLREEFPLASDAAWEYNKQDKVLEQKIQFAGTEQ
FT                   PGWVALAFQFADILVHQWDISHSLSRPITLRPDAVADATTIAGMIPDGDEFRGPGKPFG
FT                   RIVATDSDDPQDKLLAITGRDPRWTPAAA"
FT   gene            complement(65346..65903)
FT                   /locus_tag="Snas_0060"
FT   CDS_pept        complement(65346..65903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0060"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; Activator of Hsp90 ATPase 1
FT                   family protein; KEGG: afr:AFE_2008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39782"
FT                   /db_xref="GOA:D3Q0B8"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B8"
FT                   /inference="protein motif:PFAM:PF03364"
FT                   /protein_id="ADD39782.1"
FT                   /translation="MPPSDPPDPPPKPRKLRNRILIGLSVLVVLLAGYTAWANLHVYTL
FT                   TASIDIDAPPDKVWEVLVDRESYPDWNPFLVSSKGGLKEGGTITNLMRGADGTETEFTP
FT                   TVLVVEPGKELRWIGKLSPGLLFDGEHSFRLIKRGSGTRLIQSEDFTGALVPPMQSWLD
FT                   GDTLPQFKAMNKALKKRAEAGG"
FT   gene            complement(66058..66840)
FT                   /locus_tag="Snas_0061"
FT   CDS_pept        complement(66058..66840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0061"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: met:M446_1738
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39783"
FT                   /db_xref="GOA:D3Q0B9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD39783.1"
FT                   /translation="MSDVVILTGLADSRWTWRPVETALADAGTVLIADRTRHQTFPTLA
FT                   DEIVRVRDLVVGHRLGPPVVVAHSFGALIAEAYARRYPVAGLVLVDPSWDPDATGRGAI
FT                   EAGLVRAAFHGAGALGKALDVTGLARHLGPALWSLSLRAVALRRPGAGVVAATRSVYRR
FT                   GETLVAAAAEELAFRDFAAALAKSRATSHAPEVPVVVLTAVGTDPKSRDSRHWIAAHRR
FT                   LAALFPNGRHEVVRGAKHMMHIDRPEVIVREVNRLLAG"
FT   gene            complement(66837..67070)
FT                   /locus_tag="Snas_0062"
FT   CDS_pept        complement(66837..67070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39784"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39784.1"
FT                   /translation="MTHIAVHDRPTTDAAGSQPREPRRQPRPISHRRGKTEDCVINPSA
FT                   AHSQQLTNAREPGMAAIAVHERPTTHAAGSRA"
FT   gene            complement(67067..67744)
FT                   /locus_tag="Snas_0063"
FT   CDS_pept        complement(67067..67744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_2819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39785"
FT                   /db_xref="GOA:D3Q0C1"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39785.1"
FT                   /translation="MAIALLASGVVYASWLLGGWVNPGLGPVVSYASELAASDQPGSLA
FT                   FRIGDLVAGAAACVAGLWALRRRPWLGWACVVAFGVFTMLDAGLFNMSCAPSLDPTCAT
FT                   AEVAGKVPLRHQIHTLSSSLAAAAPFVGLIAFAWAWRTVTAWVLSGLMVAATAATMLAV
FT                   ATDHLVGVAQRLQLLIVSAWLVWLALRTWRATSSDPTAARTATANLAPSEQPTAVDTNG
FT                   ARP"
FT   gene            complement(68185..71487)
FT                   /locus_tag="Snas_0064"
FT   CDS_pept        complement(68185..71487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0064"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); protein of unknown
FT                   function DUF472; protein of unknown function DUF471;
FT                   protein of unknown function DUF470; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: xoo:XOO2872 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39786"
FT                   /db_xref="GOA:D3Q0C2"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="InterPro:IPR031553"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C2"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADD39786.1"
FT                   /translation="MTTVNKSAPGGWRARIPTVLATLMALLTLIVALAAVASAFRDRTV
FT                   KVREFVEMVLIPAPPNLAYAAFLAIFAAAVARRKRLAWWILVGYFSLTLVLLALLNTIV
FT                   ILAPAFVFADPASVEDTPGYVVPRLVLATFIAIVLLVLLLVGRSQFPARVGRGSLWKAI
FT                   GVLAALMAMFVLIGWGLVSMFPGTVTHGDRFQYTFDKVVGGALRFEMTRSGVAPGWIDL
FT                   LLGAFGAVALLAALFTLFKSQRLAAAMNAWDEVRLRVLLAAHGEDDSLGYFATRRDKAV
FT                   IYAPGETAAVTYRTVTGVCLASGDPIGDPADWPKAIDAWLRQARGHGWVPAVLGASEAG
FT                   ATAYRQAGLRVREIGDEAILLPREYTLDGREMRPVRQAVARIERAGYTARIRRHGELSA
FT                   SEMAAAIKRADDWRDTKTERGFSMALSRFGDADDADNVLVEAIDGIGKVRAMLSFVPWG
FT                   RRGLSLDLMRRERDADNGLMEFMVTSLCREAGRLGVDRISLNFAMFRAVFEEGARIGAG
FT                   PILRWWRRLLTFFSRWWQLESLYRSNVKYRPHWAPRYLCYGERRALGRVGLAAAVAEGF
FT                   LSADISRVSIGRAARAKPLPGLAEALAEAATTPTVDPRTRLPEQMRVRLDKLDRLRDAG
FT                   VEPYPVGFERTLACGQVARDFPDLPPDANTGRFVAVAGRVMLLRHHGKLSFATIRDWTG
FT                   DLQVMVVGDSDFRHTVDIGDHLGVEGEVVTSKRGELSVLSKKWTLTAKCLHPLPDKHLG
FT                   LADPEAKVRQRHLDLIVSPQARTDLRARGAVIHSLRTGLHDDGYLEVETPILQAIHGGA
FT                   NARPFVTHINAYDMRLYLRIAPELYLKRLCVGGVEKVFELGRTFRNEGVSFKHNPEFTM
FT                   LEAYQSYADYNTMRELTMRLVRQAAVAAFDTTVITRDDHEIDLAADWPVIPIHQAISTA
FT                   LGEHIDPGTPRDKLRQLCEAADIPLDPQWDEGAIVLEMYERLVEHATTAPTFYSDFPTS
FT                   VSPLTRQHRTDPRLAERWDLVAFGTEIGTAYSELIDPVEQRRRLTEQSLLAAGGDPEAM
FT                   ELDEDFLAALEYAMPPTGGLGIGVDRLVMLLTGNGIRQTLPFPLVKPTVDQP"
FT   sig_peptide     complement(71374..71487)
FT                   /locus_tag="Snas_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.717 at
FT                   residue 38"
FT   gene            complement(71640..74444)
FT                   /locus_tag="Snas_0065"
FT   CDS_pept        complement(71640..74444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0065"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; NB-ARC domain protein;
FT                   transcriptional regulator domain protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce6858
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39787"
FT                   /db_xref="GOA:D3Q0C3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C3"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD39787.1"
FT                   /translation="MRFETLGPLRVSDESGVLPLRGRKARVLLAVLVSRAGDAVPIDVL
FT                   ARAIWDDKVPDTAIKTLRWHIHQLRRLLGDANRITYDDGGYRLRADPSEVDSFGFERLC
FT                   ADGFAAQRSRDPVIAARCFTEALKLWRGPAFGDLVDCGILRDEAARLDQLYLDATEQRH
FT                   GVELDLGNHEEVLAELTELVERYPLRENLRAHLMVALYRCGRRSEALEMFRAGRELFAE
FT                   QLGLDPAPRLRELEKAILNSDPALDPPSATRSGPAELPRDIATFTGREAEVSELTELLV
FT                   TDSMTPLVISSINGGGGVGKSALAIHLGHLVRERFPDGQLYVNLQGATPNAEPLEPAEV
FT                   LRRFLRSLGVGGDDGISEVAELANRLRTATNGKRMLFLLDDARDSGQVRPLLPSEPRCA
FT                   VLITSRRTLSTLDGSVNRALDGLSDADAVTLLERLVGTDRVAAEPEAVRRLLGWCGGMP
FT                   LALRICAARLVARPRWSVASLADELADETRRLSELEVDDLAIRSSFAVGYRQLCEDSAS
FT                   AARVFRLLGLHDGPDFTTRHVAALAELDEPDAERSLAELTATHLVEPAGPGRYRTHDLM
FT                   RLFARERVTAEESAAERRASVERERRFYLGTVRNMLGVCEPGMRNRLGLVPEEFVRHGV
FT                   RFEDAKSAYAWAMADTANLLAICRAAIGGGATDDPDFTATTVTVLGPVLVIRGSAGPMA
FT                   DLHELGIKARKWVTKPDLRFFISTGAAELMRVAGKHDEALRHLEVAMSISREQGWRVRE
FT                   GWILVGVGTMYWWMGELDQATDHLDRAVAIAAETGDRALEGSATSHLGHVHAESGRHDA
FT                   AIEAMRKVLAFAQDSGRPRGRVEGMISLGRVYQLADRPTEARDCYERATAMLDETGLAG
FT                   TRYEAEALWGLADAGHALGETELTRERWDRAAKLLFDLKLIDAGERDHIISVPEPDRPK
FT                   AIRY"
FT   gene            74558..74989
FT                   /locus_tag="Snas_0066"
FT   CDS_pept        74558..74989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39788"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39788.1"
FT                   /translation="MGHLINHRETDEAMSLPDGSKGPVDMRTDNVFALAEALRADAERF
FT                   RTDANRIMREIQGEEGGSRYYGADPRNVPAAQTMNRHDEVRRAAEKLVADVAAGFTGMS
FT                   RSTRAVIHAFRNQDGLNAAKVRRVRDVLRLPREHGEGPV"
FT   gene            74998..76455
FT                   /locus_tag="Snas_0067"
FT   CDS_pept        74998..76455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39789"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39789.1"
FT                   /translation="MGEFDAYDIDELAEMVSRDRPGGLFDQAAGWRKLHRLLDGYATRL
FT                   SERLDQARPSWAGAAADVYFAELRARHDELRWASDTADFNASAWDRIASNAARSQGEVL
FT                   RIQQEWRDVDGSEPTDGTESRLREERRRSYDEAARAVMDEVSGDNDLSRAAMADHHQFT
FT                   PMPGVDLPEDHPVEPRDPGEPRGPVNPRDPRDPVNPPSGRGPELQGPGGAPPAPQPASV
FT                   LPPDPGPAPGPRPVPVPTPTPVPGPRPTPVPRPGPGSGPGPKPTPAPRPGLGPRPTPTP
FT                   APRPGVTPRPVPGTRPTPRPPGPTVRPVIGSRPGTNVPGPGTRVPGSLTRPVIGSRPAV
FT                   GGTEAPKALIGKDGVAGRRGTGATPGVRSSTSHFGGGGLNRPVVGSSRAKPASGAAPGP
FT                   GGRVGRRRGDDETNHGDGPLGEFWTPGRTVPSVITSRPTVEHDPGPVSQLGRRRPRAET
FT                   TPDEETLWSPPMSHQEGLSRKDAERWI"
FT   gene            76446..76973
FT                   /locus_tag="Snas_0068"
FT   CDS_pept        76446..76973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39790"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39790.1"
FT                   /translation="MDLTLERLNVMATSPDKSVQARMSNAAGLQVKLEPGTVDRHTERS
FT                   LGTQLTAAVNGAITGYRKGAAKAFGVLRAQWGMPSRSDADPELQDEPQTVTTSGAGNVS
FT                   VRMRGETVTAVGLHPGTLRRISEPELLDELRDALLSAMTRHAELITAKSRTTATATPRP
FT                   LERTASWRTTSK"
FT   gene            76952..77281
FT                   /locus_tag="Snas_0069"
FT   CDS_pept        76952..77281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39791"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39791.1"
FT                   /translation="MADDIEVVLTNLNRIARNELPPIITNTSTASQEIKSGLEGIEPAF
FT                   DGDVFGPTLEAFQSTVTSVCAELDKANERVKDTVHAVIEVLGAYRAVDGANARSITATT
FT                   SPVGE"
FT   gene            77299..78162
FT                   /locus_tag="Snas_0070"
FT   CDS_pept        77299..78162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39792"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39792.1"
FT                   /translation="MTNMTGAIHEAVDAIGTAIIYAESRKGSWVFEQQEWLDFVRELSP
FT                   LMHHQYGRLANCDPSPAKAASKRIESGKTSLAKNANPNGSLESQTKRIKKLCETWRSDG
FT                   GYAFHSHIGKMEFALLHQQEMAAVLSSLMELHSSHVLATQEDLLNIANLTIDSLERHGY
FT                   DIQQKERQKLGAILDTLVSVASGGIVGSLGSGAAKAVGEAVSGIKGSSAVSAAMQLPTD
FT                   DTMLIIKTMKRKVDQLIEQTTAQQSQIRVALTSVFEAYVDKPIMLPPEVATGTLSDQDW
FT                   RYATRR"
FT   gene            78289..80472
FT                   /locus_tag="Snas_0071"
FT   CDS_pept        78289..80472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0071"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: scl:sce0368 putative
FT                   iron-sulfur protein, transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39793"
FT                   /db_xref="GOA:D3Q0C9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C9"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADD39793.1"
FT                   /translation="MGVVQIVATLIAAVVTIVAITVFARTGMSMVRIIKLGAPDPTRRN
FT                   KGAVRLKTMLRETVGHTRMLKWTLVGAAHWFVFVAFITLFPVLVEAYLKVINPTWTLPF
FT                   VGHWSLWLLYTETIGALGIAGIVALFVVRMLNQPRNNPAPERPEGTELSEAHTRTSTSR
FT                   FERSRQWQGFYIEATIFGIIASHFITRSLKVAAGELDVPAWAAPISNAIGGAMSGLGEA
FT                   ALTPITIVALVEIIISWLFFYILGRNITMGLGWHRITAFFNIYFKRNADGPVSLGAAKP
FT                   LMVRGEPIDFENADPETDPFGVGQVEQFTWKGLLDFTTCTECGRCQSQCPAWNTDKPLS
FT                   PKLLITDLREHLYAKAPYLLAGGGKDALGEETGTAEQLKDVPADALAEAEKSLVGDVID
FT                   PDVLWSCTTCGACVEQCPVDIEHVDHIVDMRRHQVMIESAFPSEAQTLMRNLENKGNPW
FT                   GAAPNTREDWTKGLDFEVPRVDSASPDFEYLFWVGCAGAFDDKAVKTTQAVATLLYEAE
FT                   VKYAILGNGETCTGDPARRSGNEFLFSMLAEQNVETLNEAKVTKIVATCPHCLNTLGNE
FT                   YGQLGGNYEVIHHTELLSNLIAERRLKPVTKLENGVTYHDPCYLGRHNRVFSPPRELLG
FT                   EVSATGLTEMPRNSEKSFCCGAGGARMWMEEKIGTRININRSTEAVETGAKTVAVACPF
FT                   CSTMINDGVNAVGAGDDVEVVDVAQILLRNTRE"
FT   sig_peptide     78289..78363
FT                   /locus_tag="Snas_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.780) with cleavage site probability 0.770 at
FT                   residue 25"
FT   gene            80612..82501
FT                   /locus_tag="Snas_0072"
FT   CDS_pept        80612..82501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce0244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39794"
FT                   /db_xref="GOA:D3Q0D0"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D0"
FT                   /inference="similar to AA sequence:KEGG:sce0244"
FT                   /protein_id="ADD39794.1"
FT                   /translation="MSKPTFRQRARYWFDNTMSKGTKALISWLTIITLVVVAIGAGLAV
FT                   LASLIDPKAEDEGFAANLWTAFIHVIDPGTITGDTSTPLFIGMMLVITIGGLVIISSLV
FT                   GILTTGLDAKLEELRKGRSLVVESGHTVVLGWSDQVFTVISELVEANESEKRACIAILA
FT                   DRDKVEMEDEIRAKLSDLKTTKVVCRTGDPADPDDIAIVNPEQAKGIVLLTSNEEDPDA
FT                   QLVRSLLAVTEGGQKTDGPHVVGAVTDSRNLPAARLAGGPRAQVVDGDDIMARLMVQTC
FT                   RQSGLSVVYTDLLDFGGDEMYMVEEPRLVGCTVQQVVHAYRVSSFMGIYNPNTGSRINP
FT                   PSSTVVNPGDRLIMLSEDDSTIVLDGAQPYIEEKAIVARGEHGSRPERTLILGWNARTP
FT                   TVLEQLDAYVSRGSTTDVVSDHGDMSTQLRRLGPQMKVQSVNFKEDDTTSRALLESLNV
FT                   ASYDHVIVLCRDDVPAQLADSKTLVTLLHLRDMAEKSGQRYKVVSEMADDRNRGLAQVT
FT                   QADDFIVSEKLISLMLTQTAENPHLSQVFNDLFDPDGSEIYLKPCEYYVRPGMPLNFYT
FT                   VAESARRRGETAIGYRQAALSSQAPTFGVVLNPDKAAGFTMQAGDKVIVLAED"
FT   sig_peptide     80612..80755
FT                   /locus_tag="Snas_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.674 at
FT                   residue 48"
FT   gene            complement(82524..82979)
FT                   /locus_tag="Snas_0073"
FT   CDS_pept        complement(82524..82979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c2780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39795"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D1"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c2780"
FT                   /protein_id="ADD39795.1"
FT                   /translation="MDNNFDFLVGTWTSKQRRLREILNGCDEWYEFTGDLKCWSIWDGA
FT                   GNIDEVTFPDQGYSGVTVRLYDAKTDEWSLYWASSRSPMALPPQVGRFVDGRGEFYADD
FT                   VFNGEKIKVVFIWSNITATTARWEQAFSRDGGETWETNWVADFTRTS"
FT   gene            complement(83017..83901)
FT                   /locus_tag="Snas_0074"
FT   CDS_pept        complement(83017..83901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0074"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   sit:TM1040_0151 ECF subfamily RNA polymerase sigma-24
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39796"
FT                   /db_xref="GOA:D3Q0D2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D2"
FT                   /inference="protein motif:TFAM:TIGR02957"
FT                   /protein_id="ADD39796.1"
FT                   /translation="MTAGRAETGPDAATDAFVAHRNLLFTVAYELLGSAVDAEDVLQET
FT                   WLRWADVDLDTVRDHRAYLVRIATRQALNRLRTLSRRKESYVGPWLPEPLLTTPDVAED
FT                   VELADSLSTAMLLVLETLTPTERAVFVLRDVFALDYDEIAEAVDKTPAAVRKVAHRARS
FT                   HVAARRPRGEVSPAQSRAALEAFRSAVATGDLQGLVDILAPDMVMLSDGGGIVTALPNP
FT                   IVGADKVLRLFAASLDTFLRGATLEPVRVNGFPALLMRVCGKLDGVLTLRLDDGLVSGL
FT                   YYVRNPEKLSRVR"
FT   gene            84067..85125
FT                   /locus_tag="Snas_0075"
FT   CDS_pept        84067..85125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0075"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rso:RSc2229 NADH dehydrogenase,
FT                   membrane flavoprotein FAD NAD ubiquinone electron transport
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39797"
FT                   /db_xref="GOA:D3Q0D3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D3"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ADD39797.1"
FT                   /translation="MKVVVVGAGYAGMMAANKLARKARNAEITVINPRPQFVERVRLHQ
FT                   RIAATTRAARPFSAMLRKGIRSRVGTVDKIGDGTVVLDDGARFDFDHAILAVGSTVRPM
FT                   PGTVPVGSWDGAEAARRSLAALGEGATVTVIGAGPTGIETASEIASTRPELRVRLIGAA
FT                   IAHSYSLGARERVLTELERMNVDLVEDSVTEVTDGVVRLESGDRFRSDLSLWAVISGVP
FT                   QLASRSGLAVNEDGQVIVDAYLRSVSDDRIFAVGDCAAVPGARFSCQCAIPQGGYVGGA
FT                   CARLLRGRELEPFVMRFRGRGVSLGRRDAVVQFTDADDNPKESFAAGATGVALKELATR
FT                   GAKFGAGTGWGA"
FT   gene            85184..85999
FT                   /locus_tag="Snas_0076"
FT   CDS_pept        85184..85999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0076"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gbm:Gbem_1049 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39798"
FT                   /db_xref="GOA:D3Q0D4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADD39798.1"
FT                   /translation="MNAVNQPRPSALATLARSTAAPARTAPAVVDQSVIIPVYNESDRL
FT                   AATLAEVRAHLNGAGGAWELIVVDDGSRDDSAAIAARFAAGEPRIRLLRTPRNRGKGHA
FT                   VRHGVLASRGRRVLYCDADLATPIGELDRLHAKLDAGFAGAIGSRVGPHADIRQRQPLP
FT                   RVLLGRLGNRLIRLAAVPGVGDTQCGFKLFDGDKARRAFTLTRVDGWAFDVEVLYLFAR
FT                   GDWPVAEVPVRWSHRAGSKVRMRDYPATLAELLRMRWRHRGAPPRVRQQ"
FT   sig_peptide     85184..85261
FT                   /locus_tag="Snas_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.847 at
FT                   residue 26"
FT   gene            85996..87753
FT                   /locus_tag="Snas_0077"
FT   CDS_pept        85996..87753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2095 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39799"
FT                   /db_xref="GOA:D3Q0D5"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39799.1"
FT                   /translation="MTATAVLAAAETRSRSRWRPWHARAWVPATYLVASVALYLGLWAS
FT                   PSGRYLIDSGQDQNQWEWFFAVTARSVTELDNPLFTTLQNHPEGVNLMANTTMLGVSVP
FT                   LTPVTLLLGPGVTWALVLTGSLAATATAWYWLLHRRLGHSRLAAALGGGFCGFAPPVIT
FT                   HAHAHPNFVALFVLPFVVALLLRLWDGERPLRDGAILGLLLAYQIFLGEEVLLLFATGM
FT                   TIFAIAYAATRPARARAALRPLGTGLGVAAAVSLSLVAFPLYWQFLGPQSYSGLLHGNA
FT                   GNDLLAFVTFASRSLGGDDRTAGALAWSTEQNSFFGWPLVIMVVTLAAVLWRVPRARAL
FT                   SITVAVAALLSLGSSVKFDGEDTLIPGPWLLLSWLPLYESVLDSRLAMVCVPAIAVLLA
FT                   MAVDRVRLLFGLPHWQRTPRLLWTGVLLAVLAPIAPTPFTVVDRAPTPTFFTSGMWREY
FT                   VPDGGTVVPVPIPSPGDTTALQWQLDSDLDFRLPEGYFIGPGQPDRRGIYGAMRRPTSV
FT                   LLREVRDSGEGRDVTEEQREQAAEDLRHWDAELVVLGPHPAEDALRYTVEDLLGPGHRA
FT                   GGVWVWKVR"
FT   gene            87756..88367
FT                   /locus_tag="Snas_0078"
FT   CDS_pept        87756..88367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0078"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   dia:Dtpsy_1254 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39800"
FT                   /db_xref="GOA:D3Q0D6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD39800.1"
FT                   /translation="MTSSVTGQLTTPWTVRERAPDTPRRAVHADLEREYVEYVTVHLPA
FT                   LHRVARLLCRDRHRADDIVQTTITKLYIHWKRAKAASNLDAYVRTMLVRAFLSEQRLSW
FT                   AKVRLFGSAQEIPGTPSVHSPDVETRDLVHTALSRVAPKQRAVLVLRFLCDLPVTEVAQ
FT                   ILGCSPGNVTSLTTHGLKRLRALLGDRAVAALEGGGRDER"
FT   gene            88357..89412
FT                   /locus_tag="Snas_0079"
FT   CDS_pept        88357..89412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39801"
FT                   /db_xref="GOA:D3Q0D7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39801.1"
FT                   /translation="MNDDEREAARLLEPLRQPEPPATSAVDVDRAMRTGRRTIRVRQVA
FT                   GTLACVVAVLGIAFTVTVPYYHSPPAEETTSEFGVTTQEFAIGSAGGFTPLTYETGRSR
FT                   QRATLTTQDGATDAVVTLYPKGRVPRVDGETWKPTGGTAPDVKGGAAVWPSEPVFGDDA
FT                   VELAWQWRPDAWAFVSVTGPEADQDRAHKVALSVEPGADIDVAVPATYPTPHPGTVQES
FT                   AVISTLRSIGDHERAERIYQVRYRASGDDSDWITVGVREPAPDTDESTTVDDRPALVEK
FT                   NKVTFLDGTGLFVEVSDESVLDEPLTDFAARVELKSDLEWSPPPLSPSDMPTSSSETPT
FT                   DSSTETASPTP"
FT   gene            complement(89458..89547)
FT                   /locus_tag="Snas_R0004"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(89458..89547)
FT                   /locus_tag="Snas_R0004"
FT                   /product="tRNA-Ser"
FT   gene            89655..90515
FT                   /locus_tag="Snas_0080"
FT   CDS_pept        89655..90515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0080"
FT                   /product="Poly(3-hydroxybutyrate) depolymerase-like
FT                   protein"
FT                   /note="KEGG: pap:PSPA7_0646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39802"
FT                   /db_xref="GOA:D3Q0D8"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D8"
FT                   /inference="protein motif:COG:COG3509"
FT                   /protein_id="ADD39802.1"
FT                   /translation="MTAMRTLRGLAVLALLAVAVGCGGPGEAGSQDKADDKTETKADPG
FT                   EPGLHKKVKVDGGKTYDVYVPKGRSLDEPVPAVLVLHGMPGDAAEAREQSGLDALADEE
FT                   GFLAVYPDNPNGSWTPNPDDEGDSDFVRDIITDLTGTWNADPKRIFVSGTSNGGDMALT
FT                   IGAKLPDLVAGIAAVVPAGTEEVAKVMDAVETPVPLIAFFGGNDPREGLGLDLVATWRD
FT                   RVECGKAKTDKGKQVTVREYACADDTAVVTQEVHEGFHEWFGTAAEPEPVWASAAMWEF
FT                   FTRKS"
FT   sig_peptide     89655..89741
FT                   /locus_tag="Snas_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.801 at
FT                   residue 29"
FT   gene            complement(90523..91290)
FT                   /locus_tag="Snas_0081"
FT   CDS_pept        complement(90523..91290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0081"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: sfu:Sfum_0549
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39803"
FT                   /db_xref="GOA:D3Q0D9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0D9"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADD39803.1"
FT                   /translation="MLLCVDIGNTNTVLATFEGETLVHSWRIKTDPRATADEMALTFRG
FT                   LLAGDNVEVSAICVSSTVPQALRELRVMLSRYYAAKPTVLVAPGVRTGVQLAIDNPREV
FT                   GADRIVNTHAAYNMYGGPSIIVDFGTSTNIDVISEKGEFLGGAFAPGIEISIDALASRA
FT                   AQLQKVEPVKPRSVIGKNTVECLQSGIIYGFAGQIDGLVTRIIKQLGTGVSAVIATGGL
FT                   APVVIEECATITNYEPMLTLIGLRMIYERNAPQ"
FT   gene            complement(91294..92169)
FT                   /locus_tag="Snas_0082"
FT   CDS_pept        complement(91294..92169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0082"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: ara:Arad_8931 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39804"
FT                   /db_xref="GOA:D3Q0E0"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E0"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADD39804.1"
FT                   /translation="MTTVDERLTAQGLDPDEVNAIIDRALAEDLGPNRSDPTSEAIFPL
FT                   TVTGTADLVARESGVVAGLAVAEAVFKHFDPNVAFTHLVDDGARVYAGDRLATVAGPVR
FT                   YLLMAERTVLNLLCRMSGIATHTREWTRVLDGTKVTVLDTRKTTPGLRTLDKYAVRAAG
FT                   GGNKRMGLYDVAMIKDNHKFAAGSVTAAFEAVRAARPDIAIQVEVDTLDEAREAVAAGA
FT                   TFLLCDNMSPAQLREVVAAVGPDVQLEATGNITLTIAEKYADTGVDYISSGALTHSSPI
FT                   LDIALDIRQE"
FT   gene            complement(92318..92557)
FT                   /locus_tag="Snas_0083"
FT   CDS_pept        complement(92318..92557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39805"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39805.1"
FT                   /translation="MTRRTSSCRRGDTRGAARAVPWRKSSYSDNSGGNCVEARVSVLPQ
FT                   VRDGKLGDDSPLLTLDEATFRGLLHQIKTGAFTI"
FT   gene            complement(92554..93426)
FT                   /locus_tag="Snas_0084"
FT   CDS_pept        complement(92554..93426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0084"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39806"
FT                   /db_xref="GOA:D3Q0E2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39806.1"
FT                   /translation="MCGPPDSREEVLTMTNDPSARPTLARRQLGAELRKLREAAGMTHA
FT                   EAGAAVELHRNTIAAIEKGKQGTKSYIVKNLCSPEVYDAPPEVMSYLTGLVVKGKQRGL
FT                   YEKHEPGMKPGIRWFASAEVEYGYIMTWEHLNMPGLLQVPEYYDAQRQTRPPQEAPDEP
FT                   ATKNFRFKRQEVVFGRDPLPRMEFVIGEGALHVMDGLPDVKDAQIARLLEVAKLPGVDI
FT                   RVLGGFHPAMSGAFTILSPTDPDDELSFVYVDALDACRYLEDPDVVSRFVGTFRTIYSM
FT                   AIPIKEFLK"
FT   gene            93624..93803
FT                   /locus_tag="Snas_0085"
FT   CDS_pept        93624..93803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39807"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39807.1"
FT                   /translation="MITSYRPPRTLAEVEVTIPCRACREQGVRAVQTPDGLRAQRCADC
FT                   DGTRRKRIIRECEG"
FT   gene            94011..94212
FT                   /pseudo
FT                   /locus_tag="Snas_0086"
FT   gene            complement(94309..95958)
FT                   /locus_tag="Snas_0087"
FT   CDS_pept        complement(94309..95958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0087"
FT                   /product="L-aspartate oxidase"
FT                   /note="TIGRFAM: L-aspartate oxidase; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   mxa:MXAN_4629 L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39808"
FT                   /db_xref="GOA:D3Q0E4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E4"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ADD39808.1"
FT                   /translation="MTTMDIPALPPVPRRLRAADPSWTETTDVCVIGSGIAGLTTALYL
FT                   REAGLHVTVVTKVNIDDGSTRWAQGGIAAVLDPLDTPAAHAEDTRIAGVGLCDPAAVDV
FT                   LVKEGPDRVRELIHTGANFDRYADGSLMLTREGGHRAKRIVHAGGDATGAEVQRALHAA
FT                   VHADPWIRIIDHALVLDLLRDKSGRACGVSLHVLGEGSEDGVGGVLARAVVLATGGMGQ
FT                   IFASTTNPSVSTGDGVAAALRAGAAVTDIEFVQFHPTSLFLPGSRDQQPLISEALRGEG
FT                   AHLVDGEGVRFMVGAHELAELAPRDVVAKGATRIMRRDDVDHVWLDARHLGAEHLESRF
FT                   PTILASCRAAGIDPVVDLIPVAPAAHFASGGVRTDLHGRTSVDGLYACGEVACTGVHGA
FT                   NRLASNSLLEGLVFARRIADDLARELPAQSDPHTDADAASWAVSTTSRQSLQRAMTAGA
FT                   GVLRSADSLAETAAVLTTLGNEHSGRPRTATWEATNLVTIAATLTAAAHARTETRGCHW
FT                   REDFPDAVDTWRGHLLAGIGADGVLTQRWEAA"
FT   gene            complement(95958..97421)
FT                   /locus_tag="Snas_0088"
FT   CDS_pept        complement(95958..97421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0088"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10 serine carboxypeptidase; KEGG:
FT                   gur:Gura_2114 peptidase S10, serine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39809"
FT                   /db_xref="GOA:D3Q0E5"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E5"
FT                   /inference="protein motif:PFAM:PF00450"
FT                   /protein_id="ADD39809.1"
FT                   /translation="MNDEKQPEAATDAKDGKPAEPADDLVTTTHSLGELRYTATTGRIV
FT                   LREEVTEDDKFTGHKPKAELSITSYTLDDADHADRPVTFAFNGGPGSSSVWLHLGILGP
FT                   RRVDAGDAGAMKPPPYRLVDNHESLLRHSDLVFIDPVSTGYSRAVNGEKAKPFHGYTGD
FT                   IESVGEVIRLWTTRNNRWLSPKYLAGESYGTLRAAALSDFLQNRYGMYLNGLMLISPVL
FT                   DIGTLEFSDHNDLPFAMYLPTYAAIAHYHGLHGDRSLREVLDEAEEFAAAEYPRVLARG
FT                   SRLPRAERDAAVATIARLTGLSSDYVDAVDLRIEHIRFFTEVLRHKRKVVGRLDGRFTG
FT                   YDADYGREHFSADPSMSAIIGPFTAALNHYVRAELEYENDLPYEVISRKVHPWSYKEFE
FT                   AKNLSVADKLAAAMRANPHLRVHVACGYHDGATPHFAGEYTMARLAIPAELRDNVEFRY
FT                   YEAGHMMYLHEESRLRQSRDLAAFVVGGE"
FT   gene            complement(97433..97885)
FT                   /locus_tag="Snas_0089"
FT   CDS_pept        complement(97433..97885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0089"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: scl:sce0938 hypothetical protein; TIGRFAM:
FT                   aspartate 1-decarboxylase; PFAM: aspartate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39810"
FT                   /db_xref="GOA:D3Q0E6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E6"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ADD39810.1"
FT                   /translation="MLRTMLKSKIHRATVTEADLHYVGSCTVDEDLLEAADILPGEQVS
FT                   IVDITNGSRLETYVIPGERGTGVLGINGAAAHLVHPGDLVILISYAAMDDREAREFEPK
FT                   IVHVDSGNRIVALGNDATAAAPGTAGDPVTSPNVARNSVRGTAPVA"
FT   gene            complement(97885..98706)
FT                   /locus_tag="Snas_0090"
FT   CDS_pept        complement(97885..98706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0090"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: bja:blr2102 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39811"
FT                   /db_xref="GOA:D3Q0E7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E7"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADD39811.1"
FT                   /translation="MTVRVVATREELAKARAELSGTVALVPTMGALHDGHVANIRAAKA
FT                   RADTVVVSIFVNPLQFGPNEDFEKYPRPLSADLELCAAEGVDLVFAPNREVVYPHEVSV
FT                   TVDPGPLGEILEGASRPGFFRGVLTVVSKLFHLVRPDFACFGEKDYQQLTLVRRLVSDL
FT                   DFPLEIVPVPTVRESDGLARSSRNVYLDTEQRAVSLAISRALKAAADSPDPLAAAREVL
FT                   DAAPGIALDYLALTDPALGPAPETGAARLLIAAKVGTTRLIDNTPVHIGVK"
FT   gene            complement(98703..99629)
FT                   /locus_tag="Snas_0091"
FT   CDS_pept        complement(98703..99629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0091"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_02774 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39812"
FT                   /db_xref="GOA:D3Q0E8"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E8"
FT                   /inference="similar to AA sequence:KEGG:SYN_02774"
FT                   /protein_id="ADD39812.1"
FT                   /translation="MAMSPTGASGPHQESRLDVGIISAGRVGSVLGAALARAGHHIVAT
FT                   SAVSDASRDRARRLLPDAAVLSPDEVAERAGLLLLAVPDDELAQVVSGLATAGHFQPGQ
FT                   LVAHVSGAHGIEVLRPAVSAGALPLALHPVMTFTGRPEDLDRLDGVSFGVTADETMRMV
FT                   GEALVVEMGGEPEFIPEQLRALYHAGLCHGANHMTTLINEAVDILRECGVMHPERMLGP
FT                   LLSASLDNTLRLGDNALTGPIVRGDTGTVASHLDALSRALPDSVAAYRAMARRTADRAI
FT                   SHKRLSVAAAEPLLDVLSGPDGEGGRK"
FT   gene            99782..100633
FT                   /locus_tag="Snas_0092"
FT   CDS_pept        99782..100633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0092"
FT                   /product="N-acetyltransferase"
FT                   /note="PFAM: N-acetyltransferase; KEGG: bra:BRADO6242
FT                   putative arylamine N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39813"
FT                   /db_xref="GOA:D3Q0E9"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0E9"
FT                   /inference="protein motif:PFAM:PF00797"
FT                   /protein_id="ADD39813.1"
FT                   /translation="MWNSEQLDLDAYLTRVGHDGDRTPTLATLRALQRAHVLNLRWDTI
FT                   DSFLYREVRLDLAAIQDKLLRRGRGGYCYEHTVLFAAVLEKLGFRFTAVSARVQLGADS
FT                   TTPRPATHAMLIVDLDGKRWLSDVGFGSSPLEPIELVDGGRGDSGPWPYLLRWQDITHG
FT                   SPGWAVHQRGDGPEGPEGWTVRQVFTETPQYPIDYVLGNHFVASNDRSPFVTRPYIQRL
FT                   RTDRYDTLDALTWTTERPGQDAVSETVRPHEVPKLLDDVFDIRVDAAEARLLVDRLTER
FT                   EA"
FT   gene            100678..101448
FT                   /locus_tag="Snas_0093"
FT   CDS_pept        100678..101448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0093"
FT                   /product="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="PFAM: N-acetyltransferase; KEGG: si:rp71-1f1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39814"
FT                   /db_xref="GOA:D3Q0F0"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F0"
FT                   /inference="protein motif:PRIAM:2.3.1.5"
FT                   /protein_id="ADD39814.1"
FT                   /translation="MSVDVDAYLKRIGVTTPVSVTAESLRTLHLNHLRTIPFENLSIHL
FT                   GETISLDEAPLLDKVVTRSRGGFCYELNGAFAWLLRELGYTVTLLSARVFAGDNPGPPF
FT                   DHLALKVDLDEPWLADVGFGAFASHPLRLNDRGDQTDPAGTFRIADAEHGDLIVYENGE
FT                   PQYRFEAHPRELAEFEAMCWYQQNSPKSHFTKSPVCSRLTDTGRVTLTGRTLKRLADGE
FT                   TTKTTLKVEAEILATYRDLFGVTLDRLPDDPREA"
FT   gene            101455..102390
FT                   /locus_tag="Snas_0094"
FT   CDS_pept        101455..102390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0094"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   eba:ebA3370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39815"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F1"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ADD39815.1"
FT                   /translation="MLPWSQAMRRALYGPGGFYTLNSPNRHFRTSAQFPLFATAIAELV
FT                   RRTDSRLDHPEVFNLVDVGAGSGELLRRVLDEEDLNGRLRPVAVELRPAPPGLDERIEW
FT                   RTSLPGGIIGLLMACEYLDNMPLDIAVADAAGAVRYELVDPGSGETRPGQPVSSVDADW
FT                   LRAWWPLGQAGQRAEIGRSRDQEWARLCGNVSRGTVVAVDYGHTKDCRPPLGTVTGFLD
FT                   GHQVAPVPDGTRDITAHVAMDSLGDGGLWTQRDALRELGISGSRPPLELSRTNPAEYIR
FT                   ALSRAGDAAELTDPAGLGAHHWLVLNLTQR"
FT   gene            102444..103580
FT                   /locus_tag="Snas_0095"
FT   CDS_pept        102444..103580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0095"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: rhi:NGR_c22090 NADH-quinone oxidoreductase chain D1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39816"
FT                   /db_xref="GOA:D3Q0F2"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F2"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADD39816.1"
FT                   /translation="MTEMTVGVGSGVGEFADMVLNIGPQHPSTHGVLRLKLTLDGERVT
FT                   GCEPVVGYMHRGAEKLFEVRDYRQILMLANRHDWLSAFCSELGVALAVERLMGIEVPER
FT                   AVWLRTALAELNRVLNHLMFLGSYPLEIGAITPMFYAFRERETLQAVFEEASGGRMHYM
FT                   FNRIGGLKEEVPSGWTSRARQAIGEVRRGMSDVDDIIRTNEIFAARTKGVGVLSAETAA
FT                   AYGVSGPVARASGLDFDLRRDEPYLAYGELDVPVVTRTAGDCHARFGCLLDQVYVSLDL
FT                   AEKCLNRVDAIGGPVNVRLPKVVKAPEGATYAWTENPLGVNGYYLVSRGEKTPWRLKLR
FT                   TASYANVQALSTLLVGCLVPDLVAILGSMFFVVGDIDK"
FT   gene            complement(103586..104146)
FT                   /locus_tag="Snas_0096"
FT   CDS_pept        complement(103586..104146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0096"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   mrd:Mrad2831_1768 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39817"
FT                   /db_xref="GOA:D3Q0F3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39817.1"
FT                   /translation="MAGDQVDGRKLRGHLRRAQIIEATLTVVHRDGAAGVTHRTVAKEA
FT                   GITTSLTLYYFDTLDALLVAALTSVADSYTRRIREIIDTEPDKIAGLAQLIADSAGPGR
FT                   ERALAERELSTLAARRPALRPAARRWRENVAEMARTQTDDPDAIETFVALSDGLCTALL
FT                   LDDREADPAHIRAVLGKALAKGD"
FT   gene            complement(104136..105686)
FT                   /locus_tag="Snas_0097"
FT   CDS_pept        complement(104136..105686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0097"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pmy:Pmen_3210 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39818"
FT                   /db_xref="GOA:D3Q0F4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD39818.1"
FT                   /translation="METESAGWRPWCGLGLLALPTMLLGLDVTALYLVVPDIAADLRPS
FT                   ATQTLWIMDAYGFLIAGFLITMGTLGDRIGRRRLLLIGMVGFGAVSVLAAFAPSAGLLI
FT                   AARALLGVAGATLMPSTLSLISDMFTDARQRALAIGLWATMFAVGMAAGPVVGGALVAE
FT                   YWWGAVFLIAVPVAVLVLVLAPFLLPEHRTRGGDRLDVASVGLSLAALLPAFYALKHAA
FT                   ADGLTVEVGLAALFTTVASIGFVRRQNRLRTPLLELRLFRDRTFRVALVVLLVGLIGFG
FT                   GVMFLVTQYLQLVEELSPTTAGLWMGPPAAAMLLGAVGAPLLARRVSPGVLMAATLALS
FT                   LLGYVLLGLAGTDSRVGVIGGFAFVYLALGVIAALGTDIVVSAAPPHKAGSAASLSETV
FT                   QELGIAAGVAVLGSLTTAVYRAGVDRAPGLDGDTEAAYGDSLSGAVAVADQLPDGALAQ
FT                   AKLAFTDGLNLAALVAGVAIAAAGLACLLALRRLPRLGAAASEAPEPIASAAGRDDGR"
FT   gene            complement(105787..106587)
FT                   /locus_tag="Snas_0098"
FT   CDS_pept        complement(105787..106587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_3705 helicase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39819"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39819.1"
FT                   /translation="MTLVERDLYANMADAEAETRRAINELRNEVRRAALGGHEPVKAVA
FT                   SATPRPPRELPAYEEQQQDDRRPRPVAQGSADPYSRAREEREPTSGYVAETTAVPRQRW
FT                   EDDYPVSGYENEGRDRRSNRHGSGQAVEAWRAEAEPTTPSRGTSRRARGVENGWSDEVY
FT                   NSGSQPRASRGNDADSGAQPRASRTNGSDPAGGRGRHYREPDELDGVIPSRHYREDDDS
FT                   GEIPSRHTTGSTRRREYASGESRSRGDSRSGGSYMDTYYGDSRR"
FT   gene            complement(106589..107998)
FT                   /locus_tag="Snas_0099"
FT   CDS_pept        complement(106589..107998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0099"
FT                   /product="imidazolonepropionase"
FT                   /note="TIGRFAM: imidazolonepropionase; PFAM:
FT                   amidohydrolase; Amidohydrolase 3; KEGG: acp:A2cp1_2448
FT                   imidazolonepropionase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39820"
FT                   /db_xref="GOA:D3Q0F6"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F6"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ADD39820.1"
FT                   /translation="MSLLVDNIGELSTCVGEPLSDAAVAIDGYEIAWVGPSGDAPSCDE
FT                   RVDAGGRAVIPGFVDSHSHLVFTGDRSAEFAARMAGRPYTAGGIRTTVAAVRGADDETL
FT                   RANVRKHRAEMLRQGTTTVEIKSGYGLTVDDEARALRIASEFTSETTYLGGHIVPPEAD
FT                   ADEYTALVAGDMLMSCLPYARWADVFCDRGAFDVEQAREILTAARDAGLGLRVHGNQLQ
FT                   HGPGVRLAVELGAASVDHCTFLSDADVEALADGDTVATLLPGVEFSTRSPFPDAKRLLD
FT                   AGVTVALASDCNPGSCYSSSMPLMIAFAVRDMGMTVEQALWAATAGGARALRRDDLGVV
FT                   AVGKRADLVILDAPSFVHLAYRPGVPLVHSVVHDGKIVDMALTRRLTFVRAASVARMGS
FT                   KVWRYVSKPHQRPQVAAGKDSVDAVLDRVRLRSPRGVDSVGRRLRLHDQVRLDPGPGLR
FT                   GPDRAVGRAAH"
FT   gene            complement(107995..109650)
FT                   /locus_tag="Snas_0100"
FT   CDS_pept        complement(107995..109650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0100"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: mxa:MXAN_4343 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39821"
FT                   /db_xref="GOA:D3Q0F7"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F7"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ADD39821.1"
FT                   /translation="MSEAREVRAPRGTELTCANWQIEAPYRMLQNNLDPDVAERPDDLV
FT                   VYGGTGKAARDWQSFDALLRTMRTLRGDETMLVQSGRPVGVFQTHEWAPRVLIANSNLV
FT                   GDWATWPEFRKLEQLGLTMYGQMTAGSWIYIGTQGILQGTYETFAAVANKHFGGTLAGT
FT                   LTLTAGCGGMGGAQPLAVTMNDGVCLIIDVDATRLRRRVETRYLDVVAADLDEAVRLAT
FT                   EAKQEKKPLSVGLVGNAALLVPQILRMGVPVDIVTDQTSAHDPLAYVPDGIDLGDAPDY
FT                   AAKKPEEFTDRARAAMAKHVQAMVEFQDGGAVVFDYGNSIRGEAKLGGYDRAFDFPGFV
FT                   PAYIRPLFCEGKGPFRWAALSGDPKDIAATDQAILELFPENESLARWIRLAGERVAFQG
FT                   LPSRICWLGYGERDKAGERFNELVADGTISAPIAIGRDHLDTGSVASPYRETESMKDGS
FT                   DAIADWPLLNAMLNTSSGATWVSIHHGGGVGMGRSIHSGQVTVADGTPLAAEKIARVLT
FT                   NDPGSGVMRHVDAGYERAEQVAHERGVRVPMRES"
FT   gene            complement(109702..110703)
FT                   /locus_tag="Snas_0101"
FT   CDS_pept        complement(109702..110703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0101"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B2739 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39822"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD39822.1"
FT                   /translation="MGHLDGRIALITGAGRGIGEAVARYFAAEGARVVVNDLGVDIDGT
FT                   GADASVAETVAASIRADGGAAIANTDDVADWDGARRAVASAVDGFGDLHVVVNNAATER
FT                   NLGLVDMTEADFDSVVGVSLKGTFAVSHWAARFWRERFEAGERVDRSLVNTASGSGLLN
FT                   PLPTQTNYAAAKAGVAAMTLIHALELGRYGVRVNCSSPSMVRTRLTENVAGMPQPRAEG
FT                   FDPTAPVTSAPLVAYLATAECGLTGQVLSMRGSTVLVNRNWSKGPHLSKGEELWTVDEL
FT                   AAALPDLSPDDPFQTLAAALDGALGSRLGEEGRAGVRRMVDAALDAAAAGRG"
FT   gene            110775..111353
FT                   /locus_tag="Snas_0102"
FT   CDS_pept        110775..111353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0102"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce6308
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39823"
FT                   /db_xref="GOA:D3Q0F9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39823.1"
FT                   /translation="MEPGLRERKKQRTRDALVAAAVDLFQRQGYEHTTVAQIAEAAELS
FT                   TRTFFLHFPTKEDVLLANTDRRIAAGVQAITTHRANTPLATVLLTAMERMIDDADPSDL
FT                   TQLRAQLLVRTPALQARLFQRLFSGQTALIDALTTTFDVDRVEAAARVGAMIGAVNAAT
FT                   LASLDQGDPPSRQREAMTRAARLAVTPPA"
FT   gene            111438..111911
FT                   /locus_tag="Snas_0103"
FT   CDS_pept        111438..111911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0103"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mlo:mll1121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39824"
FT                   /db_xref="GOA:D3Q1H6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1H6"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ADD39824.1"
FT                   /translation="MNARLNAFENPVLGKVFKHLIAANKSLADTGLPHTTQELVKIRAS
FT                   QINSCGFCTDMHTKDALAAGETQQRLNLVAAWREATVFTDAERAALELAEEGTRIADAA
FT                   GGVSEDVWANAAKHYDENQLGALVSLIALINAFNRGNVIIQQPAGDYQPGMFG"
FT   gene            112036..112914
FT                   /locus_tag="Snas_0104"
FT   CDS_pept        112036..112914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39825"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39825.1"
FT                   /translation="MSRESHPLHPSFRLPETFTALVEFIMDGLDPADPDVWHYASWADK
FT                   GGDLFSGDLSAGLLGKPVGDDPAELCGELLYTFQPLEILPFCWNGGDGLHYGWAVLAPE
FT                   LEGDDHPCVSFAPVDDHAVWLGDDTKQALENLLAGSMASWRERGREQGLDAPDTDERWG
FT                   AVCRALDLRPDLDSGLISPGARSKRVLEPRVPEGWRYEATSDGIGVLAPQSAFAPETVQ
FT                   VDQPWDFEQWRVVARVYLDEGRPGSALAVLKSLSYYDRGTVELMGEAYRRLGRETHAER
FT                   AELWLRLHATD"
FT   gene            113007..114920
FT                   /locus_tag="Snas_0105"
FT   CDS_pept        113007..114920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39826"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1H8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39826.1"
FT                   /translation="MEVDEILECLVALETGARQQKPDESRYVLIETEWDGESSGTWSAS
FT                   DDPVSRSLVLDALASKVYEYGDLLAELDDDEHPLLASVSSPERKALAQVLLGLQEAFQP
FT                   LSDVPVGNPFLDDATTSQGAARPVVVVRDAESQGLDFTWAVMELAPRAEPEGDDRALLA
FT                   ATARGDDDAIAAALRSGADANALDAEGMTPLHHAVAHRRLEAVAMLLKAGADPNAQADF
FT                   RNAPCFASLDGQGRVHPGAARIDDDEHWWIIGELLEGGADVNALDPRGSTLVDLAIATV
FT                   PYPDQVVAYLRDRGGRHASLARREFTEHLSRLSPGDWDRQAVSVNEVRYLLENEGPVVV
FT                   TDALHLLLKREWTEDEVSAETLFELTDLLLSHGARDNVATGQNPLDRAYELFGNGKRPQ
FT                   YQVVTYRLRKAGFARSIRSMLEWLPEGDVAAQRAHLAELRERLEASGPQPEALYWLLSP
FT                   RGWSEHEIGGEFFGELIDVLLSHGGQNVVVNGRTPLGWSRIWLGRGGHPQYRIVVDRLL
FT                   AAGFTYSARDYLDRIPLGDVEEQREFLPELRERLEAEGPQPEAMHWLLSPNSKWSPDEV
FT                   SGEIMGELTELLLEYGGRDTDVNGTRPLDRAINRVKHDGLANYQPVVNRLRAAGFRRGG
FT                   QT"
FT   gene            complement(115042..116061)
FT                   /locus_tag="Snas_0106"
FT   CDS_pept        complement(115042..116061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39827"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1H9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39827.1"
FT                   /translation="MGRNDSEFPSDEELKKLAGKIKGAAIRANTKILKSYDPDTYGNYL
FT                   DQLDGIRSQAEWLGTAFDDFLKPSPWDFDDMLKALDEIASDLGQAVGETEIKNGIVQGR
FT                   IDTTKQFLGEGGWKGALADSFKMDYLEPIGSHIAANQGAVTLVTHDGLQAMRDIYGKAR
FT                   ENLKDLGEKAVTAFEQADGISASDLKTLLTVLSAAFGLGTAVLSAFAPAAAAGAGIASA
FT                   LVSGGIAVGSDKVGEDEESELAADYPDKVEENFKNALEKLKEQITTMEDELIKVLQKGT
FT                   SDIASIVWGEKLDRLNGFSALFGMGNQSLLAPKVPDLSMVAFGDDPGKLKDGLVQVSG"
FT   gene            complement(116075..116455)
FT                   /locus_tag="Snas_0107"
FT   CDS_pept        complement(116075..116455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39828"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39828.1"
FT                   /translation="MATNEPVTGGDIYALWEVAHKGLPTVEEVYNKALETHKNKVAGGD
FT                   DKTFGRCFAAWEELRQHSEYLLSRTQGSLDGASKALDIAIDQFKYVDGDNAKGLTEAGK
FT                   EFQGYLDEGISDPDHVDQDGDK"
FT   gene            complement(116485..116988)
FT                   /locus_tag="Snas_0108"
FT   CDS_pept        complement(116485..116988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39829"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39829.1"
FT                   /translation="MGILAERLDSLSIETSSPDGQITGVFRPTSALSVHFRDGGYRGYT
FT                   ERGLERQLAALVASAWARYWRARQAAVAEATGEPAVPHQPWDTAGRRYRAERDRTRCEG
FT                   MSAGHRVHVSHTGLRDWNVVVRDGTLSTLDEFGFAAELESGFTAAMRDHRHKLMMLRDK
FT                   HLPR"
FT   gene            complement(117227..117844)
FT                   /locus_tag="Snas_0109"
FT   CDS_pept        complement(117227..117844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: MESR4; Misexpression suppressor of ras 4"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39830"
FT                   /db_xref="GOA:D3Q1I2"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39830.1"
FT                   /translation="MTDDNTGTDKVVEPEETADTEEAEEAEQATVLVMGPDGKPVGTMT
FT                   VDPESGEPQDPSKLVEQPAKVMRVGSMVKQLLEEVRSASLDEAGRKRLKEIHARSIAEL
FT                   EEGIAPELREELERLSLPFDDDTTPSESELRIAQAQLVGWLEGLFHGIQAALMAQQMAA
FT                   RMQLEQMRRGGMAALPAGSQLPPGVQMMANDDEHSGGPGQYL"
FT   gene            complement(117910..118701)
FT                   /locus_tag="Snas_0110"
FT   CDS_pept        complement(117910..118701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0110"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   xau:Xaut_0912 naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39831"
FT                   /db_xref="GOA:D3Q1I3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I3"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADD39831.1"
FT                   /translation="MRELSDVTYEVSDGTAVITIDRPDRMNSFRGQTVDELIYCFKTAW
FT                   ASKDVGVIILTGAGDRAFCAGGDVKERAETGSYGPTEWGTFEIERLHRMIRDVPKPVIA
FT                   AVNGVAVGGGHVLHVLCDLSIAAEHARFGQSGPKVGSFDAGFGSAYLARVIGEKRARQL
FT                   WYLCELIDAPTALSWGLVNEVTPAAELLSTAREWAAKINAKSPTALRFLKHSFNADTDH
FT                   LSGLSHLAFDGLDVFSDTEEAAEGATAFAEKRAPDFTRFRR"
FT   gene            complement(118712..119671)
FT                   /locus_tag="Snas_0111"
FT   CDS_pept        complement(118712..119671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0111"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   sumf1; sulfatase modifying factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39832"
FT                   /db_xref="GOA:D3Q1I4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I4"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ADD39832.1"
FT                   /translation="MAMDSCCAPARDPENPDPAAGDGADAWGFAVPKREPAKVRRGMVR
FT                   VDVGEFDMGGEDVDANPTDGEGPPRPVRLSPFHIDTVCVTNVEYARFVRETGFVTDAER
FT                   EGWSYVFHLLVAPTARGHVMDASVPGAPWWLAVRGASWRAPHGPGSSMSSVQNHPVTHV
FT                   SWRDAAAYAAWAGKRLPTEAQWEAAARGGLSGARYPWGDELLVRGAHRCNIWQGSFPRH
FT                   NTAEDGHLGTAPVKTFRPNGYGLYQMAGNVWEWCADWWTTARDGDSDPTGPATGTSKVI
FT                   RGGSYLCHDSYCNRYRVAARTHNTPDSSTGHMGFRCVF"
FT   gene            119683..120495
FT                   /locus_tag="Snas_0112"
FT   CDS_pept        119683..120495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39833"
FT                   /db_xref="GOA:D3Q1I5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I5"
FT                   /inference="similar to AA sequence:KEGG:MXAN_0913"
FT                   /protein_id="ADD39833.1"
FT                   /translation="MADPREVLTRPAEPGITIAYGDEPDQVVELFQPKGEPKATVVAIH
FT                   GGFWREAFDRTHLRPFCHGLTAAGFAVVSLEYRRSGGAGGWPQTFEDIEAALELLDDEL
FT                   TEHDVDPDNVILTGHSAGGHLALLAADLPWAEPDLTFTPLLQPGGVMVERGQSRLRGVV
FT                   ALAPVSDLPRCYVEHLGDGAAAALMGGGPADFPAEYAEADPMRRELGVPVMVVHGEADD
FT                   RVPVQMSRDYVVRRKAELRELPGIGHFEVIDPQSTIWPEVLDALNSLV"
FT   gene            120723..121859
FT                   /locus_tag="Snas_0113"
FT   CDS_pept        120723..121859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0113"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: sml:Smlt1589 putative transmembrane magnesium/cobalt
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39834"
FT                   /db_xref="GOA:D3Q1I6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I6"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ADD39834.1"
FT                   /translation="MSDFRGLAKRALRKTTGRRAHHEPKPPEAAAVERAPVPGSSLIDA
FT                   AVYRDGRRVSTPSSLAETYREARSDPETMAWIGLYRPTPGELKSLAIEFDLHPLALEDA
FT                   LEAHQRSKLERYGDTLFVVLRAARYLDDDESVDFGELHIFVGPGFVITVRHGAAPDLAV
FT                   VRKRMEAEPELLARGHEAVLYAIFDAVVDGYVPVVAGLQNDIDEIETEVFGGDPQVSRR
FT                   IYELSREVVQFQRAVRPLSGMLRGLISGFEKYGIDEELRRYLRDVADHAVSVMEQVDSF
FT                   RQALADILTVNATLVAQQQNAKMQEMTETSLAQNDEIKKISSWAAILFAPTLIGTVYGM
FT                   NFDYMPETHWKVGYPMAIVAMAATCVTLYLIFKRRNWL"
FT   gene            complement(122022..122669)
FT                   /locus_tag="Snas_0114"
FT   CDS_pept        complement(122022..122669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0114"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: vei:Veis_1888
FT                   beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39835"
FT                   /db_xref="GOA:D3Q1I7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADD39835.1"
FT                   /translation="MTEDDGIVRTLPNALAAHARHFYNSGGTPVEPRRAATVLILRDLP
FT                   YTAGAPGGVEVYMLRRAASMVFAGGMYAFPGGRVDPSDIDVLSAAVREVREETGLRLTE
FT                   LHAWSRWVTPEFEPRRYDTWFYVARLPEGAQPLDISGEADWAGWLPPKRALADHNDQML
FT                   PPTAVTLTELSGFNSVDSVLTVAEDRDLTPITPRAVIDNGTVRLALPGDPEF"
FT   gene            complement(122662..123816)
FT                   /locus_tag="Snas_0115"
FT   CDS_pept        complement(122662..123816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0115"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: kpe:KPK_1840 beta-ketoadipyl CoA thiolase
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39836"
FT                   /db_xref="GOA:D3Q1I8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I8"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADD39836.1"
FT                   /translation="MEAYLIDAVRTPFGRHAGGLSHIRTDDLAAMPIAELLRRNPDVDP
FT                   ASIDDVILGDTNQAGEDNRNVARMAALLADLPVTVPGVTVNRLCASGAEAIVLAARQVA
FT                   SGDAERVVAGGVESMSRAPFVLPRPDTAFPRNLSLVPTQVGWRLPNPKFARAWVDSLGE
FT                   CAQNLAAEYGIGREAQDTWALRSHLRAQDAWDKGLHAQRVMHVDGVPRDECVRADTNRE
FT                   KLAGLKPAFTVDGTVTAGNSSPISDGAAAVLVSRDPGENPMARLVSSATVGVSPERFAV
FT                   APVDAINKALFKAGLHFRDIAVWELNEAFSAMVLSCLHLLPEVDVNRVNPNGGAIAYGH
FT                   PLGASAPRVIMDLCDQLRRRGGGYGVAAACIGVGQGMAVVVHVD"
FT   gene            complement(124233..125096)
FT                   /locus_tag="Snas_0116"
FT   CDS_pept        complement(124233..125096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF21871 gene product from transcript GF21871-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39837"
FT                   /db_xref="GOA:D3Q1I9"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39837.1"
FT                   /translation="MRRRTPLTAAACLAVLAVSAPAPAFAHSAPIDEYVALGDSSVAGP
FT                   LIPDWDTGEPGCLRSTNNWAVEVADELGVANLTDVSCSAATAEHMANPQSLPLGGSAPP
FT                   QFDALSDTTDLVTTTIGGNDVGLVGEALKCVNLLPEPAGQSCKDRLTSGGVDQLAAKID
FT                   AFEPAFGEMLDGIREHAPNARVVVVGYGTYIQPGGCYPETPVWSRDADYLQDTIGRLDD
FT                   MMARQSAEHGVEFIDIREATKGRNLCAPTGTRWYESLIPTSPATPLHPNRIGMTGIGEA
FT                   VAAELR"
FT   sig_peptide     complement(125016..125096)
FT                   /locus_tag="Snas_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            125202..126437
FT                   /locus_tag="Snas_0117"
FT   CDS_pept        125202..126437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0117"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="KEGG: bvi:Bcep1808_4574 CdaR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39838"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J0"
FT                   /inference="protein motif:COG:COG3835"
FT                   /protein_id="ADD39838.1"
FT                   /translation="MNTHKEEPLRLGGQAVDDWLARRYERLAAELVDGFAATIPIYGRF
FT                   PPDLRRDILWITRHNLDMFIGMLRQRQAPSAEDLAPLAESASRRAEEGVPLADVLTAYH
FT                   QGIRVTWTQCASLATPDDHDDLVSVSTLVFEYQQIVTSVVATAYAEERQNILGHEREAR
FT                   RALVTALLDGQPAEELAERAGVHLAPGYLVLCLSFGSAEDSDGRRAAISDRRRVRAVAS
FT                   VLEVWPHGQVLTILDPHGGTALLPIKATEPGRTDAISPAERASLRESLAALDFPVLAAA
FT                   HLSTIERVPVVHTTTREVVDLVERLDYPPGIYQLADVLLEYQFTRPGPGADVLAELLAP
FT                   LERGTELETTLETYLRHDLSRNATAAALNVHPNTLDYRLNRIARLTGLNPSRQSDLHKL
FT                   TAALIARRHTLG"
FT   gene            126468..127196
FT                   /locus_tag="Snas_0118"
FT   CDS_pept        126468..127196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0118"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   kpn:KPN_01782 putative deoxygluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39839"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD39839.1"
FT                   /translation="MTRLDGFKIVVTAAGRDFGRSLAIGLAERGAELFLSARDVAAAER
FT                   TRAETGHPDRVHAFGCDLSRPDTIAGFAEAVAQRTDHVDVLINNGARYLDGTELTSASD
FT                   ADIAETIASGATGTVLAAKHFLPLLRRSQRPDIVTMVSACADPGHDRSLAHPAFYAAKS
FT                   AQAGFTEILSRRLRPEGVRVMSLYPPDFDNPDRLSPEWDATPRTAADPLTAQSLIDCVL
FT                   FAIGQPRDCFLRSLHFEQVQ"
FT   gene            complement(127165..128682)
FT                   /locus_tag="Snas_0119"
FT   CDS_pept        complement(127165..128682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0119"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: gur:Gura_1785 apolipoprotein N-
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39840"
FT                   /db_xref="GOA:D3Q1J2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J2"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADD39840.1"
FT                   /translation="MDAVRKTPLWIVVVATAASAVLLYSGTGIYAVAALTWLAPVPVLW
FT                   LAPRVSARAAFLTSAVAGLVGATNNLIWYITSPSDAPLWPMGLMIMLAYSLTFALGVLP
FT                   YRALLLRGRALLAAVTLPAVWTVVLWIVAVSNPTGIMGTLASAQGDVPLVLQTTTVTGM
FT                   WGLEFLVLFVPAGIAALFAPSVGAGARWRTAGVAVVVAGLVLGLGAWRLVGGGEGPSQT
FT                   VALLSNNDSGWGARLDQPAGEELVAKYEKRIAALPDGVEAVVLPEGEFTADEESLGVLV
FT                   EPMRRLAKEKDLTIVVGAVYKDEPKQYNNALVIPPKGDVVTYTKHHDGGPNTLGTELAF
FT                   QPGHGKRVGIAICADLNIPNPARQYGVAGARALLVPAADERYDGWLHARAGVLQTVANG
FT                   SSMAWAGRTGTLTVTDGYGRVLAEKDSGGAGEFTEVVTEVPQGPGATVYSRYGDWFVWL
FT                   CIGLAAVGTVLALSKRRDKPSPAASATVEAAAAASGRPTEPVRSGDS"
FT   sig_peptide     complement(128581..128682)
FT                   /locus_tag="Snas_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.826 at
FT                   residue 34"
FT   gene            complement(128666..129247)
FT                   /locus_tag="Snas_0120"
FT   CDS_pept        complement(128666..129247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0120"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pzu:PHZ_c0753
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39841"
FT                   /db_xref="GOA:D3Q1J3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39841.1"
FT                   /translation="MPKPDTAQRIAEAALAILIAEGPKAVTMRRVAADAGVTTMASYRH
FT                   FPNRETLLRTVADNAFAELGKTWGERDQLGDFDTRLRANLDDFLDFALTKPNLYTFLLT
FT                   DRRDGNRQFPQDFGGDRSPAFAPLLATVEQGMRDGLLRSDDPLEVTLAIATTGMGLVDL
FT                   YLGGRIGMPETEFRALCLRTAERVLNGCRS"
FT   gene            129432..129698
FT                   /locus_tag="Snas_0121"
FT   CDS_pept        129432..129698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39842"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39842.1"
FT                   /translation="MQRTSTQRSRIRSAYTRQQPPPYEPPPGVTEVMAWQLASSQWRDH
FT                   LPDDLLGVDCVACRAPWPCDAWDIANDILNDCRDDAAERCGTA"
FT   gene            129739..130353
FT                   /locus_tag="Snas_0122"
FT   CDS_pept        129739..130353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0122"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ara:Arad_4512
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39843"
FT                   /db_xref="GOA:D3Q1J5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39843.1"
FT                   /translation="MSLPMTTPKVINRSRREEILELAVELFAARGYHGVSMDDIGARAH
FT                   ITGPALYHHFKGGKEEMLAEALIPVSARLLAGGREHTAAHADDPRAALRALVTFHVDFA
FT                   LTSPAVIAVQLHELDRLPSEPRHRIRKLQRSYVEEWVGVLRRLRPELGDTDARVLAHAA
FT                   FGLMNSTPFLGRDSLAERPRIAELLTEAALSALDPEHRSTP"
FT   gene            130380..131711
FT                   /locus_tag="Snas_0123"
FT   CDS_pept        130380..131711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0123"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein;
FT                   phosphoribosylglycinamide synthetase; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: mxa:MXAN_5595
FT                   acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39844"
FT                   /db_xref="GOA:D3Q1J6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J6"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADD39844.1"
FT                   /translation="MFDSLLIANRGEIARRVNRTARELGIRTIAVYSEADADLPHVTEA
FT                   SEAVLLGPADPASSYLNTEAILAAAKNTGAQAIHPGYGFLSEKPGFARDVTEAGIAWIG
FT                   PSPEAIDAMGDKVNARNLMSANDVPVAPGGGDPVTDATAALAVAESIGFPVMVKAAAGG
FT                   GGMGMAIAEDAKALEEQAEKIHGFATRLFGSGDLLIERYFPRVRHIEVQILGLPDGRVL
FT                   ALGERECSVQRRHQKLVEETPSPALTDATRARLLEASSRAGEAVNYVGAGTVEYLFDVD
FT                   SGEFFFLEMNTRLQVEHPITEAVLGIDLVEAQLRVAAGEELGFSDPKPSGHAIELRVNA
FT                   EDPKRFLPGPGTIDTWVEPTGEGVRVDAGYQAGHTVPRFYDSLMAKVIVHGADRAQAIE
FT                   RAKRAVDGFTITGPKSNLAFHAELLDNPEFNSGDYDTGIVGRMR"
FT   gene            131708..132625
FT                   /locus_tag="Snas_0124"
FT   CDS_pept        131708..132625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0124"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   scl:sce4321 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39845"
FT                   /db_xref="GOA:D3Q1J7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J7"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADD39845.1"
FT                   /translation="MTTALPSSVSIREVGPRDGLQSENPIAVADKVRLINALSRTGLSR
FT                   VEAVAFVHPRAIPQMANADEVWEAVDRNPDVRYSALVPNLKGADRALKAGFTELEVVVS
FT                   ASDTHNRKNINRSTDESLDALGELIATVHDGGATAEVIVATSFGCPYEGDIAASRVAWV
FT                   VDRAVAAGADRVAFGDTTGMGTPRRVRELLEAVRASQPDIPILLHFHNTRGTALANVLT
FT                   ALEYGVTEFDASVGGLGGCPYAPGASGNLATEELVHMLHDMGIDTGVDLDALLEVAVMA
FT                   EGLVGRELPSGVLRAGPRTRLTPL"
FT   gene            132812..133711
FT                   /locus_tag="Snas_0125"
FT   CDS_pept        132812..133711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39846"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39846.1"
FT                   /translation="MTGQHRGTGERRLARLRACLTSRGLRRGLLIAGFATVAWLAGSSH
FT                   ANADSGPVADTELATTPLVSRALEAMTTSDETGVADEARSPDFRHASSTVDTAASETPN
FT                   RVLRFTHPVTAPLAKQATPDMVAPLTSAARPVTGELDAVTKPVDGTLKRIARPVAVDAN
FT                   PIGAVLSWVKPTSNGTENETVRDHSDSAAAKARHGDLGANVTLDRTVPHDRNADGRTGA
FT                   SEPFTGTAQPDIYGIAAPGGIGTGTGPGGSPTHDTGAGLSMSAADSAVNAGTSRVNPLT
FT                   AATGQLPDHVEDPAVSPD"
FT   sig_peptide     132812..132958
FT                   /locus_tag="Snas_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.605 at
FT                   residue 49"
FT   gene            134180..135238
FT                   /locus_tag="Snas_0126"
FT   CDS_pept        134180..135238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0126"
FT                   /product="putative glycine-rich surface protein"
FT                   /note="KEGG: bcj:BCAL3154 putative glycine-rich surface
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39847"
FT                   /db_xref="InterPro:IPR005528"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J9"
FT                   /inference="similar to AA sequence:KEGG:BCAL3154"
FT                   /protein_id="ADD39847.1"
FT                   /translation="MTKTWARRTVQASAIAAGVLLVSAGAAQAYGSDANTTGNIGVGTG
FT                   NQAMAPVQAPIDICGNATSVLGVANAGCHGGSNATMTESAHGGSDLTSTGNMGVGNGNQ
FT                   VYAPIQAPISVCGNSTSVAGSATSGCKGGSDATLNNGHGAPDATTTGNLGALTGNQAIL
FT                   PVQAPVDVSGNATTVGGHSVAGSHGGSNALAWAGGHHKAAEALPGVPGGLPTAGVTNVP
FT                   VGQVTGALPTNDLGNKLTSGGVDGVTGNLPTAGVTDGLPTAGVTDGITGKKPVKDVTKK
FT                   ATKVTKPATESGRVAEHGGADLTSTGNLGVGNGNQVYAPIQIPVDISGNSIAVGGVSTA
FT                   GSHGGSNATQNH"
FT   sig_peptide     134180..134269
FT                   /locus_tag="Snas_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.925 at
FT                   residue 30"
FT   gene            135522..135812
FT                   /locus_tag="Snas_0127"
FT   CDS_pept        135522..135812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0127"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: vsa:VSAL_I2766 30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39848"
FT                   /db_xref="GOA:D3Q1K0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K0"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ADD39848.1"
FT                   /translation="MRHYEVMVILDPDLEERQVTPSLENFLKVISEAGGAVENLDIWGR
FT                   RRLAYEINKKSEGIYAVANLQSEPAAVAEMERQMRLNESIMRTKVLRPELR"
FT   gene            135884..136375
FT                   /locus_tag="Snas_0128"
FT   CDS_pept        135884..136375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0128"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: gur:Gura_4397 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39849"
FT                   /db_xref="GOA:D3Q1K1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K1"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADD39849.1"
FT                   /translation="MAGETVITVVGNLTDDPELRYTPSGAAVAKFRVASTPRTFDKASG
FT                   EWKDGEALFLSCNAWRQLAENCAETLSRGSRVVVQGRLRQRSYETREGEKRTVFELEVD
FT                   EIGPSLKYATAKVQKVSRGAGGGGGRSGGGSAPDDPWATAVPAGSSGQQRGGFDEEPPF
FT                   "
FT   gene            136434..136673
FT                   /locus_tag="Snas_0129"
FT   CDS_pept        136434..136673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0129"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: prw:PsycPRwf_1641 30S ribosomal protein
FT                   S18"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39850"
FT                   /db_xref="GOA:D3Q1K2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K2"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ADD39850.1"
FT                   /translation="MAKAAPVRKPKKKSNPLDKEGITYIDFKDTALLRKFISDRGKIRA
FT                   RRVTGVTAQQQRQIARAVKNAREMALLPYTSQAR"
FT   gene            136690..137139
FT                   /locus_tag="Snas_0130"
FT   CDS_pept        136690..137139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0130"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: dde:Dde_1410 50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39851"
FT                   /db_xref="GOA:D3Q1K3"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K3"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ADD39851.1"
FT                   /translation="MKLILTREVSGLGEPGDVVEVKNGYGRNYLIPQRFATPWTKGGQK
FT                   QVDQIKRARTAREVRDADHAREIHEQLAAVNVKLTARAGTGGRLFGSITPAEITDAVEA
FT                   AGGPKLDRRRLELPGHIKAVGSHEVAIKLHPEVRSTFKIEVVAAK"
FT   gene            137350..138474
FT                   /locus_tag="Snas_0131"
FT   CDS_pept        137350..138474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GJ14166 gene product from transcript GJ14166-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39852"
FT                   /db_xref="GOA:D3Q1K4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39852.1"
FT                   /translation="MASAGRESRGHDRVASLRWSSVATFAARGFVIAGMAGVAWMLGTT
FT                   TAQAAPEGQTSPDSLVPATSSVFDDAVSTSEQAARSIRSNQLGSGGSSSIDVAESLVSE
FT                   LSEEAGGTLTDAGHNGRGSHHEDKPSGTGTSGTRQNEGADSVHGLVRDLTRPSSLEETV
FT                   SETTDPLAELTDEVETPVSKMTRAMVTPISDGVDKADESVSGLLDEATDPVSDRDVASV
FT                   LAPLADSASLTKLIGTGDNGNRQSIHNTLRSADADAGFKAPNTSGNSAVSGTEATENGT
FT                   SSDTGSALSGAKGGASAPAQLPLSPRPHIPGVFSGGSTTGNGIATDRGATDAGAACIGY
FT                   AGQVQTAQVSRVRPNMSTMGRPSELIADPAVSPD"
FT   gene            138852..139214
FT                   /locus_tag="Snas_0132"
FT   CDS_pept        138852..139214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39853"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39853.1"
FT                   /translation="MRKSIKALAVAAVAAGFGALALAGTAQAGPTGAEEMGMNPTGGGV
FT                   SILSDICAGNWNGPVITGATANNTDTRDLCSGYNGSDDAQLKLGSNLCALNWDWNDAAK
FT                   VGVINSVKDYRLCHAK"
FT   sig_peptide     138852..138938
FT                   /locus_tag="Snas_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.907 at
FT                   residue 29"
FT   gene            139331..139690
FT                   /locus_tag="Snas_0133"
FT   CDS_pept        139331..139690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39854"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39854.1"
FT                   /translation="MGEEMRKSIKALTVAAVAAGIGAFALAGTAQAGPTGAEEAGTGKI
FT                   SILSDWCVGNWNGPVITGATANNTDTRDLCSGFGGSDADFKLGSNLCAVNWDWNDAAKV
FT                   GVINSVKDYQLCHAK"
FT   sig_peptide     139331..139429
FT                   /locus_tag="Snas_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 33"
FT   gene            139793..140155
FT                   /locus_tag="Snas_0134"
FT   CDS_pept        139793..140155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39855"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39855.1"
FT                   /translation="MRKSIKALTVAAVAAGIGAFALAGTAQAGPTGADEMGMNPTGGGV
FT                   SVLSDICAGNWNGPVLTGLTANNTDTRDVCSGFGGSDDAQLKLGSNLCAVNWDWNDAGK
FT                   VGVINSVKDYQLCHGK"
FT   sig_peptide     139793..139879
FT                   /locus_tag="Snas_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 29"
FT   gene            140399..140605
FT                   /locus_tag="Snas_0135"
FT   CDS_pept        140399..140605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39856"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39856.1"
FT                   /translation="MKRTIAAVMLALGAAFFVATPALAEPVGQQAPTAGLGLPDPASVD
FT                   LAKLPVCGLNVANQTLAPDCQPQ"
FT   sig_peptide     140399..140473
FT                   /locus_tag="Snas_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(140668..141039)
FT                   /locus_tag="Snas_0136"
FT   CDS_pept        complement(140668..141039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39857"
FT                   /db_xref="GOA:D3Q1K9"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39857.1"
FT                   /translation="MTTSRTSTRGEKADGTGERAFAPTLMATAVWFIVPLVLFVVWSFL
FT                   FAGDTCAGKPCGPAQRIGDGVSAALPWAFPSFALSLLIAVLLRLPAVGWRAGATGTAAA
FT                   ILGSGLTTAILMSVGYDIG"
FT   gene            141382..142806
FT                   /locus_tag="Snas_0137"
FT   CDS_pept        141382..142806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0137"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: gbm:Gbem_2801 replicative DNA helicase;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39858"
FT                   /db_xref="GOA:D3Q1L0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L0"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ADD39858.1"
FT                   /translation="MDHDTYANRKGGAQQSRAGDYPDEPPPEEGGHEFERTPPQDVMAE
FT                   RSVLGGMLLSKDAIADVVEILKTNDFYKPAHATIFDVICDKYARGEPADAVTMVAALND
FT                   LGELGKVGGAPYLHTLISSVPTAANAAYYARIVSERAILRRLIEAGTRIVQLGYGTAAG
FT                   GGRDVDDLVDLAQQAVYDVTERRVSEDFAVLSELLQPTLDEIEAVGESAGAMTGVPTGF
FT                   ADLDRLLNGLQPGQLIIVAGRPGAGKSTAAMDFIRHAALHHQQAAAMFSLEMSKVEIVM
FT                   RVLSAETRVPLHVLRSGQLSDDDWTRLARRMGEISEAPMFVDDTPSMTLMEIRAKARRL
FT                   KQRHNLKLIVVDYLQLMSSPKRVESRQQEVSEISRGMKLLAKEVECPVIAVAQLNRGPE
FT                   QRTDKRPQLSDLRESGSLEQDADVVILLHRDDYYDKESPRAGEADMIVAKHRNGATDTI
FT                   TVAAQLHLSRFVDMAV"
FT   gene            142927..143277
FT                   /locus_tag="Snas_0138"
FT   CDS_pept        142927..143277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39859"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39859.1"
FT                   /translation="MHSLTRRLATVTLGGALLVGSLTGCGIFGTAVDCGKLAAATNDVT
FT                   SNMTDADGLKSAIEKFRAAAKDIDDAELKDSVNTFADEAEKFQKYIDNPTGDVPDESKM
FT                   MEAATDIEAKCS"
FT   sig_peptide     142927..143046
FT                   /locus_tag="Snas_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.422 at
FT                   residue 40"
FT   gene            143385..143750
FT                   /locus_tag="Snas_0139"
FT   CDS_pept        143385..143750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39860"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39860.1"
FT                   /translation="MKSLTSRVLTLGATGALAVAIFSGCSLVQGAVDCATVGETMSKIA
FT                   SNVGGDEKTLKKYTKELRDEAKNIEDADLKKSAEDFADEAESVNAGLNGDLQGGAETEA
FT                   DKLQGSADKFLEKCNAL"
FT   sig_peptide     143385..143477
FT                   /locus_tag="Snas_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.502 at
FT                   residue 31"
FT   gene            complement(143659..144783)
FT                   /pseudo
FT                   /locus_tag="Snas_0140"
FT   gene            complement(144794..145267)
FT                   /locus_tag="Snas_0141"
FT   CDS_pept        complement(144794..145267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0141"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: dal:Dalk_0768 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4- cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39861"
FT                   /db_xref="GOA:D3Q1L3"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L3"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADD39861.1"
FT                   /translation="MIIPEVGIGTDVHAYDASRPCFVAGLEWPDTPGLAGHSDGDVACH
FT                   AACNALFSATGLGDLGSNFGVDRPEWSGASGPTLLREAAARVRAEGYSIGNVSIQLVGK
FT                   YPRLGARRVEAEAVLTECLGAPVRISAATTDGLGFTGRGEGLAGTAVALVYRG"
FT   gene            complement(145350..145835)
FT                   /locus_tag="Snas_0142"
FT   CDS_pept        complement(145350..145835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0142"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: scl:sce1704
FT                   putative transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39862"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L4"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADD39862.1"
FT                   /translation="MSFSVGETVVYPHHGAALIEAVETRTIKGVEQEYLVLRVEQGDLT
FT                   VRVPAGNVELVGVREVVGAEGLTEVFDVLRAPHTEEPTNWSRRYKANLEKLASGNPLKV
FT                   AEVVRDLWRRDRERGLSAGEKRMLTKARDILVGEVALAEASTKDDAEVLLDKVLAEA"
FT   gene            146110..146475
FT                   /locus_tag="Snas_0143"
FT   CDS_pept        146110..146475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39863"
FT                   /db_xref="GOA:D3Q1L5"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39863.1"
FT                   /translation="MVSRPGEDNAVPGLPEEWGRIVIPDDASDLEELADEVRFELGITE
FT                   DPVEERRQRRLPFIVVAVTVAIALVSLFTVPWLGRVGQVTPPKQTISSTVESESVPECA
FT                   TGQTRCATTSRSTVSSG"
FT   gene            complement(146472..147779)
FT                   /locus_tag="Snas_0144"
FT   CDS_pept        complement(146472..147779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39864"
FT                   /db_xref="GOA:D3Q1L6"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39864.1"
FT                   /translation="MGNVARLWTGAIAWQAMSGTIIGGRAVPRRLLTVLSLATATAVAA
FT                   IAVPAIAAETQAMKFEHIDHSPFSLKEGPDGPDYQAMVDKVEADPRVTKSSLSDVVTAA
FT                   SPQRTGRYPLCHDTNLKPELKPTGFCWDSGDDTSADWIPQGVTGSGDADPSGTVDGRRL
FT                   VAASWHYKEDDFARISIADYTKPAEKLSYHHLLLVQPTADGNFQSVDNVHADGLMWVGD
FT                   KLFLSTGVRMQVFSLEHIWKTRTDGGDAGKIGLVGDDAYARWHGWAMPMIAEYRTTWSD
FT                   DGSWKSCNSVTGEQPCMNSIALAPDRKSFVTAEFYQPGAAGGRVIRWGLDEATGLPTGA
FT                   ATEAFVSPIWHQQGIATDGTAFYVVGDCPGSPPPDDPNNHSCIHKALPDDEPHVLTKAP
FT                   PLTQNLSYWPKTGELWGINERINTSAGKRVVFNVKP"
FT   sig_peptide     complement(147621..147779)
FT                   /locus_tag="Snas_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.858 at
FT                   residue 53"
FT   gene            complement(147865..148896)
FT                   /locus_tag="Snas_0145"
FT   CDS_pept        complement(147865..148896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0145"
FT                   /product="chalcone and stilbene synthase domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: par:Psyc_0421 chalcone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39865"
FT                   /db_xref="GOA:D3Q1L7"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L7"
FT                   /inference="protein motif:PFAM:PF02797"
FT                   /protein_id="ADD39865.1"
FT                   /translation="MVNAVIAGFGVATPPTFEQTALWNDFFVSHTDGSERAKKIFHNAG
FT                   VDTRHGVINPLTEDISRWTTGQRMARYETESLSLGESALAQALDNAGLSARDLGLLTVV
FT                   SCTGYATPGLDITLAARLGAATDTQRMVIGHMGCYAAIPGLRAVADHVRVSGRPAALLC
FT                   VELTSLHLQPAPLDTEQAVAHALFSDAAAAVVVLPDATGGTEIVDVTSRTDTSHAEAMT
FT                   WHVTDTGFRMGLSSRVPLVLARQLPDTVTGLLNRHELDIADIEAWAVHPGGRRILDVAE
FT                   KALALTPEDLHPSREVLRQHGNCSSATILMILREVLADRPAETVACAFGPGLTLYSALL
FT                   RSV"
FT   gene            complement(148954..150102)
FT                   /locus_tag="Snas_0146"
FT   CDS_pept        complement(148954..150102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0146"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-
FT                   CoA dehydrogenase domain protein; KEGG: psa:PST_0144
FT                   isovaleryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39866"
FT                   /db_xref="GOA:D3Q1L8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L8"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADD39866.1"
FT                   /translation="MLTVRRMVAGMRDRARVHDEEGSFPAEDFRQLRQRGLMGLMVPKE
FT                   LGGRGASFSEYVEVAFQLGRGNGATGLVFNMHASVTGALAQTPKELAEELGAGAEFFAQ
FT                   REEVLAAAASGSLYSVAMSERGSGSRLSKMSTTYVPEGDGFRVTGLKSFVSGAGNADAY
FT                   LVAAKHADKPDVISQFLVPAGEGVTIDPVWDTMGMRATTSHDLRLDVHVPAARLLGGVE
FT                   GVTLLAAQLAPHWMVASYAAVYVGVARAAVDLAAKQINERKLSDVASVRARLGRADAAV
FT                   AAAWATVAEAARRVDAGDPQAPTWVWRAKLLAGDTAAEVTASMMEACGASSIRRGNPLE
FT                   RLFRDARCGAMQPATSDVCADWLAVAALGGDPYADTVAGPRW"
FT   gene            complement(150065..150787)
FT                   /locus_tag="Snas_0147"
FT   CDS_pept        complement(150065..150787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0147"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bba:Bd3625 3-demethylubiquinone-9 3-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39867"
FT                   /db_xref="GOA:D3Q1L9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADD39867.1"
FT                   /translation="MVNRNDPRQYDELAEEWWKPNGAFAMLHWLAKSRCALIPEPARAD
FT                   AVLVDIGCGGGLNTKHVSGYRHIGIDLRQPNLRLAADHGLAAVRGDALRLPVADESADV
FT                   VVAGEILEHVPDWRAAVAEACRILRPGGTLVVDTLADTWLCRFVAVTLAERMPGGPPPG
FT                   IHDPALFVPPQALLSECAGFGVTLELWGLRPAALSLVRWLVRRRGEVPMITTRSKSILY
FT                   AGRGVKHAHGSAHGRRDA"
FT   gene            150808..151584
FT                   /locus_tag="Snas_0148"
FT   CDS_pept        150808..151584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0148"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: tmz:Tmz1t_0177
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39868"
FT                   /db_xref="GOA:D3Q1M0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M0"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ADD39868.1"
FT                   /translation="MKPPALIRACHPGPSMTVTLVGAGLAAASGRDAVSVASVFVAVLL
FT                   GQLSIGWSNDALDAARDTETGRPDKPVAAGEVSRRLLFWLAGAAVVGSAAASLYVGWQG
FT                   SLHILAVASAWSYNHPLKRTPLSVLPFAVSFGLLVGYADADPRPGMIAAGALLGAAAHF
FT                   ANVLPDLDDDARTGVRGLPHRLGARGSQLVAATLLAASGVIAGLHIVNVAGIAVMALSA
FT                   VFAIVVLVSRPGRTVFRVVMAAAIVDVVALLAAVAT"
FT   gene            151691..152461
FT                   /locus_tag="Snas_0149"
FT   CDS_pept        151691..152461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39869"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39869.1"
FT                   /translation="MPHAIPSKPLTRAALGVALAAASAFALTGCGAGQVTQTQDMVAAV
FT                   PGTSATISKPSEGIKIALRDAYIEFAEDGYAAGEAAPLSIRIFNSGKKSDTLTKVEFPD
FT                   SEAAGVTVAGESSGDASESPSDSESPSGDTSPSGDESPSGDESPSGDESPSGDSSASPS
FT                   GDESPSGSESPSETASSKVDLKLPVNGKLLLAPDGDQYLELTGLKQELNAGDVVTITFV
FT                   FAEAGEVEMDIPVAPPAEAAEREEPSEHGGEEGH"
FT   sig_peptide     151691..151771
FT                   /locus_tag="Snas_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.410 at
FT                   residue 27"
FT   gene            152491..153888
FT                   /locus_tag="Snas_0150"
FT   CDS_pept        152491..153888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0150"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: aav:Aave_0262 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39870"
FT                   /db_xref="GOA:D3Q1M2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M2"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADD39870.1"
FT                   /translation="MAKSPKTVYACSGCGHSVPKWVGKCPDCGEWGTMEAAVAMSGPAA
FT                   APRRAATARPAIPAQSIAQVSAKQAQAKSTGVDEFDRVLGGGLVPGGVVLIAGEPGVGK
FT                   STLLLDVAHRYAAAGHGRTLVATGEESAAQVRLRADRIGALHPDLMLAAETDLASVLGH
FT                   IDDVKPGLLILDSVQTVTTSDVDGVPGGVTQVRAVAAGLISVAKERGITTILVGHVTKD
FT                   GNIAGPRVLEHLVDTVVHFEGDRHSTLRLLRGVKNRFGPADEVGCFDMTEDGIVGLTDP
FT                   AGLFLAESPDEPVPGTCVTVTMEGRRAMLVEVQALVGGSAKDGTIPRRTVSGLDYARLN
FT                   MALAVLHQRGHVKCLDREVYAATVGGMKVMEPAADMAIILAVASSVSGAPVSADIVAIG
FT                   EAGLTGAIRRVTGVPRRLAEAARLGFRHALVPPGCAEGAPKNMTVTEVSTIAEATRIAA
FT                   QRWAARA"
FT   gene            complement(153917..155101)
FT                   /locus_tag="Snas_0151"
FT   CDS_pept        complement(153917..155101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0151"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: ilo:IL1818
FT                   beta-lactamase class C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39871"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M3"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADD39871.1"
FT                   /translation="MASRRTVLGLAGAATVAAGITVASSGIAEADSKVPDGLKPGGELD
FT                   RYVKKLAAEGKFSGAFLLTHKRRKVLSRAYGMADAKAGVRNETDTRFKLASVTKMFTAV
FT                   AINKLVQDDKVRYAEPIGKYIDGFSDEVAEKVTIHHLLLHTSGLGDFHDLPGYEEASRK
FT                   WDTPDEVMNGTLDFIREDKLRFPPGAGWQYSNAAYCVLGGIIAAVSKQSYFDYVRDNVF
FT                   EPARMRASDFYTRPQWQKDPKLAHPYFKDDETGEWVDRVDEQAYIGLPAGNSFATVGDM
FT                   NRFANALLDAELLSRQFTHIMLTPKLPVGGGGKEPPPDPDKPRMTGFLGYGTFSSLIGD
FT                   QRVHGFSGGSQAGPSTSIDIYPDSDWVTVILTNRDPSTVPEVNKIITKHILGAK"
FT   sig_peptide     complement(155009..155101)
FT                   /locus_tag="Snas_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.698 at
FT                   residue 31"
FT   gene            155218..155874
FT                   /locus_tag="Snas_0152"
FT   CDS_pept        155218..155874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0152"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: mca:MCA2330 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39872"
FT                   /db_xref="GOA:D3Q1M4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD39872.1"
FT                   /translation="MRVLLVEDEEPLAGYIAVGLRKHGLAVDVAHDGQTALDKCDFTPY
FT                   DVVVLDRDLPVVHGDTVCQRLAAQGTARVLMLTASGTVEDRVDGLSLGADDYLGKPFAF
FT                   SELIARVRALARRSAPARPPLLRAADVVCDPARRTVERAGRPIHLTPKEFGVLEQLLAA
FT                   GGDVVSAETLLDKVWDEHADPFSNAPRITVGTLRRKLGEPPLIQTVTGAGYRVVP"
FT   gene            155871..157067
FT                   /locus_tag="Snas_0153"
FT   CDS_pept        155871..157067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0153"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   sfu:Sfum_2006 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39873"
FT                   /db_xref="GOA:D3Q1M5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADD39873.1"
FT                   /translation="MRWPRFTARGRLTLLYMAMVLGAGAVMTALTYVLMRSSLRRRSFV
FT                   HTDVDPDSPAGLPFPERFDELIERDRMTILSDLLVKATVALVVVSVLAAVLGWFVAGRV
FT                   LRPIRQISAASRRLSAENLAERVPVRGPADELAELADTVNGMLDRIQRGVAERDRALAS
FT                   QRLFTANAAHELRTPLTTMRTAIDVTLDGEPDRDELLAMIADLDTTVERSRRTLDGLLL
FT                   LAGSHAAPAEQSPVALDGLVAELLEAKAPAIAEHRIDVRRELFPAPALGDPLLLERLTG
FT                   NLIDNAVRYNHPDGHIALRTGTADGRAFLRVANSGPHVAPESAPGLLEPFVRGGGGRIR
FT                   ATGGVGLGLSIVRAVVTAHDGDLSIAANPDGGLTVTVELAVDPAAATRTDGGRDDHVA"
FT   sig_peptide     155871..155957
FT                   /locus_tag="Snas_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.938 at
FT                   residue 29"
FT   gene            157079..157735
FT                   /locus_tag="Snas_0154"
FT   CDS_pept        157079..157735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0154"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39874"
FT                   /db_xref="GOA:D3Q1M6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M6"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADD39874.1"
FT                   /translation="MSEAPFIAAARAAYDATAEPYAEAVPGKLADMPLDRALFGAFAEL
FT                   MRANQNTTVADVGCGPGHVTDLLCGLGLDAVGIDLSPRMIEVARRRYPKPRFEVGSMLD
FT                   LDLPDGGLGGVLAFYSIIHLPWTERPRAFAEFHRVLTPGGQLMLGFQIGDERRHHDEAF
FT                   GKPIDLAWYRQQPGEVAELLRDSGFDVRTTVVTEPEEGQAVRHGHILARKPATAA"
FT   gene            complement(157750..158394)
FT                   /locus_tag="Snas_0155"
FT   CDS_pept        complement(157750..158394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39875"
FT                   /db_xref="GOA:D3Q1M7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39875.1"
FT                   /translation="MPRNASAGWTVMRQRPPRRALTRLSGFVLMGALATCITWLIFITE
FT                   PAQLSSGASNPAAKMPTFMAIAVVVSVLLAAAPALRPPRLAANHYGLAVRPGAFRTVLL
FT                   PWVHVEEVTAVAVPGRRHPDAYILVACDDYLGRTTGDRPRFLDQAVLREANRAADGRVG
FT                   DFDLAVRLADFTDTPEAILERIASYAPDHVDVNNQLDDPIEDRDAKKKPAE"
FT   gene            158455..159639
FT                   /locus_tag="Snas_0156"
FT   CDS_pept        158455..159639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0156"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; helix-
FT                   hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39876"
FT                   /db_xref="GOA:D3Q1M8"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M8"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADD39876.1"
FT                   /translation="MTANRSVDLARTYAVRSTLLPLAHGALNIVEGAADVVLPERDEPM
FT                   RATLALMAPGTALRDGLERILRGNTGALIVLGFDETVAALCTGGFHLDVEFAATRLREL
FT                   CKMDGAVVLTSDGTKIVRAAVHLMPDSTIRSEESGTRHRTAERVAKQTGFPVISVSQSM
FT                   HIIGLYVNGQRHVLDDSAAILSRANQALATLERYKSRLDEVAGTLSALEIEDLVTVREA
FT                   MVVVQRMEMVRRIADEVEGYVIELGTDGRLLALQLDELMAGVDSDRTLIVRDYLPEDLE
FT                   RSAPVKAMAELDGLTAGELLDLSAVSRALGHNGGSEMLDAPISPRGFRLLGRVPRLPGP
FT                   VVERIVGHFASLQRLLGATVDDLQAVDGVGAARARSVREGLSRLAEVSMLERYV"
FT   gene            159713..162115
FT                   /locus_tag="Snas_0157"
FT   CDS_pept        159713..162115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0157"
FT                   /product="cell division FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: dac:Daci_4199
FT                   cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39877"
FT                   /db_xref="GOA:D3Q1M9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M9"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADD39877.1"
FT                   /translation="MAGLRATFDNTVARHLSAVGRLNAVRAALDAAPPSGPDAASVAAE
FT                   TALAQRLSAAAAALRDDPGLVHIGQARLHASSFPVLVPFIGTGHLAFSHDSREPRVAAL
FT                   MRAILLRAMASAQPGQLEIEAVDAATVGASLAALQPLADARLMRVTTDAAGLERALAAC
FT                   EDHVKSVLRGERSTKLVLALASTPELNEDLRGRVDALARSGVAGGVHLLAGGFEQLPTA
FT                   VTIQVADDMRVGNPPDAPIGAAGLNAPVAFDRPLTDDYVRAEATRVADRAKAAAELRFA
FT                   DLAPDRLWSEDPSDGLSTLAGRDSQGVLRLSFDDETPHWLVGGRTGGGKTVFLLDILYG
FT                   LAARYSPEDLALYLLDFKEGVSFTEFTPQSADSTFIPHARAVGVESDREYGVAILRELD
FT                   AEMTRRSVVMKRHGVARYSQLRGAESLPRILCVVDEFQVLFAGNDKLAREAVGLLENLA
FT                   RKGRSYGVHMILASQTTSGIEALYTKKDSIFGQFPLRVALPGATSVLDHLNPAAQGLRT
FT                   GEVVINADGGIAGRDRKVRFPNAHAESELLYQLRHDMWSARRDAQPPTVFYGYAAAHLD
FT                   EDPRLAELTETPRPRVLLGRRVNAALDTAEITLDNTPGRHLSILGADPTGAHLLNAAAI
FT                   SLAKQRPQARYVVAALAEPGLAQATATALGEQAELVAADDLATVMAELTEAAQPAFLIG
FT                   FGLDAANLTMDGKKALTTLLRTGPASGVHLLGWWRGLRRFTDDIGGSAGREDVSCSVVL
FT                   NVPGNELMGHFGQSVMDWNPRPGRGLLIDRHANRHDLMVPYTLRETE"
FT   gene            162112..162777
FT                   /locus_tag="Snas_0158"
FT   CDS_pept        162112..162777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39878"
FT                   /db_xref="GOA:D3Q1N0"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39878.1"
FT                   /translation="MTRPGSGYDEYLTALRDLDNVRAAQDQASAVQRDQRTGIDTTVER
FT                   LWQRLSDQRDQLNRLAVDCGLPAVPTQPTPTPPPADPQAELTIAVTDVDSADTGYADAH
FT                   YLAHRPKFLPRWRADDRNGLIYGLYALLSLFAQVGVLASAAGTESLGDMIVEVLTCVAL
FT                   PLPAWAAGWLTIGVVSRPVLGEGTLGPNGKLVRNPRLGAVICFSTLVVSCALGNIYLN"
FT   gene            complement(162787..163548)
FT                   /locus_tag="Snas_0159"
FT   CDS_pept        complement(162787..163548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0159"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   rlt:Rleg2_2905 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39879"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD39879.1"
FT                   /translation="MSTRFAGKTVLITGGGSGIGREAARAFAAEGATVVVAGRREAPLK
FT                   ETVELVTAEGGTASFVTGDVTNEEDVRRIVATVAERHSRLDVAVNNAGVFAAGPLAEFE
FT                   LDQWQRLVDINVTGVLLSMKHELRQLKQQDGGGAIINVGSTVGAHKSVPGLAAYGASKA
FT                   AVSALSRAAAAENIRDGIRINIVSPGSSDTPMSMRGGETEQQRAERLHETVPLGRVGQL
FT                   DEVVSAVLWLASEGSGFAVGHDLVVDGGVSL"
FT   gene            complement(163624..164205)
FT                   /locus_tag="Snas_0160"
FT   CDS_pept        complement(163624..164205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0160"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: swd:Swoo_3433
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39880"
FT                   /db_xref="GOA:D3Q1N2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39880.1"
FT                   /translation="MARTKEFDPDTALRSAMELFLRHGYEATSVADLVETLGVSRASLY
FT                   ATFGHKDELYRKALDLYNRSQPIDFAEILSRPGPVLPSVREVVEEFAAQAKLPDGSGAC
FT                   LIVNAAVERMSADDAVARQVESSWDFLETTLFMALCRAKAQGELSPDADPRAQARFVLV
FT                   MLQGIRVLSGSAVSAERIDDAARQTLAALS"
FT   gene            164330..164950
FT                   /locus_tag="Snas_0161"
FT   CDS_pept        164330..164950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0161"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: acp:A2cp1_2781
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39881"
FT                   /db_xref="GOA:D3Q1N3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39881.1"
FT                   /translation="MTDNSRRRGRPATGVREAVLAATEEILAESGVARLSTKEIAKRAS
FT                   VAESSIFYHFNDRLGLLKAVVDTHRPGFRQTLAEIRAGGGSGELRADLVALLESLEAFY
FT                   LRITPILAAVQSDGELRGRFSDRGASEEIGPRRGVTALAEYLDAERAAGRVRRDLDSLA
FT                   IAQLLTGVAFQRAALIRLSGPEGVPPGGVEPIVDALLPSLVKP"
FT   gene            165026..165511
FT                   /locus_tag="Snas_0162"
FT   CDS_pept        165026..165511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd3624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39882"
FT                   /db_xref="GOA:D3Q1N4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39882.1"
FT                   /translation="MRTRIIKATAVFVTGLLAGMFTYGALNVAQAFKAVPLDVRFTYHV
FT                   ALMNVNAYVMQITMGLAVLSALTLTVIARGTPRLLAGAATVLGVATFVITRFGNVPINQ
FT                   QIRQWVKTSPPADVASILDRWELLHYFRTGTAVLMFATIVLIAVRYRALRPADPATP"
FT   sig_peptide     165026..165121
FT                   /locus_tag="Snas_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.374 at
FT                   residue 32"
FT   gene            complement(165522..167168)
FT                   /locus_tag="Snas_0163"
FT   CDS_pept        complement(165522..167168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0163"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mlo:mll5046 putative FAD-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39883"
FT                   /db_xref="GOA:D3Q1N5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N5"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADD39883.1"
FT                   /translation="MDTDVIVVGAGLAGLVATAELAEAGKKVILVDQEPEQSLGGQAFW
FT                   SFGGLFLVDSPEQRLMGVRDSKELAWQDWLGSAGFDRDEDAMPRAWAEAYVDFASGEKR
FT                   SWLKERGVKFFPVVGWAERGGYLADGHGNSVPRFHITWGTGPAIVEAFEKRVRAAVDSG
FT                   LVTLAFRHRVDDLTVTDGRVTGVSGSVLQPSDAKRGESSSREVTGDFAFTAQAVVVTSG
FT                   GIGGNFDLVRQNWPQRMGTAPKHLISGVPEHVDGRMLGITESAGGEIINRDRMWHYTEG
FT                   IQNWDPIWPHHGIRVLPGPSSLWLDATGRRLPAPLFPGFDTLGTLEHIMSTGYEYTWFI
FT                   LTQKIIEKEFALSGSEQNPDLTGKSIKKVLKRALPGATPPVEAFKKHGADFVVANTIEE
FT                   LVAGMNGLTEERLLDVERVWDTVRQRDREIRNKFTKDLQVLAVRATRAYRGDKLIRVAT
FT                   PHRLLDPKAGPLIAVRLNILTRKTLGGLHTDLSGRVLRPGGEPLPGLYAAGEVAGFGGG
FT                   GMHGYRSLEGTFLGGCIFSGRQAGRAVAEAL"
FT   sig_peptide     complement(167100..167168)
FT                   /locus_tag="Snas_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.602) with cleavage site probability 0.298 at
FT                   residue 23"
FT   gene            complement(167234..167806)
FT                   /locus_tag="Snas_0164"
FT   CDS_pept        complement(167234..167806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39884"
FT                   /db_xref="GOA:D3Q1N6"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39884.1"
FT                   /translation="MSRPAVSGDVIANAIAIAGFALATWLWVFPPHSGWALVVGVVAAA
FT                   VYYLGNFSRSRGGMRLLLMLVPLTYVATLITGTGMTVLEIVGETDECVVESRQSYFTGS
FT                   GDGVDVTVACPGGETYRFNEARARTVEGEKVLVTYDPSGNVKANLTELQHDGLGIGFMV
FT                   WTVADTALLVGLPVWIAARDRARRRVD"
FT   gene            complement(167858..168055)
FT                   /locus_tag="Snas_0165"
FT   CDS_pept        complement(167858..168055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0165"
FT                   /product="protein of unknown function DUF1271"
FT                   /note="PFAM: protein of unknown function DUF1271; KEGG:
FT                   bxe:Bxe_C0944 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39885"
FT                   /db_xref="GOA:D3Q1N7"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N7"
FT                   /inference="protein motif:PFAM:PF06902"
FT                   /protein_id="ADD39885.1"
FT                   /translation="MKIKADREVCVGAGMCVLTAAELFDQDDDEGRVLVLQPEPHPDQV
FT                   AAAREAVELCPSGALSLEEG"
FT   gene            complement(168066..169271)
FT                   /locus_tag="Snas_0166"
FT   CDS_pept        complement(168066..169271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0166"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bxe:Bxe_C0945 putative
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39886"
FT                   /db_xref="GOA:D3Q1N8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N8"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADD39886.1"
FT                   /translation="MSTVEVPRGVPLDRPNPFDPSPQLTRLRETRPISRMIFFPDEHEG
FT                   WLITGHEQVKKVLADTRFSSSSTFQRSPVDSPFLPKQLKEFPVEPGMFIRMDPPDHTRL
FT                   RRKLTGVFTVKRMKVLEARVAEIVNQHLDELAASPKPADLVEKFALPVPSMVICELLGV
FT                   PYEERAEFQTRSHKMLSFSTQPEERMASIKEIQEYILGLAKQKRAEPTDDLLSDLTQDD
FT                   DLEPAEMGGIGFLLLVAGHETTANMLGLGTFALLEHPEQLEILRDDPELMPKAVEELLR
FT                   YLSIIHLGARRIAAEDIEFEGHLIKKGDSVSISVAGANRDPNKFDDPDTLDVRRTATGH
FT                   VSFGHGVHQCLGQQLARIEMRIGFEALLRRFPGLRLAVDPSEVPLRTDMAIYGVHKLPV
FT                   TW"
FT   gene            complement(169319..169816)
FT                   /locus_tag="Snas_0167"
FT   CDS_pept        complement(169319..169816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39887"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1N9"
FT                   /inference="similar to AA sequence:KEGG:MXAN_2431"
FT                   /protein_id="ADD39887.1"
FT                   /translation="MPELSIAERELVGRFGVFVEMSGGQRIAGMLVGYLLICKPEHQSI
FT                   TEMADALAISKASVSTVIRQLQQGLKVERVPVPDSRQHYYRLAGGGDWTEILRTRWKFL
FT                   NAGRDVAAAGLRLVGDDPDRRERMQEFADFLDFLVEEFSPELVSRWETYRNKRTAEREA
FT                   PR"
FT   gene            complement(169933..170682)
FT                   /locus_tag="Snas_0168"
FT   CDS_pept        complement(169933..170682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0168"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   bvi:Bcep1808_3503 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39888"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P0"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADD39888.1"
FT                   /translation="MVSNVVVLSDIHGVLPALEAVLAEPDVRSAERIVLTGDILSGPQP
FT                   VEVFDTLLGLGERVVWVRGNADRELVEIRRDGKAIPEIPVSEWAAGQLREEHVGLLEGM
FT                   ASTARLGIEGLGEVLFCHATPRDDEEVVLVDSRPARWEEVLAGLDPAVTTVVCGHTHMP
FT                   FSRLTHGVTVVNAGSIGMPYGRRGAPWLRLGPGIEMRHTEYDYEVAVARIAAESTFPDA
FT                   AAWADEYVYSRNSERDALAAFGPRDGR"
FT   gene            complement(170746..172065)
FT                   /locus_tag="Snas_0169"
FT   CDS_pept        complement(170746..172065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:pRL120266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39889"
FT                   /db_xref="GOA:D3Q1P1"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P1"
FT                   /inference="similar to AA sequence:KEGG:pRL120266"
FT                   /protein_id="ADD39889.1"
FT                   /translation="MTVLTGEALADRAADVLRGNDLGDMTAAAPRLYPHMWSWDSALIA
FT                   VGLARISVPRAITEMRTLLRAQWTTGMIPHIVFSDVDGYFPGPDRWRAHLAPTAPSGVR
FT                   TSGICQPPVHAIALRHILDAGRRSGGTDQAEAERFISSTFDSWLNWHRWLATARDPDGL
FT                   GLVEIHHGWESGMDNSPRWDDAYARITPGTLEAFTRLDTRHVADVSERPSDTEYARYLW
FT                   LIEQMRRADYDETAMRSSLDFRVADVFTSAILAVASDVLADLGDEFDRTEAAAELRDIA
FT                   ARFRAGVASTIDSTTGLARDLDRHDDEWIDADSVAGFAPLLSGGDVDLIDRQREIFWGP
FT                   RWCGHPDLAHRLPASLSPAATNLRPKTYWRGPVWPFLSWLFGWGLRHHGHIGDAEAIRE
FT                   AGLAQLTDGHFGEYYEPFTGEALGSHRQSWTAAVALDWLA"
FT   gene            complement(172062..173144)
FT                   /locus_tag="Snas_0170"
FT   CDS_pept        complement(172062..173144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0170"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ara:Arad_9759 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39890"
FT                   /db_xref="GOA:D3Q1P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD39890.1"
FT                   /translation="MADISIRNLSRTYSGQKAPATDDVSLDVADGEFMVFLGPSGCGKT
FT                   TLLRMIAGLELPDAGSVAIGGKDVTYLAPRNRNLSMVFQSYAVFPHRRVRANIGFGLKM
FT                   RGVAADEIARRVDRAADLLQLTDYLDRYPAQLSGGQRQRVAVARAIVVDADVLLMDEPL
FT                   SNLDALLRLSFRAELKKIVAELGTTTVYVTHDQAEALSLGDRVAVMRSGRIVQQGGPID
FT                   VYDSPADTFVGGFLGSPPMNFLDGEVADGPKLRVGEQSLAVPSALASFAGQPVKLGVRA
FT                   ENITVSQSRDESAVPATVDVVEPVGASVLLTVTVDGQELKVQAPPTFRIDPGATAWLTF
FT                   PADRLRFYDPESAMALETDR"
FT   gene            complement(173175..174038)
FT                   /locus_tag="Snas_0171"
FT   CDS_pept        complement(173175..174038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0171"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_9760 sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39891"
FT                   /db_xref="GOA:D3Q1P3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD39891.1"
FT                   /translation="MTTSDTAATPTRGNSAALRAHRWRRFGVQVACLAVTAFMAIPIYL
FT                   IAVAAFSSRDALNEFPRALWPSDLSWDTMGTFVSSTGILPAFGNSLIVGVNTLVWSLLV
FT                   GAPAGYALARYAFRGREPYQLFLLFTRALPIVVLSVPMAQLFLSTGVYDTTTGVTLLHT
FT                   ALALPTTVLITAAVFVAVPRDVEEAAQIFGCSPFSAFVRVVLPLALPGVSAASIFTFVL
FT                   SWNEVLGAAVLTLNRRTLPGQVLSTLQYSPEAYRFAGGFALIVPAIIFIALMRKYLLNM
FT                   WGTTLR"
FT   gene            complement(174035..174916)
FT                   /locus_tag="Snas_0172"
FT   CDS_pept        complement(174035..174916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0172"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120263 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39892"
FT                   /db_xref="GOA:D3Q1P4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD39892.1"
FT                   /translation="MAATQVTEVAPRRRRIPPVVWLIAPSVLFMAALMGWPTISGLIQA
FT                   FKTGDGFGFDNFARMAADPFFWPAVRNTLLLIVILIPVQFALALGMALLLRAKPKLSGL
FT                   YFYIWAIPLAVSDLAAGLVWLSIFTDHGYLNSFLSHLGIDGVNWLSYDSNTSMFFAVFI
FT                   AELWRATSLVLVIVVAGMQGIPKDYDEAAQVFGASYWQRLRHVTLPLLRPSLQVALILR
FT                   TILAFQTFAVAQALTGRDFPVLVGETYNWYVALRNPSVASALALVILAISMITAIVYLR
FT                   ALRDPSDKGGKR"
FT   gene            complement(174918..176249)
FT                   /locus_tag="Snas_0173"
FT   CDS_pept        complement(174918..176249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0173"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rle:pRL120262 putative substrate binding component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39893"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADD39893.1"
FT                   /translation="MATSPHRPPAGLSRRSLLGGAAALAAVPLLSSCVGFNTSGGKAGS
FT                   LDFLSTQFTPVEEKQRFEKVLADAKVNAAYNAVEGNVFASTLTSQAEAGSVQVSLAGAM
FT                   HGELAPLADRFTDVDGLLKGKLAQAEYPKDLLELAKAGGSTAKYIPWMQASYVVAVHKR
FT                   ALEWLPSGADVNSLTYDQYLDWAIAARKANGSPVFGFPAGPDGLYARFVQGHLLPSFTG
FT                   GQVTTFRSADAIDAWKYMKELWANFVPASTNYDNMQEPLAKGEVMVAWDHIARIIEAPK
FT                   GNPDEWLLVPSPKGPKGLGYMLVVAGLAIPDGAPDPDGATDAILSLSEPDVQIEVLKQN
FT                   TFFPVSVTELPDDLEGATKLAAEAITAQREAKDAIMALPPVGTGERDGEVTAVFQNSFR
FT                   QICLDDRSIKSVVDEQAAELQSILDDLKIPCWAPDPAEAVCEVG"
FT   sig_peptide     complement(176172..176249)
FT                   /locus_tag="Snas_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.476 at
FT                   residue 26"
FT   gene            176363..177583
FT                   /locus_tag="Snas_0174"
FT   CDS_pept        176363..177583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0174"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mxa:MXAN_6549 ROK
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39894"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P6"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADD39894.1"
FT                   /translation="MTAMRPSGRFPAQAANTPGHLLNLIRSRDNWTRQQLLTATGLSRT
FT                   TLFSRLGQLFRSGYAYESGAARSTGGRPSSLVRFEDRGRVVLVIDLGHRHGRIAITTVG
FT                   GTTLRETRLSIDIAQPPKTLLPTIYDQAQHLLDTGTDEKLVGVGVAVPGPVSPVTGHLT
FT                   ETTIMPGWHHYPLNAEMADRWGVPVLLENDARAYALGESVERPDASPLVAVKYANGIGA
FT                   GIVLDGQLLCGVGGAAGDIGHIRITDARGRRCRCGRNGCLAAYASGHALLRQLRRPTDT
FT                   TVDDLATTMATHQPTETAVRAAATLLGRTLASLVATLNPQLIVLGGVLGRTPAVVEEVR
FT                   SQIHTLAIDRVTTPLSVTASTAHHPVGTGLTALVTGHVYAPDNVDATLTAQPTTADTRS
FT                   TPPHRAP"
FT   gene            177616..177691
FT                   /locus_tag="Snas_R0005"
FT                   /note="tRNA-Trp1"
FT   tRNA            177616..177691
FT                   /locus_tag="Snas_R0005"
FT                   /product="tRNA-Trp"
FT   gene            complement(177744..178439)
FT                   /locus_tag="Snas_0175"
FT   CDS_pept        complement(177744..178439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39895"
FT                   /db_xref="GOA:D3Q1P7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39895.1"
FT                   /translation="MSAISKSDRITTGLAGLLSGVLSILMVGLYFVYDGAPPPENVLGR
FT                   NLITVTTFIGFLIFGAGLARLLRQARGGDAGLSGSIAVTSLLTYVAVTLVSASLEVGTS
FT                   LWKPNSDMDPTVDGPLAAGMVLLHGPIARGLVAAFLITLTISAARTGLLRRWVLTGNII
FT                   LALTNLALVPSLFFGMNAANFYAANGWGAVASIGLINVIWFATLGGALLRSRAARQTPV
FT                   PTPAPAPTR"
FT   gene            complement(178468..178818)
FT                   /locus_tag="Snas_0176"
FT   CDS_pept        complement(178468..178818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39896"
FT                   /db_xref="GOA:D3Q1P8"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39896.1"
FT                   /translation="MENTNKTHSGQTTSFLSRLTSFGREIFAPVTAPPKSPQRSLLVAR
FT                   QATALLGIFGTVVQVIVWLMIGVIGGDLDAPWWLWTVAASTLLVAGFTMAHRLIPGTPR
FT                   PDTAANQPNVSA"
FT   gene            178952..180112
FT                   /locus_tag="Snas_0177"
FT   CDS_pept        178952..180112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0177"
FT                   /product="histidine kinase dimerization and phosphoacceptor
FT                   region"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: scl:sce5432 putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39897"
FT                   /db_xref="GOA:D3Q1P9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P9"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADD39897.1"
FT                   /translation="MERDAEAEPADTSTGGRWDPAGLVLTVLPALAAFAGGLAQLYWVL
FT                   LAGPVGTMRWVDIGCGAAACFVLLFRSRARTGIAIALAVVAAFAATGGVANMVALYGVA
FT                   RYRRLPVALAVGAADVLAGYCFWLVYPENNKLSLTLVVNVAIVAAIVAWGAMRQTQESL
FT                   LLSYRERAERAEREQRLRETQIRQAERTRIAREMHDVVTHRISLVALHAGGLMVDPEPK
FT                   IDVVRGSAELIYGSARQALEELRLALGALRADEPTSLEQPGLDRIQDLVEDALRAGQEV
FT                   ELDMDPAIVETAPPGIGRDAYRFVQEGLANVRKHAPNAVAVVTVAAADGVLRVRVVNEM
FT                   VDGSLGVPGAGAGLIGLRERADLAGGTLSHGPVDGRFELVGELPWT"
FT   gene            180103..180768
FT                   /locus_tag="Snas_0178"
FT   CDS_pept        180103..180768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0178"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   scl:sce5431 two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39898"
FT                   /db_xref="GOA:D3Q1Q0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD39898.1"
FT                   /translation="MDVTTTSVLLVDDDPMVRNGLRMVLRADPGIVVVGEAGNGRQAVD
FT                   QARELRPDVVLMDLQMPVMDGVAATRELRGLPDAPAVLVLTTFHLDTYILDALGAGASG
FT                   YLLKDIPPTEIARAVQMAAAGESVFSSSVTRSLVQRVASPATDPKIEAARAALAALTER
FT                   EREVAAAVAAGKSNAAIASEMFMSEATVKTHVSRILTKTRSQNRVQIALTVYRASGVR"
FT   gene            complement(180773..181945)
FT                   /locus_tag="Snas_0179"
FT   CDS_pept        complement(180773..181945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0179"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rme:Rmet_2721 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39899"
FT                   /db_xref="GOA:D3Q1Q1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADD39899.1"
FT                   /translation="MKVTFLVHSLDRVGGITRATLTTASALAARGHGVRIAAIFRLSSR
FT                   PRFDVDPRVEVVTLVDEVDGRRRSTRDSALRKRPSRIHPRGDTFYEHAYTELVDARLTE
FT                   FLNDCEADVVVGTTPGLNVCLAALAPRGAITVAQEHMFYEHHEPSLRAELSRAYERMDA
FT                   VVTLTQRDAARHRRELPHLASRVTRIPNSVPAPPRRARRPDNRVIVAAGRLEPAKNFAM
FT                   LIDAFAIVHRHHPEWRLRVVGDGSQLDGLRAQIQRLGLSHRVSLPGMITPMDREWAAGG
FT                   IAALSSDFESFGLTVIEAMHFGLPVVSTHCRYGPPEIITDGEDGLLCPVGDAERFGAAL
FT                   CRLIEDRALWRRCSRTARRTAGRYVPEEVVADYEKLFNRQLEHRDLSTLG"
FT   gene            182140..182514
FT                   /locus_tag="Snas_0180"
FT   CDS_pept        182140..182514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0180"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: xau:Xaut_3967 PadR-like family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39900"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q2"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADD39900.1"
FT                   /translation="MTGPLREPTFLILTALAREPLHGYGIVTEVSQLSEGRVGLRPGTL
FT                   YGALDRLREDGLVASDREEVVDGRLRRYYRLTDEGAATLREAVEQTRRNVDAAAKRLRA
FT                   FPSPSFDTPRTAHRLAGGTA"
FT   gene            182511..183464
FT                   /locus_tag="Snas_0181"
FT   CDS_pept        182511..183464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39901"
FT                   /db_xref="GOA:D3Q1Q3"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39901.1"
FT                   /translation="MTTNHEVLEQRYRRLLRVYPGRYRRERGEEIVGTYMDCAAEDRKR
FT                   PTLADVGDIAKAGLLQRLRHAPEGLPGGMRVAAAAALSVVTAVSFVFTLRVEMSPPPGG
FT                   TEFDTFGAFQSPAVILWALWMAVGLSAAFLPGRVTRGLVLVPMAATLAYIPIAYLTYYA
FT                   SPPMFSVIPLAVFGALVLAWPKTPHWTMRVAPPVSLLLALGAFGITEPHRTYRTGDVVL
FT                   DLPVLVLLALGAIVIAGVVEYFTRRTTRTLWAASVLLLPAVWFATYSLAGTRMSAGDWN
FT                   VAASGTYVTTAVNFGLMALAIPLVALAWSHWRAAKR"
FT   gene            complement(183522..183935)
FT                   /locus_tag="Snas_0182"
FT   CDS_pept        complement(183522..183935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39902"
FT                   /db_xref="GOA:D3Q1Q4"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39902.1"
FT                   /translation="MSDSKSTGLKLVPRSRATVATLAGLLVGIIGILMQYAVTPEKFPG
FT                   FPPGVYVIGGCGVLVWLMQRLSWGTLPAILVTLQIIVLGGFIQGELTKNLQSSNTMTVI
FT                   ANLVLLVGMVFATVTAVVAIRRNLRDRARRQAA"
FT   sig_peptide     complement(183822..183935)
FT                   /locus_tag="Snas_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.833 at
FT                   residue 38"
FT   gene            complement(184020..184502)
FT                   /pseudo
FT                   /locus_tag="Snas_0183"
FT   gene            complement(184549..185022)
FT                   /locus_tag="Snas_0184"
FT   CDS_pept        complement(184549..185022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39903"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39903.1"
FT                   /translation="MTTLTAPAPAAHLTAELAAVLRLLERMGANTIVLGSARDAASVAT
FT                   RAALAEAWTERGGEILDSVDWPESAASWLRQARRFAAPKPDAWVVAARPTGWAHMVGRL
FT                   TDTAWTADRTIVTAALRAPDVLASFDAASFAGLRGVTREGRTWRIGRATAGKR"
FT   gene            complement(185050..185781)
FT                   /locus_tag="Snas_0185"
FT   CDS_pept        complement(185050..185781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39904"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q6"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c1943"
FT                   /protein_id="ADD39904.1"
FT                   /translation="MTHETHTRDRFTDRVAEADWTAVKAELDEHGSALLPRLLSSDEAA
FT                   EIAALYDEPRHFRATVDMKRYRFGQGEYRYFTDPFPEAVQRLREELYPRLLPVARDWAR
FT                   KLKWDATWPDTLSAWLAECHEAGQRRPTPILLRYQTGDWNALHRDLYGDKVFPLQVVIN
FT                   LNQPGVDHTGGEFLTLEQRPRAQSRGSARLIPHGHGLVFTTRDRPVASTRGWSAAPMRH
FT                   GVSVLRSGRRHTLGLVFHDAT"
FT   gene            complement(185819..186595)
FT                   /locus_tag="Snas_0186"
FT   CDS_pept        complement(185819..186595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0186"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rlt:Rleg2_4064 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39905"
FT                   /db_xref="GOA:D3Q1Q7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD39905.1"
FT                   /translation="MSDLFRYETGSGRPLVFLHGGFLDHHMWDDQLPGFGEDHRVIAPD
FT                   ARGHGRSPNATGPFRHTDDVARLLRHLDTGPAILIGVSMGGATAVDTALEHPELVAALV
FT                   VSGVGTSEPYFTDPWTTDTWTRWHTAMTAGDIDTSIQVFTEFAAGPHRGLDDIDGSVAD
FT                   RLRHMTRSTMSKHTADEPDWQTPVPDTWSRVADITVPVLAVNGAIDSPDHLGMAERLTT
FT                   TVRDGRSTAIDGTAHYPNMEEPARFNAIVREFITTV"
FT   gene            186653..187114
FT                   /locus_tag="Snas_0187"
FT   CDS_pept        186653..187114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0187"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sil:SPO3579 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39906"
FT                   /db_xref="GOA:D3Q1Q8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADD39906.1"
FT                   /translation="MNDSQPAASVDRFFEVFDLVGPLYRRIHRKVEQDTAREGMSVGVR
FT                   AVLVMLHDRGPMTVPQLGREQALSRQFVQRMVNEAAARGLAEAVANPAHKRSSLIRLTT
FT                   DGHAVIAALLERERAMLRAAAADLSDADFDACGRVLSRLLRLLDDVDVD"
FT   gene            complement(187115..192031)
FT                   /locus_tag="Snas_0188"
FT   CDS_pept        complement(187115..192031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0188"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: pfl:PFL_2147 nonribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39907"
FT                   /db_xref="GOA:D3Q1Q9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q9"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADD39907.1"
FT                   /translation="MTSPRELATVPDLLRANTDAHPDRIAVSAGDGRWTYTELLARASR
FT                   LATALGDAGVRPGDLVGVCMPRGRDGIAALLATWAAGAAYLPLDPSYPRHRLEYLAADS
FT                   GFTALLTTTGLADRVPVPSGVPVIDTDTVPDALAPTAWPHRPQPSDLAYVIYTSGSTGE
FT                   PKGVMVEHAALTNLVRWHGEAFDITTADRCSHIAAAGFDASVWEIWSALANGAALHVIP
FT                   EDIRQSFDEAIDWCAAEAVTVAFLPTVMAEHLLRRPADDRLALRVLLTGGDRLRLHPGD
FT                   HPFTLVNNYGPTECTVVATSTVVKPHPGDTAAVPSIGQAIDNTRIHLINEDGQPDERGE
FT                   IWICGAGLARGYLGLPELTAERFVTGPDGERAYRTGDLAHRNPDGSLVFLGRVDDQVKI
FT                   RGYRVELGEIDTALRWLDGVADCVTVARPDAVGEQRLISYVVPEPGREAPRLREALAEL
FT                   LPSYMVPAVFVELDALPVSANGKLDRDALPEPHGFEALTDERPAGPSSAAPSGTAPVEL
FT                   LTSLFAEVLGTPAVGTDTDFFDAGGHSLQLTMLLARIRDRFGIELKYRDLFAAATPSAL
FT                   AQLLGNHSPAPDDPAPTPAEADAPVPLSPAQQQLWLTSQLASGTAVNNVFKSYRVEGSI
FT                   DVPALEWALAETVRRHEVLRTRFDVLDDEPVQVIAPPWQPRVELIEATDVPDAVTAFVT
FT                   RPFDVAALPLLRLAIMRGDETQLAIVLHHLITDGWSLELFLAEVAGHYRDRTTGTVTDL
FT                   PAPKQYGDFARAQRARMASSALKQSRAEYVTTLSDFPQLLELPADRPRPPERDFATDTV
FT                   HFGVPAEVADKLERLGREHGATRFMTLLAACDVLLHRWSGQERFLVGTPVANRTTVDSE
FT                   STLGFFVNTLVLPADLSGDPDFGDLLDRVTGSSLAAFTRQEVPFADLVDDLDPQRSLAH
FT                   NPLVQVLFSLQDVPATRLDLPGAELTEQPETVGATPFDLAVHLTPTAHGLTGELRYATE
FT                   LFDRATVERIAAQFNQLLESIADDPHQRVGGIDLLPAAERAELAALGTGPIRHPDPTVV
FT                   PWKIRRIAEQPPDRVAVEDADGTWTYAELMHQVRALSVILRERGVGPESLVGVCMRRDR
FT                   MLLASLLAVWMCGGAFIPMDPSYPRKRLEYMIADSRPTVLLATPETAATLDVGDVDIVL
FT                   PGQHPAPDDADWPDVDITGANLAYVMYTSGSTGNPKGVMVEHSNLVNLLDAYAADPGFG
FT                   PEDRLLALSSLSFDPAVRELTLPLTVGGRVIIAPEVTADPDELDALLRRGATHFGATPG
FT                   VMKLYTSHTAKLPDTVRLLFCGGETISDALAEALLDLGITVLHGYGPTETTVSVCFAPV
FT                   TADTPISIGRPIANTRLHVVDPAGRLVPRGVPGELVISGAGVGRGYLHRPDLTAERFRP
FT                   APDGSRGYHTGDLVRWTGDGNLKFLGRTDNQVKINGCRVELGEVDATVRDFPGVRDNLT
FT                   VTRDDPSGGKRLVTYVLAQPGHRLDTAALHASAVESLPTHMLPSAWAILDAFPLNPNGK
FT                   VDVSALPDPSPSHANQEPPTTATELALAAIWHDVLGTPTPTRDADFFTSGGHSLAAMRV
FT                   VTRIRERLHPDVALRDIFAHPRLRDLASHLDGLTDTEPATPAIGRVDRSKHRLDASRLS
FT                   "
FT   gene            complement(192015..193295)
FT                   /locus_tag="Snas_0189"
FT   CDS_pept        complement(192015..193295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0189"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   scl:sce4550 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39908"
FT                   /db_xref="GOA:D3Q1R0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD39908.1"
FT                   /translation="MTSRTENVTFRFREERNYSRFFSGQSLSLLGDEISAMAIPLIAIQ
FT                   ILDAGAFEQGLLFFSKFLPALLFGLHFGAIIDKFAKRSILVAADLARMLLLAVIVILWA
FT                   VGLLSLPVFLVIAFGFGAFNVLATICGQAYIPKLVPEPKLLDANGKLQKVTTFAEVSGG
FT                   SVAGAVVQVLTAPIALILDAISFLVSALFVAGVREPGHPPERAEHEKPRIWDGVTFILR
FT                   NVRLRAITLCTATSNFFSAMMVSLYLLFAMNVLHFTPLMIGILLSVASCTALISGFFTE
FT                   RGTRHLGVRGSLIAGQLVMAAGCVVLPFAGGDTIVKSLLLVASHGIFVIGMIAFMTTQV
FT                   TYRQQVTPENMQGRVHAGSYMLTYGAFALGALAGGVSGEYLGIRETLVIGALGHILAAA
FT                   WLLPRSVRVTDGEPPTPAKEEAHDIAS"
FT   gene            complement(193279..194028)
FT                   /locus_tag="Snas_0190"
FT   CDS_pept        complement(193279..194028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0190"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: dac:Daci_4759
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39909"
FT                   /db_xref="GOA:D3Q1R1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R1"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ADD39909.1"
FT                   /translation="MHIRTVTPKPAARVHLIGFPGAGGSQTHFRRWDSALGPWIRLSVV
FT                   DPWSLYFAAQAAEVDSLPDLASLLLPELAVSDSRFVLAGHSFGALLAYETARQLDEGRH
FT                   GDRLAGLVAMAQRAPTTPAPERISHLGDDRLLRFLRDMGGTPEEVFAEPELLDLLLGRL
FT                   RDEIRLSERYRDTRAEPLDRPLRVYFGDQDSGIAPIEARKWTKSVTGDHVLRTFPGGHF
FT                   FPFDDFQVVSALLEDTLTKEPLHDIQN"
FT   gene            complement(194039..197254)
FT                   /locus_tag="Snas_0191"
FT   CDS_pept        complement(194039..197254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0191"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: mxa:MXAN_3636 non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39910"
FT                   /db_xref="GOA:D3Q1R2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R2"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADD39910.1"
FT                   /translation="MNEVYPVSFAQRRLWFAEQLTPGGARQHVDLTRRVHGTVDVAALQ
FT                   SAVDTVVARHESLRTRFGVVDGSPVQVIVSTVAVPVEVIETGDAPAALREVIERPFRLD
FT                   EAPLLRVALIRGGGDTVLTFVLHHIIADGWSLGVLADEIGSCYLAYLGGTKPHLPPLRL
FT                   QYVDYTLWQAEAVKSEAVAARHRDYVAALSGAPQLLELPGDRLRPDEPRHEGATTEFTI
FT                   PDETMAAVERLATRCGSTVYMTLLSAYFLVLSRWTGQRDLLVATPSAGRGRSETEALIG
FT                   FFVNTVVLRGDVSGDPTVAELVARTRDASLAAFANEDVPFEWLVEGLAPERSLIHHPLV
FT                   QAMFSYQNTPGDELKLPGARLERLDVYGGTSMFDMTLELAPGASGLDGVVQYSTALFDP
FT                   ETAHRFAVHFGNAVAAMVDAPDRPVSGIEILAAEEREHLLRTGTGAPSGDLTPALTRIR
FT                   DRAASEPDRVAVIDTDGEVSYEWLCRHADTVAAALRELGLEPESLVAVCLPRNRFMLST
FT                   LLGVWAADAAFVPLDPGYPAARLEFMLADSGAVAVLSTRELAASLPIAEGTPVIHVDEL
FT                   PDNPTLEPSAVEVPADRLAYTIYTSGSTGRPKGVQIEHRGIANQIDAFADLLGFTAEDR
FT                   MAGLTSMSFDPVFIELFVPLVTGGTVVMLDNTMAGDPERLDEALTEHGVTVAQATPSTW
FT                   KLYTDHAKDAPPRLRRILTGGEALSSDLAESLLWLGLEVHNVYGPTETTVWATSAHITD
FT                   PGRITVGRPIPGLRMFIMDSHGRLAPTGAAGELWIAGTGVARSYQGRADLSAERFVTAP
FT                   DGTRAFRTGDLARWNRDGSLDFLGRVDDQVKIRGHRIELGEIEAVLREHPDVRDALVAV
FT                   RTAPGGEKQLVAAVTGSAAGAAVAPGGQPGREPTSTDWLASEAKRWAARQLPAHMVPSQ
FT                   ITAVAALPLTPSGKGDRKAVAALAAPPDTAPDRALPADDAQLRLHEVWCEVLQLPAVSV
FT                   TANLFDLGATSMSIVKVRQELRVRHGLDLPLTAFFTHPTIAALAASLGVEPRPAVGAKR
FT                   GAARRRVPHPDAARRRERRRGRT"
FT   gene            complement(197247..202991)
FT                   /locus_tag="Snas_0192"
FT   CDS_pept        complement(197247..202991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0192"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   Methyltransferase type 11; Methyltransferase type 12;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: mxa:MXAN_3779 non-ribosomal peptide
FT                   synthetase/polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39911"
FT                   /db_xref="GOA:D3Q1R3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R3"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADD39911.1"
FT                   /translation="MDISALTEEQRSRLAALRAGKAGARPEGIKPTGATRAALSAGQQR
FT                   IWFLSRFLPDTSAYNIVGSYRVRGEVSLTALQKTVDTLVARHASLRTRFIVDGDTPAQV
FT                   VEPQAVVKVRLDTADEGELDVRLDAFGRELFDLETGPLLRVLLTRTGPGEAVLSIAIHH
FT                   IIADGWSLGVFIGEFTAVYRQHLHGTDADLKPIPISYVDYSLWQRSREGTPEHKEQLSW
FT                   WMEALSHNPKVLELPTDRPRPAVQTFNGSRHRFAVSAAVRADVERLAREHATTPFAVLL
FT                   TAFSAVLRRWSGERRLNCATPVANRSRVETESVIGFFVNTVVLPMDLTGEPSFAELLDR
FT                   VKRVCLDSFSRQELPFEQLVDALSLDRTLSHNPLAQVMFILQSAPAGDLDLAGASLESI
FT                   DTETGTTKFDVTMEFFPAAAGYTGVIEYATDLFDAATAERLAVHYDQMLRAMLADPHGS
FT                   VATAPMLSASEREQLAAWNATEADTELGRRITDVVADRVREQPDAIAVSGDGVHLTRGE
FT                   LSDAAGRIANLLRGIGIDSDGLVGLCLRRGPHLVPSILGTLASGGAYVPFDPEQPPARV
FT                   AQMVRDGGIGIVVTTEDDRGALVDLPDTVTVLSLDAPATIAALAEQDTGWPQVAASDRD
FT                   LAYVIHTSGSTGTPKGVMVEHRAAMNRINWMQREYRLAESDRVMQKTTYTFDVSVWEFL
FT                   WPLMHGAAIVLATPDAHREPERLLDEITRHRVTHIHFVPTALSALLAHGSLAESSLRRI
FT                   FTSGDALPRDLCERVEADCGIAIDNLYGPTECAIDVTYWAWRPDVAGPPPIGHPVANTR
FT                   AHVVDEHGNELPVGVPGELWIGGVQVARGYLNRPDLTAERFRPDPFGGDGERVYRTGDL
FT                   VRRRADGALDFLGRIDDQVKVRGFRIELGEVEAALNRQPEVAEAAVLCRVDASGDKQLL
FT                   GFVVPDAGHLDTGEATVPWSDVFDQAYTDGDDPEDPEFNLKGWQSSYSKKPIPVDEMSA
FT                   WHADAVAKITATRPRRILEIGCGTGLFAFKLARGCEHYTGIDVSAEGLDYIAAQLPKLG
FT                   LTDKVSLHRLAADELSALDGQTFDCVVINSVAQYFPDRDYLDAVLASAATLLAPEGTIF
FT                   LGDIRNLGITAMFHDSVVRHQNPDTDEAVLTARAERQFAEETELLIHPAYFTTLPQRIP
FT                   GLRWAETSVKYSHGDNQLVRYRYDVTLHTEGEPIPVTEFGHWENLDRLTEQLASGVDGD
FT                   YLAVAGIPNARLHPDGVQPARLRELAEGTGLEALVTWSPSGAPGSLAVVYHHPGTRVTV
FT                   PHVSDEPDTNTPASGWAWRDLPRALRQRLRDILPDYMVPSMLVPLRRMPVSATGKVDRS
FT                   VLERIPDLRQISRGHTPPRTATERLVAEIFAAVLNVPEVTCEDNFFDLGGDSIKITQVA
FT                   VRLRDAGHPVMIRSIFANQTVELLATFLDTDTTAPTVAASPARVRDLPSGSFPASPLQE
FT                   HMMSVAPERTSNGMYVVQRVLRYQGEFDPDAAREAWHATVAATPFLRTVLRRSGDGFTQ
FT                   SPEANVDGSITALDWSGLDDDAKTEAIAEFLRTDRETGFDPATSLPTRFAFIRLGERHG
FT                   CWVISMDYRRLDGWSFTTYLGDFLAAYHRPGETGAKRRAPFDYASYVEWREERMRDGSV
FT                   ADWWRERLTSMSPIPVPPANRLSHRDFNVLITTVDAQAARGFHAACRAAGVTAAAGVQA
FT                   LWGAVTQRLDGHAAPRFGLTTAGRPAELPGIETALGMFMNTLPTTWRAGPADAVRDWMT
FT                   GAAESSLDLIDHGMIPQPELVRMAGLNEGEALFDTYLVFQNAPSADTGEDEHEQGFELI
FT                   DETPAAYSQQEHRLRLDVFPFEGRLHLSLSGYEPPARLREYLALLASGVIAMDAAAVDR
FT                   PMSTVLDADVAVPPLLDTDGLVTAMVLNAEAPQRKEETDE"
FT   gene            complement(203017..206181)
FT                   /locus_tag="Snas_0193"
FT   CDS_pept        complement(203017..206181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0193"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase ; Acyl transferase;
FT                   phosphopantetheine-binding; KEGG: mxa:MXAN_4415
FT                   non-ribosomal peptide synthetase/polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39912"
FT                   /db_xref="GOA:D3Q1R4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R4"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ADD39912.1"
FT                   /translation="MTDRVAIVGAAIRTAGAVDTAGFWRLLADGRGGRREFDRAELERR
FT                   GVPGVRFADPRFVPVSFPLANPAGFDAAAFAISPAEAELMDPQHRAMLESAYRAVESSG
FT                   HHIASLADTVGVYVGARPGLHAVLLRATGADIDETKLVTGSYSDYLAARLSYTFGLGGP
FT                   TISVQTTCSTSAVAIHLAVQAILAGECDSAVAGGVAIDIEDAGYLCPEGGVFSPRGRCQ
FT                   PFTTTADGTVDGNGVASVFLRRLDLALADGDPILAVVAGTAVNNDGRDRVGFTAPSVSG
FT                   QSSVIGEALDVAELTPDHIGLFETHGTGTSVGDPLEIEAATLAYREAGMTGDGLRLGTI
FT                   KANIGHLTSAAGAAGVIASLLALRNEAIPPNLPLTEGASAIDLSHTPFRLTDRLEPWRR
FT                   GPEPRFAAISSFGLGGTNAHIILGDPDEVARRGARRSWQVLPLSADDAQRLTETVTATR
FT                   QAASEATSDERHDLGHTLRLGRPELAVRAVAMLPVEDAATATEAEHEAADMAASAAQCA
FT                   AAVEGRTAPAAAEGQAASTAGQGSAVAKAERETADMAASAAQGAAAVEGQAATATTAVW
FT                   PTASSFRSPSAEPPSLVYLLPGQGGRSSAAAHQLYQSEPWFTATVDTGLDIVEDVADPR
FT                   TFARVRNAFVLGTLTDDTEVAQPVLHLLAAGVATVLERLGIQPTALAGHSVAEITAAQL
FT                   AGVLDFAEATTAVCHRGAAMAAMPPGEMYAVRATPALLADLPDGTEISVRNTPSSTVLS
FT                   TTAGEPLRNWLDARALRYRRLGTSHAFHHASMADAAEAFTKRMRGISLRPPRIPLLSCP
FT                   TGTWLEASQATDPVYWGRQLREPVDFVSGLRAVVAAHPNAVPVQLGAGTHLLAAIREAV
FT                   PMRPNAGTPVIRETTADTGIAMLPDGDARMTLPAAIGALWQHGVPVDWNAYAEHDRGLR
FT                   TAAPPRPLLTTPVLHPALRGRTPGIDPSDLDNTPAPATPSPEAEDVPLLGPVCECWAET
FT                   LGAMPAPDDDFFASGGDSIAAGQIVARLRSRFDVAIPVHLPLVATSPRELARAVDELLI
FT                   AAVLQD"
FT   gene            complement(206264..207523)
FT                   /locus_tag="Snas_0194"
FT   CDS_pept        complement(206264..207523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0194"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; protein of unknown function DUF201;
FT                   phosphoribosylglycinamide synthetase; KEGG: plu:plu1218
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39913"
FT                   /db_xref="GOA:D3Q1R5"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R5"
FT                   /inference="protein motif:PFAM:PF02222"
FT                   /protein_id="ADD39913.1"
FT                   /translation="MPNPNDRNGQKSLPTLVVVYAFGSASATQIVAAARGLCDIVLLAD
FT                   RSEPYVAEQFPLMLELASVIDATDRDEAEVLGEVTALAPSGVTTFADDKVELAARLARA
FT                   CGVVGHSEDTVEVVTDKLCQRRRLTEAGVEATRFAAIAGPGDVAAAAAEVGFPAVLKPR
FT                   RGNGARNTRLVESEADCELAVTEVHGEETRGLLLEEALTGIGIRDEVHADYVSVESLSQ
FT                   DGGITTLCVTGRFPMAPPMRETGMIVPAALPDAEAERVVALERAILRALGVRDGLSHTE
FT                   FKLTADGPRLIEVNARLGGPIGHLTKLALGIDVVRMGLLVALGQRVEVPPPSWRGVAFN
FT                   RAVPPPLGVSEVVSVKPLAELRGLPGVVFCNQRVRPGDRVDSRRGERDMLATVVGLTES
FT                   HEELLAINAAAERAAERMCR"
FT   sig_peptide     complement(207440..207523)
FT                   /locus_tag="Snas_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.390 at
FT                   residue 28"
FT   gene            complement(207765..208190)
FT                   /locus_tag="Snas_0195"
FT   CDS_pept        complement(207765..208190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0195"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: sat:SYN_00419 aspartate 1-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39914"
FT                   /db_xref="GOA:D3Q1R6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R6"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ADD39914.1"
FT                   /translation="MFRTMLKSKIHRATVTHADLHYVGSLTVDENLMEAADLLPGEQVA
FT                   VVDITNGARLETYVIPGQPGTGVIGINGAAAHLVKPGDLVILIAYAVMDEEHSRGYAPK
FT                   IVHVNGDNEIIDLDVDPAAVAPGVAGEPRRSPLAKPA"
FT   gene            complement(208265..211168)
FT                   /locus_tag="Snas_0196"
FT   CDS_pept        complement(208265..211168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0196"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; NB-ARC domain protein;
FT                   transcriptional regulator domain protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce5225 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39915"
FT                   /db_xref="GOA:D3Q1R7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R7"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD39915.1"
FT                   /translation="MSLPLGPSSAFESAPKIPMDSHITLPSELRPVLVRLLGPVEIAGE
FT                   DGWQRGGAPKQACVLACLALSPGTAVSIETLAHRVWDGPHPTETRNIIYGHVTRLRQLL
FT                   KPHDEVRLRRMGTSEYQLDIEPELVDAWRMRDLAGKARAVQAGGDMTTAAELWRGAVEQ
FT                   WRGPALAGIKTEWSARTSRRLRNDYLAAAAGWSECLLQLGQHEAVVGNLEPIVEHHPLV
FT                   ENLVAPLLLALYRCGRTMDALNRYTDTRRQLRKTLGNDPGERLRTLYQRILRQEPELLR
FT                   APATERREAAPAAVSPAPAPVPAQLPARVSGFINREAQLETLDAQLPSASLVTISGMAG
FT                   VGKTALAVHWAQRIASRFPDGQLYVNLRGFDPSGQPTEPADVIRGFLDALAVPPHSIPV
FT                   SPDAQIGLYRSLVADRKMLILLDNAGEEKQVRDLLPGTPECLTIVTSRNRLTGLTASHG
FT                   AVPMPLSEFTPEESRRFLRSRLGEGQLAAEPQAADTIIATCAGLPLALAVVAARAATMP
FT                   QVQLEQSAAELRGATGDLEPFVMSDVSTDIRAVFSWSYRLLGAEAAHFFILLGHHPGPD
FT                   ISTAAAASLAGVPLPRARALLGELLRVHLVTERRPGRFVCHDLLRSYASELDTLAEWEG
FT                   LREGLRRVVDHYTHTAHAAARLVHPMHDLPPEPSRCPGVTPEKPADRQAAMAWLRTEHE
FT                   ALLASMELSIADGWDSRTLRIAAAMLICLDLHGMWGVMVATQEKALAAAQRLGDPRAIA
FT                   GVHRDLSRAYSRLGRFDEAEQRITEALRQFEQLGDLGGQARVQHQASVLNAMRGRHREA
FT                   LTAATRAVELGELAGDLVAQAIGHNAIGWHLSQLGDQSEALSHCQRAMVLADKIGYQQI
FT                   KGGIWDSLGHIHRRRGCLDQAMHCFRRAVDDELAIGNRLGFASALVGCGDVRFLQGETD
FT                   AARETWQRALSILEALKHPDAERVRGRLAGRLDPSGD"
FT   gene            complement(211220..212146)
FT                   /locus_tag="Snas_0197"
FT   CDS_pept        complement(211220..212146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39916"
FT                   /db_xref="InterPro:IPR021889"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39916.1"
FT                   /translation="MRQAARRLREALTDEQADAAFHPFADADRTRWDYRPRPRPGACIG
FT                   EFGLTGRKRAHQLLATAMSPHAFAQITTIMGLEEVLDRAESWRRGRHSDDFWIAVFGSP
FT                   EDEAWAWRFEGHHVSVSMTVVAEEVSPTPVFLGANPASVDYRGTPVVRPLAIEEELARD
FT                   LLARLPDRQRAQAIVSPVAPSDIRTGNARDITDIDRWPGLRAADLSRGNAEILDRLIDV
FT                   YLDRLPPSLAAAERAVIEPDAIHFAWEGSAERGGGHYYRLQSPRLLIEYDNTQNDANHV
FT                   HTVLRRPGDDFGRGLLPSHVASEREPR"
FT   gene            212236..212586
FT                   /locus_tag="Snas_0198"
FT   CDS_pept        212236..212586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0198"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: sit:TM1040_3855
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39917"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R9"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADD39917.1"
FT                   /translation="MRYMLLIYGCDRPEPDDPKFAEAMASINAFAEECRRRGVLEAGEP
FT                   LKRPETATTVRVREGQTLMTDGPFAETHEHLGGYYIIDCQNLDEALELAAMCPFAAEGT
FT                   IEVRPLEADVAP"
FT   gene            212583..213800
FT                   /locus_tag="Snas_0199"
FT   CDS_pept        212583..213800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0199"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: maq:Maqu_2177 RNA polymerase
FT                   ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39918"
FT                   /db_xref="GOA:D3Q1S0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD39918.1"
FT                   /translation="MTAADTVERVYREQRTRMLAALVRAFGDIELAEETLHEACAQAMD
FT                   SWAAGVPDDPVGWLVTVARNRGVDWIRRARVGREKAELAGARAETVDIEPDPNSLVDVG
FT                   DDRLSLVFACCHPDLELRARVALTLQVVAGLTAAQIARVFLLTESGLAQRLVRAKRKLR
FT                   DTGASFEVPPDHRLPERLSGVLAVVYLIFTQGYTAEPGSRDHGELRDEAIRLGTLIATL
FT                   FPDEPEVLGLLALMLLHDARSAARYDPSGELVLHADQDRSTWDHEQIAEGVALLGRALR
FT                   HGAAGPYLLRATIAALHTRPTTDWPHIVGLYRTLMDVDDSPVVALNHAVAVAMDQGPAV
FT                   GLALVDELDLPTFHLFHATRADLLRRLDRRDEAATAYRRASELATNPADRRFLDRRLRE
FT                   LGPDHG"
FT   gene            complement(213833..214423)
FT                   /locus_tag="Snas_0200"
FT   CDS_pept        complement(213833..214423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39919"
FT                   /db_xref="GOA:D3Q1S1"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39919.1"
FT                   /translation="METMTAYRRAQDGFDQVMAAVGDEQWDRPSTCAEWTIRDVAGHVI
FT                   WGQRQLRAWAVGEEYESPTGFPGSSKPGELAADDPLATWRTARAAADEALTDETLARVV
FT                   TIGGPVGDIPVIGVAELLTTDLLGHSWDIGHAAGQDVRLDAELLPGSMEWSRKYVSRSA
FT                   ALFGPEVTPEADADDQDRLLAYLGRRPGQHLAS"
FT   gene            complement(214530..215558)
FT                   /locus_tag="Snas_0201"
FT   CDS_pept        complement(214530..215558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0201"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: psp:PSPPH_2128 ribose operon
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39920"
FT                   /db_xref="GOA:D3Q1S2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADD39920.1"
FT                   /translation="MRSRLKDVAQRAGVSIKTVSNVVHGYQHVRADTRQRVEQAIADLQ
FT                   YRPNLSARSLRAARSGVIALALPEMDAPYFAELARHVVAEAEEHGWTVLIDQTEGSRER
FT                   ERVVTGGIRSELIDGLIFSPLALTAEDLAERTDSTPMVLLGERITGSPPIADHVLVDNV
FT                   AAAREATEHLLGLGRRRIAAIGAQRTPAGVTARLRLRGYRQALRQADVATDDTLIQGAS
FT                   QYRRAHGAEAMARLLERDDPPDAVFCFNDLLALGALRTLLQRGIRVPEDVALVGFDDIE
FT                   DGRFSTPTLTTIRPDKARIGALSVDMLAQRLSGDLKGPPRESYVGYELVVRESTAGAEP
FT                   VA"
FT   gene            215715..217232
FT                   /locus_tag="Snas_0202"
FT   CDS_pept        215715..217232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0202"
FT                   /product="alpha-L-arabinofuranosidase domain protein"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: vei:Veis_3457 alpha-N-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39921"
FT                   /db_xref="GOA:D3Q1S3"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S3"
FT                   /inference="protein motif:PFAM:PF06964"
FT                   /protein_id="ADD39921.1"
FT                   /translation="MDNRHKASVVLDPAFAVAPVDRRLFGSFVEHMGRCVYGGIYDPGH
FT                   PSADEHGLRTDVIDLVRELGVSVVRYPGGNFVSSYRWEDGIGPVADRPRRLNLAWRCLE
FT                   TNEFGLGEFMTWARLAVVEPMMTVNLGTRGVAEACDMIEYCNHPGGTALSDLRRKHGSA
FT                   DPYDIKLWCLGNEMDGPWQVGQKTAAEYGRIAAETGKAMRIVDPSIELVAAGSSNSQMP
FT                   TFGDWEATLLEHAYDQVDYLSLHHYFDPANQDRDSFLASGTVMDRFIDDVVSTCDHIGA
FT                   KRRSRKKIKLSFDEWNVWYQSRFTEPGDREWIESPPLIEDDYDATDAVVVGDLLITLLR
FT                   HADRVSIANQAQLVNVIAPIRTAPDGPAWRQSIFHPFALTSRLARGTVLRTETAGPRHE
FT                   TPRHGEVPTLSTTATHDAATGQTVLFAVNRAEHPVELAVDARALSGVRLAEHLTIAEDD
FT                   PTAINTPADPDRVGPRRLPPSVMDNGRCLVRLPALSWNALRLSEEKE"
FT   gene            217238..218563
FT                   /locus_tag="Snas_0203"
FT   CDS_pept        217238..218563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0203"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sme:SM_b21604 putative sugar uptake ABC transporter
FT                   periplasmic solute-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39922"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADD39922.1"
FT                   /translation="MPLPDSGPFSRRALLGLAAGSTAAIALSACGGGSDTAEDGSQGGT
FT                   KYDGPKVDLDFWNGFTGGDGPIMKQLVKDFNAEHDNIKVKMTTYEWESYYEKVPAAVRS
FT                   GKAPDIGIMHVDSLATNAARGVILPLDDVADALKLSKGDFVEPVWNAGVYDKKRYGIPL
FT                   DVHPEGNFYNKKLLDEAGLDPDNPPATGDDYADALDKLKKAKIKGMWMTPFPFTGSHTF
FT                   QSLLWQFGGDLFSSDAKDPAFAEDAGVKALTWMVDLVKDGHSPKDVGQDADAVAFQNGK
FT                   TAFNWNGIWSINTFNDVDGLEWGVAPLPQIGEQKAAWAGSHNFVLLKQRTVDTNKQAAS
FT                   KVFVNWISGKSVEWAKGGQVPARNSVRDSKEFGKLTEQSVFAEQVDYLHFPPAVPGIGD
FT                   AMPQVDKAVNQAVLLKKKPADALADAADKAAKILAENRKKYG"
FT   sig_peptide     217238..217333
FT                   /locus_tag="Snas_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.636 at
FT                   residue 32"
FT   gene            218568..219467
FT                   /locus_tag="Snas_0204"
FT   CDS_pept        218568..219467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0204"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce3058 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39923"
FT                   /db_xref="GOA:D3Q1S5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD39923.1"
FT                   /translation="MARNPTKAHTRWFTPYVFLAPYLVLFSVFVLAPAVYGLWISLHEW
FT                   DYMLPSQPWVGLDNYVDLFDSESLVFGDFWSSMSATGIFTVASVPFLVVIPLGIALLLN
FT                   RKFPGRNVFRAIYFAPYVLGVAVVGLLWRFLLDPNIGGVNYLLGLLGLPDDIAWVNSLP
FT                   WGWIALVGMTVWWTLGFNAVIYLAGLQDVPRHLYEAAELDGATAWQRFWHVTLPGLRPV
FT                   TAFVVTVTILASANMFGQSYLVTQGAPGDDTRTAIMYIAEEGLRAFRMGNAAAMGFVLA
FT                   LILGVISVLNFRLLRYKE"
FT   gene            219474..220313
FT                   /locus_tag="Snas_0205"
FT   CDS_pept        219474..220313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0205"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: smt:Smal_2681
FT                   monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39924"
FT                   /db_xref="GOA:D3Q1S6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD39924.1"
FT                   /translation="MASSTSKRPGIAWYTMLIGLSLVFVAPLVWMFLTSFKTRNEALAI
FT                   PPTFLPEEFSTKGYQTILGDDSQAPVLTWFLNSLLAAVGHTVLVLAVASGAAYALARME
FT                   FPGKKLIFGVIISTLLIPSFVLLIPNYLIVDSLQWIDTPLALIVPGAAGAFGVFFLRQF
FT                   FTSLPPDLEEAAVLDGANHFQIFVKIVLPLSKPALATLAVLSFLSNWNDFIWPIYVMFS
FT                   PENMTLPPGLATLQGAYGIDYHVLMAGAVITAVPVLALFLFTQRYVIEGVSRSGLKG"
FT   gene            220315..221229
FT                   /locus_tag="Snas_0206"
FT   CDS_pept        220315..221229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0206"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   mxa:MXAN_5247 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39925"
FT                   /db_xref="GOA:D3Q1S7"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S7"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADD39925.1"
FT                   /translation="MTFTNPVHDHNFPDPGALRVGDVYYVYGTNDGVHNVPLLISMDLV
FT                   EWTLVGDALPELGRWAESGRTWAPEVLRTDSGYVMYYTARSPKDDLQCLGLAVSTSPGG
FT                   PFVDTAERPFIAQTDEGGSIDASPFTDADGQVYLHWKNDGNHVGVATHLYGQRLSSDGR
FT                   ELLGEPVRLLTNREPWHGHVIEAPQMFLRDGQHYLFYSAGAFDSDGYAVGYARCDSPLG
FT                   PVHDAPENPILTSGPGAAGPGHCSIVIGPDGDSTWMLYHAWPPDAIGSGVSARGRRLWL
FT                   DRVEWRDGSPVVHGPTANPQPEP"
FT   gene            221384..221926
FT                   /locus_tag="Snas_0207"
FT   CDS_pept        221384..221926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0207"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: rso:RSc0018 response regulator transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39926"
FT                   /db_xref="GOA:D3Q1S8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S8"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADD39926.1"
FT                   /translation="MSTSTITHARPPRPARRLAVTVEFPRGTDGLGDQMLSVLATLKEL
FT                   VGQGGTVTVASDPPQAPVPLLPKKSHAAAPPDGGIRVFPETRIVTDGPRPVPLSRLEFD
FT                   LLHFLIARPDRVHTRQQLLEVVWGVGRGDIGQRTVDVHVRRLRAKMPRLAEALVTVRGV
FT                   GYRFDSTDTVALISIRD"
FT   gene            complement(222035..223459)
FT                   /locus_tag="Snas_0208"
FT   CDS_pept        complement(222035..223459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0208"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bbr:BB2411 putative transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39927"
FT                   /db_xref="GOA:D3Q1S9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD39927.1"
FT                   /translation="MTTETPSTESPRVAPHPWRWRILGFLGIAQLMLILDVTVVAIALP
FT                   HIETDLDLSREALTWTVSAYPLAFGGLMLLGGRLADLWGAKRIVLAGLLTFTAASLVTG
FT                   LATDGAVLLGGRVAQGVGAAMLSPAALSLVVTLFDGRERDKALGVWSALGGGGAALGVL
FT                   VGGLLTTGPGWSWVFYVNVPVGAVIIVVLAKLLPRTGSAAVRGRLDILGALLVTASSGA
FT                   VIYALISAGEAGWLTVANGVLALLAIAGYTAFVWWQKRSHSPLMDVRLLARRPVATGTF
FT                   LILVATALMIAVFFLGTFYFQRARDYSALHTGLLFLPIAVATMLGANLTGRALGRFGAR
FT                   TLAIAGLLLAALGLAAPVVVMSPVVVVVGVAIAAAGTGALFVVASATALGQVSPQEAGV
FT                   ASGIVSTFHEFGASVGAAVVSSVAAASLIGDTLSGFTDGFVVIASAAAVAAVIAGFLTP
FT                   GKQPTGSGAGAHLPAH"
FT   gene            223552..224139
FT                   /locus_tag="Snas_0209"
FT   CDS_pept        223552..224139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0209"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_1727
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39928"
FT                   /db_xref="GOA:D3Q1T0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39928.1"
FT                   /translation="MTSSDSRPRRRADAERSIARIVAAARTTLGDNPDATIDDIAKAAG
FT                   VGRMTLYGHFKNRADLVEAALVDALRAGEERLSAVDLSGDARDALARLLASSWSLVAES
FT                   NALLEAAQPILPTERIRQLHAAPAERVEGLIRRGQSQGVFRTDLPNTWLVNAVFYLVHG
FT                   AADENRAGRLAGTEAAAVITGTVQSMLATPNP"
FT   gene            complement(224208..225224)
FT                   /locus_tag="Snas_0210"
FT   CDS_pept        complement(224208..225224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0210"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mlr1136 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39929"
FT                   /db_xref="GOA:D3Q1T1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T1"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADD39929.1"
FT                   /translation="MRAVVFEEFGVLPEVRRVPDPEPSPDGVVIRVEATGLCRSDWHGW
FT                   LGHDPDITLPHVPGHELSGVVEAVGTGVRDWRSGDAVTVPFVCACGRCRDCAAGNGQVC
FT                   ANQTQPGFTGWGSFAEFVAIDNADVNLVAVPEGMTFATAASLGCRFATAFRAVVHQGAV
FT                   RGGEWVAVHGCGGVGLSAVMIAAACGARVVAVDISAAALELARQFGATACVDAAEGTAE
FT                   RVMDITDGGAHLSLDALGSATTCAASINGLRRGGRHVQVGLLPKDPPLPMARVIGWELR
FT                   LLGSHGMAAAAYPPMMDMVADGRLRPDRLITGTIGLDEAPRALAEMAGPGITIIEPG"
FT   gene            complement(225238..226020)
FT                   /locus_tag="Snas_0211"
FT   CDS_pept        complement(225238..226020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0211"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: scl:sce2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39930"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T2"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADD39930.1"
FT                   /translation="MTEGKRLEKEIELDASVDEVWEAVSTGQGFATWFVPHDIKTDENG
FT                   VPVVAEGDFGSGNTDQGRLLEWEPKRRVKFGNYSSDSTQVLEFLVEGKDSGSTVLRLVQ
FT                   SGAQGEDWEMEYHSKGWDLFFQNLREYLEYFRGKPVANALVMSFTTVDAKTVWERMYAA
FT                   LGANRDLAVGDLVELTPKGVEPIKGTVDIAVPGAVLGVRTEDGLYRFGGQGADAWGMVN
FT                   AFHYRYGTDVDPAEWTERWQRWINEVFPPSEAPQAQPA"
FT   gene            complement(226017..226622)
FT                   /locus_tag="Snas_0212"
FT   CDS_pept        complement(226017..226622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0212"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: scl:sce2340
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39931"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T3"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADD39931.1"
FT                   /translation="MDEIAVIEDPRAAADSLDPVRARLLAELAEPATAAALARRLEQPR
FT                   QKINYHLRSLERHGLVEQVDERRKGNVMERLVRATARSYVISPRVLGGVEPDPARSPDQ
FT                   LSARWLLAVASRLVREVGELITGAARERKRVASYAVEGTIRFASAAERAAFTAELTETV
FT                   TALVARYHDEAAPAGRDHRIVVALHAVPPNENNDSEES"
FT   gene            complement(226655..228013)
FT                   /locus_tag="Snas_0213"
FT   CDS_pept        complement(226655..228013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0213"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; acetyl-CoA carboxylase
FT                   alpha subunit; KEGG: acetyl-coA carboxylase ; K01959
FT                   pyruvate carboxylase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39932"
FT                   /db_xref="GOA:D3Q1T4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T4"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADD39932.1"
FT                   /translation="MSDRHSAREFLALLTDDFTELPAEPPTASASSPADDGPIGWPGYG
FT                   AARQRARQRTGEDESVVCGTAHIGATRAVVLCFEFGFLGGSIGERTGARIEAAHIHARR
FT                   HRLPVLSLIATGGSRMQEGMRALAQLQRIVRQAALTRQAGLPQLAVLRDPATGGGWAVL
FT                   GPSADVILALPNAQVGFAGSRVRPADADPSAYTAESQLAHGHIDAIVPLEALRDKLSHW
FT                   LHLLTTPAAEPAEVPAALASPELPVTGWQAVTAARAAHRPRAVSYLDAYFDAREPVSGD
FT                   RLGDTDPGLLCGFGSRSGVTIAYAAQTGSRTTPSGFRTASRLIRTADRLGIPVLTLIDT
FT                   PGAANDAASERAGTAAAIAELFTTIAEVTIPMTTLLIGEGGSGGAMALASPSNTWATPD
FT                   SYFAVIAPEAATSILKHPPGATPEVAEQLRLRPQDLLALGIIRGIALRITLFP"
FT   gene            complement(228010..229446)
FT                   /locus_tag="Snas_0214"
FT   CDS_pept        complement(228010..229446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0214"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mxa:MXAN_7148 putative long-chain fatty acid-- CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39933"
FT                   /db_xref="GOA:D3Q1T5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T5"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADD39933.1"
FT                   /translation="MDSLFPSLWTGERKTALRFGDRELDYPRLAAVASALADRLRTESR
FT                   VALWAEPELTTAVATVAALLAGVPVVPINPKIGERELEHILADSAPGLVLAAPGAAMPE
FT                   ALRSLPRVDIALDTDGPAAQPSEPDEAAPALIVYTSGTTGPPKGAVLPRRAITATLDGL
FT                   AEAWRWTGDDVVVHGLPLFHVHGLVLGILGPLRRGGTAHHLGRFSPSAVTQALEGDGTI
FT                   LFGVPTMYHRLAETVDTDTALAAALSRARLLVSGSAALSLPDHERLTAATGQRVVERYG
FT                   MTETLMNTSVRIDAEPKPGTVGIPLPGVELRLVDDNGGVITDSDGETIGEIQVRGPNLF
FT                   TEYLNRPEATAAAFTDGWFRTGDMATRDGDGDLRIVGRQSTDLIKSGGFKIGAGEIENA
FT                   LLDHPDVTEAAVTGEADPDLGERVVAWIVPADPHRPPTTEALADHVAVKLAPHKRPRVV
FT                   HFRESLPRNDMGKIMKRALK"
FT   gene            complement(229471..230718)
FT                   /locus_tag="Snas_0215"
FT   CDS_pept        complement(229471..230718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0215"
FT                   /product="Dicarboxylate carrier MatC domain protein"
FT                   /note="PFAM: Dicarboxylate carrier MatC domain protein;
FT                   Citrate transporter; KEGG: xac:XAC0567 dicarboxylate
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39934"
FT                   /db_xref="GOA:D3Q1T6"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T6"
FT                   /inference="protein motif:PFAM:PF07158"
FT                   /protein_id="ADD39934.1"
FT                   /translation="MSAELISILVLVAVFAIATTRSVNMGALSFTAAFAVGTLVAGLDA
FT                   EGIFAGFPGDLFVVLVGVTYLFALARANGTTDWLVHGAVRLVGGRVALIPWMMFAVTGL
FT                   LTAIGAVSPAAVAIVAPIALGFASRYQISPLLMGVMVVHGAQGGGFSPISVYGAIVNGI
FT                   VDKEDLPGSPIVLFLASLLVNLVIAAILFVLCGGLKLPRHVAAKDEAADPERDALNPAR
FT                   ITTLFALAALVVAVLGFNLDAGLTAITLAAALSVVWPKSSRDAVGQITWPTVLLICGVL
FT                   TYVAVLEQMGTIDYAGTSVSQIGVPLLGALLICYIGALVSAFASSVGIMGALIPLAIPF
FT                   LALGDIGAIGMVTALAISSTVVDVSPFSTNGALVLASAAEVDRERFFRQLMIYGGIVVA
FT                   AVPPIVWLALVVPGFG"
FT   sig_peptide     complement(230611..230718)
FT                   /locus_tag="Snas_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.443 at
FT                   residue 36"
FT   gene            230919..231626
FT                   /locus_tag="Snas_0216"
FT   CDS_pept        230919..231626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0216"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   dvm:DvMF_1205 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39935"
FT                   /db_xref="GOA:D3Q1T7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T7"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADD39935.1"
FT                   /translation="MPDALRPMSRRRLYEQVLDRLRDYGTEAGLKAGDRLPPERELAQR
FT                   LGVSRASVKQAIVVLEVQGLVEVRHGGGTYLLTDRLDTEPVDSLVERRGRLPDVLDARE
FT                   ALETRLAALAAERRTDADLTAIEQALEFMAAEIDNGEYGVEGDRRFHASVTAAAHSPLL
FT                   AQFMKSIAEKITESRNESLRQPGRPRKSLAQHHRILDAIAEQAPGKAAEAMRRHVRTVA
FT                   KVRLLDWDPDSAE"
FT   gene            231663..232898
FT                   /locus_tag="Snas_0217"
FT   CDS_pept        231663..232898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0217"
FT                   /product="Lanthionine synthetase C family protein"
FT                   /note="PFAM: Lanthionine synthetase C family protein; KEGG:
FT                   mxa:MXAN_6388 lanthionine synthetase C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39936"
FT                   /db_xref="GOA:D3Q1T8"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T8"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="ADD39936.1"
FT                   /translation="MNETRTPEELGRGGLDWLLTTARQTDDGLAWPVQPSADNVDHMLY
FT                   WGTPGIVVAMLEGQRHFGDDRYGDAAARGATAMAAAITDCEGSSLYTGTTGLAVTLHAV
FT                   GEQLGDDEYTAAATRALKLTRSRFDGTRWGELFELLLGNAGIALGAKYCGDLDLAVDAL
FT                   EPYLRTAEPTEHGVQWEHRPGAESRMHHFSHGTLGIAHALAEIGAAANRPDFTELALAG
FT                   VADVVARDEAGPDGFLVPHSDPWDDTRQASRYNYGWCHGPAGDAHVFRLLRDLTGDPQW
FT                   TALADRCWHTITHSGLPRRTRPGFWDNNGRCCGTASVLALANDRLVERDDDPAFAQVLV
FT                   DDLAQRATVTDTGVCWSNVEHSADPSELEPQTGWAMGNAGIVRELLRYSRIRSGGQSGY
FT                   AVGLPDQPAART"
FT   gene            233005..233619
FT                   /locus_tag="Snas_0218"
FT   CDS_pept        233005..233619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0218"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: esa:ESA_02861
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39937"
FT                   /db_xref="GOA:D3Q1T9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1T9"
FT                   /inference="protein motif:PRIAM:3.4.21.92"
FT                   /protein_id="ADD39937.1"
FT                   /translation="MPSATETPPIGTADDQLSARLLRQRIIVLGTEVDDQVANRLCAQL
FT                   LLLSAENSRDDISLYINSPGGSVSAGMAIYDTMRLIPNDVRTVAMGLAASMGQVLLCAG
FT                   TAGKRYSLPNSHVLLHQGSAGFGGTAADVEIYAGHLERVSARMTELVARHTGQPVEKVE
FT                   KDSLRDRWFDAAEALEYGFIDHIVERMDDVSPLAGTTTEGQ"
FT   gene            233621..234241
FT                   /locus_tag="Snas_0219"
FT   CDS_pept        233621..234241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0219"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: sfu:Sfum_0100
FT                   ATP-dependent Clp protease, proteolytic subunit ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39938"
FT                   /db_xref="GOA:D3Q1U0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U0"
FT                   /inference="protein motif:PRIAM:3.4.21.92"
FT                   /protein_id="ADD39938.1"
FT                   /translation="MSQYTIPTVVEKTAGGERAFDIYSRLLSDRIIFIGTEIDDGVANV
FT                   VMAQLLHLESVSPDLQIGLYINSPGGSFSALTAIYDTMEFIRPDIATTCMGHASSAAAV
FT                   LLAAGTPGKRSMLRHAKVMLHQPSSQAQGTLPDLAIQAKEVAKVRAEMDEILSHHTGHP
FT                   VAKIREDTDRNKTFSAQEAVEYGLVDQIITSRKASPVKALVAA"
FT   gene            complement(234242..235288)
FT                   /locus_tag="Snas_0220"
FT   CDS_pept        complement(234242..235288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39939"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39939.1"
FT                   /translation="MPHPVLDLSSASRDVYLSPSRLSRETELIGELYALLEPQLNVLAD
FT                   DIEDDPDLAEAIEAVRTIAAGGRADADTAHELLTGWAEELEETGDHDDAITARIVWLVA
FT                   AWLSVKVGRHLRTEAGSDPLWRFGGLVNVLALPRLGKDFREVMAAVDETGFHDAHRPAV
FT                   SGEHYDRALEAVVAELSKLDSAKRLDVLYAWISPLLDEVAWENREFMDEPEMETAEAVE
FT                   RFRRLASGDTPDDGDEADAVHYHLTSFALGESEDQDPDMHVRSQAAYLAADWLRLKTGR
FT                   QLRADENLGNYAPDDLPGLVNTLAWTRSRQISQLPEYVDELIDSGHDLLTPITELRAML
FT                   TDLTSPSD"
FT   gene            complement(235356..235703)
FT                   /locus_tag="Snas_0221"
FT   CDS_pept        complement(235356..235703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0221"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: rle:RL0620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39940"
FT                   /db_xref="GOA:D3Q1U2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADD39940.1"
FT                   /translation="MDVNAIPHTPRPLLRTILGGVLRGIRRHQGRTLSDVADAARVSMQ
FT                   YLSELERGRKEASSEILAAVCEALRVELSDVLAEVGRVMMAQRVRHASISVARQTAATR
FT                   ASSPQAYALAA"
FT   gene            complement(235772..238528)
FT                   /locus_tag="Snas_0222"
FT   CDS_pept        complement(235772..238528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0222"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; Tetratricopeptide TPR_4; SMART: regulatory protein
FT                   LuxR; KEGG: pol:Bpro_3193 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39941"
FT                   /db_xref="GOA:D3Q1U3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U3"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD39941.1"
FT                   /translation="MATPAPASAPPRADVLAELRSTLERHHRVVVRGPAGVGKSVLLDR
FT                   LKSEWDGDVVLAAYPGRTGVPFATLAELFADVEAGWLDALTPPRRAAVETLLRLREAPE
FT                   SGLDLIGLRLALRELLRRVTAANRVWFVVDAAERCDEQSLDLLIGLWRHLPAHRVRVLL
FT                   STRDAELSGRLAGTGAREIAVPLWSSTEIRELLAPLALPHRQVSQVCRASGGLPGLASR
FT                   IGEALAAAPGDAADHRTAILPLAEAVTGELLTELSPRARNTTLVAALATHATERQLRQA
FT                   GCGSAHRDLAEAVRLGLVELTETGEVAFHAEAIRDALVAKASERTIRRVHRTLAQVVTD
FT                   PVASVRHRALAADRRQPELASELDKTVPVAQRTGEVALAAELALMAAELTPSDDTAALI
FT                   RRWLSACQHAGSAGRVDWVERAAKAVCDLSEDPNDRLRARMAVIDAVGQDFGKVRQTFA
FT                   AAESEARGDNRTDPGLHAELLTWMAWRTYVCDTNPSEVLSLSRRAAVLAERGGNSLVHM
FT                   QALTMVARMQRFLGLPGDETTLRRAVAVAPLPVRDVAGSANFLRARHALFDDRLDTARE
FT                   QFTELLSLAERLGELKSLTEVLRSLAEVELRGGDCQAARAHIARAMDLLAGSDLSPSPV
FT                   WYVAALVETHAGDRDRAMILARQGLASAREDNDVVFTARNEYVLGLLRLYRGHAEAAVR
FT                   SLRETAALDDRCGVTDPSPLPFHGDLAEALVHTGQNEAALAVLNRARDTATRLGRHSVL
FT                   PRLDLAESAHRIAVGDHQAAAVLLKRALTEFTHYGLQLERGRTLLATASLERRRRKRAR
FT                   ARELLTEAATLFAECQATPWRRQAETARAQLEHQRHGAPDEIAALTAGESRVVRLVAEG
FT                   ATNRQVASTLDVSVKTVEASLTRIYRKLGIQTRTQLAGYRRPDEPGA"
FT   gene            238770..240560
FT                   /locus_tag="Snas_0223"
FT   CDS_pept        238770..240560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0223"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; PKD domain containing protein; proteinase
FT                   inhibitor I9 subtilisin propeptide; SMART: PKD domain
FT                   containing protein; KEGG: sdn:Sden_2868 peptidase S8 and
FT                   S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39942"
FT                   /db_xref="GOA:D3Q1U4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U4"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADD39942.1"
FT                   /translation="MKLPPARRLLVAVGTVTAITATTVLAGAPAAHAAEAEIVNSDASG
FT                   VIEDRYIAVLRDSAVKATQKSVDAKAETLADKYHGEIDRTYHATIRGFATTMDESDAKR
FT                   LAADPVVDYVETVREVKLAEDQTNPPSWGLDRVDQNNLPLDKKFSYPTQAGDGVTVYVL
FT                   DTGVRLSHQTFGGRAKSGYDFIDNDANASDCHGHGTHVAGTTAGSQYGLAKKADVVSVR
FT                   VLDCQGFGDNALIADGIDWVTEHAVKPAVANMSLGDTQPSPVMEDAVQRSIDAGIQYSL
FT                   AAGNNSGDACSFSPARLPAAVTVGSTAESDGRSSFSNYGRCLDLFAPGSNIVSSANSGD
FT                   SGQATMSGTSMAAPHVAGAIALYLGQNPNATPQQVRDAIVTNGTAGKVTNPGSGSPNVL
FT                   LYSGFINEPPAEHDFSIAADPGSATVEPGQSAKTTVSTKVTKGQAQQLKLSATGLPSGA
FT                   QASFDPAAIASGESSQLSIATSSGTPKGSYPVTITAEGTEATRTASFTLQVGADGGNKQ
FT                   PIADFTSNCFAGIGYCFFDGNGSSDPDGSVASYKWNFGDGTTGTGAAPFHRYSPGTYKV
FT                   TLTVTDNKGATGSVTKTVTV"
FT   sig_peptide     238770..238871
FT                   /locus_tag="Snas_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 34"
FT   gene            240695..241699
FT                   /locus_tag="Snas_0224"
FT   CDS_pept        240695..241699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0224"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: pmy:Pmen_0662 glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39943"
FT                   /db_xref="GOA:D3Q1U5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U5"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADD39943.1"
FT                   /translation="MTRGCLVPLVVTALASPGVAWGADFEDNPWLEQRVMDMAHSGGEI
FT                   EAPTNTMYAFKRAVGLGADMIELDVQSTADDELVVLHNATVDDTTNGSGEVADLSTDEM
FT                   RALDAAHNFVPGTGTAPGRPEEDYPLRGVRTGQIPPPDGYTADDFAIPTLAEVFATFPE
FT                   VPINIEIKGRADTDLLSFRHNAKLLAAFLEDSGRTDVIVTSFNDAALATFHHRAPEVPL
FT                   APGMAGIAAYFFAGVKPQPGTVALQIPVTFNGIRVATPAFIERAHRDGYAVHIWFSGSA
FT                   PETEATYNELIDACADALMPARPSLLEEILDERGIVRPGRPGIDPCFESGAPG"
FT   sig_peptide     240695..240763
FT                   /locus_tag="Snas_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            241709..241891
FT                   /locus_tag="Snas_0225"
FT   CDS_pept        241709..241891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39944"
FT                   /db_xref="GOA:D3Q1U6"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39944.1"
FT                   /translation="MFAASRKSKAVSKRAKDAPANGGTMIGRIPKPVWTLITTAVTAGV
FT                   GMFMKWLRDRPGKAR"
FT   gene            complement(241944..242828)
FT                   /locus_tag="Snas_0226"
FT   CDS_pept        complement(241944..242828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0226"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: mlo:mll7820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39945"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U7"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADD39945.1"
FT                   /translation="MDEPKVVLSDLVVGESPRWHEGRLWFCNWGAHEIIAVDPDGNAEV
FT                   VLRDAEVDPHSIDWLPDGRMLIVPKNTERGRLLRREPNGDIVSHADLSGLPSGFNEIVV
FT                   DGRGNVYVNGADFDFLSFISTLDHTDQRPLHLRPGFVPGFIALITPDGRSRIVAEDIAF
FT                   PNGMLVTPDNATLIISESFAGRLSAFDVAADGGLSGRRVWAEGLGPDGICRDADGAVWT
FT                   SSGETDCVRVAEGGEILDRVDFDRSPFACMLGGPERRTLYVVAATWNPENPFGGRTGQL
FT                   LAVPAPAAGVGWP"
FT   gene            complement(242895..243806)
FT                   /locus_tag="Snas_0227"
FT   CDS_pept        complement(242895..243806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0227"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: scl:sce6834 ECF family RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39946"
FT                   /db_xref="GOA:D3Q1U8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD39946.1"
FT                   /translation="MVDELGEAARRFEENRARLRAVAYRMLGSLAEAEDAVQETWLRYS
FT                   RADTAEVANLPGWLTTVTGRVCLNMLRARRTRREVSIDAVTDDGRRGADTELERHPATD
FT                   ADPEREAVMADSVGLALLVLLDTLSPGERLAFVLHDMFTVPFEEIAPLVDRSAAATRQL
FT                   ASRARRRVKGGAAVSRAELDRQRPVVDAFLTAVRGADLEALVALLDPSVTLRADRHVVP
FT                   SARPITISGATTVAETAMAATGRARFTGLVLIDGAVGLLMAPGGRLRLVLRFGFDGERI
FT                   TGIDVVADPARLAELELAVVGD"
FT   gene            243920..244687
FT                   /locus_tag="Snas_0228"
FT   CDS_pept        243920..244687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0228"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; NAD-dependent
FT                   epimerase/dehydratase; Male sterility domain; dTDP-4-
FT                   dehydrorhamnose reductase; KEGG: ank:AnaeK_3321 NmrA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39947"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2X7"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ADD39947.1"
FT                   /translation="MSASILVTGGTGTLGRLVTPLLRDTGARLRVLSRGSRATEPGVEH
FT                   VTGDLLKNEGLTAAVAGVDTILHLAGGAKGDAEATANLVRAAHRAGTVRHLVHISVIGA
FT                   DRMPLAWFANQRGAEQAVTESGLPWTMLRAAQFHDLVLTMVRGMSKLPLIPAPGGLRFQ
FT                   PVATADVASRLAELTLGDPAGLVPDLAGPTVYTLDELVRGYLSANGRRRLFLPIRIPGK
FT                   AGRAYRAGHNLNLDTAVTGEHTWEDFLADRVPA"
FT   gene            complement(244741..245148)
FT                   /locus_tag="Snas_0229"
FT   CDS_pept        complement(244741..245148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0229"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: afw:Anae109_4036
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39948"
FT                   /db_xref="GOA:D3Q2X8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2X8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADD39948.1"
FT                   /translation="MSIMIFPNLPVKDLEAAKKFYTALGFELNKDFSDDNAASIVIAEN
FT                   IVVMLLREEFFSTFDSRTIADTATTVESVHALGVESRGKVDELVDAAIAAGGKEAGEAK
FT                   DEGFMYGRAFFDLDGHHWEVMFMDLSAMPQE"
FT   gene            245292..245846
FT                   /locus_tag="Snas_0230"
FT   CDS_pept        245292..245846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0230"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mlo:mlr0926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39949"
FT                   /db_xref="GOA:D3Q2X9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2X9"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADD39949.1"
FT                   /translation="MARLVYSAIMSLDGYIADENGEFGWAMPSDEVHGFINDRMRSIGT
FT                   HLYGRVLYETMTGWETDPSLAEQPLGRDFAEQWQAADKIVYSTTLDKPVTAKTRIEREF
FT                   DPVVVQGLKDTAEADLLIGGPVLAAHAFAAGLVDVCELYVVPVIVGGGHLGLPEGLFLN
FT                   LELLEERRFANGFVLLRYKVG"
FT   gene            complement(245946..247217)
FT                   /locus_tag="Snas_0231"
FT   CDS_pept        complement(245946..247217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0231"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase;
FT                   aminotransferase class-III; KEGG: scl:sce6587 glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39950"
FT                   /db_xref="GOA:D3Q2Y0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y0"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADD39950.1"
FT                   /translation="MSDSKNLMRRLVEADSEVAQLIDAEGRRQHDKIRLIASENYVSQA
FT                   VMEATGTLLTNKYSEGYAGKRYYEGQQLIDEVEELAISRAKSLFGVDHANVQPYSGSPA
FT                   NLAVYLAFAQPGDTVMGMSLPMGGHLTHGWSVSATGKWFNAVHYGVRKDTGRVDFDEVA
FT                   ELARQHRPKLIFCGGTAIPRTVDFAAFAKIAQEVDAILVADIAHIAGLVAGGAHPSPVG
FT                   HAEVVTTTTHKTLRGPRGAMLMSTEERAKALDKAVFPGLQGGPHNHTTAAIAVALREAA
FT                   TPDFADYATRIVANAKALAAALTERGFDLVSGGTDNHLILADLTSKDIGGKPAAKALDR
FT                   AGVELNFNTVPFDPRKPFDPSGLRIGTAAVTTRGMTEADMPKIAAWMDDAISAAHDGQE
FT                   DKLDDIAGQIRDFCAAYPIPGWTE"
FT   gene            complement(247210..247668)
FT                   /locus_tag="Snas_0232"
FT   CDS_pept        complement(247210..247668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: PPP1R13L; protein phosphatase 1, regulatory
FT                   (inhibitor) subunit 13 like"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39951"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39951.1"
FT                   /translation="MRHPVGVNQPDDNGQPQPPDGFDPRQNPRGLMTDGRRVADPADFG
FT                   RGPRGGDFPQTVFRNERPPVQRHHREQTTDEYEETARSMASHPLFRGLLQELPPRTAPP
FT                   SQEWLDRWSSTARSILELLYSRDPLALDRRLASALNGVLTREGGRTDE"
FT   gene            247790..249253
FT                   /locus_tag="Snas_0233"
FT   CDS_pept        247790..249253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to gamma-aminobutyric acid (GABA-A)
FT                   receptor, subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39952"
FT                   /db_xref="GOA:D3Q2Y2"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39952.1"
FT                   /translation="MSKSTPVNAIGTAFAVAVLAALAQLGLATGLAILIWRSGSAAEWA
FT                   AQLSWGAFLAAVATIAGGLVAGRLITDTGPRITAVLASGIGAFTLAPLIAVPAMRFEDA
FT                   PIATAPFAAVGIGVLAGLLLSGLALAWRAIKISVLATIALTWVLAILAAFVPVDDASRI
FT                   VKVAVWGEWKGLSASAPIVPALLVGTLLIGMITAWVMTSPDAVGDHRITAISGAVGPLL
FT                   LVAAYAAAGQDDVRVDPQWHGMGVGTGAVVAGLLGGLLVTALRRAPSPAPAVDTALTPT
FT                   ATATASVEPGSLGDPSEDDRTQTVPAMPRADQTYEVPAAPPPFPPPPAENLDPYVSAEY
FT                   DEAQLTQYVDATAAAGHQAEVRGTEFDEPEPPPPPPAPEPEPQPEPAKKTAKKARKTAK
FT                   PKPKPEPAPEPEAEQALFPPPEPESDPGKTKAMPAAKPDETDPDENWYSELRDENAFIN
FT                   DHNETPDSAPEPEAAPQKKRRWGRKKKED"
FT   sig_peptide     247790..247861
FT                   /locus_tag="Snas_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.750 at
FT                   residue 24"
FT   gene            249371..250384
FT                   /locus_tag="Snas_0234"
FT   CDS_pept        249371..250384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_6226 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39953"
FT                   /db_xref="GOA:D3Q2Y3"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39953.1"
FT                   /translation="MRRNNGSLPPAISLFFLTPVIAEFLPGYLSLDSLVTALVLAPMYG
FT                   GGALLIRELTRRAGRGWWTILILGLAYGVVEEGFGTQSLFNPHYADLELLQPAHLPGLG
FT                   MGAWWTVFVVALHAVWSIALPIAIVEAFTASRPRQPWLGRIGLTVTALVFALGVAVIAS
FT                   FTMAGDDFRATPGQFIGAAVAVVLLATLALTLGGKLDAQTLAERAAPPVWLVTALSLLA
FT                   GAAFAGSAFLVSSGGADQLGWPLVLGYLVLVALMVTIVRHWSVSPDWGDAHRLALAGGA
FT                   LLTYAANAFIETPSTPVDPALDLAGNLGFALGAVVLLLLATRRVSNTALRPQRVGQ"
FT   sig_peptide     249371..249439
FT                   /locus_tag="Snas_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.924 at
FT                   residue 23"
FT   gene            complement(250443..252125)
FT                   /locus_tag="Snas_0235"
FT   CDS_pept        complement(250443..252125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0235"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   scl:sce1630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39954"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y4"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ADD39954.1"
FT                   /translation="MRQIDEIAETYVAEALELSPMTATYMGVEGHDHEFDDLSPEGLAR
FT                   QAALVRDTLSKLSATEPVDERERVAKEGMEERLGLELERHEAGDEYLSLNVISSGVHNV
FT                   RQVFDMMNTDGQDNAANIAARLNAVPQALRQYTQTLREEAAAGRVAALRQVSEVAGHCD
FT                   NWNGAKGDDFWNGLIGKVTVDGKPAEGALAEALGSGAAAARAATAEFASFLREELAPKA
FT                   PSKDAVGRDAYSRGSRYFLGAAVDLEETYAWGWQELHRIETEMAAVANQIKPGATVDEA
FT                   VAILDADPARSISDKHEFRDWMQQLADATVADMADKHFDIPEPVRAIECMIAPTADGAI
FT                   YYTPPSEDFSRPGRMWWSVPDGQDHFAKWREVTTVYHEGVPGHHLQIGQTAYRSELLNR
FT                   YQRQMLWCSGHGEGWALYSERLMDDLGYLADPGDKLGMLDGQAFRATRVIVDIGVHLEL
FT                   EIPADNPFGFRPGQRWNAELAWEFLRAHCRIEEEMLKFELNRYLGWPGQAPSYKVGERI
FT                   WLAAREDYKRRKGAEFNLKQFHTDALNLGALGLEPFQAALARL"
FT   gene            complement(252135..253073)
FT                   /locus_tag="Snas_0236"
FT   CDS_pept        complement(252135..253073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0236"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; 6-phosphogluconate
FT                   dehydrogenase NAD-binding; KEGG: nmu:Nmul_A2195 prephenate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39955"
FT                   /db_xref="GOA:D3Q2Y5"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y5"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ADD39955.1"
FT                   /translation="MDIGVVGLGLIGGSLLRRAHAAGFRVSGFDADAATREAARQAGYE
FT                   VADALAGLADARLLVLAVPLPALATVLPELSGYGGLLTDVTSVKEPVTRLVARHCPSVR
FT                   FVAGHPMAGKETSGFAAADADLFEGRVWVACLDEDTDLDDWLRLAETACALGARVVPAT
FT                   VAEHDTAAARISHVPHVLAAALSLLAADPLSRALGAGSFADGTRVAQSSPELAAAMCAG
FT                   NAGPVAAELRRLVEELAEAGNRLGDHDAFRDWYAGARELRVDWPPEPGDVRRLPVTTED
FT                   LLSLGRAGGWVTEVDRGTRSVMVRQPQVSVA"
FT   sig_peptide     complement(253008..253073)
FT                   /locus_tag="Snas_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.696) with cleavage site probability 0.672 at
FT                   residue 22"
FT   gene            complement(253275..253616)
FT                   /locus_tag="Snas_0237"
FT   CDS_pept        complement(253275..253616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0237"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: bac:BamMC406_3452
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39956"
FT                   /db_xref="GOA:D3Q2Y6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y6"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADD39956.1"
FT                   /translation="MLVTAFDTETGLPIRLLHDRVLVRVDTGDGERRSAAGIVIPATAS
FT                   VGHRLAWATAVAVGPLVRMVQTDDRVLFDPDDRSEVELHGREYVLLRERDIHAVAAQRV
FT                   DDNATGLYL"
FT   gene            253733..254998
FT                   /locus_tag="Snas_0238"
FT   CDS_pept        253733..254998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0238"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mxa:MXAN_7270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39957"
FT                   /db_xref="GOA:D3Q2Y7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y7"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADD39957.1"
FT                   /translation="MSRFARFRMRASQTWARLRTNPYVERYEQVRRRNEDPELDDVPDE
FT                   VEEEFADADEVEPPDPEGVPHGVKVAAGWSWRALVIAAAVVGVLYLASILSFVVIPILV
FT                   SLLLAAMLQPLVALLVKAHVPRSIAAAIVLIAGIAAVAGVLTLVINQFVANIDTLVDSV
FT                   QKGLLNLQDWAKYGPLHLEQKQINNFFSEFQTVITDWLSDNQSILAGTAVESLGIVFNI
FT                   LTGAFLVLFTTFFFMRDGRRIWTFLVRMLPERAHEPLLHAGFASWRTLVSFVRATILVA
FT                   FIDAVGIGAWLMFLDIELAIPLAALVFLGAFIPIIGATVSGIVAVLVALVGDDWVTALL
FT                   VLAGVIVVQQVEGHLLQPLLMGRAVSVHPLAIVLAVAAGVVLAGPIGALIAVPIVAVLN
FT                   NGIKALRAHAHPPDETPGNVAA"
FT   gene            254995..256989
FT                   /locus_tag="Snas_0239"
FT   CDS_pept        254995..256989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0239"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; DEAD-like helicase; KEGG:
FT                   mxa:MXAN_6717 putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39958"
FT                   /db_xref="GOA:D3Q2Y8"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y8"
FT                   /inference="protein motif:SMART:SM00491"
FT                   /protein_id="ADD39958.1"
FT                   /translation="MSKPTVAQLLDAAVAAVPGGEIRPGQQAMATAIAESMESGTHLMV
FT                   QAGTGTGKSLAYLAPALLSPRPVVISTATLALQSQLIATDLPRLSEAVEPVLGRKPRYA
FT                   VFKGRHHYLCAAKIGADATDEEDTLFSDTEESGWVGQRSRLGKDIGRLTDWANDTDTGD
FT                   RDDLDPGVSDAAWRQMSTSARDCVGAANCRWGGECFAEAARNRAREADIIITNHALLSI
FT                   DIMHNRTVLPEHDLLIVDEAHELADRTTSAARAELSANSVDRLGRRASGVCGKEIAAQL
FT                   TEIADQLGVVITECPNTRLEELPTALTEVLTLLDGACGTAIGEIGNVKPDSPEYMSRTQ
FT                   LKSWLTEARETAQRCLAGGRQDVRWCEGDGRGRSLIVAPLSVAGLLGEELFAERTVIAT
FT                   SATLTLGGSFDTAATSLGLKKENEVTEADKPSGTNTGPMWRSMDVGSPFEYRKQGILYV
FT                   AAHLPRPTASGLSDAAADELIRLVTALDGRALGLFSSKRAATTAAEVLREKTDLPILLQ
FT                   GDETLPLLVKKFKADARACLLGVMSLWQGVDVPGDACQLVIVDRLPFPRPDEPLSAARS
FT                   AAADEAGGSGFASVSVPHAAIRLAQGVGRLIRTGGDRGVAAVLDPRLHTARSYGPYLRK
FT                   SLPPLWYTTDSDKVQGALRRLAATPADLR"
FT   gene            257071..257700
FT                   /locus_tag="Snas_0240"
FT   CDS_pept        257071..257700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0240"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   gme:Gmet_3132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39959"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y9"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADD39959.1"
FT                   /translation="MRFSLRPQDDAFYKFFIEAAENIVKGTAILAELGEAEVDTQSVSE
FT                   RLVEVEHANDEITHELYNKINSTFVTPLDREDMYQLGSQLDDVMDHIEAAGNLVYLYGL
FT                   SELPSLPREMVEIVDVLKAQAAITVEAMPKLKGMDPSLRDYWIECNRLENDGDRAYRML
FT                   LVRLFSGEYEALTVLKLKEVADELEKACDAFEHVSNTVETISVKES"
FT   gene            257701..258705
FT                   /locus_tag="Snas_0241"
FT   CDS_pept        257701..258705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0241"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: dvm:DvMF_3185
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39960"
FT                   /db_xref="GOA:D3Q2Z0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z0"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADD39960.1"
FT                   /translation="MDPILIGVIAVVAAAMIFDYTNGFHDAANAIATSVSTRALTPRAA
FT                   LALAAVGNFVGAHLGEGVAKTVGGDLVHIPQEFSGLAVVLAGVLGAITWNLITWWFGLP
FT                   SSSSHALFGGLVGATLVAGYDVLWAGILEKVIIPMVASPMVGFVLGFIVMIAIMWIFKR
FT                   KNPRKLSRGFKIAQSVSAAAMSVGHGMQDAAKTMGIIVLALYVGGFQDSNEHIPEWVFY
FT                   SSAAMLALGTYAGGWRIIKTLGRRVIDLGPPEGFAAETVASGVLYTNALVFEAPISTTH
FT                   TITSSIMGVGATKGKAAVRWGVAGNIVIAWVLTFPAAAAVAAGVYLLVRPLFS"
FT   gene            complement(258775..259149)
FT                   /pseudo
FT                   /locus_tag="Snas_0242"
FT   gene            259511..260482
FT                   /locus_tag="Snas_0243"
FT   CDS_pept        259511..260482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0243"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: bpt:Bpet2252
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39961"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z1"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADD39961.1"
FT                   /translation="MTTPRSGAAKARRLVSVAVGIALILGFTAVPAEADPSVKELEKKI
FT                   EKRAEELEGTIEDYNAAREDLDKTKKKIKKLDKKLAPYEKELDKLYDKAEPIVMAAYQG
FT                   QGLTGPTAMLNSDSPEAFADKISALDGLSAGDAGLIGKVAKKARAYKSKKTDLEELKDE
FT                   QDKKESDLSKAKKKIEKEIEDLQGDRKTTIKNETGADYVPDYVPGKRGEVVRHAMAQVD
FT                   KPYVWAAAGPDGYDCSGLILDAYRQIGISLPHNAARQYGQATHIGKGDLQPGDPVFSNG
FT                   LKHVTMYIGDGYVVHAPTFGQPVQVAKMDTAASPYYGAGTFL"
FT   sig_peptide     259511..259615
FT                   /locus_tag="Snas_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 35"
FT   gene            complement(260554..261579)
FT                   /locus_tag="Snas_0244"
FT   CDS_pept        complement(260554..261579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0244"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; KEGG: sfu:Sfum_1469
FT                   fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39962"
FT                   /db_xref="GOA:D3Q2Z2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z2"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADD39962.1"
FT                   /translation="MPIATPEVYADMLDRAKNGAFAYPAINVSSSQTLNAALAGFAEAE
FT                   SDGIIQVSTGGADYFSGPTVKNMVSGSVAFAEFAREVAKNYPVNIALHTDHCPKDKLDG
FT                   FVRPLLDISAERVKGGQEPLFQSHMWDGSAVPLDENLRIAEELLAKTAAARIILEIEVG
FT                   VVGGEEDGVVGAIDEKLYTTVEDGLATAAALGSGEKGRYMTALTFGNVHGVYKPGNVKL
FT                   RPEILKEIQEAVGAKVGKTKPFDLVFHGGSGSLLEEIRSAVDYGVIKMNVDTDTQYAFT
FT                   RPVADHMLKNYDGVLKIDGEVGNKKKYDPRAYGKAAEAGMAKRVVEACENLRSVGTTAA
FT                   K"
FT   gene            261698..261871
FT                   /locus_tag="Snas_0245"
FT   CDS_pept        261698..261871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39963"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39963.1"
FT                   /translation="MATENWQIPEADAAEQAAAATETDEAQARPRQVTEADEADTLEQT
FT                   QEVPEDDEYREP"
FT   gene            complement(261911..262426)
FT                   /locus_tag="Snas_0246"
FT   CDS_pept        complement(261911..262426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_02655 NTF2 enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39964"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39964.1"
FT                   /translation="MRTISKIGAVAAVAVALLGGVATVAVAEGGAAGTTAAQREKEARD
FT                   ALERLRERQFEAWDEKDGAAFASTFAKDGDMVTFNGDHLATRAGIASGMQYYFDNFIED
FT                   TTIELLDEKVRFVDGKLAIVVRTTCLVRDGESECRDGSDSVNTNVMAKRHGVWEQQSFQ
FT                   NTRIDPIE"
FT   sig_peptide     complement(262343..262426)
FT                   /locus_tag="Snas_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.932 at
FT                   residue 28"
FT   gene            262612..262703
FT                   /locus_tag="Snas_R0006"
FT                   /note="tRNA-Ser1"
FT   tRNA            262612..262703
FT                   /locus_tag="Snas_R0006"
FT                   /product="tRNA-Ser"
FT   gene            complement(262775..263107)
FT                   /locus_tag="Snas_0247"
FT   CDS_pept        complement(262775..263107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0247"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   mmw:Mmwyl1_1901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39965"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z5"
FT                   /inference="protein motif:PFAM:PF04266"
FT                   /protein_id="ADD39965.1"
FT                   /translation="MYLNGRKTAGSSIKEDFLAAGDPLPRVGNFWIVLNSRAEPACLLR
FT                   TEKIAVHKFYDVPPQIAVAEGEGDLSLEHWRRVHQAAYEPHLAEWGLASIADATVITEY
FT                   YTLLFT"
FT   gene            263398..263838
FT                   /locus_tag="Snas_0248"
FT   CDS_pept        263398..263838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0248"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rlt:Rleg2_5785
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39966"
FT                   /db_xref="GOA:D3Q2Z6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADD39966.1"
FT                   /translation="MTLKKLDNIEIIVEDLDAVIAFFTELGMEVEGRSQVEGSWAARLV
FT                   GLEDQKVDVAMMRVPGDNGRVELAQYRMPDAIRSLPENAPPHTLGIRRIMFAVEDLDGK
FT                   VAHMLAHGAELVGEVVRFGDSYKLAYLRGPEGILVALAEELG"
FT   gene            264077..264841
FT                   /locus_tag="Snas_0249"
FT   CDS_pept        264077..264841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_1210 GCN5-related N-
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39967"
FT                   /db_xref="GOA:D3Q2Z7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39967.1"
FT                   /translation="MTVDVNSVDQPASLAEAPLRQARNSGAFWAATARSRGHEVLRRPG
FT                   FVAAVGDERAGTRVLIQEPGLDGDAVAEIVELARGAAGPVDVEDPFSATDLSQLGYRNW
FT                   QMPVMLRQPGPVEEPHLEVVRAGNAAELRAAERAVIDGFELVRFEPYRGNEMFPEALLD
FT                   EDGVDVFIVRVDGGEVAGACVTVVDNGYGSHYWVGTPEAFRSRGVGRAAMLGSLAPLAD
FT                   MPVTLTASRLGRPLYESLGFAVAAPATWWASR"
FT   gene            complement(264833..265297)
FT                   /locus_tag="Snas_0250"
FT   CDS_pept        complement(264833..265297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0250"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: pen:PSEEN3530 superoxide response
FT                   transcriptional activator; TIGRFAM: redox-sensitive
FT                   transcriptional activator SoxR; PFAM: Transcription
FT                   regulator MerR DNA binding; regulatory protein MerR; SMART:
FT                   regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39968"
FT                   /db_xref="GOA:D3Q2Z8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z8"
FT                   /inference="protein motif:TFAM:TIGR01950"
FT                   /protein_id="ADD39968.1"
FT                   /translation="MNTGPDNHLTMGEVIRRTGVAASALRFYEHKGLIFSERDRGNHRI
FT                   YARHMLRRVSLIIVAKRLGIPLADIAEVFATLPRDHEPSHDDWQRVSRGWRKRLARRRR
FT                   AIENLERELTGCIGCGCLSMKACLLLNPDDTLEPQGPGPVRLRETETALP"
FT   gene            complement(265372..266295)
FT                   /locus_tag="Snas_0251"
FT   CDS_pept        complement(265372..266295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0251"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mms:mma_2003
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39969"
FT                   /db_xref="GOA:D3Q2Z9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD39969.1"
FT                   /translation="MSTSYTMNGDLRIAYEDHGGHGGDPLLLVMGTAFSRFWWPPKFIA
FT                   TLVEAGFHVASYDHRDAGESDRWPDQPKANPIASQFRKGKLAYTAAEQASDGVAVLNAL
FT                   GWDGAHLFGHSMGGLVAQHIALGFPGVARTVTTSAAVPAAASRLGLLRYVRPGVLVKLS
FT                   RAKYPRGPEGDVAAAIGYARMLAAPDYPLDEEYAREAAERDRACGIDPRDTQAQARQTG
FT                   ARWSGPGPEALTVPLLSFHGDADPLLRLSAARDLTAAAPDSRLIVVPGVGHTLPGPLFA
FT                   DYVAEVRRHVDRWATSAPRLRFSRAY"
FT   gene            266375..267040
FT                   /locus_tag="Snas_0252"
FT   CDS_pept        266375..267040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0252"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: avi:Avi_9231 TetR-family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39970"
FT                   /db_xref="GOA:D3Q300"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q300"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39970.1"
FT                   /translation="MSTDEVIWLRPEQATTGRPAERSRAEITAAAITVADRDGLDAVSM
FT                   RKVAAELGTGAASLYRYVNNRDDLLDLMVDATGADFEFPPPTGKPVTDLVQLGVRHRQI
FT                   MLGHPWLPTLVLTRPTLGPSGAAILEYFLTVLDDHPLPATAKLEAFALFSGFVAMYVHN
FT                   ETHTAAETVARQTTYLLHLATDGEHPQLAATLLAAQPAEGSDRFPVILARVLTGLLTI"
FT   gene            complement(267087..267701)
FT                   /locus_tag="Snas_0253"
FT   CDS_pept        complement(267087..267701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0253"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: mms:mma_2815
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39971"
FT                   /db_xref="GOA:D3Q301"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q301"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADD39971.1"
FT                   /translation="MTPEVLTADNTAVLLVDHQIGLFTGVRDLGTDELAHNVAALAASA
FT                   TRLGLPVIATTTAADSMWGPLVPELVAALPHGHPVIDRGTVNAWDDERVRRAVEATGRR
FT                   NLVIAGVSLEVCAALPALAAVRNGLNAYVAVDASGTFSRTKRETGLLRLAQAGVVVADY
FT                   SALMVEILADNAAPHAGEVYGALDMPFAKLVGGLSAAIRSR"
FT   gene            complement(267836..268336)
FT                   /locus_tag="Snas_0254"
FT   CDS_pept        complement(267836..268336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0254"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: hch:HCH_03585 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39972"
FT                   /db_xref="GOA:D3Q302"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q302"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADD39972.1"
FT                   /translation="MPDMMDEVQRLWHEVRPEADVGPMGVVGRIQRASRLLEQGHRDYF
FT                   SRFDIDDGEFNVLATIRRYGPPYTVTPGKLTETSYIKAAAITNRVDRLVAKGYVTRETD
FT                   PDNRRKVRVTLTSSGLDIVERAFDGHVTNEDRMLAALDGEEREQLAGLLRKLLESLGDV
FT                   PKG"
FT   gene            268620..268877
FT                   /locus_tag="Snas_0255"
FT   CDS_pept        268620..268877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39973"
FT                   /db_xref="GOA:D3Q303"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q303"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39973.1"
FT                   /translation="MLGQLFVPKLVDGKRTSRVLALAALLWALGGGLGLQHLGGLWWLI
FT                   GAGIGVLAAIGNLAAEPARERRLATATERGRPAAWSESGV"
FT   gene            268924..269415
FT                   /locus_tag="Snas_0256"
FT   CDS_pept        268924..269415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39974"
FT                   /db_xref="GOA:D3Q304"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q304"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39974.1"
FT                   /translation="MATTPRHWTLPRILVRVVLFFSLFGPALADLAIPDVAAMHLHNPN
FT                   WPPHAKFHDAQYLVMAALLAAIGLTMLWRRTGNLRLQFHWAAALASVTWLAMFAALLFP
FT                   GTGIIDPEFVADNVSILGLNPQLFIALVMLVLLAVAVGVERFGRRIPLAPESNRTPAAA
FT                   "
FT   sig_peptide     268924..269013
FT                   /locus_tag="Snas_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.974 at
FT                   residue 30"
FT   gene            269477..270043
FT                   /locus_tag="Snas_0257"
FT   CDS_pept        269477..270043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0257"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bbt:BBta_0873
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39975"
FT                   /db_xref="GOA:D3Q305"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q305"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39975.1"
FT                   /translation="MTSTAGRRPRSDAAHNRDRVLTAAEELFNSQGTAVHMSEVAKSAG
FT                   VGVGTVYRHFPTRRALVEAVAEQRFVEILAFAREHCLDQPDPREALRGFLHHVGEVHER
FT                   GRGQSDAIEAVLGSTEPRGEPGERLQEVGETLLRRGREAHVVRADITVADLYMIVGCVA
FT                   TICRNGFGDWRRFVEIALNGFRPLD"
FT   gene            complement(270053..270859)
FT                   /locus_tag="Snas_0258"
FT   CDS_pept        complement(270053..270859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0258"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   rsh:Rsph17029_3698 WecB/TagA/CpsF family glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39976"
FT                   /db_xref="GOA:D3Q306"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q306"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADD39976.1"
FT                   /translation="MIDQGKRNVLGVYVDAIDYEAATEKVVDAAREQRPLALTALAVHG
FT                   VMTGVQDRAHEARLNSFDVVTPDGQPVKWALNLLHKAKLSDRTYGPELTIRVIARMAAE
FT                   GLPIYLYGSTPEVLDTFRAKLSERFPDLVIAGWEPSKFRANEVGEPEQIAKRITESGAR
FT                   LVLVGLGCPRQEIFAHAMRPLLNMPLMAVGAAFDYHAGNLRKPPEWMQKRGLEWLWRLG
FT                   LEPKRLWRRYLILNPLYLARLTGQATRVWKAKPATATREGADSFAV"
FT   gene            complement(270856..271929)
FT                   /locus_tag="Snas_0259"
FT   CDS_pept        complement(270856..271929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0259"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; short-
FT                   chain dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: rsh:Rsph17029_3699 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39977"
FT                   /db_xref="GOA:D3Q307"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q307"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADD39977.1"
FT                   /translation="MSVALITGSAGLIGSEAVRHFAKLGFTVAGIDNDMRAYFYGSDGS
FT                   TAWQVEELKRELGASYEHHSVDIRDRDGLDKLFKHYGSDLAVIIHCASQPSHDWAAKEP
FT                   FTDFDINATGTLNLLEYTRKYAIDAPFIFCSTNKVYGDTPNRLPLIEKDTRWEIDPSHP
FT                   YVDGIREDMSIDNTLHSIFGASKVASDIMVQEYGRYFDMKTAVFRGGTLTGPAHSAAEL
FT                   HGFLGYVMRCVMERRNYNIYGYKGKQVRDAIHSHDVVTAFEAFYRAPRVAEIYNLGGGR
FT                   ASNISVLESFTVAEEITGEKAQTTYVDQNRVGDHIWWISSMARFQEHYPDWKMSHDVNS
FT                   IMRGIYEANVDRWVPQS"
FT   gene            complement(272043..272756)
FT                   /locus_tag="Snas_0260"
FT   CDS_pept        complement(272043..272756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0260"
FT                   /product="glycosyl transferase WecB/TagA/CpsF"
FT                   /note="PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   ret:RHE_CH01358 putative teichoic acid biosynthesis,
FT                   UDP-N-acetyl-D-mannosaminuronic acid transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39978"
FT                   /db_xref="GOA:D3Q308"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q308"
FT                   /inference="protein motif:PFAM:PF03808"
FT                   /protein_id="ADD39978.1"
FT                   /translation="MRQRHPGRFRCCGVLIDSLTPEAATQALLTSRHGQARRAHLCDTY
FT                   TVSIALADTEFRDLLNASDINFPASTRLVRQGRRLAARNLTDRIHPPTLMFDTMSQGRQ
FT                   PGLRHYLCGPTPEVVKTLKKTLLEKLPGVDIVATSVLAFPIMPAENAALRKLAADYRPD
FT                   IVWVGCETPQQHGFVAEYASVLGTTLVAVGDAFSVLSGVKPPSRPWTTQLLGTARFGYG
FT                   TLTDKRRSRKLDRVP"
FT   gene            272837..273811
FT                   /locus_tag="Snas_0261"
FT   CDS_pept        272837..273811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0261"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   Os02g0805600; hypothetical protein ; K00344 NADPH2:quinone
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39979"
FT                   /db_xref="GOA:D3Q309"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q309"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADD39979.1"
FT                   /translation="MRAVEIAEPGGPEALKVIDAPDPIPGSGEVVIEVAAAGINRADAA
FT                   QRRGKYPPPEGASPYPGLEVSGRIIAIGPGVAGVSVGDEVCALLSGGGYAERVAVDARL
FT                   LLPIPDGVDLVDAAGLPEVAATVWSNVFQIARLTEGEMLLVHGGSGGIGTFAIQLATAR
FT                   GCGVLTTARSHNADALRGLGAELVIDYRDQDFAEEVATHTDGRGVDVILDHLGASYLDR
FT                   NVASLNLNGRLAIISMQGGSKTEFNLGALMRRRGSVSATTLRSRPIGERADIIAAVRDN
FT                   VWPQVASGQVKPVVAQRFPLADVVEAHRVLDAGGYLGKILLTT"
FT   gene            complement(273842..276031)
FT                   /locus_tag="Snas_0262"
FT   CDS_pept        complement(273842..276031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0262"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   swp:swp_1383 hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39980"
FT                   /db_xref="GOA:D3Q310"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR028208"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q310"
FT                   /inference="protein motif:PFAM:PF00353"
FT                   /protein_id="ADD39980.1"
FT                   /translation="MVEPKINVDSQWFDLKADPTKLEKSATKWRAMGKKGDDVSGDLHD
FT                   AANVVLDGKGKEWKGDTRDSFETHKTSLVKAVAGTKTPSDDVAGALDGLATLLRNRQGD
FT                   LDALKTKLLGRVANVVNGGQITFSPKDAKETKGVMDAVAAARGIRDGLDIQMGTHTSAM
FT                   SKAVGEWQAISTKWSKYASENAPDTFKLPPEADNGTQVLKLPDGSVIVNTGTGDEKTDV
FT                   RTDSDGNVIVTVDGKEYKYPPGTPVAIRGGEGDDEVTINPSVKSDVTVLGGEGKDQIVD
FT                   NGLPGQDPSTGPRTIIGGDGDDRIVVNGENKNISSGAGNDKVTAMGDNNNVSTGDGKDN
FT                   VETTGGYNSTGRGGDFVRAGNHNDNPFLKGMDVHESTTFGGTGDDEIQGSTKDDKISAG
FT                   SGDDQVYGHEGDDLVDGGAGHDYLDGQDGDDNISGGADKDTVYGLDGDDTLTGGSGRDY
FT                   LEGAEGNDTIGGGTEEDVVSGGRGDDNLHGDDGDDVMYAGAGKDTLDGGEGNDKQFVQD
FT                   EDKVASDGVAPGMWGVNDSDTVQKVDIVDNSYIQVRGSDEFQDRIRADLDMYSSSPTGK
FT                   QMMENLGDRVSDTHDDWKPGEREVVIKEFDEENGTASSGKLSGSDVEIQINPDFHLDDP
FT                   GEATTSKTEREGVPSAILYHELAHGYDYLNDTSADGHDKGNDAPNDERQAAGLDYDWTG
FT                   DGKRDNVHDKDNPHPYAYTENGLRDEMGRDHRDAY"
FT   gene            complement(276084..278312)
FT                   /locus_tag="Snas_0263"
FT   CDS_pept        complement(276084..278312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swp:swp_1383 hemolysin-type calcium-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39981"
FT                   /db_xref="GOA:D3Q311"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR028208"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q311"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39981.1"
FT                   /translation="MVEPKINVDSQWFDLKADPAKLEKAATHWRAMGKKGDDVSDDIHD
FT                   AANVVLDGKGKEWKGDTRDSFETHKSDLVKSMATTKGKSDDVAGALDGLATLLRNRQGD
FT                   LDTLKSKLQGRVANVINGNQITFSPKDAKETKGVMDAVAAARTIRDGLDTQMGTHKTAL
FT                   STAATDWTAISDKWKKYAADNAPDTFKLPPEADNGPQSIKLPDGTVIVNTGTGDEKTKV
FT                   HTDRDGNVIVTVDGKEFKYPPGTNIAVRGGEGDDDVTIDPSVKSDVTVLGGEGEDTVVD
FT                   GGGPGSDPSTGSRTVLGGDGKDNIVVNGDNRNVSSGAGDDRVVALGDNNNVSTGDGKDD
FT                   VRTTGGYSSTGRGDDFVRAGNHDDPLYKDKPVHESTIFGGEGNEEIQGSTKDDKISGGS
FT                   GEDEIYGHEGNDLISGDGGQDYVDGQDGNDNISGGGDTDTIYGLDGDDTITGGSGKDYL
FT                   EGAEGNDSVNGGTGEDVVSGGRGDDTLHGDDGNDVIYAGDGKDSVDGGEGNDKLLVQDG
FT                   DNVASDKVASNGYSVNDTDTVKNVKIVDSSFIKVDGSDEFEDRMRADLNMLSGSENGTK
FT                   MLANLEDKIDNSRDDYMPGERELVINEFDEDNGEALPGADGFFGHDVNLNINPEYDSGN
FT                   EKPPSTVLYHELGHAYDYYNDTTDDGRHNDPKDPDYVYEKKYWDLAGPEERVGAKNSER
FT                   QAAGLPIDHDGDPNTPTKIDPDHPIEYTENGLREEMNWGHRDQYGSPY"
FT   gene            complement(278327..278713)
FT                   /locus_tag="Snas_0264"
FT   CDS_pept        complement(278327..278713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39982"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q312"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39982.1"
FT                   /translation="MAKEVQADFVELGVLGKAFTTAGTGLRTGLKDMREEGLIPANAFG
FT                   NTPGAEGFNESYSDVLEKAGQAMEDLADTVERDSDNVYRVAFAYQKTDLDNKAKIDANT
FT                   EKEKLDRLREEVGSVPYPSKPTIV"
FT   gene            complement(278909..281749)
FT                   /locus_tag="Snas_0265"
FT   CDS_pept        complement(278909..281749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0265"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rlt:Rleg2_5436 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39983"
FT                   /db_xref="GOA:D3Q313"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q313"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD39983.1"
FT                   /translation="MLFGRDSEKRALDQLLADARDGHGGALLLHGVAGSGKTALLDHAA
FT                   AAAGEALVLRAAGVQMEADLPYAALHMLLRPVFDGIDALPQPQAAALRSAFGLGPAAEA
FT                   NRFTVGLATLTLLAERAESRPVVCLVDDAQWLDLPSFHALLFAARRFEADRVAMLFASR
FT                   SSGAELRAEGLPERELSGLDHDASVALLEAAGVPVPVRERLIAATDGNPLALRELARDV
FT                   DRLGGTGPVAVPLTTKLQQLFAADVESLDEPVRNLLLIAAAEGTGDVEVVLRAAEGLGI
FT                   GAEALRLAAEAGHIDVTADRVSFRHPLVRAAVYQSATPPQRRAVHGVLSRIFDSEDDAD
FT                   RRAWHAAARVSGTDDEVADDLAASAQRAAARGGQAAAVTILERAAELSSRPGVRGGRLV
FT                   AAAEAAGDSGQHDRTRDLAARAEPLVTDPMQASRLAELRAEEELLHGSVAAARDILDEG
FT                   VRRVAAVDGGRAVIMVTHLANVAVHWGAPQWVDEAVGLLGTIEFAGRGSDGAGSAEVPQ
FT                   RGGAAATAELIVAAAAACEGIREVMAGDAGRGVELVRAMVEPMRPLRSGLVGARVFAAT
FT                   LSGLAADDDVAVELLEPLITECRSLGMVGWLPTLHTGLSEALTRLGRFRDARASVAEGA
FT                   RIAAELGQTRMAACLDATGAVLAAVAGEEVTDEPGELSPWALATWRHARSLAALVRGDY
FT                   ELAVGHWNSIVGTAAELTSAAWVWAPGQVEAAVRAGDPAGAARAHELFARWADGGGRGD
FT                   LHAIRLRCEALLANESEAGQRFEAALKAHEAAGPAARAGRAAGSLAGTGKAARSAGTGG
FT                   WAARPFDAARTTLLYGEWLRRHRDRAAARRQLRRAAEEFERLGAVGWAERARLELRATG
FT                   ETRATRAARPDLRDRLTPQELQVVKLAATGATNRDIGAQLFLSPRTVGHHLYKAFPKLG
FT                   VANRAELARVFAGDES"
FT   gene            281825..282295
FT                   /locus_tag="Snas_0266"
FT   CDS_pept        281825..282295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39984"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q314"
FT                   /inference="similar to AA sequence:KEGG:Rfer_0485"
FT                   /protein_id="ADD39984.1"
FT                   /translation="MPHNFEPMNITTDTTGITELFQRLVDAWAAADAVGYAECFTPDAD
FT                   YVTFIGTHMKGHKHIIDSHEALWTHFQRNTRLHQVIDSMRFITPDVAILVTRGAILQPK
FT                   QDAPKRGDWKIQTLVALRTADGWRFTSFQNTKHRWLFEKIGARRDPRMSPKS"
FT   gene            282397..283470
FT                   /locus_tag="Snas_0267"
FT   CDS_pept        282397..283470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0267"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39985"
FT                   /db_xref="GOA:D3Q315"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q315"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADD39985.1"
FT                   /translation="MKKSWIRAGVATAAVGTLGIATAGPAMAEDSEKYNYAGLFGAGDG
FT                   YTLNTPDGSKLVANTTGIYPEEDEAGEARTYRLDTTPVSEDPEIVYDKHPWADTSIGNL
FT                   GRVKWIVDNSFPTIDAATVADKAGADLTGVADPDKAAYTATQAAIWVLTSDLKLNPDDP
FT                   TGENDAVDAAVLDITHYLINENERIAEPSDAFTVEGKAKWDGKRLGPFHFDGVDDEGWV
FT                   MAHKVDSGHEAGKVVDEDGKKLTHLEPGQKFYVDPNKGIKKLVIGGIATDSPKAGTLML
FT                   PRYDKSQPTLILAEDAGYGVTTSRTVTVGGGSGSGGDDILPVTGMSLTGVMGIGAALLV
FT                   GGALTLVLLRRRATAEV"
FT   sig_peptide     282397..282483
FT                   /locus_tag="Snas_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(283551..284444)
FT                   /locus_tag="Snas_0268"
FT   CDS_pept        complement(283551..284444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfm:Xfasm12_0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39986"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q316"
FT                   /inference="similar to AA sequence:KEGG:Xfasm12_0778"
FT                   /protein_id="ADD39986.1"
FT                   /translation="MRKRHLIYATLLATVGLSVAGVAGFASADPASEAERQSAKASKLD
FT                   TTTDLDEYWTPERIANAKPVTAPKASRASGDSQPDGESVVIDGTKPKLKSPVDTTIGRL
FT                   LFTTDDGDYICSANVVPSDNGSVLATARHCGFENNGRNYRFAPDYDSGNTPHGWWDWKS
FT                   AGWTSGGDGVAFDYAFIVLNKKDGRTVQDTVGSSGIAFNNAIDRDAQITGIPGATDAVF
FT                   HCNGKAYTNGNNQQLMDNCDGMSGGASGGAWLQDMDGGSGYQVGTYFGSVGSAAAGSYF
FT                   GEEAREVWTGASTTPV"
FT   sig_peptide     complement(284358..284444)
FT                   /locus_tag="Snas_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 29"
FT   gene            complement(284506..285435)
FT                   /locus_tag="Snas_0269"
FT   CDS_pept        complement(284506..285435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0269"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   cak:Caul_4640 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39987"
FT                   /db_xref="GOA:D3Q317"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q317"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADD39987.1"
FT                   /translation="MHHPRNPTVPPGVEYHRVLAGDKRRVGRGILAILLLVVGGAVFAF
FT                   AASQAAGYLDARLGRTNPARGGSDYTPIFHAATMFSLALLIPWSMLIQRWLYGVRGASL
FT                   HSVLSRFRLDVFGRALLIIGPIWLIPTVVLNVAMPAERTHWSNADLVAVFATTLLLTPL
FT                   QTAGEEYGVRGLVFRVAGSWSRGPRLGLVLGVLVSSLAFTAVHGSSDPWIILWYFTLAV
FT                   SLAVITWRTGGIETAIVIHALLNTLTFLLAIVVHADLTNTDRSAGAGSVALLVPSVVVA
FT                   GIAAVVWLWTRRTGPVLTPSRASTLTNK"
FT   sig_peptide     complement(285295..285435)
FT                   /locus_tag="Snas_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.560 at
FT                   residue 47"
FT   gene            285564..286178
FT                   /locus_tag="Snas_0270"
FT   CDS_pept        285564..286178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0270"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_2620
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39988"
FT                   /db_xref="GOA:D3Q318"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q318"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39988.1"
FT                   /translation="MAKRDPEGLSTRDKILLAAITMFGEDQSASLSVRAVAARAQVSTG
FT                   SLRHHFPTQRALQDAVLATIYDHVSADDRIHDRSSPARDRLLDCLRQVLAAAKPGEQAR
FT                   KAWGEIFHRFVEPDPTDEIRASYLAIEQEVQRRVEYWLTVLGNEGALPDGDNTRRARFL
FT                   VTVLNGLSIERALPAQTSILNSETETLRTAVDCVFAPLSAE"
FT   gene            complement(286165..286587)
FT                   /locus_tag="Snas_0271"
FT   CDS_pept        complement(286165..286587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0271"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   bid:Bind_1015 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39989"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q319"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADD39989.1"
FT                   /translation="MSDKTTRPVPIDVDPELACPIAPVVDIVFSRWTTPILWALNEFGR
FT                   QRFVELERAITTITPKVLTQRLRQLERDGLVSRAYYPEVPPRVEYEITELGRSLAPLFA
FT                   SLAEWSVNLDKVEQARRDYDERVHGSRRGTPPSTQR"
FT   gene            286677..287501
FT                   /locus_tag="Snas_0272"
FT   CDS_pept        286677..287501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0272"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: scl:sce8968
FT                   nucleotide-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39990"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q320"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ADD39990.1"
FT                   /translation="MIVVTGATGNVGRPLVRKLADAGEQVTAVSRNIATTDAPQGVRQL
FT                   RADMSEPESLKPALDGAATIFLLTSPDFLANGNLADVMAVVRASDVKRVVLLSSQGVGT
FT                   KRHPSMLEDVVKQSGLEWTMLRPGNFASNAFQWAASVREQRTVNAPFADVALPAVDPDD
FT                   IAAVAAVVSRERGHGGAIYTLTGPQPISPRQQAAAIAEAVGEPVRFVEQTRDEARAQML
FT                   GYMPEPVVEATLGVLGTPSAEEQRVSPDVERLLGRAPRPFAEWATRNAAAFT"
FT   gene            complement(287509..287901)
FT                   /locus_tag="Snas_0273"
FT   CDS_pept        complement(287509..287901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39991"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q321"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39991.1"
FT                   /translation="MKLLTGTLLAGAACLSVLAGCSSPEAKDDSSKSDSSLAKFTGSWQ
FT                   NEEAGTELTVKDSGKVTLTGWGEESTLTSELTADKTDGVAAFDVDGSDKTPFHFVVEFR
FT                   NSESDQIYLDDTNETDVPPLEMTRQD"
FT   sig_peptide     complement(287821..287901)
FT                   /locus_tag="Snas_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 27"
FT   gene            complement(288074..288772)
FT                   /locus_tag="Snas_0274"
FT   CDS_pept        complement(288074..288772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0274"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   swp:swp_1383 hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39992"
FT                   /db_xref="GOA:D3Q322"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q322"
FT                   /inference="protein motif:PFAM:PF00353"
FT                   /protein_id="ADD39992.1"
FT                   /translation="MFSAHTLRSGLRIAVRAAVIATVAAVGVLAFGYGAYASSGQAGTF
FT                   QCTISGTAAADVLNGTNGNDVLCGFGGNDVINGKGGNDIVYAGNGNDVVNAGNGNDLVY
FT                   GGNGDDRLFGGNGNDRLFGQNGNDRLYGGNGNDTLSGGNGNDKAYGGNHADKISGGNGN
FT                   DGLYGQNGNDVVRGDAGRDVVVAGGGKNQLFGGAGRDSLFAKNGFPDFLNGGPAKDSCS
FT                   RDKIDTVVSC"
FT   sig_peptide     complement(288644..288772)
FT                   /locus_tag="Snas_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.593 at
FT                   residue 43"
FT   gene            complement(289132..289752)
FT                   /locus_tag="Snas_0275"
FT   CDS_pept        complement(289132..289752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0275"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   sil:SPO3673 type I secretion target repeat- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39993"
FT                   /db_xref="GOA:D3Q323"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q323"
FT                   /inference="protein motif:PFAM:PF00353"
FT                   /protein_id="ADD39993.1"
FT                   /translation="MFTPPTLRSSLRIVARASLVATLAAVGVAASAYGAYASSPEPESL
FT                   QCTLSGTASSDTLFGTNGDDVLCAFGGNDVIYGAGGNDIILAGAGDDQVFGQGGMDTIY
FT                   GEGGYDVIYGGNGADNVYSGAQADQIYGNNGADTLYGQGGNDVIRGQAGDDYLVAGNGN
FT                   NWLYGGNGFDTLHAANGYIDHVDGGAAYDTCYFDYFDSVVNCE"
FT   sig_peptide     complement(289648..289752)
FT                   /locus_tag="Snas_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.414 at
FT                   residue 35"
FT   misc_binding    290072..290273
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 83.58"
FT   gene            290313..290843
FT                   /locus_tag="Snas_0276"
FT   CDS_pept        290313..290843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0276"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   afw:Anae109_1188 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39994"
FT                   /db_xref="GOA:D3Q324"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q324"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADD39994.1"
FT                   /translation="MSTIEAALTAGTGQAPSDSRLTLSSIMSPQDTNLMGTVHGGVILK
FT                   LIDSVAGVVAARHSQGPAVTASMDETVFLAPVRVGDVAHVDARITWAGRTSMEVAVTVT
FT                   ADRWNETVPATTVATAHLVMVAVDDNGNPRPVPPVVPVSQEDRLAWREAEIRRTHRLAL
FT                   RASLSSKKDDNAA"
FT   gene            290833..291459
FT                   /locus_tag="Snas_0277"
FT   CDS_pept        290833..291459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0277"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ppd:Ppro_1992 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39995"
FT                   /db_xref="GOA:D3Q325"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q325"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADD39995.1"
FT                   /translation="MLPDAATYLSYLAAIALLTITPGPDMMFVIANAGRWGTRAGIVAA
FT                   LGITVGEALHMTVAALGLASVFAANPVLYQVIRYAGAAYLLYLGVQVLRHRSRASEESA
FT                   ADHSSPRAAFTRGMVTNVLNPKMALFSLAFLPQFIDPAQGAVTGQLLVLGATFVLLQFI
FT                   VDVGLSVAAGQLGDRFLRRPAVARGVNTVTGAVFIGLGVRLAAFG"
FT   gene            complement(291464..292135)
FT                   /locus_tag="Snas_0278"
FT   CDS_pept        complement(291464..292135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: MOT37; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39996"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q326"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39996.1"
FT                   /translation="MDKQLARAIRVAVRHTQTPTEDELRTIEKLHVLRARDLSGLESCT
FT                   SMRHLVLSGCDPVSLQSLTGMRDLEVATVEYCGLRRLDGVEELSDSFLYLKAPNNSIED
FT                   LSPLLDCPGLNRLEVQGNPLSEHSYLEILPRLRARGVQVFASGMREWRLTRRLHEIGLP
FT                   FSYYHSDEGHQLCRPGLSYTDFPATGHPIIDPDDLERLIDAEPTRIHELFAQEELMFAL
FT                   P"
FT   gene            complement(292232..292879)
FT                   /locus_tag="Snas_0279"
FT   CDS_pept        complement(292232..292879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: RGD1561983, RGD1561983_predicted; similar to
FT                   Muc5b protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39997"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q327"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39997.1"
FT                   /translation="MKPSTVLNRSIRLLACAATIAALALVAPATAQAAPTAALPTPGQK
FT                   FDLTVTSEGIGLTIDGKAITSEPLRGTLTVTIDANPSDPKKLSVEAKPSDLTLSTKAPQ
FT                   TTSITVNQDNAVVDEKSILRVVKPTPATYEHIMVLDLKLTVSMPAAPGKAEEIMQLATK
FT                   DPAQLRATDVKQFPPVNQQYSLAGPVELISQDGSSTVPMTLDGFDVIVNQSA"
FT   sig_peptide     complement(292778..292879)
FT                   /locus_tag="Snas_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 34"
FT   gene            complement(292962..294164)
FT                   /locus_tag="Snas_0280"
FT   CDS_pept        complement(292962..294164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0280"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pae:PA1626 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39998"
FT                   /db_xref="GOA:D3Q328"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q328"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD39998.1"
FT                   /translation="MSRVHDRPLAPPGPALLGFAALAMFVAALNLRPALAAVSPLVDAI
FT                   RSDLGLSATGVALLTTIPTLAMGLFAPFAASVARRFGPRHGVALGLAVIAVGTAARGLG
FT                   GAAWLQLSCAAAVGAGIAIAQTLLPAIVKARFAARPGLATGVYTAGLGLGGAIAAGVSA
FT                   PLAATIGSWHGALASWSVLAVVGIAVWLTARPALGPDPATTTAGPATRGLPWRDRTAWR
FT                   VTVLAAANSALYYCELAWVAALLHDDADRTAVDAGVLLTVLIAIQVVAMLAVPAILGEA
FT                   RDIRFGLTLTTAATALGFAGLALAPATLTWLWIVVLGIGHGGLFTLVLTVPVVISRDAA
FT                   EAGRISAMAFFVGYACAALAPMLVGGLRDALGDFQLAFALLSGLAVATLLPISKLRPTG
FT                   G"
FT   sig_peptide     complement(294054..294164)
FT                   /locus_tag="Snas_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.973 at
FT                   residue 37"
FT   gene            294257..294733
FT                   /locus_tag="Snas_0281"
FT   CDS_pept        294257..294733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0281"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   bpt:Bpet2894 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39999"
FT                   /db_xref="GOA:D3Q329"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q329"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADD39999.1"
FT                   /translation="MKMTSGVEWALHACVTLSQAADPVPAARLAELHGTPPAYLAKQLQ
FT                   SLARAGIVTSTAGQVGGYTLTRPATEVTVLEVVQAVDGTEPAYRCTEIRQRGPLAVPAE
FT                   KCERSCAIARAMAEAQEAWSRALSRITIADLARGIDADSDGTAMADVRGWLAAV"
FT   gene            complement(294626..295891)
FT                   /locus_tag="Snas_0282"
FT   CDS_pept        complement(294626..295891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0282"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cco:CCC13826_0670 ProP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40000"
FT                   /db_xref="GOA:D3Q330"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q330"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40000.1"
FT                   /translation="MGVVSVKKSVVLLSLGHACVDVYQGAVAALVPFFIAERAYSHAAV
FT                   AGVVLAASLLSSVAQPLFGAVTDRRALPWLLPVSTIVGGVGIALSGVSGSYAVTLAFVA
FT                   VSGIGVAAYHPESARVARIASRGSHTAMSWFSLGGNVGFALAPLLVTAVVATGGLRFTP
FT                   LLVLPALAGSVLCLPVLRGLAASAANGSVAAQAKRPDDRGSFVKLSIAVVGRSITFVGL
FT                   STFIAVYAQERVGGGVLAGTIALFTLYVGGAVGTILGGRLANRWDRVTVVRYAYLVAVV
FT                   AVAGVVFVPGPAFYLFVAATSAGLYVPFSLQVTLGQDYLPSRVGTASGITLGLTITIGG
FT                   LASPLIGGLADATSLRVALAPLIAMPVLSWLMFRTLPEPAVMGADGSDGRQPAPDVGHR
FT                   GAVAVGVDAPGQVGDGDARQRS"
FT   gene            295938..296678
FT                   /locus_tag="Snas_0283"
FT   CDS_pept        295938..296678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0283"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; Cupin 2 conserved barrel domain protein; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: reh:H16_B1996 transcriptional regulator, AraC-
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40001"
FT                   /db_xref="GOA:D3Q331"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q331"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADD40001.1"
FT                   /translation="MPKIRHQPTAPTLARQLAPGDVIDAHRHDDHQIVYAARGVLAITT
FT                   DKGSWIAPATRAIWVPAGTTHAHRAHGDLELHLVGLPARDNPLDLAEPTVLAIGPLTRE
FT                   LILAYTRSPADDSPERARLRAVLLDQLRATPQQPIHLPTPTDPRLSELCDRLRADPADN
FT                   STLTVLGRRVGASERTLSRLFKTELGMTFPQWRTQLRLYHALVLLADNASVTAVAHTCG
FT                   WSSTSAFIDAFRRAFGHTPGAHQR"
FT   gene            296727..297497
FT                   /locus_tag="Snas_0284"
FT   CDS_pept        296727..297497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0284"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; KEGG:
FT                   mxa:MXAN_6550 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40002"
FT                   /db_xref="GOA:D3Q332"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q332"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADD40002.1"
FT                   /translation="MSPKWKLLAVAVTATIAVGGGTLAYADSRASWEEQFGGEAGSPPD
FT                   ASRWVQQTGCEWGNGKEEQCYTDGGRNAELDGEGNLVITAKAEEFNDRHFTSARLRATT
FT                   INDPGTVEVRAKFSGYVAGAWPAIWTTDEANWPTNGELDLMEIGGGGDWKPQYHSHFGT
FT                   VDDHQQYGDFYPDDSDDPTWTDWHTYRVDYTNGADGEASFYIDDKLAATVPYQVPDDAP
FT                   AYVILNIAVGGWAGTPDPRLHNTMTVDYVKVTEA"
FT   sig_peptide     296727..296807
FT                   /locus_tag="Snas_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.870 at
FT                   residue 27"
FT   gene            297517..298641
FT                   /locus_tag="Snas_0285"
FT   CDS_pept        297517..298641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0285"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG:
FT                   sit:TM1040_2712 peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40003"
FT                   /db_xref="GOA:D3Q333"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q333"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADD40003.1"
FT                   /translation="MTIFTKVELTDRLAKARSATEASGIDAVLISPGADLHYLTGYDAK
FT                   PLERLTCLVLRPGAEPLLVVPVLERAAAQASPAGDLGLELVSWHETEDPYALVAALLPP
FT                   GTRRIAYDNHMWAEKLLAFRSALPGTEQELAGEILRELRMRKSGNEIEALRRAGAAIDR
FT                   VHARMAEWLRPGRTEREVGADIAEAIAAEGHATVDFVIVGSGPNGASPHHDLSDRVIQP
FT                   GDPVVVDIGGTTADGYCSDSTRTYVAGGEAPEEFAAYYEVLLRAQIAACEHVRPGVTAA
FT                   SVDAAARDVIAAAGYGERFIHRTGHGIGMQGHEDPYIVAGNERVLEPGMAFSIEPGIYV
FT                   DGAHGARIEDIVVVTDDGVERLNLTPRELVVIDA"
FT   gene            complement(298649..299131)
FT                   /locus_tag="Snas_0286"
FT   CDS_pept        complement(298649..299131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0286"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: aha:AHA_4067
FT                   DNA-binding transcriptional regulator AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40004"
FT                   /db_xref="GOA:D3Q334"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q334"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADD40004.1"
FT                   /translation="MPSDSRIDRLDAQLIALLTAEPRIGVLECARRLSVARGTVQARLD
FT                   KLSARGIIRGFGPEIHPTALGYTVMAFVTLEIRQLRGHDTVTRHLESIPEVLEVHTVTG
FT                   SGDLMCRVVSRTNADLQRVIDTIVSSDGVVRASTVIALDEQIGYRTLPLVEAAASG"
FT   gene            299266..300444
FT                   /locus_tag="Snas_0287"
FT   CDS_pept        299266..300444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0287"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: 4-hydroxyphenylpyruvate dioxygenase ; K00457
FT                   4-hydroxyphenylpyruvate dioxygenase; TIGRFAM:
FT                   4-hydroxyphenylpyruvate dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40005"
FT                   /db_xref="GOA:D3Q335"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q335"
FT                   /inference="protein motif:TFAM:TIGR01263"
FT                   /protein_id="ADD40005.1"
FT                   /translation="MVDTINEAQLVGAVEHDINADDFPIKGWDHIRFYVGNAKQAAHYY
FT                   STAFGMTLEAYRGPEQGFREHAEYMLRSGGVRFVLAGGITADSAATKHYAAHGDGVIEV
FT                   ALEVPNVDDNYAFAIKQGAVGVEEPHDLTDEYGTVRVAAIATYGETRHVLVDRSRYNGP
FT                   FLPGYVAAKPIVDRTAAIKDGREPKRFFQALDHVVGNVEEGKMLDWVTFYQKVMGFTNI
FT                   VEFVDDDIATEYSALMSKVVANGTRKVKFPINEPAEGRKKSQIDEYLEFYGGPGVQHMA
FT                   LATNDILASVDAMRANGVEFLDAPDSYYDDPEMRERIGTVRVPIEELKKRSILVDRDED
FT                   GYLLQIFTKPQQDRPSVFYELIERHGSLSFGKGNFKALFEAIEKEQAKRGNL"
FT   gene            300486..301316
FT                   /locus_tag="Snas_0288"
FT   CDS_pept        300486..301316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0288"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   sat:SYN_02280 RDD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40006"
FT                   /db_xref="GOA:D3Q336"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q336"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ADD40006.1"
FT                   /translation="MTDIEPGWYRDPAAPETQRYWDGEQWVGKPVDINATPPTTPEPLP
FT                   EPVVEPEPVRREAAGPDPAMAAGRGSLGDTRMPLFAIDQKKVDRLLEGKTLAHPGQRLV
FT                   ARIIDIIVVLLLNAVVNGWFIYQYFDALMPTVRRIMADPNADYGTELPTRAYQLQYTIL
FT                   FIAILVWFAYEIPSTVKSGQTLGKRIMGIKAVPIYAERMRWGLAISRWSLMMLSLACCP
FT                   IGFVAALIDGLWCLYDKPFRQCLHDKNPGTMVIQVPHDELRPKGATHVPPTDPR"
FT   gene            301291..302373
FT                   /locus_tag="Snas_0289"
FT   CDS_pept        301291..302373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0289"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: scl:sce8915
FT                   histidinol-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40007"
FT                   /db_xref="GOA:D3Q337"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q337"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADD40007.1"
FT                   /translation="MSRPLTRADLDALPSYVPGRNPADLARELGLTEAIKLASNEVPFG
FT                   LLPGVAEAVAEAAAQGHRYPDMGVLALREALAERFKVDVDRVATGCGSVALFEHVVKAA
FT                   ATRGDEVLYSWRSFEAYPIVVAGVGATSVRVPNTPGHGHDLEAMAAAITPKTRIVVVCN
FT                   PNNPTGTSVGRAAMDAFVDAVPSDVLIVVDEAYREFVTDPDVPDALEEYGDRPNVVVLR
FT                   TFSKAWGLAGLRAGYLVAAPEVADAVRKVVTPFSTNACVQAAALAALEADVEMRRRAAI
FT                   MISERDRLTTALRALVPQIPDSQSNFLWLPIGEQTVPFAKHCESRGVIVRPFAGEGVRA
FT                   SFGTPEQNDRFVAVASEFFA"
FT   gene            302370..302990
FT                   /locus_tag="Snas_0290"
FT   CDS_pept        302370..302990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40008"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q338"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40008.1"
FT                   /translation="MTARAVLAVAALALLGGCGDKAEPKSTAESGWEITVYYTAVESFH
FT                   DGETVEVTGCSELDCENGDDPLGEYPRDFVKAVKDEGTGRITSGDHEGEYLNWSHGVGY
FT                   WLDEEARNSHGDALRPYVSAATDADVLPKGTRVEIVACGDADVPDKVCDKLMKPTWTID
FT                   DEFTPGLGGEKHLDVYLGEEDREDFTESQWYTTLENAELRIHS"
FT   sig_peptide     302370..302438
FT                   /locus_tag="Snas_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.650 at
FT                   residue 23"
FT   gene            303057..304148
FT                   /locus_tag="Snas_0291"
FT   CDS_pept        303057..304148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0291"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mxa:MXAN_0212 aminotransferase, class I and II family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40009"
FT                   /db_xref="GOA:D3Q339"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q339"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADD40009.1"
FT                   /translation="MAPTDVISFSRGAPSLDIVDIEGLKAAAAKAFETDPARIAGYGTA
FT                   VGYPPLREWIAAKHNVPVEQVIVTNGSLQADAFLFDALVTPDSPVIVERPTYDRTLLGL
FT                   RNRRGQLHPVHVQPDGLDVAELAEILKGGVRPTLAHVIPNFQNPAGVTLSGPKRTELLR
FT                   LANEYDFVIFEDDPYLDIRFRGENLPTMLELDDNDKVVFASSFSKTICPGLRTGYLVGP
FT                   TDLIKKITTMATNTYVAPNMLAQATVYQFAASGALDASIANVKKALAERADALGAALTK
FT                   HLPQATFVLPDGGYFLWVDFGDDVDVDKLAPAAEARGVQVVKGTGFVVDGGQHSLRLAY
FT                   SAVSTDRIDEGVRRLAAAVEDCR"
FT   gene            304578..305153
FT                   /locus_tag="Snas_0292"
FT   CDS_pept        304578..305153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40010"
FT                   /db_xref="GOA:D3Q340"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q340"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40010.1"
FT                   /translation="MTNPTIATPTRPWWQWLLRRWPTALALLLSALTLGGSGTDEGVRS
FT                   FAHVLGLLPLLYLVVAKLEKRRATWPLLVTGLAAVIGLRVLDLIPLAAVWWAIALVVLV
FT                   WGAFDGHLAKSGTLRVQALGMLIFGGLGLLGLIVDPELARYLIAAGWFFHGVWDFVHLK
FT                   LDRVVARSFAEWCGVVDIVVAAELLLYL"
FT   sig_peptide     304578..304697
FT                   /locus_tag="Snas_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.460 at
FT                   residue 40"
FT   gene            complement(305259..305651)
FT                   /locus_tag="Snas_0293"
FT   CDS_pept        complement(305259..305651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40011"
FT                   /db_xref="GOA:D3Q341"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q341"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40011.1"
FT                   /translation="MGMFRRKPKHRDQIRGELVEGIGHLRTATAHAAAGAKEKMGPAMD
FT                   RTLVAVGLRKKSRRRWPWIAGTVVAVTAAAGTATVIMWRRSNAKAMDEDLFADDTESAR
FT                   ADDLAYEPPTMEKEERARTMAGATAD"
FT   gene            305769..306281
FT                   /locus_tag="Snas_0294"
FT   CDS_pept        305769..306281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0294"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mxa:MXAN_1176 peptidylprolyl
FT                   cis-trans isomerase, cyclophilin-type"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40012"
FT                   /db_xref="GOA:D3Q342"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q342"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADD40012.1"
FT                   /translation="MTTATLHTNVGDIVIQLFDNHAPKTVANFVGLAEGTQEYTDPTTG
FT                   SSGSGPYYDGTVFHRVIDGFMIQGGDPTGTGRGGPGYQFDDEIHPDLAYVKPYLLGMAN
FT                   AGKGTNGSQFFITTGPQPHLTGKHTIFGEVSDPASQKIVDTIGSTQTGAGDRPVNEIRI
FT                   ERVTITR"
FT   gene            306281..307234
FT                   /locus_tag="Snas_0295"
FT   CDS_pept        306281..307234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0295"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: sfu:Sfum_0904
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40013"
FT                   /db_xref="GOA:D3Q343"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q343"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADD40013.1"
FT                   /translation="MDDNPNAPVCYRHPQKETYVRCARCDRPICPDCMNQASVGFQCPE
FT                   CVREGQKSVRRPRTALGAVGGSGMVTKTLVGINVAVFLLGLVWAASLGGVGNVLGGDTT
FT                   PLHYLGSLWAPPYSDIVVEGLGIKVSGVAGGAYYRLLTSMFLHYGVIHLLFNMYVLWVI
FT                   GQYLERELGPLRYLGLYLLSGLGGNVLTYLLADTGASITNANSWAWTAGASGCIFGLFG
FT                   AMVLINRKLGRDMSGVYVILGLNLVITFLPGTNISWTGHIGGLLTGLALGAALAYAPRA
FT                   NRAMIQTVAFVGVLVVFVGLIAWRTSTLNTLLSSIT"
FT   gene            307309..308223
FT                   /locus_tag="Snas_0296"
FT   CDS_pept        307309..308223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0296"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: gme:Gmet_1468
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40014"
FT                   /db_xref="GOA:D3Q344"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q344"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD40014.1"
FT                   /translation="MTNNSTSSSRLAPPPVGGFAEIDGRRLFVHQSGDGGPAVVFLPGA
FT                   SAIGFDYYLPQQEAAKFATAVIYDRGGSGYSDPMPLPRTAEAVATELRDLLHAQNIPGP
FT                   YVLVAHSLGGAYAQRFAQLYPTEVAGLVWVDAFVSNWDDFVPASNSLAASEEMAPTREQ
FT                   LEQALPVMREYVTAMFADFPTDVREALVDYHVSDVWVTVGIAERTKLDVLADEINAGPN
FT                   LPDVPVIALTPVAVDPNQAALMSEEELRVMHDGKIKMHRALVDSVSNGEQRILEDADHS
FT                   NITFKRVDAVVQAISDVIDRATR"
FT   gene            complement(308260..310518)
FT                   /locus_tag="Snas_0297"
FT   CDS_pept        complement(308260..310518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0297"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   monooxygenase FAD-binding; KEGG: rme:Rmet_2202
FT                   salicylyl-CoA 5-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40015"
FT                   /db_xref="GOA:D3Q345"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q345"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADD40015.1"
FT                   /translation="MRIAVIGGGPGGLFFAALARQRDPQCHVDVFERNESGTTYGFGVV
FT                   FSDETLDNFAEADPRIHADMASRFVTWQDIDTYYTPDVGGPTTKLTSTGHAFAAMSRVE
FT                   LLNLLSKRCLDVGVNVHYGDEAPPLAALRDSYDLVVGADGVRSQTRNALAEHFRPTLDV
FT                   RHNRYIWLGTSKVFDSFTFDVRATPHGVMQLHAYPYGDGSTAIVEMREDVWRRANPTAA
FT                   DCTEVFADRLDGHSLHGKGTDWIDFATVRCSSWSVGNVVLLGDAAHTAHFSIGSGTKLA
FT                   MEDAAALADAVTSAPTLAEALASFETTRRPVVESTQRAAQASLEWFEDLQQYLVQHPTQ
FT                   FGFNLLTRSRRITYDNLRLRDPRYIAELDAWFAADEVARGAMPEPATPRPPMFQPFRLG
FT                   PLTLKNRVIVSPMDMYSSDDGVPGDFHLVHLGSKALGGAGLVMTEMVCVSESGRITPGC
FT                   AGLYDDEQQRAWKRIVEFVHANSDARIGVQLGHSGRKGSTKLMWDGIDEPLPEGNWPLV
FT                   AASPLPYRPDSQTPGELTREQLAEIRDQFADSARRAREAGFDLLELHCAHGYLLSGFIS
FT                   PLTNRRTDEYGGDLANRLRFPLEVLAAIREVWDGALTVRISATDWCEDGITGADSVEIA
FT                   RAFAAAGVDGIDVSTGQVVVEEKPAYGRSYQTPYADRIRHALRAEFPRLAVIAVGAISS
FT                   ADDANSIILAGRADLCALGRVHLYDPHWTLHAAAEQEFPVTWPKQFRAGARKPPTGRG"
FT   sig_peptide     complement(310459..310518)
FT                   /locus_tag="Snas_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.641 at
FT                   residue 20"
FT   gene            310554..311291
FT                   /locus_tag="Snas_0298"
FT   CDS_pept        310554..311291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0298"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   azc:AZC_1490 short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40016"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q346"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD40016.1"
FT                   /translation="MTTVNTTAKPFDGKTVVVTGGAGGIGHAVSEAFTDAGAHVVTVDL
FT                   TGADHDLDVTDAAALTRAMADVNARHGGPHVLVALAGGSLGIPRDLDAFTDEQFNKVLD
FT                   VNVTGTLNACRAALPYLKQAKGSIVTCTSIGARQPSPVTGVAYAAAKAAIGGLTRRLAA
FT                   EVGPDGVRVNALAPGLVLTPRLSGMFDGLSQSDRDSVTEAIALRRMPELREIVDPILFL
FT                   AGEGAGYITGVTLDVNGGRYMPP"
FT   gene            complement(311390..311992)
FT                   /locus_tag="Snas_0299"
FT   CDS_pept        complement(311390..311992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0299"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="KEGG: mrd:Mrad2831_2146 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40017"
FT                   /db_xref="GOA:D3Q347"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q347"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_2146"
FT                   /protein_id="ADD40017.1"
FT                   /translation="MNTPVAAHRHAAVILAGGAATRMGGVPKPELTLGGRSLVRRVLDA
FT                   VPQASPRVVVGEVVARDFIVTAEDKPGSGPAYALAAGLAYVPDGVPLVVALAGDMPFLT
FT                   PELTAALCEAVKGDSDGAVLVDHNGRRQWLCGVWRRQVLAERLAGAAPGSGVRQLLGGA
FT                   RIVDVSWLDDDLPPWFDCDTPAALAYARQLEREFRRH"
FT   gene            312051..312857
FT                   /locus_tag="Snas_0300"
FT   CDS_pept        312051..312857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0300"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: ade:Adeh_0826 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40018"
FT                   /db_xref="GOA:D3Q348"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q348"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ADD40018.1"
FT                   /translation="MGRASDRRKILRIDTHGRRHRPDTLAAEEPLEIQLNGSPFTVTMR
FT                   TPGDDVDLALGFLHAEGVIADPKDTAGAKHCTDSDLNVLDVTLRVPAPSPARGFTVSSA
FT                   CGVCGSASLDALQAHYAEKLRYDLAADPIRVTPDLLQSLPDRLRAAQRIFDRTGGLHAA
FT                   ALFTSDGELICAREDVGRHNAVDKVIGWALREDRLPLTSHLLAVSGRAGSEIVHKAAMA
FT                   GIPVLTAVSAPSTLAVDLARGWNLTLAGFVRDGQCNVYSGEQRITD"
FT   gene            complement(313041..313772)
FT                   /locus_tag="Snas_0301"
FT   CDS_pept        complement(313041..313772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0301"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: rle:RL3140 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40019"
FT                   /db_xref="GOA:D3Q349"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q349"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADD40019.1"
FT                   /translation="MAAAYKHRPPYPTEVFDTLQELIVDEPRAVLDIGAGEGAIARPLA
FT                   TRVDRIDAVDVSAAMIAAGRQRPGGQAANIRWIHSDVESATLDGPYALVTAGASLHWMR
FT                   WPDTMNRLVPLLSPNAKLAIVDHGPRDLPWQDELLAIIKRHSRNPDYDPSFSIVDFLVG
FT                   QGLLDDIDKAEFGPTPFWQPVADYVEQFHSTATLAREHMSPREVREFDEAVEAAVSPWI
FT                   TDGRVKLPIVAKVVWGRPQAG"
FT   gene            complement(314106..315137)
FT                   /locus_tag="Snas_0302"
FT   CDS_pept        complement(314106..315137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40020"
FT                   /db_xref="InterPro:IPR025447"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q350"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40020.1"
FT                   /translation="MTPSCEPPTEPDAADISLSTPMDLLSAIPYLVGYIPADSLVLVGL
FT                   DAKQITATLRVDLPRTDQPVTKLRISPDVLRRNKVEAAVIAGYGPPERVTRCVDHLRRM
FT                   LAAQNIELVDALRVTDGTFWSYVCQEPACCPPEGRPVNPGDSPVDAAFTYAGMRALPHR
FT                   QAVTAQLEPVKGPTRAAVTRATNQVRKLLDDTDAMFSARETLLDEARTILAKATEAGAP
FT                   LPEIDQTVRLAAALTDAKLQTEAMTLVDSHSPHKMVDLWLWVTRHVAPAFRARPAALLG
FT                   FAAWRCGNGVLATEAVRRSLTDDPHCPLAMVLGRLLDEGVPPSSIPKITGELLLPLPCS
FT                   PAG"
FT   gene            complement(315510..316430)
FT                   /locus_tag="Snas_0303"
FT   CDS_pept        complement(315510..316430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0303"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: lhk:LHK_00425 TrmB; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40021"
FT                   /db_xref="GOA:D3Q351"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q351"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ADD40021.1"
FT                   /translation="MSTIEPSSSIRSFYRRRGKVRPSKLDAYDRLYPVLGVDRQQPPPL
FT                   PEIFGRTAPVVLEIGSGMGDATVAMAAADPDRDYLAVEVHVPGIANLMMRAEEHELTNL
FT                   RVFEGDAVSLARSCLPADTLDAIHVFFPDPWPKARHHKRRLISPENVALLRSRLRRGGA
FT                   FHLATDWEHYAESMLEVLDADPGLSNAHDGFAPRPDWRPVTKFERRGIAEGRQIFDLEF
FT                   VRPEQPLSLGILAHGPQTLVPSRCRRRAARDLRVLCDHSQLGGDRRHGQARDDRTGARH
FT                   RRQLLQRHGQGLQLLRGFVDAVGRQ"
FT   gene            316472..317761
FT                   /locus_tag="Snas_0304"
FT   CDS_pept        316472..317761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0304"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   aha:AHA_1897 alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40022"
FT                   /db_xref="GOA:D3Q352"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q352"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ADD40022.1"
FT                   /translation="MTFDEAARLRVDPGAGRVYEHGWQSWSPTREYPVAGTSYRQRTEY
FT                   VHTGHLRPEKPVPTDGFQAEGLLVATDADGAAHRFATGSATDIPSIRARLDGDRLVVTA
FT                   DGTVEHTVHADVDTALTSFGDAFAARAGVSVRPAPTVWCSWYHYFTDVTEADIDENLDA
FT                   IGEHELPVDVIQIDDGWQKAVGDWLDLSDRFTSLSRIVKRINDSGRRAGVWVAPFLALA
FT                   TSDLVRDHPEWIIDGAAGHNWGTETRGVDPRRARTYLTDVFTMLREAGFDYFKLDFLYA
FT                   GAIDSVEAYREGLAEIRRVVGPESYVLGCGAPILPSVGLVDAMRVGPDIAVTYEPGNGD
FT                   PCHPSQRGAAANTIARAWQHGRFWANDPDCLIARPEVERREEWADTVERYGGLVSVSDR
FT                   IAALDEWGMDTTRRLLSNPPGPGPLAHGRG"
FT   gene            complement(317746..318126)
FT                   /locus_tag="Snas_0305"
FT   CDS_pept        complement(317746..318126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40023"
FT                   /db_xref="GOA:D3Q353"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q353"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40023.1"
FT                   /translation="MSSFTASQSRLLGSIVERVVRATGGQSSTVDGLRVCRSGRLRLYG
FT                   KGGTQYGDVFVTGRSRGPLSDGLIAHEKHHRDAQWRRYGLVFGVMYLAAHVADVWIGRK
FT                   PLNRYELAAEEASDWGGGYPRP"
FT   gene            318176..318865
FT                   /locus_tag="Snas_0306"
FT   CDS_pept        318176..318865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0306"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: scl:sce2352
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40024"
FT                   /db_xref="GOA:D3Q354"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q354"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADD40024.1"
FT                   /translation="MPVTHAFFSVTVDLVVLTVQRETLSVLLIKRAFDPFKDSLALPGG
FT                   FVTEGEDLMAAASRELAEETGLSTAEGHLEQLATYGTPDRDPRGRVVTVAYLALLPDLP
FT                   APRAGSDAAAAAWHPVPSLLDKEDVLAFDHHRILCDGVERARAKLEYSSLAAEFCPPEF
FT                   TIAQLRRIYEAVWGATVDPRNFHRKVTGTPGFVVATDNYTDGDRGRPARLYRRGPASSL
FT                   HPPLLRR"
FT   gene            complement(319226..320470)
FT                   /locus_tag="Snas_0307"
FT   CDS_pept        complement(319226..320470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0307"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   scl:sce1366 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40025"
FT                   /db_xref="GOA:D3Q355"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q355"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40025.1"
FT                   /translation="MSVITRGTSVGRIGLLWCAYEFLNDFILLYALETLLFVDTGLSTG
FT                   EITSLLIAWSLTSVLLEVPSGVLADVLPRRLLLTIAPLLRSVGYGLWVAFPSYPAFLAG
FT                   FVLWGVSGALQTGATEALVYDNLKHHRATDRYATYAGRARASQTVAVLIAMLLTPTVYA
FT                   LGGYAALGIGSVAVCALAAVVALAMPEHREERHAEFDGLRAYGRTLLAGLREVRGSRVV
FT                   MFSVAMVAIVPAIWGSLEEFAALLAVEFGAGKPLVPYLVAALTGGITVGALLAGRAERL
FT                   SWRRLAAGLGLGAAVTVTAGLYGGIAGFLLLLPAFAMFNAAGVVAEVRLQNAITGPARA
FT                   TVTSVAGLSLEASSIVIYAAYALAASQVGHGGAFALSGVGYGLVALAIIVVVSVSARRP
FT                   PRRQVKAFDQPGLGA"
FT   gene            complement(320629..320922)
FT                   /locus_tag="Snas_0308"
FT   CDS_pept        complement(320629..320922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0308"
FT                   /product="transcriptional regulator, MarR/EmrR family
FT                   protein"
FT                   /note="KEGG: ccs:CCNA_03498 transcriptional regulator,
FT                   MarR/EmrR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40026"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q356"
FT                   /inference="similar to AA sequence:KEGG:CCNA_03498"
FT                   /protein_id="ADD40026.1"
FT                   /translation="MPQPGFDALIHAPTRLSIMAFLIPLDWAEFRLVRDEVGLSDSALS
FT                   KQITTLEEAGYLEVKKEFQGKRPRTSVRVTDAGRTAFEGHLAALRGIVGDRL"
FT   gene            complement(320978..321226)
FT                   /locus_tag="Snas_0309"
FT   CDS_pept        complement(320978..321226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40027"
FT                   /db_xref="GOA:D3Q357"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q357"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40027.1"
FT                   /translation="MPGPTYDTPWPYFYGLGAALLVFSAVYLLDDWIETHLGFVASVLA
FT                   VAKRQTSQPAEPFKVLASRRWCSWACSSPWSGGRSSC"
FT   gene            321264..321383
FT                   /locus_tag="Snas_0310"
FT   CDS_pept        321264..321383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40028"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q358"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40028.1"
FT                   /translation="MKKLTRILGGLAIGAAALTTSLAAASPAQAADTEAKLSG"
FT   sig_peptide     321264..321356
FT                   /locus_tag="Snas_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            321423..321626
FT                   /locus_tag="Snas_0311"
FT   CDS_pept        321423..321626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40029"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q359"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40029.1"
FT                   /translation="MGHNGDNAVWISVKSVGVSSWEQVDAETGVVAQSGTGNVERTVTG
FT                   LYSSYTLTVYCGPSYYCSADVE"
FT   gene            complement(321672..322256)
FT                   /locus_tag="Snas_0312"
FT   CDS_pept        complement(321672..322256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5837 Ig-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40030"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q360"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40030.1"
FT                   /translation="MPIPTIALTTVAISALGVLCAQPAAAMTTGNPVISELAPSGPGGS
FT                   RDEYLELHNDGDNPVSIGGWRLYACDSASSPSLMTTFPAGTILAARGELGQYLLLAGDE
FT                   YLGRSEHPGPQSPDIWYSFDTSASDGWMLTDRYNRRVDGIGTGTGEGCDDNPLVPRCRW
FT                   GDAESATRDFRARADADGYVCGPASPTNSMG"
FT   sig_peptide     complement(322176..322256)
FT                   /locus_tag="Snas_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 27"
FT   gene            322501..323115
FT                   /locus_tag="Snas_0313"
FT   CDS_pept        322501..323115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC0447 nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40031"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q361"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40031.1"
FT                   /translation="MRRSLATIGALGLIASVFGFGGSAAAADPAKDELKVSPNVVISEV
FT                   KPQGSDGAEDEFIELSNSSLEESVDISGWRLVTCSSTGAEVTAFTFPAGTFLEPQGENE
FT                   SHYLVAGPDYSGAVSPDDQVELGIERTGGVMLRSQYNARIDGLGYSSTAGACVEGPAAA
FT                   RLPQTNTTDLSSQRNQEYKDTDQNKTDFGQILQSPQNQESV"
FT   sig_peptide     322501..322581
FT                   /locus_tag="Snas_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 27"
FT   gene            323363..326881
FT                   /locus_tag="Snas_0314"
FT   CDS_pept        323363..326881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0314"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: shn:Shewana3_1740 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40032"
FT                   /db_xref="GOA:D3Q362"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q362"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADD40032.1"
FT                   /translation="MTLVLAGALGLASPLPAYAAGSAANDGPAALGGKATAVTLLTGDT
FT                   VSFRDFGNGNPQYSVDAASRSDGREVGFHAEGDVDAFYVYPSDVMPYVSKGVIDRELFN
FT                   VTALSEQDLDDKSSDELPLILGYDHKGHRSDRTLTRAADSLPGTTDSLGLSTIQGAGTI
FT                   LDRDKAAKFWRSLTRDTKGAKLSEGVKSIELDQRVSVDLAESVPQIGAPDAWRDGHTGD
FT                   GVTVAVLDTGVDATHPDLKDQIAKQANFTDDESATDGHGHGTHVASTIAGTGAASDGKY
FT                   TGVAPKAKLLSGKVLNTEGDGTASWIIAGMEWAVENHADVVGMSLGGGPTDGTDPLAQA
FT                   VDELSASSDTLFVIAAGNSGPSRGTVATPGSAASALTVGAVDKSDQMAEFSSRGPRLGD
FT                   YAVKPEITAPGADIVAARATGTTMGEPVNERYTATSGTSMATPHVAGAAALLADAREGL
FT                   RGQKLKNALVSTAKDGGSAWYAQGSGRVDVPRSIGQDVYATATADFGDLSKATEPVSRD
FT                   VVYTNDTDAAVTLTLASAVGDQSGTSAEVLKLSDDTVTVPANGTATVTAKVDGTSLGRG
FT                   TYGGVITASAGDVKLRTPIGFGIRSNHKLTVKVNDSTGKPSGFDWIVTLINDSYDPDNP
FT                   NGDSSYVLNTSGGVASAQVPDGTYTAITAVYEGDFGNWVLDRVSLVTKLEFSVDGDTEI
FT                   TLNAADAVETKAKAPKATETRAHWVSMNREYANIPGKFYAMYENSGGAYPIHVSPTAAG
FT                   KLGYLAVMDMWTLAEPKALKPVENNAKLEYSQMPGYSYHLPFYYPNGVPDTLSRTVSDA
FT                   DLSKVYTVSHADNPKAIYERSWVSHPSNGSLVSASKYYVAPGKSVEYMLVDDKLTWTRA
FT                   TTQLYYPSAGKRYYQIQWSWDRFTSGGSGPDEHWFQAPSLRGGAVDLRREFLGNPAGVS
FT                   TAVAFARGGPQNGEFVPGFHTLDNSDGHFMTPNGQSDLWSKWRMWNADTGAEIAADWKY
FT                   VRWPVFAMSSKAANYKLEAVDQPIARTGDLFQTGTKATTEWKFSSAPSQTAVPQGYTCG
FT                   VLSDGGGGTCQFQPVIQLRYDLSLDVDNHAPAGRQHTITVYAGSHSQVAERASVTRIDV
FT                   RYSTDGGKTWRTGSPQNKSVNGQATVSVDHPALGQTDGTVWLKVSAEDEKGNTVVSTVE
FT                   RAYLLK"
FT   sig_peptide     323363..323422
FT                   /locus_tag="Snas_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            326980..327993
FT                   /locus_tag="Snas_0315"
FT   CDS_pept        326980..327993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0315"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: ank:AnaeK_3528 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40033"
FT                   /db_xref="GOA:D3Q363"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q363"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD40033.1"
FT                   /translation="MPSSGADRVFDFDLLNADATTVYTTVVGAQPISREHLARLTGMPA
FT                   ERLRDAVERLTALGLVSQGVGEEERLIAAPPDIALEALLLGEEERLKRARLWARSLSAE
FT                   YYRRVDAADPSHLVEVVVGREAVFERFQQIQQASRHQIRVIDKPPYAAPDAELNIPNER
FT                   ELLRRGVVWRVIYDAAGLESFHRLEGDVRNTMTAGESARVLSDAPIKLMISDDRLGMLP
FT                   LQIAPRTINSIVVVHRSALLEALSALFEQLWCQALPLVHSGEPQGPTTEPTEIERQLLM
FT                   LLTAGLTDERIAERMGVSLRTMQRRLRELLERLGATTRFQAGIRATLQGWIRVPEE"
FT   gene            complement(328083..328355)
FT                   /locus_tag="Snas_0316"
FT   CDS_pept        complement(328083..328355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40034"
FT                   /db_xref="GOA:D3Q364"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q364"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40034.1"
FT                   /translation="MIQEEPIHDLLQRLRVRAGLSERELADVLCTIARQSTITANRVRR
FT                   WECGDRIPGPQWRAALSTAFDIPQSQLTQAAKLTRLMRSLDRLET"
FT   gene            328591..329679
FT                   /locus_tag="Snas_0317"
FT   CDS_pept        328591..329679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0317"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: azo:azo1945 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40035"
FT                   /db_xref="GOA:D3Q365"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q365"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADD40035.1"
FT                   /translation="MSAADYTPSQTGRTRFEVARTMLELPMLSETVPLARYPIFRTTDP
FT                   VMAAERARTLFCPHRITEIDEPRHFHARQQGVNLRSLSISVLSYHCGVRLRTTELRDRY
FT                   LILIPLGGAAEINVDGESLAVYPTLGCVVGACGPVRMGWSANCLMLVVRVERGALEAEL
FT                   RERIGGTGPVPIRFESAMDFASGLRAGWWRQLTHLVEDLDADSALPRHPLCVGGLESGL
FT                   MLGLLVAQPHNHSERLRAAHPAIGEHRIMRAVAILEREPQRPWTTAGLAREAGIGVRAL
FT                   YTDFRRVLDTSPMAYLRNVRLRRVHRELRQPSRNTGVTVAKVATTWGFSHLGEFAAAYR
FT                   RFYGENPSATLRRAEAATRVIV"
FT   gene            complement(329669..329941)
FT                   /locus_tag="Snas_0318"
FT   CDS_pept        complement(329669..329941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0318"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40036"
FT                   /db_xref="GOA:D3Q366"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q366"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40036.1"
FT                   /translation="MAPPGIGRLIRLARQRRGLSQYQVADALASCSGNHCVDRNRVARW
FT                   ERGGRVPDPYWRHWLGLVLELPRGRLDQAARISYAQRDYYGRIRR"
FT   gene            complement(330227..331120)
FT                   /locus_tag="Snas_0319"
FT   CDS_pept        complement(330227..331120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40037"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q367"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40037.1"
FT                   /translation="MSEETWRPLGVDDEDEVAQYDALHDGVPSWMASPYWAWNQDALTI
FT                   YRRYRDGSGRIAMLDTKLAEEMCQALRLSFPNLRTDAIDSRIGKEQLKTAMEYLVKHSA
FT                   PLQIADYLLAHDGHAAHAEMDSLLERSKSVWTIGTRAGRPALVRRVPLGVQVAVDTVIG
FT                   QAGQAGVRLAKAWEELYGLNPDASAAYRLAILAVEDAAVPVVSPNNQSATLGTVLKQIE
FT                   DQKNWKLPMDREHPNAPSREVLVSMMRMLWHGQHDRHGGQPTAPGNVSVDEATIAVSLA
FT                   ASLVHWFEAGLIQRGA"
FT   gene            331839..332681
FT                   /locus_tag="Snas_0320"
FT   CDS_pept        331839..332681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40038"
FT                   /db_xref="GOA:D3Q368"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q368"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40038.1"
FT                   /translation="MFASLLPGLRQLRAPLASGAAWLAVVWLWWGRHLPSRDEATGLLS
FT                   DVYELTEHVGIAAVTAAMAFCAYIVGEVWEAIRGSHPAFRTTQIAEKAVSFPAFSLAPS
FT                   RISKTWSAHGLLGFFTDSKAIFGDLFPNLGVKRPDSLNDEQKNELLEAMWRDINRAVSL
FT                   TLDRDPELMAIYERASAEYWFRRLLAFPLGLAVGSATAASTSTWQMTVVGILVGAALWF
FT                   TLNTQAQQKNGESVIAFLGAMYHEKLPCPALTEAGLRLFGPDEAGQSRTSNTGSVGYL"
FT   gene            complement(333409..334941)
FT                   /locus_tag="Snas_0321"
FT   CDS_pept        complement(333409..334941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40039"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q369"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40039.1"
FT                   /translation="MIGKVAKRSRRVRGLLHYLFGPGDANEHTDPRVVAGYAPAASLQP
FT                   SGNLASGFDVAGLARRLEAAERSLPEGRGPVRNVWHCALSLPPGERLNHETWGRLAERF
FT                   ADEMGLTETPDRPGCRWVAVHHGDSAGGNDHIHVVAILVCDGDPPRPEWLRRDYPRVQR
FT                   ACARLEAEFGLIQATPGRESGRGRPAASRAEYRRAARTGKPLDRDVLRREVRAAAAGAN
FT                   TELEFAARLHAAGLRVRTRSNSEGLVVGYAVALPPAESGQPRWLSGSKLEADLGLPQLR
FT                   SRWPESAPAAAAAWEAPPPIPAVGRVTDPDQAWRQLPEVLEQVTGSLRDEPLLDAELGG
FT                   TARTAADLTALLAARAEPGPRFGPVSRAADQLGRAAAGLPCNRRAAAVGLLHEIARAIH
FT                   RSRIGQHSDSVVLHVAIAVVHLAAAIQALCAARANASGTTDLALNRLRATVGGLHQAAR
FT                   DATPNTPQARSGIASAFARSTNVALGKHGPGADAGRAYRPRPTGPKPTQAEL"
FT   gene            complement(334938..335312)
FT                   /locus_tag="Snas_0322"
FT   CDS_pept        complement(334938..335312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asa:ASA_pAsa105 mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40040"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q370"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40040.1"
FT                   /translation="MRRRKNPEPPDHRNRRVTTRFSAEEYRVLAERAAARGLALSAYIA
FT                   LAALATDPDRTETPRGGRRRDAASRQSRELFRLLRGAATNLNQLTKRAHQYANVPAELG
FT                   EVAAFIGEVAVRVDEQLGAE"
FT   gene            complement(335606..335890)
FT                   /locus_tag="Snas_0323"
FT   CDS_pept        complement(335606..335890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40041"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q371"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40041.1"
FT                   /translation="MERETHQTWLVWGDTEIEAFLDGYWLTPVGVDDPDLLSMIRDRDP
FT                   EWEPPNDDVENLDDLNNSCALVVSTITEKEIVERTAEVRKSLRGYIRIK"
FT   gene            complement(336338..336742)
FT                   /locus_tag="Snas_0324"
FT   CDS_pept        complement(336338..336742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0324"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rpb:RPB_4127 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40042"
FT                   /db_xref="GOA:D3Q372"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q372"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADD40042.1"
FT                   /translation="MAPVAAAIIADNGKVLMVKRRVSEGQLSWQFPAGAIEVGESEQDA
FT                   AVRETREETGVDVRPIKVLGHRVHPITGRWIVYVACDCVEGKAHVADTEEVSEVMWCSR
FT                   KTLAQLVPYPLFEPVQAHLDNLLWLRQRHC"
FT   gene            complement(337175..337303)
FT                   /locus_tag="Snas_0325"
FT   CDS_pept        complement(337175..337303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40043"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q373"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40043.1"
FT                   /translation="MGKHDKKPDPSGNGHKPKDKVDPKKFVKPEDVKHKHDRKDDK"
FT   gene            337392..337628
FT                   /locus_tag="Snas_0326"
FT   CDS_pept        337392..337628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40044"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q374"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40044.1"
FT                   /translation="MSNIDTLLEAADEWREAVNIFDTEMAERHQDFFYGLVGSLTESGT
FT                   ITPTDAGQIIATTGRYLQYGQRDDLENVLHELV"
FT   gene            complement(337644..338468)
FT                   /locus_tag="Snas_0327"
FT   CDS_pept        complement(337644..338468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0327"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bac:BamMC406_5323 aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40045"
FT                   /db_xref="GOA:D3Q375"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q375"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADD40045.1"
FT                   /translation="MTASVEVPQYVAEETTARWPNVGPQWVSEAPGELRQLCEQYGAIP
FT                   ETVLPARYGLVVAVQAKDRELIMKGSPDPDGPNQVKVMSALADLQVGPTILESFSTDTG
FT                   FWTIMTRIKPGEPLRNLGASLAPPDKLATILRPLVNQPSPSSTLPYIGDWLRDRLEDDA
FT                   LSDLAPGRTVASETERSEALSVLSELTDAGAQGLCHGDTSPGNILTGENGKLYLIDPRG
FT                   MRGEAAYDVAVLGLKSAMTVSPETRVSDLAKAVGVDVGRAERWAAIALAARV"
FT   gene            complement(338465..339148)
FT                   /locus_tag="Snas_0328"
FT   CDS_pept        complement(338465..339148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0328"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: avi:Avi_1080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40046"
FT                   /db_xref="GOA:D3Q376"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q376"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADD40046.1"
FT                   /translation="MLCGSGPLLLDFDGPVCGVFAGDPSPRIALGISRIVEATGIEVPL
FT                   ELREHSMELLSWVDTLDVPGLTETVEDALSDAELRAVQTASPTPFAREVIEAAHRAAKP
FT                   VAVVSNNSASSISAYLRAQELDEYVWPIVGRPYANPSEMKPNPIPLLRAAESLNVEPET
FT                   CVFVGDSVFDIEAGLAAKTPVIGYANASHKTKTLADAGAKVIIRSMGDLVSTLQNCPTS
FT                   SQGAQ"
FT   gene            complement(339175..340044)
FT                   /locus_tag="Snas_0329"
FT   CDS_pept        complement(339175..340044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0329"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: efe:EFER_3657 putative GntR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40047"
FT                   /db_xref="GOA:D3Q377"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q377"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADD40047.1"
FT                   /translation="MPDAGEFRGERDPESPLPPKVQIANQLRAAILTGVFQPGDKLPSQ
FT                   PELSRMYKTSRQTAKNGLEILAAERIIVMGQGSNARVRAITQRSVELRPHVEAAFEQGH
FT                   VVIDFAGFSSETLRGVLSEPLDKIRVGRFTPESITVRILITDVSKPIALPVPAETGTDD
FT                   PDVRARSARITGRAVDGIVDQIHELGDLGLVKTASAEVRVHDLGPMFKLYLISRQEAFF
FT                   GFYPVVEHTVPIKREPTPIYDLMGKDVPLFHYAVSDDDATHGAQFVEAAQTWFDSVWTT
FT                   IARERESE"
FT   gene            340184..340879
FT                   /locus_tag="Snas_0330"
FT   CDS_pept        340184..340879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40048"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q378"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40048.1"
FT                   /translation="MERNGSHPVAGVAARMCRERHGHVPSFVDVACETCWADAIGADQD
FT                   VIATEPDMPKVCPQDPNLVDEVVVARACRGEETEVTLAEWRLINKVLVGKGLSRNQIYR
FT                   RLYRVRVVDALGNQVPHEVARHYPASMVTDMAAVRSRLDGVPVELTPAELRVAIRRLLA
FT                   DKHSIHEVAFRLRISKEQVRVVRASSPRLRSSRKALVGQPPSNTAAGTVPPSHNSASAN
FT                   HELRVKVVA"
FT   gene            340880..341134
FT                   /locus_tag="Snas_0331"
FT   CDS_pept        340880..341134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40049"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q379"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40049.1"
FT                   /translation="MPFSQSHNEFDRLAAAAHALHDAVHEFMAEFHGAGAEITDDDRSR
FT                   KVFDNLAAVDTDAVLVLDRLTRTGHHQQASELAVPSAGR"
FT   gene            341159..341521
FT                   /locus_tag="Snas_0332"
FT   CDS_pept        341159..341521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40050"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q380"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40050.1"
FT                   /translation="MYDDPTGQKFGIPTFYWRGAPAGFATRRQLRATGLCPGGQDVAGQ
FT                   IKWRGIGGERTAYLYRIDLAKPKRTATPRVLAALDKALRARKTCGTCGQVKPYFIRTKF
FT                   DECAECVEAAGGCYAA"
FT   gene            341587..341952
FT                   /locus_tag="Snas_0333"
FT   CDS_pept        341587..341952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40051"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q381"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40051.1"
FT                   /translation="MTAVLSTHDLKAQLRRAATIQGLRDMAAWLDEHPDVPVPAYHVEI
FT                   LHSLNGDSDEAEAAELRRIAEAAETTADFDQNHPEVLIKFGPVKYRFYMIPEQVQKRHD
FT                   AWNSYRDSVQVDEVVPV"
FT   gene            341949..342608
FT                   /locus_tag="Snas_0334"
FT   CDS_pept        341949..342608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0334"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: rpt:Rpal_3580 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40052"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q382"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADD40052.1"
FT                   /translation="MSTVNMVSILVGAAPGLIAASTATVTALRWRRIACMDALTRIPNR
FT                   RGLRRLARIVRKKAREGQPVAVAVVDLAKFKAVNDTFGHDTGDAVLAAVAKRLTDQAVV
FT                   AGCVRLGGDEFAAALTPRRGCEWPLVIDVVSRWLSAPLTVDGQQLNLNARLGAATATGT
FT                   DHDLSQLLAAADAAMYAARRNNRTTGLVHGGVAVPARPRVRARDDHDITIDTAVAA"
FT   sig_peptide     341949..342011
FT                   /locus_tag="Snas_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.295 at
FT                   residue 21"
FT   gene            342605..343003
FT                   /locus_tag="Snas_0335"
FT   CDS_pept        342605..343003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40053"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q383"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40053.1"
FT                   /translation="MSKRIDPNRMPDQNLVDALFLCTGGLGSQAAVNLLVEHGHFLSRT
FT                   DFRRDCLDVTEDEGEQFASVDWNRAAEVSFPCSNSERSILLIAASLATSDIKVNLRDVI
FT                   TGLDTFNTRRVLVAIAHAAGKDGLVNQP"
FT   gene            343000..344802
FT                   /locus_tag="Snas_0336"
FT   CDS_pept        343000..344802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40054"
FT                   /db_xref="GOA:D3Q384"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q384"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40054.1"
FT                   /translation="MISIGDYPKGKEMSVTDAAHASTEYPVPARLPVAPASGGETLVVP
FT                   PMPRVPEGATCLACLPKVKQLSAQLELVAAERDDLAAAVEGFREEVSTQKAQTVVARQQ
FT                   RDDLHDENQVLSQRLTEAEALAEEAVQARSTAEAALADTETLSTENTDLRSELDAVIAE
FT                   RDRLAAESKVKDDKAAKLAAAKLRAAEARKSARRFRVVAPSFVFYLICLSGALYGLVEV
FT                   LHGVFGWDYQYAIPLGLALELAGIKFKLDADAQLDAGEDAKTTQRVSKIVAALIIGLNV
FT                   GGHIWLIMPGQAVAFGTLSALGYLSWTNRSSFMRRLTMRAEGRADATHLHFTKADERQY
FT                   GKAAVDQARQLAAADIAGELTKHEALQKGAEMVAAAEQAADDANRERRLVTLVRNLKRA
FT                   EYPANPELADVAVARMRPQQLASGLMASDAEHAAMVDSILDLLENRANGWSSKLGTRPG
FT                   TKTGTRREPGRDETGNASGPESGNRQDKTGTETGSENTPESGNENPVSPAESRTTDKPG
FT                   SHPDSVPGTDAKPQFGPAPKRKVKGCPNSRAARAIGKHISMTGSKPSIPDIAKQFKVST
FT                   STADRWINGVYDFMSPTANGKDRP"
FT   gene            344799..345521
FT                   /locus_tag="Snas_0337"
FT   CDS_pept        344799..345521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40055"
FT                   /db_xref="GOA:D3Q385"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q385"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40055.1"
FT                   /translation="MTTTDRRTWSPYAPRPEDPDYDATSASPKPIEVAVPASVEPKPVA
FT                   APTVAVAETAESPTSTSGPESTAEGNSALRTPHSENTPRDSKQQVDDGDGVPETPHSAP
FT                   KSAPATTGTEPAATGPEAAQADDEPGFTESAKASAASIGQRLKPLLLGLRPPAIWTQPP
FT                   ASLKALVLYADQAPWADKTGPIRASGRVWNRVIAVPLCTVLYYAAWLVQRPSRFVVLLV
FT                   LYVLLAHTSLGGWLPWLW"
FT   gene            345561..345944
FT                   /locus_tag="Snas_0338"
FT   CDS_pept        345561..345944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40056"
FT                   /db_xref="GOA:D3Q386"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q386"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40056.1"
FT                   /translation="MGNAVLAGVALVMFGIFYWYKLWPKVQCWLLVAVGWGLGGMVGSG
FT                   LQYALGQANDLSSTGMQLLFGVGVPGLFALATMTIFVLNMLPNKTVSTPPIGWVARICA
FT                   LLVPLTMVAMPSLGDNLMTSIGA"
FT   gene            345948..347366
FT                   /locus_tag="Snas_0339"
FT   CDS_pept        345948..347366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40057"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q387"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40057.1"
FT                   /translation="MDPITIAIIGLIAARVVGLGATDIAYAVRGKDSPRWEARKAAIKA
FT                   SAQTGRPVRYGFGGYMADMIDDAWISARERRERKHTGPAPHKNKPMRSYLGRVWGHRWE
FT                   DAGLKHDKKHRDRQIKRGLVDPDTPVEGSVDDAFATVPRDQAANHFNTEGDPRASAGDP
FT                   FTPDDLRRYGEWVKQRLAPRHHAAVDEWVTAESQAARDRSSFFDHRFTELADVDNSLNS
FT                   WLNGTHPVVVQRQRSQDLIDQAMDLVDTTAKEPTQEEPIANSDTAMDHGDVDDLRTNPN
FT                   PDPDGADMFKHPLDQRPDAFMAWVRQTYPDSWQQRLELTPELTKSEWDHHILDKEATTT
FT                   DTPSAESSTPMEPTTPSTVTYLHEFINRKDPNTMTTTANAEAVGLDDAITYAEQSTQHH
FT                   TDTASALELFKISLAQGGCGQGTLGIVDEIDDANTVIQGLYQRLHDSLVQDKVTVGDAY
FT                   NARPDAGTKEFVTN"
FT   gene            347433..349613
FT                   /locus_tag="Snas_0340"
FT   CDS_pept        347433..349613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0340"
FT                   /product="cell division FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40058"
FT                   /db_xref="GOA:D3Q388"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q388"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADD40058.1"
FT                   /translation="MTITRARAATGPSPAAEPAITDGDLASFNLSDFNPKATTPPMGPE
FT                   QGRPRDKFHKLTAKQAAPHYVSACLMAAAGAAQFATTVSGEPGIVAATCATVLFVAGVI
FT                   LWIIAPVRYRITTAAKDLGRGWVISVACSILTWLTYTAAAGIDVDTVAALVGGTTVLGL
FT                   RWWRQHRIPNPSTDPPAPVTPKPVVIDTVLRELEERWLAEVGSKHGVMPGATLSGGTPT
FT                   DVGEEYLVQFATAHHTVSMLINKLPNIAVGLKCEVSDLIVESVPGDASRARLTILTKSP
FT                   LKTRTVFDTADIDVGAGRLPLGLWGDGTGYASWRLYTANSMWGGVIIGGIGSGKSVLMA
FT                   AIAIAARLRGDTITWFIDGQDGASNPALFAESDWAAGRERAKEMLTAAAEEVTWRSRQN
FT                   RSKRWSGFTPSPTRPGILIQIDECHLIFDDPECVALAEYIARVGRKVGIALVCASQYAG
FT                   AKTFGGSVPLRSSLMQGNAVVLYTTSKAEKNFFNGLELDPSQLPSDMPGFGYVIDAAGG
FT                   KMAPFRGRDFERLPEVDDLDQDNLPDAEADLKHSITWWLRQCPEILLDTLSVTAADAVT
FT                   GGGYTQRRERQAEDLGRWDDQVAAMEQGILPADYQPGVDSPTTRPAATGPVARLLQLVP
FT                   PRLSDFLRRSPASPTTTVPPMGLSPAEEAVWMALADAESGLKLGQLVAATDYSETYVRG
FT                   QLDNLIEAGHVEQPKKFGPYQLTNPAAETVAA"
FT   gene            349645..349905
FT                   /locus_tag="Snas_0341"
FT   CDS_pept        349645..349905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40059"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q389"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40059.1"
FT                   /translation="MANTNITCRHGTTGFCWDDATPDQRKLFDYAHTHAYDWAIERGLA
FT                   RDDAERYAGASAAHTVDVYPDAYSHSLNLVSDLATKYPHVN"
FT   gene            349997..350218
FT                   /locus_tag="Snas_0342"
FT   CDS_pept        349997..350218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40060"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q390"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40060.1"
FT                   /translation="MTRINDKGEQHMQRENAAKNARRNLDRAERDNLDTNQRIQLGFAW
FT                   TLLSIAEEMNRRTQVQAKIHDIDGFDKT"
FT   gene            350285..350467
FT                   /locus_tag="Snas_0343"
FT   CDS_pept        350285..350467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40061"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q391"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40061.1"
FT                   /translation="MATTKLQLGDVVVHIPTGLKGKVKELDGDDVLVKWNGGTLVSPEG
FT                   ENWLDAADLRFYGRR"
FT   gene            350544..350759
FT                   /locus_tag="Snas_0344"
FT   CDS_pept        350544..350759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40062"
FT                   /db_xref="GOA:D3Q392"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q392"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40062.1"
FT                   /translation="MKLLINTALFTVFTLAEAGLLKLVVYIAHTQWLPALPTIDYLTAV
FT                   MVLTGINFLISTWRVGNKLGEAVNNA"
FT   gene            350752..351039
FT                   /locus_tag="Snas_0345"
FT   CDS_pept        350752..351039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q393"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40063.1"
FT                   /translation="MPEQRVRIDGADVALGECEWVLWASCGCPNGCALADKHGGTPLVT
FT                   EELAWRAFYTTRRDVEDHKKRGFRLELMTRDRWSAEVYPLMLRPDCPHTT"
FT   gene            351075..351353
FT                   /locus_tag="Snas_0346"
FT   CDS_pept        351075..351353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40064"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q394"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40064.1"
FT                   /translation="MNNALSRFGSDILGKCCWALKYNDGHPNGAWSTGEKLAVALVLDD
FT                   EEFLTAEDYTIPEAKQRVFGGSWEWRNTNEFDTWLAQLRALLGNNSA"
FT   gene            351403..351843
FT                   /locus_tag="Snas_0347"
FT   CDS_pept        351403..351843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40065"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q395"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40065.1"
FT                   /translation="MSHTHQQDIEYLRGLLNRAKHHVTVTVVHGLANARHRLNDQGHSD
FT                   TEVARMLTAASPHSVGARHLRRTLDAIRDGRIHVGQYFNGAEADLGDIIASWATSSTGI
FT                   DIADTMAALTTETVGFDEAVEQVDELLDECGRITDWLWKRTG"
FT   gene            351953..352327
FT                   /locus_tag="Snas_0348"
FT   CDS_pept        351953..352327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40066"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q396"
FT                   /inference="similar to AA sequence:KEGG:Bpet0944"
FT                   /protein_id="ADD40066.1"
FT                   /translation="MAPIRSEDRHRYPKDWKQISARIRHGRAAGRCECDGICGTGHTGR
FT                   CPARQHHRHPVTGSKVVLTVAHLDRTPEHCDDDNLAAMCQRCHLAYDAEQHASNAARTR
FT                   FRNATAGMEPLFGLDITTGA"
FT   gene            352426..354426
FT                   /locus_tag="Snas_0349"
FT   CDS_pept        352426..354426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0349"
FT                   /product="DnaB domain protein helicase domain protein"
FT                   /note="PFAM: DnaB domain protein helicase domain protein;
FT                   KEGG: lch:Lcho_2984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40067"
FT                   /db_xref="GOA:D3Q397"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q397"
FT                   /inference="protein motif:PFAM:PF00772"
FT                   /protein_id="ADD40067.1"
FT                   /translation="MTTMHNHEAEQIVCGAAMLNRDVVTEVGGIISAADFYTPKHQIIW
FT                   QVITDLHNTGEPTDSTAVLQRLMESKELNKVGGGAYLSDLRMSVPSAANAAYYARIIAA
FT                   DAKRREFKQFAARLDQAADTGADIDAVLDHGKTILDAAPQPAWPTPIPLTGHKRQLPEF
FT                   PVDALPDWLSEMVAAVAEFSQTPPDLAAITGLGCLSTAAARKIDVEVTPGWTESSNGYF
FT                   VVAMPPASRKSFVVKTMASPIEAIQRQLIEEAAPRIREAKIEKQAAERIAETKADAAAN
FT                   LAVTADAQGSDEAAAEYDDAKNAATEAATAAEELIVPAKPRLLVDNATPETATTHLHNQ
FT                   GGRIAVLTAEGTIFDNITGHYSGKPNLELFLKAHVGDTLDITRRDREENVENPALTLVV
FT                   ALQPDILVDFMRVRKVRTSGLLGRLLFSIPADNRGYRKIRPAPIPASTRDAYNKNITTL
FT                   VRSLLDIDATHTIAMSPAADRAIQIVHTDIEDKLKENGALRHIADWGGKLVGNTARIAC
FT                   LLHLAKHFTTGWNKPIDADTVNEASLIAFYFIDHALSTFDDVGTDEVTRDAGHVLDWIT
FT                   TQNTSRFNKRDLFRGVRSRIPRAGQLDPALGLLESHGYIKALPPAARHGPGRPPSPVFL
FT                   VHPEFANQGGTTQTVTSQHIPVPAANQAQHQ"
FT   gene            354444..354647
FT                   /locus_tag="Snas_0350"
FT   CDS_pept        354444..354647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40068"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q398"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40068.1"
FT                   /translation="MTTTTKEWLTVPEFLDEFDIARSTFQDWRAKGTAPPCRKLPNGQL
FT                   RLKRSEVNEWLESLVDNSEVAA"
FT   gene            354644..356047
FT                   /locus_tag="Snas_0351"
FT   CDS_pept        354644..356047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0351"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: lhk:LHK_00908
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40069"
FT                   /db_xref="GOA:D3Q399"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q399"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADD40069.1"
FT                   /translation="MTTSNDVRIWAIETRKLKRGNSYRVVWFVAGKRQPPETFTTWAAA
FT                   DSFRSKLVAAHRKGELFDIDTGRPISWLKNENTMSWYELTCKYVQDKWSHVSPSHREYI
FT                   ADTLTDCTEALFKTDHAEQPEQAKLRLALRRWSFSARIRDGGEPPEGHVPALKWLENNT
FT                   IDVADLGDEKKGGLLVRGVLARLSQTTKGKPAAANSFNNKRRVLNNCLKFAIEIGVLDA
FT                   NPLSLVTWRKAVVESAVDPEVVVNLDQATRLLGAVAEQGELGKRLKAFFGCMYFAALRP
FT                   EEVIDLRRSNIANLPEEGFGLFRLTNADPSVGTAWTDTGKARQRRQLKHRAVGSNRPVP
FT                   IHPDLVKLLKKHLDEFGVGRDGRVFVGPENGSAAHGYLRVFKAARKTAFTEAEQDSPLA
FT                   ARPYDLRHACVSTWLAAGVQAPRVAKWAGHSVDVLLKVYAKCIDGQEGVDLERVLHANA
FT                   TAQVDRGGE"
FT   gene            complement(356179..356254)
FT                   /locus_tag="Snas_R0007"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(356179..356254)
FT                   /locus_tag="Snas_R0007"
FT                   /product="tRNA-Thr"
FT   gene            complement(356321..358897)
FT                   /locus_tag="Snas_0352"
FT   CDS_pept        complement(356321..358897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0352"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: acp:A2cp1_2419
FT                   2-alkenal reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40070"
FT                   /db_xref="GOA:D3Q4B0"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B0"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ADD40070.1"
FT                   /translation="MPTSPVSPAGAPATGATPPADGYVLGVDLGTSHTVAVIRWPDGRA
FT                   RPLLVDGAPVMPSAVYLDEAGHIHVGRDAQRLAQTDPTQFEPNPKHRIGETSVLLGDRE
FT                   VPVTALLSAILREVAAKAVEAVGHLPPAVLTCPAKWGPQFRGVLENAAAQAGFPPVRLV
FT                   PEPVAAAHYFAEVMRRPIPMGRSVAVFDFGGGTLDIAVVRHQEDGGYAVQADGGLEDLG
FT                   GLDVDAALVDYVGRTINATVPQIWQQLTQPQNGNDRRNRRLFWDDVRGAKEMLSRTTVA
FT                   PIPVPGVESSLHLTREELEKLAGPLLERAVAETQRVIAATGQSPDQLAGLFLVGGASRI
FT                   PLVGRLLHSQLGIAPTVLEQPELPVAEGSLAAGFPAAAPVSPATTVPGEPYTPPPGQSP
FT                   PEGFLAPTPPAKPWYRKKTGWIAAGVGVVVLAVLGWLVLRDPYPQQDMHDLTDVGTAKY
FT                   PKGVGPDAVTFVSGTVDGPAAYMAAEASEDYKLHLTSVDLETGKEKWTSGLEAADDTSG
FT                   TWTVSARNGVVYAASKGYEESKLYVLNPDSGKETTIDVGVEDEFMVLGDKLIRMDKDKD
FT                   TVIGYNGSGKEQWTVKAGLDISSFGDDDTWSYYENPIGGDAIDDSHLMYVRDDEGKVNV
FT                   IDVDEGKSVTDGKVGDTDSAFIAYAGKLLVTTGASSYNLTAYDLEDNLKQLGSWKQPKG
FT                   LGAPVAISVCGETRVCVGQSQDNTDTPGSLSVFDLDDSDGVSLWQSPKETRVSGVQVAG
FT                   ETLALDTVDSEEVTRTQLYDSDFEKIGKAQEGHYLRIDSGSFLQYPWGGDDTMTSGEAT
FT                   EIVGLGARDGERQSLGSKEVQSGCAASGEQLVCPTADGYSTWRFRN"
FT   gene            complement(359458..360477)
FT                   /locus_tag="Snas_0353"
FT   CDS_pept        complement(359458..360477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0353"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: afw:Anae109_2230
FT                   RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40071"
FT                   /db_xref="GOA:D3Q4B1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B1"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADD40071.1"
FT                   /translation="MPGNSQPRNKRVSSKKGATKGSGGQGKKSLAGRGKTLSAADRPWH
FT                   KAYTGTDVPKKTKWKQEKERRAAAAEGRAPKAGRPKRPSTQSKRRDSDGVDVLVGRNPV
FT                   VEALRAHVPGTALYVVNGTELDDRIRESIRLAGNRGISILEVSKSELDRLCQGALHQGL
FT                   GLQVPPFHYEEYADVLAAAGEHPQPPLLVALDGVTDPRNLGATIRSAAAFGAHGVVVPQ
FT                   RRAAGMTATAWRASAGAAARLPIAKATNLTRAIQQAQQAGLLVAGLDADGEIDLFDLPA
FT                   AVDPLMLVVGSEGRGLSRLVGESCDLRVRIPIASAVESLNAAVAASVALAEVTRRRLA"
FT   gene            complement(360467..361909)
FT                   /locus_tag="Snas_0354"
FT   CDS_pept        complement(360467..361909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0354"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: aeh:Mlg_1810 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia ; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40072"
FT                   /db_xref="GOA:D3Q4B2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B2"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADD40072.1"
FT                   /translation="MSLRLYDTGTRKVRDFVPRVPGKVSIYLCGLTLQGPPHIGHLRNG
FT                   VNYDIMCSWFQHRGLDVTYVRNVTDIEDKVLAKSREQDRPWWAISFENERRLAADYEAL
FT                   GVRPPTYEPRATGHVPEMMDLIAELINKGHAYAPGNGDVYFSVESYPEYGALSHRKPED
FT                   MLCPDDGDESVKRDPRDFALWKAAKPGEPADSSWNTPYGRGRPGWHLECSAMSRRYLGD
FT                   AFDIHGGGTDLMFPHHENELAQSRAAGLDFTNFWVHNNMVNLSGTKMSKSLGNVLSVEA
FT                   LGERGFRPVEIRYYLAAPHYRSVIDYSDAILTESATSYRRLENFVSRAAERFGHDATEG
FT                   GALCADFTAALDDDFGTPAAFAAIHEVTREGNAALDSSDDAAARGAAASVRAMLGVLNL
FT                   DPLSRQWTETGGDDLTPVVDSLVNLVLEQRQQARKNKDYATADAIRDQLSRAGLVIEDG
FT                   PQGSRWSLARADHATGAEAHAG"
FT   gene            362004..363029
FT                   /locus_tag="Snas_0355"
FT   CDS_pept        362004..363029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0355"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: pca:Pcar_2768 molybdopterin biosynthesis,
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: molybdenum cofactor synthesis domain
FT                   protein; Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40073"
FT                   /db_xref="GOA:D3Q4B3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B3"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ADD40073.1"
FT                   /translation="MNTTSTRHSDGSGRLVDRYGRTAVDLRVSLTDRCNLRCTYCMPAE
FT                   GLAWLPRQEILTDDEIVRLVGLAVTRLGVTQVRFTGGEPLLRPALADIVARTTALEPRP
FT                   RVSLTTNAIGLKRMAPALREAGLDRVNISLDTLDPARFKTLAHRDRLNDTVEGIAAAKA
FT                   AGLVPVKVNSVLMRGVNEDEAVPLLRFALEHGYELRFIEQMPLDAQHGWSRENMVTAEE
FT                   ILTQLRTTFNLTPDPVPRGAAPAETWLIDGGPAKVGVIGSVTRPFCGDCDRTRLTADGQ
FT                   VRACLFSTTETDLRAMLRGDASDEDIAEAWRKTMWAKLPGHAIDDETFLQPPRPMSAIG
FT                   G"
FT   gene            363277..363516
FT                   /locus_tag="Snas_0356"
FT   CDS_pept        363277..363516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0356"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: ade:Adeh_1120
FT                   molybdopterin synthase subunit MoaE / molybdopterin
FT                   synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40074"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B4"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ADD40074.1"
FT                   /translation="MVTVRFFAGARAAAGVAEARVSATTVAELKAVLVKEYGAELARVL
FT                   PACGLLVDGVSNHEDLSTLTDGATVDVLPPFAGG"
FT   gene            363705..364886
FT                   /locus_tag="Snas_0357"
FT   CDS_pept        363705..364886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0357"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /note="KEGG: ank:AnaeK_0874 superfamily I DNA and RNA
FT                   helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40075"
FT                   /db_xref="GOA:D3Q4B5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B5"
FT                   /inference="protein motif:COG:COG0210"
FT                   /protein_id="ADD40075.1"
FT                   /translation="MNSEPQALFELPVGARVPRPSRESSRPRTATVARLVPMPEPLLPA
FT                   RPEPIIQDGPCLAGMEEVGTGLLDHADAMQRVAASAPPGPLLINAGPGTGKTHVLVRRI
FT                   AYHIEELHIPASQCLVLTAGSPDTVRTDLAELIGSHCDEITIAAFGDIQIRDVPALGHL
FT                   FVDDIHRMSPKLYDALRADRGAQPAFTATGDPDSALHDGPSPFESFPSDYPDARVVRLT
FT                   RNYRSTAPIIAAAMQLITPVTRAPGRTMLPERPAATTAPIGRYFAPADAAERDFAANLP
FT                   ATLAASGIDAADVMVLRPGGGEIAGVPSLSIAESAGRQFRAVCLLGVTAKNFPDTPAAR
FT                   RALFTAMTRAGDLLYLSHSGAASPLLNGIDAGLFSAFGRVAVRSPRVEQPRLL"
FT   gene            364957..365565
FT                   /locus_tag="Snas_0358"
FT   CDS_pept        364957..365565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40076"
FT                   /db_xref="GOA:D3Q4B6"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40076.1"
FT                   /translation="MSMHDPRRDDHAPDPYDAADDTRSPDSDYPPPEGFSPEGGFKGFP
FT                   RVEPDQPRIAPTPPPPPRRNLWLTLTAIAALTAATVTGIVLLGSSPPDKPTTEESESPA
FT                   PRPTDAYPDYADDDMVRAQIGDCITFDDKDDDESWRVVDCDAKEALGKVYAFAVGTTSG
FT                   DECPKLPKGTKTRYHYALDYRESDRDDYVVCAADIKKKD"
FT   gene            complement(365609..365696)
FT                   /locus_tag="Snas_R0008"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(365609..365696)
FT                   /locus_tag="Snas_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(365750..366076)
FT                   /locus_tag="Snas_0359"
FT   CDS_pept        complement(365750..366076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll2787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40077"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B7"
FT                   /inference="similar to AA sequence:KEGG:mll2787"
FT                   /protein_id="ADD40077.1"
FT                   /translation="MSTTALKPPIDRLITAVNSGDMDGFLATFAYDGVVDDWGRRFTGH
FT                   NEIRGWSERESIGLQQTFEVDSIREDGDTVVAVLQVGGNGFNGPSTFTFTLDGDLVREM
FT                   KITA"
FT   gene            complement(366045..366464)
FT                   /locus_tag="Snas_0360"
FT   CDS_pept        complement(366045..366464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40078"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40078.1"
FT                   /translation="MTTTLAIVTDDPEQARQLLAWLRRESELRGVTDLRLLPPRQTGGH
FT                   LGEATDTVLAILSNPGAITAVATTIGVWLGQRVGRTRIRVKDGEREVEIETTSRRRAEE
FT                   YTRTILAELNAGPADSVSLTVRGDNHEHDRTETTD"
FT   gene            complement(366461..368758)
FT                   /locus_tag="Snas_0361"
FT   CDS_pept        complement(366461..368758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0361"
FT                   /product="Clp domain protein"
FT                   /note="PFAM: Clp domain protein; peptidase C14 caspase
FT                   catalytic subunit p20; KEGG: ATP-dependent clp protease
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40079"
FT                   /db_xref="GOA:D3Q4B9"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B9"
FT                   /inference="protein motif:PFAM:PF02861"
FT                   /protein_id="ADD40079.1"
FT                   /translation="MAGGFNDHATYLVRLARKKAKQAGRTRVQPLHLLGSLLETASMAG
FT                   RIMDCLSESDHNQDKRNPVHVFELEPEDDDLVPFAEEMAAILSAARDEARSLDDALIAP
FT                   EHLLLGILRHGDNEAALTLEAKGIVMQPVRQALLHLRNEHSVDQIRDIVERSSDGTIMV
FT                   LTPTMWTLKDLCLSATQACFNGFLEGTTSTTVREPEVRRILQVLSRNTRNNIVLIGESG
FT                   VGKSVVLRDVARCFASGQVTDTLRDKEPFWVEWDRLQTMSSNPAPYWLNYCLDRAAHQG
FT                   VILFLDDVAEHVDFGSRLGTDGPETSLWRHLSNKTMQVVMTMKPSEYAKFANESPLHRH
FT                   FEPVRIPELSTEQTITVLNEVIRQRLSTHHAVSIADEAIPTAADLANRYIPDQFLPAKA
FT                   VTLLDEACANVQTARLDVDRVRLKFEAMDKAIHDFDGAGSEPESPEHQLNRALYVRQWT
FT                   EEHAPELNAAYSRDLGLVDDEAVRRTLAELKGIPVQELRVPDSTEPSPQPSDLTTPAAT
FT                   RLPNRLTSTAVLLGAAHYAHDAIPDTPAITNNLLSLNRRLTDVEHGSFSPDRVHQPTTD
FT                   LDTPHIPAIVEATRAATDTLLVYYSGHGLIADDGQLYLGLATTDPELWEYTALPYDKLR
FT                   KAVHDAPARNKILILDCCFAGRAIDDLSDPGRSSGQLDIEGTYVLTATTATRTAHASDG
FT                   ADHTAFTGALLGVLSEGVDEREELIRLSDIYSRLDRRLIAKGLPKPQQRGTNNIHNLAL
FT                   TRNPRWNRTLAA"
FT   gene            368833..369198
FT                   /locus_tag="Snas_0362"
FT   CDS_pept        368833..369198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_02114 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40080"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40080.1"
FT                   /translation="MAEVVYDKKDQLKQIEELLLNGEQVIAVYDAIGVGTGFIGLTDKR
FT                   VILKNKSFVGKKVALTSIPYAKISAVSLTSNKSFAGQWFSSGEMAIHAGKEIHEIEFRG
FT                   DRKTHHVHQVIMHYITR"
FT   gene            complement(369241..369639)
FT                   /pseudo
FT                   /locus_tag="Snas_0363"
FT   gene            complement(369693..370862)
FT                   /locus_tag="Snas_0364"
FT   CDS_pept        complement(369693..370862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0364"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: eca:ECA3881 chaperone protein DnaJ; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; DnaJ central domain protein; heat shock protein
FT                   DnaJ domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40081"
FT                   /db_xref="GOA:D3Q4C1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C1"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADD40081.1"
FT                   /translation="MVSRDWLDKDFYKVLGVPKDAPQSDIKKAYRQLARELHPDHNPGN
FT                   ADSEERFKEVSEAHAVLSDEKQRKEYDEMRSLMGAGAFRRGARMGGGQTPFDFDDLMAQ
FT                   ARGGGFAGGGAGGGLGDLFGSFFGGNRRRGPGKGRDVETSVELDFGDAVAGITLPLKLR
FT                   SPGVCDTCHGNGAKPGTSPKTCPSCNGAGVRTVNQGAFSLSEPCRDCDGVGTIVTDKCP
FT                   ECRGSGGVTKTRTLTVRIPAGVRDGQKIRLAGRGEPGERGGPSGDLYVLIRVRAHELFT
FT                   RDGDDILLSVPISLSEAALGTTLRVPTLDEPVTLRVPPGTPSGRILRVRGRGVSRNGKT
FT                   SGDLLVTVDIDVPDKLSDAARTALEDYAKSAPAAPRGKIERAVAASETS"
FT   gene            complement(370887..371783)
FT                   /locus_tag="Snas_0365"
FT   CDS_pept        complement(370887..371783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0365"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: dvm:DvMF_1194 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40082"
FT                   /db_xref="GOA:D3Q4C2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C2"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADD40082.1"
FT                   /translation="MTAEQNADATEAKESGPPEAETPDSGAADKDTAEESTDLATQLSE
FT                   RTADLQRITAEYHNYRKRVERDKSLAAEQTTATVVAGLLPVLDDIDRAREHGDLEGPFA
FT                   TVSEQLLNALIKLGLEVFGEKGDPFDPAVHEAVAHMVSPEVTETSCIDVMRRGYRLGER
FT                   LLRPAMVAVAEPAEAETAETGKTEAVAEDAELSAETEEAVEAETEAKAEAEAEAAVEAE
FT                   VEVEELAETKDEDATPNLDADVPSDEEQVKAEQVEDAVAEAAESDAEAGSEAVDEEKPE
FT                   SEKDKSAPDDTKKTENE"
FT   gene            complement(371780..373633)
FT                   /locus_tag="Snas_0366"
FT   CDS_pept        complement(371780..373633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0366"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: gme:Gmet_3532 chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40083"
FT                   /db_xref="GOA:D3Q4C3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C3"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADD40083.1"
FT                   /translation="MARAVGIDLGTTNSCVSVLEGGEPTVITNAEGSRTTPSIVAFAKN
FT                   GEVLVGEVAKRQAVTNPDRTIRSVKRHMGSDWSVDIDGKHYTAQEISARTLMKLKRDAE
FT                   AYLGENITDAVITVPAYFNDAERTATKEAGEIAGFNVLRIINEPTAAALAYGLDKGDKE
FT                   QTILVFDLGGGTFDVSLLEIADGVIQVKATNGDNHLGGDDWDDRLIEHMAKTFNGQHGV
FT                   DLTKDKMALQRLKEAAEKAKIELSAATQTSINLPYITAGADGPLHLDLNITRAEFEKMT
FT                   SDLRERCKKPFEQAIKDAGMNVSAIDHVIMVGGSTRMPAISSMVTELIGKDPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKLIERNTTIPTKRSESFT
FT                   TADDNQPSVLIQVFQGEREIAAYNKKLGTFELTGLPPAPRGVPQVEVTFDIDANGIVNV
FT                   SAKDVATGKAQSMTITGGSSLPKEDIEKMMREAQDHADEDRKRKEEAETRNVGETWVYQ
FT                   TEKLLAESGDKLPEDKKGEIETKLTELKTALGGTDLDKVKDATDALIKVSQEAGAAMYA
FT                   AQQQEAGGAEGGEAPGAEQQSSAKADDDVVDAEIVDEDDKK"
FT   gene            373862..375148
FT                   /locus_tag="Snas_0367"
FT   CDS_pept        373862..375148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0367"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: dat:HRM2_17430 PurA; TIGRFAM: adenylosuccinate
FT                   synthetase; PFAM: adenylosuccinate synthetase; SMART:
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40084"
FT                   /db_xref="GOA:D3Q4C4"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C4"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADD40084.1"
FT                   /translation="MPATVVIGTQWGDEGKGKATDLLGEHMDYVVRYQGGNNAGHTVVT
FT                   PDGEKFAIHLCPVGILTPGCVPVIGNGVVVDPKFLLHELDGLAARGVDVSNLRLSSDAH
FT                   LVMPHHRALDRVVERYLGSARIGTTGRGIGPAYGDKVGRVGIRVQDLLDPGILKQKLEM
FT                   VLREKNQVLVKVYNRKAIDVQTVVDEYLGYADRLAPYIADTRLELDKALTAGKNVLLEG
FT                   AQATMLDVDHGTYPFVTSSNPTTGGACMGSGIPPTRIDKVIGIIKAYTTRVGAGPFPTE
FT                   LFDENGAHLLKVGGEYGVTTGRERRCGWFDAVIGRYAVRVNGITDLFLTKADVLSSLPK
FT                   VPICVGYDIDGEFHEEMPMSQTALHHATPRYEYHDGWWEDISECREFSDLPKNAQSYIE
FT                   RLEELCGARISVIGVGPGRSQNIVRSALI"
FT   gene            375307..376464
FT                   /locus_tag="Snas_0368"
FT   CDS_pept        375307..376464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40085"
FT                   /db_xref="GOA:D3Q4C5"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40085.1"
FT                   /translation="MGRTLGPFTDVSTARVDGAYEIYRGEDDDGREVEILTLGATSAKD
FT                   PARRALLSDTVAWAHATRGPADASILSADLDSDQPYVVTLRQDGMRGVERMLERMLAMG
FT                   PPSGPLSGVNQNSGQFPIVGPPTGHIPVVTGHTDPHGIPRVVSTPPSGSPVAPASPMAS
FT                   YVTKAQTSRPPWLVPMAVVLLLLVLIAGGFFVFYGMSGEDSDGTPGGGESGADDQNAQE
FT                   MKPSWDDSLPPVKVVGDQTYTGDEGETIALARWPFAFKVTPGMTCEQPENLLAECAVPD
FT                   QAEDTWAEIQVQECPDGCGEPAKNKLVNAFDMPGEEERVDANTQIGNEYFNDEDLYHVG
FT                   MTRFYEPEPGHVLFVTVFASGNRSESAMQELHRIVNSVATQTSAV"
FT   gene            complement(376461..377273)
FT                   /locus_tag="Snas_0369"
FT   CDS_pept        complement(376461..377273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40086"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40086.1"
FT                   /translation="MRVTGVSTPTRPFRDNEDWLGSGPGVVVVLDGCGQPDNIAEDTER
FT                   GCAHGLPWYVKTLGTAVLRSAGDLATPLDDALATAIAETATAHHGRCDLHHPSTPASTV
FT                   VILRENRRTVEYLVLGDSTIAIDDGSPEPIVVTDDREIRIPFPSIGSDEEQAKRNTREY
FT                   MAVVEKLRNQPDGFPIAAADPQAAYRALAGHLGTEQVRRAIVASDGATRLVDRFGILTW
FT                   TELLDLASSGGPEEVINQTRTAETTDLECKKWPRGRAHDDATLALCVF"
FT   gene            377338..378015
FT                   /locus_tag="Snas_0370"
FT   CDS_pept        377338..378015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40087"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40087.1"
FT                   /translation="MSLPAPVLDLAASVVPDAEDLGKLAFAYAHGAPLSGFGDPDEIGL
FT                   VCVWDQPEIPAAAPTEATHVTQSWFDGLVTTVTSGEGWSQPPTAALTDIAAFAYGVLLS
FT                   DDAGAGTAARGTVSEFPTLLATRSAKALTEDLTTVPAALSNDTDPWTRAETLTTALYRA
FT                   YVAWFAAHGHYFPGPARRHEYATHFGMDEVIPKAEQNLWKTLDPTHQSDRYTEFAQLIL
FT                   NDQ"
FT   gene            378089..378161
FT                   /locus_tag="Snas_R0009"
FT                   /note="tRNA-Arg3"
FT   tRNA            378089..378161
FT                   /locus_tag="Snas_R0009"
FT                   /product="tRNA-Arg"
FT   gene            378554..379072
FT                   /locus_tag="Snas_0371"
FT   CDS_pept        378554..379072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40088"
FT                   /db_xref="GOA:D3Q4C8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40088.1"
FT                   /translation="MTGEEYLHSYDPDNSVPGSLSYFTHRFAAMAKRSGFHCTPQKVRH
FT                   FSATKLLAAKIALPAVAGRLGHSSGGRTTLQYYAAWLRETDDSAVRVLAACMPELPQVR
FT                   REKSRRDFSAEQPTRTKDELEARICNIRREEGLGPVKIQARLAAEGTDIASSAVWLVLK
FT                   RHGLNKAVG"
FT   gene            complement(379111..379647)
FT                   /locus_tag="Snas_0372"
FT   CDS_pept        complement(379111..379647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mno:Mnod_0926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40089"
FT                   /db_xref="InterPro:IPR018697"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C9"
FT                   /inference="similar to AA sequence:KEGG:Mnod_0926"
FT                   /protein_id="ADD40089.1"
FT                   /translation="MRCLVFRSMTQQLGFTCVDCGEYHPDLPMGYSTTAPASWRQEYAD
FT                   DPRSVLSSDQCVIADRIHFVRGLIEIPVVDGEEPFAWGVWVSLSPANFERATRLWETPG
FT                   REAEPPYFGWLSTELPLYSPSTIDLKTNVHTRPINERPFVELEPTDHPLAVEQREGITM
FT                   ERVRRIATALLHPPG"
FT   gene            complement(379925..380515)
FT                   /locus_tag="Snas_0373"
FT   CDS_pept        complement(379925..380515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0373"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: dal:Dalk_5036 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40090"
FT                   /db_xref="GOA:D3Q4D0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D0"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADD40090.1"
FT                   /translation="MKGQGVSELAGEAGYLLEIGLLKRTRRTGWWIAGIRDPESIAEHS
FT                   WRTAITGMIIASHEGADPARTSMLCSLHDTPETRIGDIPKIGKHYLKATAPDTIAADQT
FT                   AKCSDQAGQVIRDAIAEFEAGQTPEALCAKDADKLECLIQAVEYQHQGVSTVTRWIESS
FT                   LAALKTDTARGLADEILKANPLAWEQTRRPSAT"
FT   gene            complement(380512..381597)
FT                   /locus_tag="Snas_0374"
FT   CDS_pept        complement(380512..381597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40091"
FT                   /db_xref="GOA:D3Q4D1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40091.1"
FT                   /translation="MKQEPRAYGGISGFMLKVARQSIPVSQEAFAETLAVDPTTVQSWE
FT                   SGRRPLGAATMTQVRRLGRQLLRLGVDSELVAMIPVAIEADLIITAIATPVPDGELGQH
FT                   PLAGCVMDLRISELLTWALTGVPPRIASRIPPVRRRGPAPTRPELGWIDRKQLNANLLQ
FT                   LSDRGEQDGSTLLLRSQACFLTGLARLDTPAKLSTAASRYLVGGESWSPSWLDARSHVV
FT                   SCAYRGDPEPLRRFITHAQESDDCETAALNYTAYWVGDMPDREGDDGFMPRNLLRWRGS
FT                   RMYPHLVERLQTTHPLIDLNTHNLWLLLRSQRGLIIDDKQTSLLLLDRIDEAADSNRVS
FT                   QQSLRELRSMKSALAELGYRK"
FT   gene            381730..381918
FT                   /locus_tag="Snas_0375"
FT   CDS_pept        381730..381918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40092"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40092.1"
FT                   /translation="MISENPKTWGTYGTFTLDGQSLTYHVAHGHYWRDDIDGGTRLFQD
FT                   RLDGRDLLILIAEMRQS"
FT   gene            381915..382148
FT                   /locus_tag="Snas_0376"
FT   CDS_pept        381915..382148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40093"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40093.1"
FT                   /translation="MSFTDSETLARNANYTMKCHSKVDTEGYCTGCRNYHGKLERPGPE
FT                   GCYFYRLAFEVYRKHALSHSIQGDDNVYIRHT"
FT   gene            382126..382530
FT                   /locus_tag="Snas_0377"
FT   CDS_pept        382126..382530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0377"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: eba:p2A60 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40094"
FT                   /db_xref="GOA:D3Q4D4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D4"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD40094.1"
FT                   /translation="MSTFATPDLRNPVVAWEVIARSAVHIVREARASRRLEPLSIDGRM
FT                   LVNAVVALGIDLDVPKTVSIPASLRRGLSERETQVLLGIAGGKSNAEIGRELFITEDTV
FT                   KTHARRMYRKLGARDRAHAVAEAFRIGILS"
FT   gene            382571..383392
FT                   /locus_tag="Snas_0378"
FT   CDS_pept        382571..383392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40095"
FT                   /db_xref="InterPro:IPR032724"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40095.1"
FT                   /translation="MGSVAELIAAVRAALSTLAEGRTLTNQARATLEEATGRMEGIARG
FT                   SASYQLRNSLDALAAAVAGLDRMAEAENAAQEHVIAYLASIGADGRAPEPEPEKTSPKK
FT                   PTASSDLKAIGERLGLKPCEGLLGTLPAMKPNSGQRTRGRWHKHPDRELTSGANDRDWE
FT                   HVKDFWHHNIWSGTAEDTEPRWLAHLELKFAMTMRRTRTKSEPVDQVHEEITINHPDGP
FT                   CPQCQLLLPYFLEEGSSLTIHWPAGSATYIGRPYFDRPLRDVKPYINEEQQ"
FT   gene            383389..383838
FT                   /locus_tag="Snas_0379"
FT   CDS_pept        383389..383838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40096"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40096.1"
FT                   /translation="MNAYAAMMGPDYWMTLDDDAAVEALFASLKNTVGQDGHRCMVTIG
FT                   PETDDGIQPHLEIATDGANAYLRSHGNIAAEPGRAIPEFHAVHHPDGQTTIHHTHTFET
FT                   RTGLEDIPVNHMRVSPNWAVETVKRYIDTSEHPDCIEWIDSPAGE"
FT   gene            complement(383936..385045)
FT                   /locus_tag="Snas_0380"
FT   CDS_pept        complement(383936..385045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40097"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40097.1"
FT                   /translation="MDATVELWRSVREQAQVWAEIPIVAEVSSALPKNAPLADKQLGQK
FT                   TVAALLQELVAGYSDAMRNPLLLASIVPLLYEDHKKHSSSKVSEQTLGVWLTKMTFLER
FT                   AHRVTVAWFRAHLAGYPFILAPQLAKGSPFTTLEFTNQLIWSPEERKLGLQFMSCPPKV
FT                   PSIVKAQKIAKQIDESARAVCRALQETKEWNTFTSTNDALTDIDKTNLKESRNELSRVL
FT                   SSGEVDSNTTKLAIDRSRYRADSTRRAVARLSGGARNYAEAFIQANDLINLCTDEVFAQ
FT                   LVMYGEPEMVAASCIDFRGGGSKRIDFEVHDYPVFDIIPGNIVRVDDPLVDDAIRVLRT
FT                   NISFGNVDGISAIVGGSVLTGTSHAWRST"
FT   gene            complement(385092..387521)
FT                   /locus_tag="Snas_0381"
FT   CDS_pept        complement(385092..387521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40098"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40098.1"
FT                   /translation="MDIEVHCVDATVVLAKQIKTRGPERTWGRGELLQIVKRWIKLPLA
FT                   KGASFEIVTAGRLGPSAEALRDALSEAAEGEWAQIAKLVGISASDPIYPVLARVAIRQE
FT                   LYGVEPILAEAERQVRSMLPGSRCDTDLSDLAGQTIDRLFRVLSTKASYSAPEERFVGR
FT                   DEIADILGGLDRIHVEDRWPGTLQNEYLHLARDLPDGSVTAPRLLPTRAQHATLPWNDQ
FT                   TLGLEQLRSCQGPVILTGRPGSGKSTAAAVLQKSAAVEGSVVLVAHAEAYLGNRLDALV
FT                   ADALSAILRRDIPSATGKQLLHDANVVLFIDGVSEVPHTIRNDLREELRGHVARGNGAR
FT                   IILAGRDIAAVTSVLPVNALPTRFTIAPIGHSERFQLAQRLVPQGQSDGDRDTSARTLI
FT                   GMVERSLGDAAENPMLFVMGAQLINDGIPFEDRPSMYAAAIERMAERGLTSDMASTVAV
FT                   LGVVFSRLLDEGRRYAAPLEWSRLVSEACTLVADAGIDVSPLTVREAADRCGLLTTIGY
FT                   TQLRAPLHDSFADYLAGWASAKMLTSIPDLIADDDYQRVIFAAEIGGVDTQLATAVTRS
FT                   LPFCAARIAQYDRRPVDHSSPGQATEHLKMLLPEERVFGINMWNDGIRTIAYLTDGPSG
FT                   WVEHHVGQQMLHEAPSVVCTSDEGPLAVAVRLWRVLLKEALRQSPGPALPRLDSIESAC
FT                   AALQNYAVAESEALSTLIDQVAPARTRDPLMKAIGPFGLEAIVRPRPNEGFLDEWPIEF
FT                   AQASHISVRANEGSLSAELEAYRESSVESVMRKSPQESASDRINDAINTLVGNKWL"
FT   gene            388166..388696
FT                   /locus_tag="Snas_0382"
FT   CDS_pept        388166..388696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40099"
FT                   /db_xref="GOA:D3Q4D9"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40099.1"
FT                   /translation="MKKWYNSLSPGEQFGAVVGGTVGALIFLFAMCGFVGVLADSDGTN
FT                   VSHVGASTSASASESPTASSPSASSKSPSPEPSTSSEKPSPKPSKSESPSPPPKPDLCG
FT                   APQNPYGYNYCGTGGVVHDPPGDICFYFECIDYFDEGKGYMVACDDGMVSMSGGRSGAC
FT                   SYHGGVGRTVYGG"
FT   sig_peptide     388166..388285
FT                   /locus_tag="Snas_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.796 at
FT                   residue 40"
FT   gene            complement(388701..389072)
FT                   /locus_tag="Snas_0383"
FT   CDS_pept        complement(388701..389072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40100"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40100.1"
FT                   /translation="MRPKPTALATSLACLLAFSGCTTESDATKTEDITKRWKKHFTAAD
FT                   QPDSWQLYGRDTEKVTLTDNYLNIEGDIYNCEDTRVYWQMGRDWAKNVDDNVSTFVTVY
FT                   DDDKLAGDTTTTGEFDCHL"
FT   sig_peptide     complement(388998..389072)
FT                   /locus_tag="Snas_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.643 at
FT                   residue 25"
FT   gene            complement(389017..390252)
FT                   /locus_tag="Snas_0384"
FT   CDS_pept        complement(389017..390252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0384"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2530 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40101"
FT                   /db_xref="GOA:D3Q4E1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40101.1"
FT                   /translation="MPVAIYLLGAAIFAQGTSELILSGLLTDIASDLNITIPQAGLLTS
FT                   GFAVGMAIGAPILAVLTLRWDRRKTLLALLAAFTAAHILGALAPTYELLLLTRFAGAFA
FT                   YAGFWAVASVTAITMAGPQARGKAMSIVAGGLTIATVVGVPAGTVIGQHFGWRAAFWTV
FT                   AALTALSALGVAKTVPSQKSTPEDRPRLRTELRTFAGGRIWIAYVATAMSSGAVMATFT
FT                   YLGALLTGVTDIPTTWVPAVLVLFGLGSLLGITLGGRFADAHPFATLYTGFGGVIAAAV
FT                   LLFTGATNPTLTLIASFLLAVSGFATNPAVNVLVFSLANNAPTLAGATNITAFNVGITL
FT                   APWASGLLIGAHLGLPTITWISATLATIGLTATLTSQSLHHRYDRPAKDTVTAHETQTD
FT                   GTGDKPRLPAGI"
FT   gene            complement(390307..390966)
FT                   /locus_tag="Snas_0385"
FT   CDS_pept        complement(390307..390966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0385"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pfl:PFL_2927
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40102"
FT                   /db_xref="GOA:D3Q4E2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD40102.1"
FT                   /translation="MRRFTPGTPSIALRNRIGQLDPKPGSLAGMARPRQFDEDRAIDIA
FT                   MRVFWAKGYAATSTDDLCEATGLKRSSLYNTFTSKHRLFTLALTRYMDTKTTALLETLD
FT                   ADTPIRERLRTVLRTAVDDELTGSDGCLVVNSIMELARTDRDVARLLSADADRRTAALR
FT                   TVIHAGQRTGELDPDRDPLALANFVTATVGGLRVSARSGATPQTLESIMETAISAL"
FT   gene            391038..391340
FT                   /locus_tag="Snas_0386"
FT   CDS_pept        391038..391340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40103"
FT                   /db_xref="GOA:D3Q4E3"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40103.1"
FT                   /translation="MTDARTSPYYRPVGVRIVNFVVGGIVAFIVLSLAFVLLGANQGNA
FT                   IVELVTAVADFFAWPFRNMFTLETPELSALLNYGIAVLAYVLIGVGVNTLFRKHR"
FT   gene            complement(391337..391948)
FT                   /locus_tag="Snas_0387"
FT   CDS_pept        complement(391337..391948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0387"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mlo:mlr8191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40104"
FT                   /db_xref="GOA:D3Q4E4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E4"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADD40104.1"
FT                   /translation="MSIEFLLTTLVVVATPGTGVVYTLAAGLSRGAKASLIAAVGCTLG
FT                   IVPHMIAAVTGLAALLHASATAFEIIKYAGVAYLLYMAWATIRDKGALTVEADTAPQST
FT                   LRVIGSGVLVNILNPKLTIFFFAFLPQFVPAGAPNALPRMLGLSAVFMLATLAVFALYG
FT                   VFAAAVREHVISRVRVMTWLRRTFAASFVVLAGRLALTER"
FT   sig_peptide     complement(391871..391948)
FT                   /locus_tag="Snas_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.774 at
FT                   residue 26"
FT   gene            392187..392771
FT                   /locus_tag="Snas_0388"
FT   CDS_pept        392187..392771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40105"
FT                   /db_xref="GOA:D3Q4E5"
FT                   /db_xref="InterPro:IPR000013"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40105.1"
FT                   /translation="MTERSRLLRRGVLAAFGVGALLAIASPALATAQPVADTASETKAV
FT                   TLTYDTSQAEEFVQDVHDGAKVWNDNVENVTLEPVADGQTADFEVIATDGWPQASVPEL
FT                   GKGTIEFGRQAVDEGHNTTRISAHEIGHILGLPDVKPGPCSSLMSGASAGTDCDNAIPN
FT                   AEEKAEVESNFGSGMAAKSKTWRDMYFCDKD"
FT   sig_peptide     392187..392279
FT                   /locus_tag="Snas_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.843 at
FT                   residue 31"
FT   gene            complement(392827..394368)
FT                   /locus_tag="Snas_0389"
FT   CDS_pept        complement(392827..394368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0389"
FT                   /product="sodium/proline symporter"
FT                   /note="TIGRFAM: sodium/proline symporter; SSS sodium solute
FT                   transporter superfamily; PFAM: Na+/solute symporter; KEGG:
FT                   hha:Hhal_0554 sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40106"
FT                   /db_xref="GOA:D3Q4E6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E6"
FT                   /inference="protein motif:TFAM:TIGR02121"
FT                   /protein_id="ADD40106.1"
FT                   /translation="MNANVPTLTTFLVYLLMMIAIGVWVYRRTHNLGDYVLGGRSLRPS
FT                   VAAMSAGASDMSGYLFLGVPGAVYAQGVGATWIAIGLILGTYFNWLFIAERLRTYTERA
FT                   KNSLSLSSYFENRFEDRTQLLRIISALVIVVFFTVYVSSGLVASAQLFHSVFGISLVTA
FT                   ATIGFIVVAVYTSIGGFLADSFTDFIQGTMMFLALLVLPMIGLWAIGGFAEVGSAVSEK
FT                   SPDLWNMGDVVAYENGAWGAGDALGFVAIVSGLSWGLGYFGMPHILARFMGIRSAKDVP
FT                   VARRIGTGWVILSLAGACAVGLLGIGLIDKPLDNPEDVFFALANQLTNPWIAGLLQAAL
FT                   LAAVMSTVDSQLIIVSTALTEDFYRKVNKRASDKQLLWVGRGGVVLVGIVAFVLALIAL
FT                   GSKNPADSSILLIVAHAWAGFGAAFGPVILLSLFWPRMTWVGALAGMVVGAVVALSWPT
FT                   LDEKFFGTGLYELVPGFALALLAAWGFGHLGRRPEREWKGKYEDYLPDEPEAAKP"
FT   gene            394573..396084
FT                   /locus_tag="Snas_0390"
FT   CDS_pept        394573..396084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0390"
FT                   /product="Glycoside hydrolase, family 20, catalytic core"
FT                   /note="PFAM: Glycoside hydrolase, family 20, catalytic
FT                   core; KEGG: ccs:CCNA_00456 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40107"
FT                   /db_xref="GOA:D3Q4E7"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E7"
FT                   /inference="protein motif:PFAM:PF00728"
FT                   /protein_id="ADD40107.1"
FT                   /translation="MRLLRIPTACVILATALFIPGSAVADPSHAKAATPSTIPALGEWT
FT                   AASGTYTYSESSRLVVDPDHADELTDEAQTAAADLAALTGTEPEVVTGEPETGDVSLAL
FT                   GGGEPLGAEGYSLDVGDTFAITANADAGAFYGTRTLLQLVKQDKQIPAGTATDVPKKPE
FT                   RGLMVDVGRKYMSVEWLKKHIKDLSYAKLNYFHLHLSDTFGFRLESETHPEVTSEDHYT
FT                   KAEIRELVDLAAKYHVTLVPEIDVPGHVNAMLAQHPELQLEDQSGNKDPYFLDLSNPDA
FT                   YTLVEDLIKEYLPLFPGPYWHIGADEYVGDYGKYPQLEAYAKEHYGPDAVGKDAYYGFI
FT                   NWANEIVRDGGKTTRMWNDGIKEGDGTIAPEANIVVDYWSTHGIDPQKLLDRGHTVMNA
FT                   SWTPTYYVLGGTDIDRRWLYEDWNPDLFEKTLTIDDPKRNLGSKIHVWCDHPDAQTEDQ
FT                   ITEGIRLPLRGLAQQTWGSPKLVEGYDDFVAIDDAIGRAPGFSSL"
FT   sig_peptide     394573..394650
FT                   /locus_tag="Snas_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            396164..397504
FT                   /locus_tag="Snas_0391"
FT   CDS_pept        396164..397504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0391"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; SMART:
FT                   peptidase M14 carboxypeptidase A; KEGG: hch:HCH_04864
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40108"
FT                   /db_xref="GOA:D3Q4E8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E8"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ADD40108.1"
FT                   /translation="MKTRRKLISLLSAAAVVAAGTGLIVGSANADPGSDRNPGEQVAWK
FT                   VPGLTGKQATSLEDDGFDLVDYEDDGSAIVIGDEKVADKLRDKGMKPKFLDTIVKPVDK
FT                   DYKDTADTYYGGYHTVTAHEEHLDKVASEHSDLAKVYDIGDSWLKTKGEGGHDIKAICI
FT                   TKIADGDCEQKPDSKKPRFSMIAQMHAREIATGEVAWKFIDKLTTGYGQDDAVTKLLDS
FT                   TEVWVVPIANPDGVDIVASGGDNPILQRKNANDSAGDCGESKGVDLNRNSSFKWGDDSD
FT                   DPCAETYQGTAAKSEPETAGLEEWFQNIHPDQREDDPSSPAPNDARDTMITLHSYGQYI
FT                   IIPWGFTEDQSPNDAQLRALGEKMSESNGYKVGTNGDTVGYSTSGTTDDFTYGQLGVAS
FT                   FTFEMGADSGDCGGFLPVYECVDSTLWKENEGALMTAAEAAKAPYAE"
FT   sig_peptide     396164..396256
FT                   /locus_tag="Snas_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 31"
FT   gene            397699..398685
FT                   /locus_tag="Snas_0392"
FT   CDS_pept        397699..398685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0392"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: protein of unknown function DUF839; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40109"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E9"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ADD40109.1"
FT                   /translation="MSIHPSGTGVLAHDIEVPQGFSCRVVARSGQPIGGTSWHPAPDGG
FT                   ACFADGDGWIYVSNSDVPLAGGASAIRFGPDGEVKDAYRILAGTSLNHTGVVTPWDSWL
FT                   SCEDIFLGRVHEADPHGDRTAVAREAMGRFKHGHLAVDADRRVVYLTESEPDGCLYRFT
FT                   PWTWGDLSHGLLEVLCANGASVEWRSVPDPAPGFLDVPTRYQTDTAVRFEGGGACHYAE
FT                   GVCRFVTADGTWVYDAAQETLYRWSGPDEDLGGDILVTDLGDWLEIDLVAAGETTAVVR
FT                   VEGHRDSEITGVAFSPDGSRLYFSSQRGTHGDSRDGVTFEVTGPFRH"
FT   gene            complement(398705..399961)
FT                   /locus_tag="Snas_0393"
FT   CDS_pept        complement(398705..399961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0393"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="KEGG: bxe:Bxe_B2117 CdaR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40110"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F0"
FT                   /inference="protein motif:COG:COG2508"
FT                   /protein_id="ADD40110.1"
FT                   /translation="MSDGHGVGNRVLMLGGQPLHQMLRLRAPELARQLTEIIAAHVTTY
FT                   NNLPDEELQRDIVSLVELNLNLVANTFEHHSPPKPEEMELLWAAAGRGAQDLTPLEDIM
FT                   TAYHLGGRQATVALFADAAPEDYGDIVEAYSLLLKYNQVVSTVVCEGYMVARESMRSQE
FT                   QDARHAVVSALLNGERPMNAGALAGVRLASRYLVFTAAIGKHPDEADDKPFAVYAGRSK
FT                   LDRIRTVLDGFASEPALTVLDPAGGLILAPASDSMMDWKGARELVAVVGQAAGAPVWIA
FT                   GQLATIEEVPAAARLTQEVLDVVRLFGRPPGLYQLSDVLLEYQLTRPSHAMEELASLLD
FT                   PLAEHPDLQRTLEVYVENGLDRRQAAALLHVHPNTVDYRLRRVVALTGLDPVDPVQLQR
FT                   IGAALAARRKRVAKPDTAD"
FT   gene            complement(400103..401224)
FT                   /locus_tag="Snas_0394"
FT   CDS_pept        complement(400103..401224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0E33891p"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40111"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40111.1"
FT                   /translation="MPSFEQLEMYFSQIDAASPAASAQANWIAGAAEARQLAAELRKNV
FT                   DELLQYWSGPAATEYNGAMNAIIEFADGLADDMTDMSTGLASMASTAASIQPQGLAIIN
FT                   AARSNPYSRAAAIAPLTALLTALGQAYQSNKGQYWREPKEAPQKLPKPGGEGDSTPTQT
FT                   DVPPDVRPAPILGDLEDIGQFLQLASSTYEAFKEDDFPSGVTGEFPVNPGPGYPGGGGG
FT                   DGGGSYPGPGGGPLPGPDHPDYQPLPEPDTELTESPVSLAGATPTGLAGGTPAVSLGAG
FT                   GGSAMGAPGGAMPMAMGMGAAGAAGSAARPAASARGAGGAGGGLFAPPMGAARRNDSDE
FT                   APEGVRTWLTEDELAWDAEPAPTGVVGHPRAAG"
FT   gene            complement(401229..401594)
FT                   /locus_tag="Snas_0395"
FT   CDS_pept        complement(401229..401594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40112"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40112.1"
FT                   /translation="MPPPPPTDGRFEVDVDAIEDFQPTFNRLDSRVSTASGKVSPASAE
FT                   GLGTFTDAMTVIRDHDRLRATYLTRLEMLRAAVAIANTKTTRLIANYRGTESTETSNMT
FT                   ALLGPLANVIQQIARKD"
FT   gene            complement(401663..403009)
FT                   /locus_tag="Snas_0396"
FT   CDS_pept        complement(401663..403009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0396"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40113"
FT                   /db_xref="GOA:D3Q4F3"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F3"
FT                   /inference="protein motif:PFAM:PF05108"
FT                   /protein_id="ADD40113.1"
FT                   /translation="MRTRREQVAAHRFIVRRVISAMLNGEPETLDLPMRRMAISAMVGV
FT                   AIASLVFAGFWVVGLIWPGGAQSWQKDGAVIVEEETGARFVYWDGQLHPVLNYASALLI
FT                   TSSGDRTVHTVLQDSLADTPRGATLGIPDAPDTLPEPELFTASPWQTCSAPNPSDPTSI
FT                   ESHVIIGDTPDGGDALSSDGLLLKHDGDIFLVVKDTKYLVPSEKSLPALGADPDQVVKV
FT                   DPVFLNALETGPNLKLKIPGEGDDGIELDGETYPIGTVFTNNDRHYVLLKDGLAAIGEL
FT                   AAELIGTEPVALSSAAVGENRTDEKLEPEGFPSRRPDVMGIPDARQTAVCADWTKGKTT
FT                   VTVYSSVPKLVGDNVKAAPKGIEDVSTADHVRLPGGYGSLVRAQSSEGASGGTVFLVTD
FT                   QGWKFGLSSEALTAFGYKKLKPTPMPSALVALLPTGPELSQSAALRAIR"
FT   gene            403108..404205
FT                   /locus_tag="Snas_0397"
FT   CDS_pept        403108..404205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt0123 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40114"
FT                   /db_xref="GOA:D3Q4F4"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40114.1"
FT                   /translation="MTSPAKPATDAGAKPEPVTAARRTRTRVAGLGIAQVIGVEVVLAA
FT                   LLFVPGVPLPWLGGVAAAVALLGLGRTHGRSWFGWLGHWLRWRSRVRADRRDRRSGGEP
FT                   GPRPRLATIAERGTEIGVAFDGTGWFAAVKLEGEAPPSEVFAAVTGLLNAADTPVTSVQ
FT                   LVTRSGAEVGRDNWFAVRLDVPGAHAVAADRGGGALGVHRALGGAVSRLLKGAQDAGID
FT                   MRALSQTQLAAALRFSLDLHRPDSGEPTESWKTWRNGGMAQTTYWLRGRRSAATEVERL
FT                   WTKLSELDKGTHAISLALRPASSRPGDKRLMFRCLVRLVDEASNVEELGRELTKLTRKN
FT                   RLKLLRCNGTQGPASYASALSGGAW"
FT   gene            404202..404363
FT                   /locus_tag="Snas_0398"
FT   CDS_pept        404202..404363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40115"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40115.1"
FT                   /translation="MKPDDTSPFVAEPEPAAPAGEADAQAPDREDWRGPQDDPWQLDEQ
FT                   APPPVIGD"
FT   gene            complement(404350..405516)
FT                   /locus_tag="Snas_0399"
FT   CDS_pept        complement(404350..405516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0399"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bpy:Bphyt_4708 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40116"
FT                   /db_xref="GOA:D3Q4F6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADD40116.1"
FT                   /translation="MLLNAYAMGGTVRTVFNQANALAARGHEVGVVSVMRHRRTTQFRL
FT                   DPAVTLTPLVDKKLGVLRPGRSPLERIGWLRASPTRPGMEVPQQEARKRVFTRVVEKAV
FT                   IRALKGCTADVLVTTRPALNLLAARYAPDGVVRVGQVHQRIKPGHTGLLDAIAADYPRL
FT                   DAVVTLTRGDRAEYARMLDHRVRVARIPSPVATLHAEAADPASKVVVAAGRLVRAKGFD
FT                   LLIPAFAHVVAKDPEWRLRIFGGGPMQAKLAALIEANGLEDNVVLMGRTGDLGGELAKA
FT                   SFCALGSRSEGLPMVVLEAFTHGLPVVSCAYPGAEELVSDGRDGILVPPEDVEELGTAM
FT                   AWLATDVEARATMGERALRKARDYGPDAVAAQWEQLFTELRGAGVSRR"
FT   gene            405677..406606
FT                   /locus_tag="Snas_0400"
FT   CDS_pept        405677..406606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0400"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   scl:sce5991 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40117"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F7"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ADD40117.1"
FT                   /translation="MRSRSPNVIRIARSTAGVALLLATATLGSCTDQAATVDESCDVND
FT                   RGHWAIAYTKQEDTAVKGVYWLVDGEHKPLNKDKDIQAQDPSLSPDGRKVLFEGFHGDG
FT                   GKYVNKKLIMNTDGSGLKIFGEGISTPVWSPNGKRLAYRDTDRNTIMVSNPDGTDEREI
FT                   AEDAASNPVWSADGEKLAWIPNGANAVRWAEPEGKKSGMAQMLGEQAITVAWQPDGESV
FT                   VVSLVKGDDAHLYRLNLSDNKEPELLAEDATAPFALPDGTIGARVDKRGDGDYNQYVSV
FT                   DPKTGKSEDLAKIPGQHPSVIACHGVKR"
FT   sig_peptide     405677..405781
FT                   /locus_tag="Snas_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.797 at
FT                   residue 35"
FT   gene            complement(406596..407246)
FT                   /locus_tag="Snas_0401"
FT   CDS_pept        complement(406596..407246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL1495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40118"
FT                   /db_xref="GOA:D3Q4F8"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40118.1"
FT                   /translation="MANLVEEVALLAYRDDNGRNTAPYLQWSLAGAALLELSLRGRVGV
FT                   DDSGRVGVVDETPVGHVALDEVLTRVAGSNIGHIVSSWVQILSGTDIRTPVLEGLVDQR
FT                   ILTHDRDRLLGFIPVNRYHPAEASVEDEIRARLERALAHSAGVDVRTAALAGVIAATFM
FT                   EKAAMPQHKFGEVNKTFKELGRAPEIKPIVEGVELAVNIFRSGSGSASVVVTS"
FT   gene            complement(407340..408275)
FT                   /locus_tag="Snas_0402"
FT   CDS_pept        complement(407340..408275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0402"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: azo:azo1320 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40119"
FT                   /db_xref="GOA:D3Q4F9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADD40119.1"
FT                   /translation="MDAVSELLAGVRARGAVFRRTIMRPPWALRVAARTPVTLATMLHS
FT                   HAWIVPDGHEPVRIATGDIAVVRGEIPYVVADDPATEPELVVTDADYCPGSGGLEPLRR
FT                   TCGDPNEAGAVLVSGAFERQGELSERLLRALPPVLVVPAADSPVELLATEVARQRPGQQ
FT                   LVLDRLLDLLLVSALRTWFDSPETDAPAWCRALDDRVVGAALRLLHETPASPWTVSKLA
FT                   AEVGVSRAALARRFTALVGEPPMGYLTGWRIALAADLLRQTDLTVDTIARQVGYSNAFA
FT                   LSVAFKRVRGLRPGEHRDQAKTTPALTPTP"
FT   gene            408356..409219
FT                   /locus_tag="Snas_0403"
FT   CDS_pept        408356..409219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0403"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: mlo:mlr3941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G0"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ADD40120.1"
FT                   /translation="MTQQPILVTGATGKSGRRVVSQLRAKGLPVRAASRDGEHHFDWND
FT                   TGTWDPALAGTQAVYIVQLDGTRLVRGFVERAVGHGVRRIVLASGRGIDNPDYATDSGG
FT                   VLDGLLDSEAAVRESGVNWTISRPGWFAQNFSEGFFAEAVRAGELRLPGGDGAASFIDA
FT                   EDIAAVVTAALTDDRHAGQVYELSGPHAVTLAEAVATIAGVTGRDIRYVPLSVADYVDE
FT                   LVGQGLSSVDAKAFADVIEPLREGVDEYLSDGVQRALGRPPRTFTQFVEATAAAAGGWH
FT                   TAATRP"
FT   gene            complement(409266..410756)
FT                   /locus_tag="Snas_0404"
FT   CDS_pept        complement(409266..410756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0404"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: sme:SMa1939
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40121"
FT                   /db_xref="GOA:D3Q4G1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G1"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADD40121.1"
FT                   /translation="MRTTEHAVVIAGGGPTGMMLAAELTLANVDVVVVERRENQTVVGA
FT                   RAGGLHSRTLEVLDQRGVADRFVEAGQVGQMTGFAMTHFDISDFPTRFNYGLGLWQSRT
FT                   EELLAAWLDELEVPILRGLEVTGFAQDDTGVDVHLSDDRTLRAAYLVGCDGGRSLIRKT
FT                   AGIEFAGWDATMSHLIGIIELAEEPEWGVRRDADGMHGIGRLEYEIRDGEVVYSDEGPI
FT                   RVMITEKQVGSGEPTLEELSEAMTAVFGTDYGVHSPTSLSRFSDTSRQAESYRDRRVLL
FT                   AGDAAHIHYPAGGQGLNLGVQDAVNLGWKLAQVVNGTSPEALLDTYQAERHPVGAQVLR
FT                   NTMAQTALMRPDPRSQAARDIVAELLGMEEARKTIAAMMCGLDIHYDLGEGHPLLGRRM
FT                   PDLEVTTSDGPTRLFTLLHNARPILLNLTDTELTPWSDRVQLVNAEYDGPWELPALGEV
FT                   PAPAAVLIRPDGHVAWTGTPTDPSLPEALTHWFGPPAA"
FT   gene            complement(410913..411410)
FT                   /locus_tag="Snas_0405"
FT   CDS_pept        complement(410913..411410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0405"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpy:Bphyt_5083 transcriptional regulator, MarR family with
FT                   acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40122"
FT                   /db_xref="GOA:D3Q4G2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADD40122.1"
FT                   /translation="MPNWTIKPEPIGAPDVDDVMEQYFDEMGRRVLGREATETEKRAAL
FT                   TADPNDKLAPPRGLFLVARDPDGEFLGCAGVRLLPADPRTAELKRMFVHPAGRGAGLGR
FT                   GLLLAVEDAARTLGAKRIVCETNTKLTEARTLYTRNGYAETEPYEGHGKADHWFAKDLD
FT                   RP"
FT   gene            complement(411453..412850)
FT                   /locus_tag="Snas_0406"
FT   CDS_pept        complement(411453..412850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0406"
FT                   /product="secretion protein snm4"
FT                   /note="TIGRFAM: secretion protein snm4; PFAM: protein of
FT                   unknown function DUF571; KEGG: GK10816 gene product from
FT                   transcript GK10816- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40123"
FT                   /db_xref="GOA:D3Q4G3"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G3"
FT                   /inference="protein motif:TFAM:TIGR02958"
FT                   /protein_id="ADD40123.1"
FT                   /translation="MALTNQLCRVTVVAPNTRMDIALPDHVRLCDLQSDLLSHAAEGPG
FT                   GDDLLDDGADAGGWVLTRLGGAPLDPQLTPRQHDIVDGEELYLVPVTDTGPQAVFDDII
FT                   DAMATANQKRERKWRTGSSRRFGIGFAIAAILGSAVACVASGTTVAMWTATALCATALL
FT                   AALIFARALGRVTEAAVMGLLACGYALAAGVLALAPLATIADVSAPRLMVGGAAVAVIA
FT                   VASGIGVPTAAPIFSATAICGTALAGAAALCAFVDAAPAQAGSVAAAVVLGLIPAMPML
FT                   AFRVARLPMPTIPRSPQQLRADTNIVDSQMALRRSERADEHLSGLLTATAIISGTATVY
FT                   LALHGTLAAILLASLLTVLAFMRARIFPTVRQRLPFLLAATAGLAGLALSAWVHWPPEY
FT                   RFVLLVAGLVATAAIALGYVLGVAGKPIAPTWGRLVDILEVILFVAVVPLTLWVWDAYW
FT                   WVRTVNG"
FT   gene            412952..416902
FT                   /locus_tag="Snas_0407"
FT   CDS_pept        412952..416902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0407"
FT                   /product="cell division FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: bra:BRADO1389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40124"
FT                   /db_xref="GOA:D3Q4G4"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G4"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADD40124.1"
FT                   /translation="MSTKVFTRPPRRTGPAMPSGDLVLEPPPDLPTPGQRSVGQMLMLL
FT                   PMLAMVGAMVFMYAGRGGGVLMMVVGGLFGVSMLGMFVGSFLTSGGDQKAAQTTARRDY
FT                   MRYLSQTRRQVRRAAIQQRESMRWRHPAAGTLWAMAASTRLWERRFSDTDFGELRMSLG
FT                   KQRLAVSLVTPETKPVEDLEPLSALALRRFVRAYSNVEALPMALQVRRFRRLVFRGDAA
FT                   ANRDLVRAMLCQAAVFHSPDDLRIAVVAGTETASEWDWVKWLPHSQHAREADALGARRL
FT                   LTTSLAELEELLEDELGKRHRNVDEPAGFNDHPHVLVVVDGGHVDADDDLAGAGLSGVS
FT                   VLDIAGTVPRYPRPWLLPLDNDGARLTMEHSGRTALLGQPDGLGEPEAAAVARRLARFR
FT                   PATATSASEPLAVSAELPDLLGLGDVARLDPRKTWRTGAPTADRLSTPLGLDPAGDRIV
FT                   LDIKESAQGGMGPHGLIIGATGSGKSELLRTIVTGLAVTHSSSELNFVLVDFKGGATFA
FT                   TLDQLPHTSAVITNLEDELHLVDRMADAIRGELTRRQELLRAAGNFVSQRDYEKARRAG
FT                   ADLAQLPSLLVICDEFSELLSAQPDFIDLFVMIGRLGRSLGVHLLLASQRLEEGRLRGL
FT                   DSHLSYRIGLRTFSAMESRVVLGVPDAYELPNSPGHGYMKIDTDTMLRFRSAYVSGPYR
FT                   DGNGNGGPGHALRDRPLRFTSEHLPLPDGPTQPILAATENIDDISDSLMAVITARLHDQ
FT                   GPPAHQVWLDPLDESPALSRLFPPLVADPKRGLCPTGQQTSGGLRVPVGIVDRPFEQRR
FT                   DSLTVDLSGAGGNLVIVGGTQAGKSTGLRSVIASLALTHTPAEVQFYCLDFGGGTLRAL
FT                   NGLPHVGSVVGRKNIDEVRRTVAEMSALLDERESAFAEAGIDSMETYRRRKAAGEFADD
FT                   PFGDAFLVVDGWPTIRADFEELEDDLQAIAQRGLAFGVHMMVATNRWTDLRAALRDLFG
FT                   TRLELRLGDPSESEINRRAAKNVPERAPGRGVTPDAMQMLIALPRLDDSSEVSDLTDGV
FT                   GKLVSLIAGAWHGEAAPAVRLLPARVDVAELPTLADVPGVSIGLNESHLAPVNVDFAAE
FT                   PHFLVFGDVECGKTNLLRMLAGRIADRYPKEQARFLAVDYRRTLLGEFSSEHLAGYAAG
FT                   VDEGRKLMRDAAEALRTRLPGPDVTPEQLRARNWWQGPDLYIFVDDYDIVAGGSYNPIT
FT                   ELLDLLAQARDIGLHLIVARRMGGAARAMFEPVIQRLRELQSPGLLMSGNRDEGLLLGD
FT                   VRPAPRPPGRGILVRRSGNQLIQAAWSPPGGV"
FT   gene            417362..417643
FT                   /locus_tag="Snas_0408"
FT   CDS_pept        417362..417643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0408"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40125"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G5"
FT                   /inference="protein motif:PFAM:PF06013"
FT                   /protein_id="ADD40125.1"
FT                   /translation="MDVIKVSPAELEGFSGKLQSSASELDSILEGLRAKLDSMQWAGGD
FT                   KEAYEAQRTQWNTAVSDLNMLLNQIGRTVGTAKQDYVSTEGLNARMFA"
FT   gene            complement(417650..418306)
FT                   /locus_tag="Snas_0409"
FT   CDS_pept        complement(417650..418306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40126"
FT                   /db_xref="GOA:D3Q4G6"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G6"
FT                   /inference="similar to AA sequence:KEGG:PBPRB1537"
FT                   /protein_id="ADD40126.1"
FT                   /translation="MNPRDCATVDWRLPATGLDAIFGDGATRWEKTLPTVTGLAGIAVL
FT                   AAYAALTGNLDWSWWQYALAAILVFDLVGGVVTNALNSAKRFQHAERVAVPRRAASLVR
FT                   NHVLFAAIHVQPIVIAALFPGVGLWWGVLWYAVTLAGVIVIPLVPLHLRRPAAMTAVAL
FT                   VPVVASVMPHPDGFGWLPAILVAKLVLGAVREEPYRPVAGMESGGSREGEPPATN"
FT   gene            complement(418303..418890)
FT                   /locus_tag="Snas_0410"
FT   CDS_pept        complement(418303..418890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0410"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ccs:CCNA_03223
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40127"
FT                   /db_xref="GOA:D3Q4G7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD40127.1"
FT                   /translation="MPQASRGRRRQAELVAAGVEILSESGWEGLTHRAVAARAEANPGL
FT                   VHYYFKGSDGLRLAVAAQAARQSITALFDELLSVEPDAFPATLKRMLRAARDDRHAGRV
FT                   TTALISASFDDPAIGALVREEFADGRSRVEQWLHTRHPSWSPARTRGAAALLVATIDSL
FT                   ALQLLLDPELPLDDIDATTRTLWRAMETDGPT"
FT   gene            complement(418947..420077)
FT                   /locus_tag="Snas_0411"
FT   CDS_pept        complement(418947..420077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0411"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: eba:ebA1220 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40128"
FT                   /db_xref="GOA:D3Q4G8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADD40128.1"
FT                   /translation="MSGFAACLALAAIVVCPSPAYAKGCEAESRDDPMPQTPWPLERMR
FT                   PERMWPLTRGEDMKVAVIDSGVGEHPILKGRVKAVDYTEDKLGARCDMASHGTLVAGII
FT                   AGADTSDSPFHGLAPDASILSYRVIDTVESATSRDAVVPVVDAIRDAVDKGADVINLSL
FT                   TSVHTTALQEAIEYAHRKDVVVVAAAGNSGAEGRKSYPAAYDTVIAVAGLRPNGEHVES
FT                   SSIGDYVDIAAPGEQIDGPAPSGGGYGRREKGGTSFAAPYVSATAALLKSYYPKDSPEE
FT                   TAARMLVTADHPPGGRNQLVGYGELNPYRALTTVLTAAEKREAITPDAPQQASDPGAVT
FT                   RKRALLFTACAAALVLVFLAAKVIVPRGRNRRWRCP"
FT   sig_peptide     complement(420009..420077)
FT                   /locus_tag="Snas_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(420248..421885)
FT                   /locus_tag="Snas_0412"
FT   CDS_pept        complement(420248..421885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0412"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   avi:Avi_2989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40129"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4G9"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADD40129.1"
FT                   /translation="MVTFAQLQQSTTQSLLSGADAARKLARELEQFGAETDRLRRGLSA
FT                   GWSGDDATAAGTKLTEHVTGYRNAATSYGRIDQIVSTLVGEMNAAKQQLESAVSAAPSI
FT                   PGRVDGNGTVYVNWEALGPQPSAAAVATAKQNAMKVAGWIRDAVTRANTADQNAAGQLS
FT                   AVTGGAVPAPSTAGATVPAEGTDPAKVKEWWDGLSQQQREALIAADPKAVGGLDGVPIA
FT                   VRDQANRLALTSEMDSVGGQLSAAREELSKLSPGSPHDLASRQEYQEAASRVRELDQRW
FT                   DNLNSVKDQLGRTDLQGSTEKLHLIDYDSASDGKLVMSVGNPDTADNVLTFVPGMTTDV
FT                   EGIGTSMDYSLRMQADAAANLPGSSTASVMWLGYDAPDGVFGAANDNAYRAAAGDLTTF
FT                   QHGLRATHEGPASLNTLLGHSYGSSTVGYAASQADLRIDNLVFVASPGATVDSAGDFQG
FT                   IGADHVFATRGSDDIIRHVPEWFHGNDPVDADFGGRVFPGGDGGHSDYWNPGNPAREGI
FT                   ADIVTGQSNQLPITLQDPSVLRPESVRP"
FT   gene            422110..423186
FT                   /locus_tag="Snas_0413"
FT   CDS_pept        422110..423186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0413"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: ppf:Pput_3233 alanine
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40130"
FT                   /db_xref="GOA:D3Q4H0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H0"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADD40130.1"
FT                   /translation="MASGGRVGITDVAKRAGVSVTTVSHVLSSRRPVAEATRQKVLRVI
FT                   EELDYRPNEVARSMRVQRTSTVGLVVPNISHPFYTAAARGLEDALRPEGYHCIVTSTDA
FT                   DRDVERDAVRQLLSRVDGFVISGADKRTEDIQPILDAKLPLVMLGADIPGPGFDVVTNA
FT                   DFESGSLAAQHMLERGHRRIAFITAEDDFAAGARRVEGYRSALDKAGLSTEASLVIRAA
FT                   ASLEGGAKALANLRKLAEPPDAVICVSDVMAIGAMYAAREAGLRIPEDVAVMGFDDTEA
FT                   AALVAPPLTTMATASRDHGRKAGELILRRIQDGTADVEPQRVVFPAKLIQRESTLGRWR
FT                   GLLRVLPGRERRLLARLG"
FT   gene            complement(423115..423387)
FT                   /locus_tag="Snas_0414"
FT   CDS_pept        complement(423115..423387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpsf6; cleavage and polyadenylation specific
FT                   factor 6"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40131"
FT                   /db_xref="GOA:D3Q4H1"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40131.1"
FT                   /translation="MSAEVASTPLWIPVLLGGTLLLSLAAVVAVILLSVRVNKLSAELR
FT                   ARHPVQPMRPAPPPHGYGQQPQSPQPGQQPPLPPGQNPQQPPPPA"
FT   sig_peptide     complement(423301..423387)
FT                   /locus_tag="Snas_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.252 at
FT                   residue 29"
FT   gene            complement(423410..423514)
FT                   /locus_tag="Snas_0415"
FT   CDS_pept        complement(423410..423514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40132"
FT                   /db_xref="GOA:D3Q4H2"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40132.1"
FT                   /translation="MGKLLALVIGGVCLLVVVAVIVGIVLLVSKAKRK"
FT   sig_peptide     complement(423455..423514)
FT                   /locus_tag="Snas_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.740 at
FT                   residue 20"
FT   gene            423614..424453
FT                   /locus_tag="Snas_0416"
FT   CDS_pept        423614..424453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0416"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: smt:Smal_2792
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40133"
FT                   /db_xref="GOA:D3Q4H3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H3"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADD40133.1"
FT                   /translation="MLRIHLSPEDVARLSFKTAPHLEIGASVQALRSPNGRPGVERWRN
FT                   RTLPRLPRAAWPLLEFVMENGHASRELLEYCGIEEYTDVPDGLVAACRAYEAVCMAPVK
FT                   DAIRACVDAELVRVGQALLSDGAATALDGLGPGISFDGRTLAIDADYGTDLDVHLGGQG
FT                   LRLIPALFWNRPGFTDEGVDVPTLVYPVARPKYPYSSSVDDMALEKLLGRNRARVLRAA
FT                   ASGGGTGELARSLGISAASASEHLGVLRDAGFVVTQRDGKAVRHHLTPLGAATLRFG"
FT   gene            424539..425879
FT                   /locus_tag="Snas_0417"
FT   CDS_pept        424539..425879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0417"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: scl:sce2422 putative metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40134"
FT                   /db_xref="GOA:D3Q4H4"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H4"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADD40134.1"
FT                   /translation="MKKRFLLLAGVLAASVAAVGPAQAAEPDEPVTPQDAKYLLSLDSD
FT                   ATGANWSGTQTVTFRNKSDRTMDTLWIRLWGNGRGGCDDRAVSIEPRFGGELGAETVDC
FT                   TAVPIELTRPVPAGRTGMVSVDVDIAVPEETYRFGRAGDYRFIGNAIPVLAVHDGTGEL
FT                   PPFTSFGESFYTLESDFLVTLDHPNAVKVPATGRSIAEVKHGKNTTTVIKANNVRDFAW
FT                   AAGPFAKVDTVSATGAKLRTWYPGDIDKAKAEEVTGWVKEGMDTFDAAYGEYPYSEMDT
FT                   VIGDWEGFAGMEYPGFILTEPAKVPAVHEAGHQWFYGLVGNDQYNDPWLDESVTQYMTN
FT                   TITGVPGYCATAPFWFSDGMRIDAGMDYYNEHIEDEYAPAIYGDGACMLAELETTIGKP
FT                   AMDEALRTAVAEFSGGVITSDELRGIFAEVSGQDLSAFWERWRNTGA"
FT   sig_peptide     424539..424613
FT                   /locus_tag="Snas_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(425927..426265)
FT                   /locus_tag="Snas_0418"
FT   CDS_pept        complement(425927..426265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0418"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: mrd:Mrad2831_3042 two component LuxR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40135"
FT                   /db_xref="GOA:D3Q4H5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H5"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD40135.1"
FT                   /translation="MLQSMEVRELAESCRLTGRPEPRIAPHPTTGPTRPAATSRREPAA
FT                   PSPRERKLLRLWARGYTDQRAARELEVSLRTVRRMSASLMERYGVHSRFQVGGLAHQRG
FT                   WISLEDLF"
FT   gene            426487..428211
FT                   /locus_tag="Snas_0419"
FT   CDS_pept        426487..428211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0419"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; KEGG: oca:OCAR_7320 ABC transporter,
FT                   permease/ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40136"
FT                   /db_xref="GOA:D3Q4H6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40136.1"
FT                   /translation="MSPLPPHADPGTPDARSPGRYLWWLLWKQPSRVFLGAFWGIVSSV
FT                   GIASLPFFMGKAVDEGLRARALEPLAWWTAGLILVGGVNAAANILRHRTMTHVRMDASL
FT                   RTVQVVNRHAARLGSVLARRVSTGEIVAIGASDAKQVSHAMTSAGPGVGSVVACVLIAV
FT                   MVLSISPLLGALVLVGVPAIVLSIGPLTKRLQRTESTYREHTGVLTARAGDIAAGLRVL
FT                   RGIGGESLFASRYRRRSGELLSEGYRVGAVASWIHALGSGLPGLFLALVTWLAARLVAA
FT                   GQISFGDMVAVYGYAAALVLPVAFFIEAIFDITRGRVAARRIIGVLNLEPAVTDPAEAV
FT                   AGPVGPAELYDPESGLRVPARRLAAVATADAESAALIVERIARYTDSDAAYGGVPLSDM
FT                   ALAEVRRRILLSGNDSHLFAGTLRDMVSPSGDIDDATIGTAVRQAAATDIVEALPDGLD
FT                   TEIDAQARTLSGGQRQRVRLVRALLAEPEVLILPEPTSAVDAHSEAAIAEGLREHRRDR
FT                   TTLVLSTSPLVLDRCDEVAFVEDGKVTATGTHARLLNTEPGYRALVLRGAEEEGETP"
FT   gene            428208..429953
FT                   /locus_tag="Snas_0420"
FT   CDS_pept        428208..429953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0420"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   mxa:MXAN_1097 efflux ABC transporter, permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40137"
FT                   /db_xref="GOA:D3Q4H7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40137.1"
FT                   /translation="MNENRLPLADKRQVRRAAWALLRGDAKALTMVIVLYCLAAVAGLA
FT                   APWLLGEIVDRVDSGAGIGTVDMLGLAIAGFLLAQLLFDRFGRYLGYRYGERALARMRE
FT                   DFIDDTLRLPVSVVERAGSGDLMTRSTGDVNTLGTIVRQALPEMVIAAAHIVFILGAVI
FT                   VLNPLFSLCALLMILPLWLIMRWYLRRARSAYLAEGDANTEMSEVMAATAAGAKTVEAF
FT                   GLADRRVAAGDATVAEGTRTRRKTLWLRTVMFPVADFSYVLPMAAALFFGGLLYFNDVV
FT                   SLGVVIAASLYLRQLVEPLDQALMWIEQLQQGGASFARVRGVAEVEPDRVPSGDEPVGD
FT                   TIEVTGVHYAYTSGRDVLHGIDLSVRAGEHLAVVGPSGAGKSTLGRLLAGVDAPRVGAV
FT                   KVGGVAVTDLDQAELRRRIALVTQDHHVFIGTVRDNLILAKPTATDDEVLSALGTVGAT
FT                   WLDTLPEGLDTQLGAGHTELDAPQAQQIALARLVLADPHTLILDEATSLLDPTAAREAE
FT                   RALAAVLHGRTVIAIAHRLHAAHDADRVAIVDGGRITELGSHDELVAAGGSYAALWRSW
FT                   HGETD"
FT   gene            complement(429950..430792)
FT                   /locus_tag="Snas_0421"
FT   CDS_pept        complement(429950..430792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0421"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bpt:Bpet0064 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40138"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H8"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADD40138.1"
FT                   /translation="MLTEVAPGVLVHQSELLRNNTVVVRGGTGVLLIDPGIRNSEMACL
FT                   ANDLRQVGQPVVAGFATHPDWDHVLWHPELGGAPRYGTARCAAFMREVLSKPDWKSHVA
FT                   AGFPPEIADDPPLDRFGRISGLPAGATRIPWDGPAVRIIEHPAHAPGHAALFIEERGVL
FT                   VAGDMLSDLFVPMLDDFGDTNDPVEEYLAGLRLLDDVAKDVDVVVPGHGSVGTAGEVTA
FT                   RIALDRAYVLALRDGEAFDDPRVGSSAEPGWEWISDIHEGQLRNLARRNERGGRPEAI"
FT   gene            complement(430918..431547)
FT                   /locus_tag="Snas_0422"
FT   CDS_pept        complement(430918..431547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0422"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); NADPH-
FT                   dependent FMN reductase; KEGG: spe:Spro_3177 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40139"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H9"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ADD40139.1"
FT                   /translation="MSQQTPHETAPVALVVVGHHRSDSLTAAIAARAAERLRQAGYRID
FT                   LLQLQQEGFEPRNQVADEPQYDNPKPVYSAEVHALADRLHAADVVVPVFPVWWFGLPAV
FT                   MKGWLDRVWNHGLTYGVKPEPMAGKRMLWIGLAGIPDHDPNADLVRFLLDNTLRRGLSE
FT                   YCDVTDVHTLALFHSEGTGLTGNTRERHFQRFFERVDESVAKLLAG"
FT   gene            431629..432561
FT                   /locus_tag="Snas_0423"
FT   CDS_pept        431629..432561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0423"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: rle:RL2940 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40140"
FT                   /db_xref="GOA:D3Q4I0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADD40140.1"
FT                   /translation="MDPLSDMLGGIRAEGACVNQVSLEPPWAIRFAEGGALTLLTAVRG
FT                   EGVLVLADGTEHKLNEGSTALVRGDEPFHLADSAAAMDGPIKVLSGNGYETVCELSLDE
FT                   SDATTAVIVGTYRTTCTRQERLLRTLPSALVVDEDTTDATKPEVATLGGWLDAVTDALR
FT                   RRRGPGGQALIDRLLDWGLVCTLACWFEHQGADAPAWYRGAQDPVAGPALEAIHNRPQH
FT                   LWTVGALAAEAKVSRAHLAKRFAEVMGQPPLKYLTEWRMYTAEDLLSDSDMSVAEVARA
FT                   VGYADPFAFSTAFKRHRGTSPRQYRSAVV"
FT   gene            complement(432572..432964)
FT                   /locus_tag="Snas_0424"
FT   CDS_pept        complement(432572..432964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40141"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40141.1"
FT                   /translation="MNPSTRFTVEVTAHDEVSTEVLTRQLRIDLRALGPLSLEPVFASM
FT                   PVSPDDDPLLPPLRSGSASHQGVIAATGALSDPAVKNLFELLVAFVNRTGVGSVTVRRG
FT                   EDAVSVAGASHEDSSRELSELEKLLG"
FT   gene            433071..433844
FT                   /locus_tag="Snas_0425"
FT   CDS_pept        433071..433844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0425"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; SMART:
FT                   peptidase S1 and S6 chymotrypsin/Hap; KEGG: GJ19257 gene
FT                   product from transcript GJ19257- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40142"
FT                   /db_xref="GOA:D3Q4I2"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I2"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADD40142.1"
FT                   /translation="MFRSKLRKLLPIAVFVALAIPAAFVTLPALADDTGKSSDDSRIVG
FT                   GGTVPASTKTPWIVALHNNGDFRCTSTQISRNWILTAAHCVTTGGKYKARIGAKTRSSG
FT                   GKVIDISTIKIHPKYQQGNLYDIAVIKLKTPHTNTYPKLAFSKSHLKLGQASTIYGWGA
FT                   TKADWTGPLPEKLKYSKGKTTKKYCEMPEDVCVIGDGAVAGGDSGGPVFIKSASTGKTM
FT                   LAGACEAGHNPANWKWGGYASTVFHQKWIKGTTDL"
FT   sig_peptide     433071..433166
FT                   /locus_tag="Snas_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            433963..434928
FT                   /locus_tag="Snas_0426"
FT   CDS_pept        433963..434928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0426"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   hch:HCH_04183 ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40143"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I3"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ADD40143.1"
FT                   /translation="MESQRLSVDTATRDRRAAASLVGLSAGDAYGNQFFDLDAWRQIPC
FT                   PGRLRQTPVYEPGHVESFLKAKLLPGGQWPWTDDSEMAFGIVAELRRNGEIDPDVLAAT
FT                   WASHYQLPRDYGLSALRILDGVSEGGDWRPLSRSAFDGAGSLGNGSAMRIAPLGAWFAD
FT                   DLDAVVTQARLASEITHSHVDGIAGGIATAMAAALSVRGSSDPGEFLEAILDVTPDGEV
FT                   RHGIEEAAAHPAGTDPAEVAAHVGNGRYILATDTVPLCLWVAAHHLGDYPTAVRTVVSL
FT                   GGDIDTNAAIVGGIVAAGDLREPVPGEWLAAREPYPHWFA"
FT   gene            complement(434954..435216)
FT                   /pseudo
FT                   /locus_tag="Snas_0427"
FT   gene            435200..435358
FT                   /locus_tag="Snas_0428"
FT   CDS_pept        435200..435358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40144"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40144.1"
FT                   /translation="MMRSRGGTVAFCAAREAYERYAIPATGRPLFQAALPNLTPRAASS
FT                   VDFGNRG"
FT   gene            complement(435410..436258)
FT                   /locus_tag="Snas_0429"
FT   CDS_pept        complement(435410..436258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0429"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   sew:SeSA_B0068 streptothricin acetyltransferase Sat-1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40145"
FT                   /db_xref="GOA:D3Q4I5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD40145.1"
FT                   /translation="MRIKANGVELCVETFGAPEDPPVLLIGVTMLSWPDELCQALAGRY
FT                   VVRYDLRDTGQSTFADPDAPGYDLRDLVSDASELLRALDLGPAHVVGMGVGGFIAQLLA
FT                   LDHPDRVASLTLISTRPVAPGPVDPDLPDHSPQMMQRLFGRAKPDWTDRDSVVDYMTGS
FT                   ARILSGTRGFDEQDARATAAAIFDRAEPTDKAQRASHLGIMFAAIDSKPRWRERLGEIK
FT                   APTLVVHGDEDPFFPHGNGVALAAEIPDASLLTLPGVGQGVPRAAWPTVVEALLRHTSG
FT                   T"
FT   gene            complement(436328..437218)
FT                   /locus_tag="Snas_0430"
FT   CDS_pept        complement(436328..437218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0430"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pat:Patl_0074
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40146"
FT                   /db_xref="GOA:D3Q4I6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD40146.1"
FT                   /translation="MSFRTPGKTVVPEYARPMSEFSETEVWRAEVLVDGEPASYLTAGQ
FT                   DGPVVLLLHGTYWSRVWLPVIGELARAGLRPVAVDFPGLGRSGGELTLETATVPALADW
FT                   VVRFASALRISGPLAVAGHDIGGAVAQHLLVHDLLDVSRLALVNSVAYDSWPAPHVARY
FT                   RDPDTVAATTAAELLSARRRAVASALSGAATEGLIAEYLEPWTEARVQRSWLAMAGAAD
FT                   SRHTLDLVPALRRSTVPKLLIWGEDDDFEKVAYAEMFASEMPRTTLMRIPDADHIPTEN
FT                   APVPIARALGDFFTA"
FT   gene            437238..438200
FT                   /locus_tag="Snas_0431"
FT   CDS_pept        437238..438200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0431"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: reu:Reut_B3587 transcriptional activator FtrA"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40147"
FT                   /db_xref="GOA:D3Q4I7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I7"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADD40147.1"
FT                   /translation="MKRHRVVALVNEPQSPFELASAAEVFGGVRPDVPRHYDFRVCAEH
FT                   PGPVATTVGYPMLVDAGLAALRRADTVVIPGWQPHDAPVSAAIIAALRSAHRRGARIAA
FT                   ICTGAFVLARTGLLDGRRATTHWRHTAELAADFPELRVDRDVLFVDHGDVATSAGTGAG
FT                   IDLCLHLVRSDHGAAYAAQIALNMVLPPHREGSQLQYATRPAPVRADESLAPVLEWAST
FT                   RLHNRLTVGRLAEQAGLSERTLARRFAEQLGVSPGQWLLGQRLDAARVLLESSDLPVDA
FT                   IVTRVGLASAVNLRRRFRSRFGTTPGGYRRAFGEGRRLS"
FT   gene            438208..438723
FT                   /locus_tag="Snas_0432"
FT   CDS_pept        438208..438723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0432"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: protein of unknown function DUF664"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40148"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I8"
FT                   /inference="protein motif:PFAM:PF04978"
FT                   /protein_id="ADD40148.1"
FT                   /translation="MTRTDTPTEWDERSTIMAMLDYARASARAKCEGLTDEQARTAPVA
FT                   TSPLTNLASLIGHLRWVEFDWIETVFLGIPDQGRTPWDDDPDDVDAEMTLALRTPLATL
FT                   LSDYEQQCERYNKLIADHDLDERSRNPHPGRQPVTLRWILLHLVEEISRHNGHMDIVRE
FT                   IVDGQTGR"
FT   gene            complement(438726..439721)
FT                   /locus_tag="Snas_0433"
FT   CDS_pept        complement(438726..439721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_1553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40149"
FT                   /db_xref="GOA:D3Q4I9"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4I9"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_1553"
FT                   /protein_id="ADD40149.1"
FT                   /translation="MQDWSRGWTPPDYRVDGDGKVIGATNPRAPHNWGRWGDLDELGTV
FT                   NYITAKVRLAAAELVTTGEVVSCAIPIGDEMPVHPSRPAVVHTHALTGTDVVAGFVADR
FT                   ASGGFHGADDYVFMPLQSGTHWDGLTHGFGASTMYNGFWIGNVGADGARRLSTHLLADH
FT                   MTGRGVLLDLPRAAGVDRLPGGHAITPAELDACAHAQNVELRSGDILLIRTGELGWFYS
FT                   LDDKAPYWSGIHAGLSITTVDWIHRNEIAAIGIDNRTFEVTPFEPGHQETYPLHARLIR
FT                   DLGLTIGELWWLDDLAEVCARDDRWEFMLTAPPLTVTGSSGSPVSPLAFF"
FT   gene            439853..440290
FT                   /pseudo
FT                   /locus_tag="Snas_0434"
FT   gene            complement(440358..441437)
FT                   /locus_tag="Snas_0435"
FT   CDS_pept        complement(440358..441437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40150"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40150.1"
FT                   /translation="MTKTTVRQLAERMAELGMITRDAAEAALAHIGRWRLEALDEIVDA
FT                   DELIDYLPEFGVAISVHGEDVDHVEDYYQSILESDVTACTGGAVTVTDVTLVRVGEDTE
FT                   WLYFLRNGEPVWWYVEHQSDDYVDQLSVSEQFEDLYPGGDDPRGFLLVHRSKAEACQDD
FT                   VYVLATIEQATALRDEFGIDFLVLHRRQLPVQDTREAGDFLEHWTSNMDELLHSWRSRF
FT                   LPPGFPFDFSVASLDTLERLVLNRFADWDAVQRAAADPFVVGAVGYLGETLLRAAPGSW
FT                   DYWTGASVYDRTPLLRSNTPKAFGTTVVPLVLLSRVAGDRDFGILAEAVEDLLRAEASY
FT                   AEALRALDTAPAAEDDEDF"
FT   gene            complement(441452..443701)
FT                   /locus_tag="Snas_0436"
FT   CDS_pept        complement(441452..443701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0436"
FT                   /product="Adenosinetriphosphatase"
FT                   /EC_number="3.6.1.3"
FT                   /note="KEGG: met:M446_6826 AAA family ATPase, CDC48
FT                   subfamily protein; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40151"
FT                   /db_xref="GOA:D3Q4J1"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J1"
FT                   /inference="protein motif:PRIAM:3.6.1.3"
FT                   /protein_id="ADD40151.1"
FT                   /translation="MTSLNLTISLRPAALDARRGIVRLHPEVLAALGLLPGDPVRLHGR
FT                   RTTTGIALAAERYAGRGQVYADDLTLGNVGAIDGDEVAVEPVALAAARRVVVTAPVEIT
FT                   AAVSAETLRLALLSKVVSVGDEVSLLPLDIGGAGRDSVEQARRSLSNTVGMGWTTVLLS
FT                   IADAEPAEAVMITSDTVVSWQRAGSAPPVRRRHDMHLVRPPDEPAAPAAPRAATANLAP
FT                   AAAETPEPEVVDFEELAGVRAEAEQLRELLDLAFHHREVLATVGTEISLGILVTGPSGT
FT                   GKSTLIRSVAKEVKANLVHVWAPDIAALAANDANAALRRQVAKLTPPGVLMVSGVEALA
FT                   PRDESTPMSTVFRKTVRTILEAGHSVVCTTANPEAVSPELRQSGLLEHEIGIPMPDALA
FT                   RKELLTAFTQTMRLAAEVHLEEVAAKAPGFVAADLSTLVREAGVRAAMRAKEGGATALQ
FT                   PQDFTAALATVRPSSMADSTLELAQITLDDVGDMTEVKQTLTEAVLWPLTYPDTFTRLG
FT                   IEAPRGVLLYGPPGCGKTYLVKAIAGSGRSNVMSVKGAELLNKWVGESEASVRELFRRA
FT                   RQAAPTLLFFDELDALAPVRGQDSNSGTADRVVASLLTELDGVESLRNVVVIGATNRPD
FT                   MIDPALLRPGRLERLVYVPPPDAEARAAILRSASKDVPLASDVDLDDLGAALDNYSAAD
FT                   CAALIRESALSAMRESMDASEVTREHVADARTRVRPSLNPEQLAWLENYAKKRAS"
FT   gene            complement(443711..444142)
FT                   /locus_tag="Snas_0437"
FT   CDS_pept        complement(443711..444142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_5847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40152"
FT                   /db_xref="GOA:D3Q4J2"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40152.1"
FT                   /translation="MTKVDKTPGSALNRWAGYLMVFIALAHTAFFVPAAEWSQWLSGGL
FT                   WNGAASDASYATFWALPGGFVPALLVLGLLVVRQARRGEYLPAYVGWVLLAWCVGCTAL
FT                   IGPSGFISGIAPAVLLIGGNLAARRAATSHSHRAGVAAG"
FT   gene            complement(444221..444421)
FT                   /locus_tag="Snas_0438"
FT   CDS_pept        complement(444221..444421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40153"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40153.1"
FT                   /translation="MNWTWQFEDAEGKAIAARDSEFSNQGDAESWLGEEWRELAESGAA
FT                   VAILKNGDAVEYRMALTPEES"
FT   gene            complement(444445..445101)
FT                   /locus_tag="Snas_0439"
FT   CDS_pept        complement(444445..445101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0439"
FT                   /product="Hly-III family protein"
FT                   /note="PFAM: Hly-III family protein; KEGG: afw:Anae109_1200
FT                   hemolysin III family channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40154"
FT                   /db_xref="GOA:D3Q4J4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J4"
FT                   /inference="protein motif:PFAM:PF03006"
FT                   /protein_id="ADD40154.1"
FT                   /translation="MTAVINGPTKPRLRGLLHATAIPVAVIGAIVLVVIAPTIDGKIAS
FT                   AIYGLTSISLFGVSGFYHRSGNGYASEWLRRWDHANIYLIIAGTYTPFGVLALTGGAQL
FT                   AVLLIIWIGAAAGVAFRTVWLGAPRWLYTSLYIVLGWVAIFFIPQFLEGVGLAAVILVV
FT                   AGGLLYSLGAVVYGLKRPDPWPEVFGFHEIFHAFTVAAYLCQFSSVVLVVLASAP"
FT   gene            445234..447840
FT                   /locus_tag="Snas_0440"
FT   CDS_pept        445234..447840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0440"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; X-Pro dipeptidyl-
FT                   peptidase domain protein; alpha/beta hydrolase fold;
FT                   peptidase S15; SMART: AAA ATPase; KEGG: mxa:MXAN_5584 ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40155"
FT                   /db_xref="GOA:D3Q4J5"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40155.1"
FT                   /translation="MRVWVRSKLRVLKARKRSRWVTVVVIVLALVGGVGVWWWATSPPP
FT                   HTTEDLRIAVDGKEPTKLDARLYLPETQPAPAVLLSHGFGGTKDTVVEEAEQLVAQGYV
FT                   VLTYTARGFGDSGGKIHMNAPDYEVNDASQLLDFLADRDEVKRDGADDPQVAAVGASYG
FT                   GALSLLLAGHDDRVDAIVPQVTWNSLADSLFPNGTGDGDGVFKQSWAGLFYANGLGAVA
FT                   PQQEAPDGEESSAEPGQQGQVPPQPGVLPTGENPACGRWADDVCEMYQDIAATGRISES
FT                   AKKLLDASSPQSILDKIEAPTLLVQGQADTLFDLNQANANAKGITEAPVKVAWFSGGHD
FT                   AMGTESDQNHVEVLTGEWLYHYLRGEGDKPDDSFTFSRISGVTSSSIDLATLGMTTPKY
FT                   PGMEGSTSPATEDVKGREEQTIASPPGGTPAAISTIPAFGQLASLPGAGIARDIPGQFA
FT                   MAETEPIADEPVDVVGSPKVRLKVASDSGEAVLFVKLYDVADTGEATLPNGLIAPVRLT
FT                   GLESDIDTAEEVEVELPGIVRRVEPGHKLRVVVATSDQAYAGPQDPAEYTVQIRPEVEL
FT                   PQTPASPLPSQDAAWHTALIVLLVGIPVAIVAAIVIARLRHRRTDRSVEAETADTPLVV
FT                   RGLRKVYGDGFVAVDGVDYQVQRGQVMGLLGPNGAGKTTTLRVLMGLLQPTEGEIRVFG
FT                   HQVTPGAPVLSRLGALVEGPGLLPHLSGIDNLKMYWRSTGRPWEDARIDRVVEIADLGD
FT                   RINRKVGRYSHGMKQRIAIAQAMLGLPELLVLDEPTDGLDPPQIAEMRRVLHDYASDGR
FT                   AVLVSSHLLAEVEQTCTHVVVMSRGKVVAAGPVADIIGTGEGHRLEDAFLELVEQK"
FT   sig_peptide     445234..445377
FT                   /locus_tag="Snas_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.633 at
FT                   residue 48"
FT   gene            447837..448727
FT                   /locus_tag="Snas_0441"
FT   CDS_pept        447837..448727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lch:Lcho_1479 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40156"
FT                   /db_xref="GOA:D3Q4J6"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40156.1"
FT                   /translation="MTTHAAETAPAADGSARGYSAHATLTFATEFRRQLTRRRTQVVLG
FT                   FMALLPIVLLIAFTLGSGRQDNDDDSGNAFALADFGTVSGANFTLFALLVSSSFLLVIM
FT                   MALFCGDTVAGEASWGSLRYLLATPVPRGRLLAIKFGVGLSFGGLSMLALTGFSLLVGT
FT                   LAYGWKPLQAPLGGSLPATDALWRILGVAGYLAVMLLAVAALALLLSVSTDAPLAAVGG
FT                   AVLMQIVSNILNAVPELGDLRAILPTRYGQAWLSFLSTPIQWDEMVRGTVTSLSYATVF
FT                   TIWAFWKFSRKDVTS"
FT   gene            448808..449590
FT                   /locus_tag="Snas_0442"
FT   CDS_pept        448808..449590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo3335 putative type 4 pilus biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40157"
FT                   /db_xref="GOA:D3Q4J7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40157.1"
FT                   /translation="MSNPPQGLGEPVNGAPDMRAPAGPAPRPLYPQYPTTAPPLAPPPL
FT                   DDEPRDKTKWALLVGLAGVAIIGLVTALFVIPDGPSGGPSPDAAASSDVAIECEPGPAP
FT                   EGEPLTAERFYEDKVWTNSIDDNVTADRTGRWNHEGCCDVGLGSAQQELNDLGCAYGIE
FT                   AAYESADGHLGIAQLILAFGDTGAAMAASDMEFTSFRLHEESGVYDDSMEVYGYVEPSG
FT                   DFLVLTIGSIDSDDSTIVNEAQSTLEAFHVDYASTLPY"
FT   gene            complement(449607..450566)
FT                   /locus_tag="Snas_0443"
FT   CDS_pept        complement(449607..450566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40158"
FT                   /db_xref="GOA:D3Q4J8"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40158.1"
FT                   /translation="MNEKTDSESGARLRKRRKWLWWSIFLSVLVLLVGTATVVLGGYFT
FT                   EKGKCPESIPSTGVKEPVGEANEKWLKLVDSGFTPFDKGPVKGAAEDLSFGYLLKNTSE
FT                   YVLYNADIDVSFKDANGDDPTALLKKSDQRENASVLDSVNIPVIFPGQTVGMGSSIAIW
FT                   TEHGEDPETGEPVDLEKIDYDKLTLDIDMASGQWWEPSNDKLDFTRVAAKSVDVVDSES
FT                   SEHEYLDGREWLSADIEYLVESKACQDLKAYKPSTVVFDAENKIVGGDISGSKGDTGEG
FT                   GTYRANSDDVRYEVTELLPEGGAVKVYPYARPTKPKLE"
FT   sig_peptide     complement(450441..450566)
FT                   /locus_tag="Snas_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.765 at
FT                   residue 42"
FT   gene            complement(451125..452627)
FT                   /locus_tag="Snas_0444"
FT   CDS_pept        complement(451125..452627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40159"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4J9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40159.1"
FT                   /translation="MNDAQGDGGGGGSAVGSELAKASKQIRRLATGREFEDEGYQFAWT
FT                   DGDKDDYENPGWLESDWKQLTLDRYLAGPESNTKYGPANKGQNSTYYVVEGSEVYYYKY
FT                   DKFAWVTDLLSEFGKGSPSGLHDICKSVKGVPPKLCAKGDWPKELDKFKREYSLKEIAG
FT                   EEVLLDSGVSEMERWSGEAAATFVLAFGENLTKWEEALWGMYFLSEAVLAGVEAQTAIV
FT                   IAARDDALTIAEKTANALVAVNHWSKDDLLVALGVAAAIIPAALSFGGFALTATIIGAG
FT                   IGLSNTMVSNSDSTGVSVPESEKKHTKRTMNGDSPADILDRFRTEIGTIREEASTQEEE
FT                   LANKLERVYNSSLDIRTEKLEITYPDGSKSPADSGLGKRETKAHTSYLKDAAVTSFPQA
FT                   ASYVLGARDEVARTAGLDSDTTFHSEHRDSVSPAAEPWRLVRDLLQDITAANGKKVEDA
FT                   GEVIFKAAVDMELVDGEEAANIEKTYDDLGTGESGRKHKAIP"
FT   gene            453058..454314
FT                   /locus_tag="Snas_0445"
FT   CDS_pept        453058..454314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0445"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: afw:Anae109_3605 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40160"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K0"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADD40160.1"
FT                   /translation="MTTTSVFTDSPAVGLVCRGCSATYPLAAQHACWECFGPLEVDYDA
FT                   TALAKVTREQIESGPDNIWRYAALLPAGVDAATRVTLNPGMTPLVKADNLAAELGMKAL
FT                   WVKDDSANPTHSFKDRVVSVALTAASQLGFDRFACASTGNLANSVAAHAARAGKPSIVF
FT                   IPYDLEPGKVITTAVYGGQLVAIEGSYDDVNRLCSELTETDEFENTAFVNVNVRPFYAE
FT                   GSKTLGYEVAEQLGWRLPRQVVIPMASGELLTKVDKAFTEMGEIGLVDPSEVKVFGAQS
FT                   SGCNPIATALRAGTDEITPVKPTGIAKSLNIGDPAAGPYAIESVRRTGGWMADVDDDEI
FT                   REGIRLLARTTGVFAETAGGVVVATLKKLLAEGRLDPEAETVIYNTGEGLKTLDAVTAG
FT                   PTHQVKPSLKSVKEAGLLS"
FT   gene            complement(454311..455516)
FT                   /locus_tag="Snas_0446"
FT   CDS_pept        complement(454311..455516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0446"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: bxe:Bxe_A0959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40161"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K1"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ADD40161.1"
FT                   /translation="MTSGLDTADITSRVNRYVDVGRHAEAERIVRRALHTDPGNISLLN
FT                   DLSYTLYKQKRHDEMLEVCRTALAIEPDSPDMLQRLGLALEALGRRAEAIEATSRGLEQ
FT                   APDHHYLMRDHAHLLLLDGLNHEAVAGFRRALEVYPDDAVLMGLLGDALLQVDEFREAH
FT                   ELLTASLADRPESADALLSLGTAQMFLFHVRASLKTLALTVRADPDDARRCAVVRYLMA
FT                   WPISHIYSALRWSLPAAALAALTASLLGTTDWLQWTITGFTFAAFAYSAHWFARGGLPA
FT                   WRALFRLPPGEIALTATGIGLGYGGCVAVLAATWLSSPLLAGIGLAATALMWIVEAVEW
FT                   SLDPDEDQTVPLHRRTLANLRPIVKDDLTVLKQLRARRELRRARATAATEPSRQASSQP
FT                   PR"
FT   gene            complement(455513..455947)
FT                   /locus_tag="Snas_0447"
FT   CDS_pept        complement(455513..455947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40162"
FT                   /db_xref="GOA:D3Q4K2"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40162.1"
FT                   /translation="MTWPIIEVHAGLRWSLPPLALAALLCAATDSVGSNALGWTVTAAP
FT                   LAALAHATHWAIRAGSRGWRAIGRVPRPQRITLTAGLGLGASGLTAVIVSVWTASTVLA
FT                   ASGLVAGLALWPVLAYEWAPPPFKKRLLSPLPRLGRPSRE"
FT   gene            complement(455944..456162)
FT                   /locus_tag="Snas_0448"
FT   CDS_pept        complement(455944..456162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40163"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40163.1"
FT                   /translation="MERDDARAVATRAADYTKLRRGAAAERMLRAALTSEPGNGVLLIE
FT                   LARALHAQKRHDEALSAAESGTTSGAA"
FT   gene            complement(456203..457420)
FT                   /locus_tag="Snas_0449"
FT   CDS_pept        complement(456203..457420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0449"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bgl:bglu_1g08550
FT                   TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40164"
FT                   /db_xref="GOA:D3Q4K4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K4"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ADD40164.1"
FT                   /translation="MSEAREAVTESPSDITARVDRYTAVGRFAEAERMVRRALVTYPEH
FT                   INLLNKLSYTLFSQQRYDEDLEVTDKALALDPNEPVLYWRRSWTLWRLDRRDEAIALAR
FT                   RSLELDPHRELRHAVFEDLGRYYNWEGRHPEAFEITERGLTEFPGDTALLEVAGEALRR
FT                   QSRYYEADVYYRASLEADPHLGINWYGKALNDMMLGRARASLAGFAHSMVLEPDDDWRA
FT                   ERVRYFMGWPISGYAASFRWTLPLASATALLNPSGTGWPRWFGLVLLALTLAHATSWLY
FT                   RGGKLSWTALPRLLPLEKLSITLPAVLATLGLAAAVSALLTGSAPLGWLGLAAGVLLWP
FT                   AFGFDNALNPNESRDSSLPRRTLANTQWWIIDDFTGHPKKQWDRLRHNLKRDKSTPAHI
FT                   SPPSDD"
FT   gene            complement(457417..458709)
FT                   /locus_tag="Snas_0450"
FT   CDS_pept        complement(457417..458709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0450"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: afw:Anae109_3546 ATPase central domain-
FT                   containing protein; PFAM: AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40165"
FT                   /db_xref="GOA:D3Q4K5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K5"
FT                   /inference="protein motif:PRIAM:3.6.4.3"
FT                   /protein_id="ADD40165.1"
FT                   /translation="MAFARMFMPSADEVAAAVTEDRYSSSMQSPPPLLASLLAAVRAAP
FT                   DDVPLRVHVSQVLLDHDRAAEALEHCSVVLAREPGNAEALALLRRATAALSGTPEPITD
FT                   EPATEPEESTGFDWTRAEREVSAETVNPRTDPVTEDIETSTVTLADVAGMEAVKKRLEI
FT                   AFLGPMRRPDMAAAFGKSTSGGLLLYGPPGCGKTYIARALAGQLRAKFLAVEITDVLDA
FT                   YVGDRERHIAEVFATARLNAPCVLFFDELDALGQKRSHLRHDSWLRTVVNTLLNEMDSV
FT                   NSRNDGVFVLGATNHPWDVDSALRRPGRFDRMVLVLPPDRPARLALLNMQLAGRPLGEL
FT                   DVDALAEATGDYSGADLKHLVDSAAELALSDSMVRGEVRPISMDDFGKVLKEVKPSTGP
FT                   WLDTARNVTAFGNSDGTYDDLRDYLKRRRRG"
FT   gene            complement(458757..459476)
FT                   /locus_tag="Snas_0451"
FT   CDS_pept        complement(458757..459476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6011 copper ABC transporter, permease
FT                   protein NosY"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40166"
FT                   /db_xref="GOA:D3Q4K6"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40166.1"
FT                   /translation="MNSTIARLTFSSLLRRWRGLLLALLPIVLLLLSAAVRGMVPTEAA
FT                   RNAADPLLGNLNMATFVPLIALIVGTGAISTEIDDGSIVYMLTKPLSRWKIALTKYAVA
FT                   VATALAFAAVPTFLAGLILAGVSDGVAIGYGLAAAIASIIYCALFIMIGVLSRQAVIIG
FT                   LIYVVLWDSLVAGLVDGAKNLSVQYWAEAIASTVAPNAITAQINVVAAAVLAVVATGAA
FT                   LWYGGRRLRSLTLAGES"
FT   sig_peptide     complement(459360..459476)
FT                   /locus_tag="Snas_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 39"
FT   gene            complement(459484..460401)
FT                   /locus_tag="Snas_0452"
FT   CDS_pept        complement(459484..460401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0452"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dal:Dalk_2887 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40167"
FT                   /db_xref="GOA:D3Q4K7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40167.1"
FT                   /translation="MSTIQIDRVSKWFGHVVAVNDVTMTVAPGITGLLGPNGAGKTTLL
FT                   NMMGGFAGPSSGTVTLDGVPTWRNEEIYRTIGMVPEAEAMYDFLTGEQFVLANAKLHGL
FT                   PDPGAAARRAIDTVEMAPAAGRAIETYSKGMRQRMKMAAALVHDPAVLLLDEPFNGMDP
FT                   RQRLQLMDMLRRMGSEGRTVLFSSHILEEVEQLATHIEVMVSGRHAASGDYRAIRRLMT
FT                   DRPHRYTLRSDDDRGLASALVAEGVVGAVQVDGEDNALHVQTSDFGRFTVSLPKIARDN
FT                   KIRLYDVSPADESLESVFGYLVRS"
FT   gene            complement(460398..461291)
FT                   /locus_tag="Snas_0453"
FT   CDS_pept        complement(460398..461291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cco:CCC13826_1721 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40168"
FT                   /db_xref="GOA:D3Q4K8"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40168.1"
FT                   /translation="MSSPVNGLPNSGVIHNIGYRRYEGARLDSFNIAKALYSQTLRGSY
FT                   GIGRGIVAKLFPWFLVGAILLPAFIIMAIMNFQKQPILEISDYTMFVQAVPALFLAVQA
FT                   PHAVSRDLRFGVMPLYLSRPLTYRGYVHAKIAGVWTGLFALMAAPLLILYLANLLIKLP
FT                   FGDSTLDLGASLFGCALLAALFTMLGLLIASVTPRRGLGVAAIIAVLMGSFGVASFAQT
FT                   FLMEFGSTSSAHMAGMLSPVTLYQGVQAFLFDTKQTLVNIRPDLAIGGVLTLVTIAILV
FT                   LSYLLLMARYRKVSSQ"
FT   gene            complement(461275..462225)
FT                   /locus_tag="Snas_0454"
FT   CDS_pept        complement(461275..462225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0454"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: noc:Noc_2142 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40169"
FT                   /db_xref="GOA:D3Q4K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4K9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40169.1"
FT                   /translation="MSTITIEALTKRYSRVTALDQLTVDVPEGVCGLVGANGAGKSTLI
FT                   KILLGLSTPTAGRASVLGYDIASHGPEIRQLVGYMPEHDCLPPDVSAAEFVMHMARISG
FT                   LPTGAARERTADTLRHVGLMEERYRRMGGYSTGMKQRVKLAQALVHDPKLVFLDEPTNG
FT                   LDPVGRDEMLDLIRRIHTKFGISVLVTSHLLGELERTSDHVIIIDGGRLLKSRSTGELT
FT                   SQTHTLILEVLDPAGGADAADRAQASLEASGLGVRRAGELMYVPATDESTFDSIRDTVA
FT                   HAGLGLVRLQRDRHHIAEIFAENTPEGSQDHVVTG"
FT   gene            462435..464027
FT                   /locus_tag="Snas_0455"
FT   CDS_pept        462435..464027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0455"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: xau:Xaut_0995 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40170"
FT                   /db_xref="GOA:D3Q4L0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADD40170.1"
FT                   /translation="MARRYLLEERVASGTMGEVWRASDTRRARTVAVKLLHADLSESAA
FT                   ARVRFKSEATVVAALNSPQIATVYEYGEEPDGDTVRSYLVMEWIKGRSLAELLTQKPRL
FT                   HVHETVRVITEAAEALHAAHVAGIVHRDVKPGNILITNDFAVKLIDFGIASARDESTGD
FT                   ESGKILGTLAYLSPEQITHWRLTPGVDVYALGIVAYECLAGAPPFGSDVPAETLAGHLS
FT                   RTPAPLPPRVPEPIAEVILKAIRKRAVNRWQSAAEFASALREAAATPPPAPTSPATPTP
FT                   EPAPRATSDPRPKPGRRRMTLQLVGLITVLALIAVAVLLLWPSLFSGQSDQDTIPDQRA
FT                   AADSGTDDESDDPTSPDDESSESTKSAGKPGDPASKSDEPSDDPTSGDDDPGGGQTVPD
FT                   LKGTQTYMVEYTLQQHGYENSSGKAQSEKPGEENCVVTAQSPSAGTEASPSTTIIYYYR
FT                   APVYGCGNESRISSVDYQPMTTPSQPSVIRDTMRRRYVSRRGLRGDRPRLGGEPVSLEG
FT                   AHRIRIDGRGLAR"
FT   gene            464005..465477
FT                   /locus_tag="Snas_0456"
FT   CDS_pept        464005..465477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0456"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: azo:azo3774 putative serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40171"
FT                   /db_xref="GOA:D3Q4L1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADD40171.1"
FT                   /translation="MGEVWRGDDTRLNRPVAVKLLHSSLSENKQFRERFAREATLVAGL
FT                   KGQHVATVYDYGEEDSSGAVRSYLVMELVDGRPLSEILDERGPLPVPETVRVIGQAAEG
FT                   LRAAHEAGIIHRDVKPANILLTPDGSVKLIDFGIAHLRGKAGLTDSGIFLGTLAYVCPD
FT                   QIADEEPTPSTDIYSLGVVAYECLTGSPPFASDVPAAVLNSHLYEPPPPLPEEIPAHVS
FT                   HAILMALRKRPEHRWQTMAEFAQGIRNPDTPAPPPEPTSTPDPETPARAPKRKLQWLIQ
FT                   GAMAVVIAILSILLWQLPWQIPGFPGHGDNGGNGGQQFPGIVAESDEPAQDDTPAPGQS
FT                   ETPDVDDKSNKNSSDDSTPESAEEADTPTPANDNDDGGNDETASVPRLKGKNPNDATAL
FT                   LNQHGFHNHNPVRTDPQDGKKQCVVYRQSPRPNTTASTDTTITYYYRADPKTSCDGNDT
FT                   QSDDDPPPNPHSTWTPHPPRPSTTPHTRLRRQ"
FT   gene            465502..465574
FT                   /locus_tag="Snas_R0010"
FT                   /note="tRNA-Lys1"
FT   tRNA            465502..465574
FT                   /locus_tag="Snas_R0010"
FT                   /product="tRNA-Lys"
FT   gene            complement(465595..467058)
FT                   /locus_tag="Snas_0457"
FT   CDS_pept        complement(465595..467058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0457"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mlo:mlr0475
FT                   bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40172"
FT                   /db_xref="GOA:D3Q4L2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L2"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADD40172.1"
FT                   /translation="MAGKGVIFKRCGCRNSTTGKRLLSECPRLSERGHGSWYFHCSVVD
FT                   LWGRHHRIRRGGFASRAAATTARDTVVEQSAAQATGSTWTVTRWLRFWLAHRQTIRPTT
FT                   ARSYQLHIDLVGPYLDKVSLAGLTCQHLTEMFAELAARPNRHGRPCAAGTWQRVRATLR
FT                   AALNGAIREGLIDRNAARHVELANPHRPHAVVWTADRVEAWRRTGIRPAVAVWTAAQLV
FT                   RFLDCVQGDREYVLWSLIAFRGMRRGEAAGLRWMDVDLDRRQLMVTQQLATLGRAIYTC
FT                   PPKSRSSRRIVALDRHTVALLREHAERQRREQRAAGYAWHETGYVFTRPDGRPHHPDYL
FT                   TSRFRILCDRHDLPPIRLHDLRHGAASLAHTAGADLKTVQEQLGHGSIVLTADTYTSVL
FT                   PQTHHAAAAATARLILDTARATGRRLRQPASRREPKVKAEPCSVAAGPVDSDIAKTPSG
FT                   IKRDKRHGNSKRKRRQRRGNHRPHKKRRG"
FT   gene            467747..468502
FT                   /locus_tag="Snas_0458"
FT   CDS_pept        467747..468502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40173"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40173.1"
FT                   /translation="MIDGELLAIAQQKIANLHTVDPDRVPVDAVMALWELHSGGSQLGN
FT                   VESCYVMSECFGLLGVQTEFVPVALTIARWRTEEIVACYGKISPTDPRAESWHFLLRVR
FT                   KLSALCDPSSPALPELAGVAGARHVAQFPVGDWDRVGGIVVARGETMLVYQPVNAAPHD
FT                   VWQQSATTIDRLHCANLGSCLAAEVLDALRWNSQVARLDSQRWARVRSMIAAIGDAPLR
FT                   ITDGMHRAFQMPGGEMITVKDLARSDYTS"
FT   gene            complement(468527..471580)
FT                   /locus_tag="Snas_0459"
FT   CDS_pept        complement(468527..471580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce3803 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40174"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40174.1"
FT                   /translation="MAVDGGRVAARGFQYQYLRTLEALLERIDDESIAALRVEGGSGAD
FT                   GINTVDFDLTGDGGERMVAVQVKSRQPGSTMSASEAFGILLDLVVAVNAKEYQLITNAQ
FT                   AGPGMKDLVTALEAIDDFDELRRSLLATLAGAPSRASQVSQMLPSIIERFCRARVIVDD
FT                   RDDIEIRYHLASRLRQFRVSAREGLGEQSAGLLLGFLISDVLRRAADEGAACLTRQEFR
FT                   ERLLVPGHVLAQSLAVRDWGVVVGRVPPIPDVPRPEIITRLNDVFAPSIDAGVRTAALV
FT                   GLSGIGKSSQAAAYVANRADLYDLICWVDAESTSTLTASLRQVLAHIRGITRASIMEAT
FT                   PDELRDAVHTELSRYNGRWLIVFDNVTVARDLGAWLPAVGRGDVLITALDAATRFGKAA
FT                   TIPVEQMSRDEAVTLLRLRLDMSDAEYSSHIGLLERIVNAMGRWPLAIELATGYMHGCG
FT                   IPIHQAHHYLDRLKQRALADDMAIPVGYPRTLVAAIDMCLDHVATLTKEEPHTLQKLAP
FT                   LALMTAAAYTASRQIPIHLAAGALFAHDDELRNPDFRTAGPMFVGPESADLLEAVRELR
FT                   RFSLVDFDEDLPHEFDSLVADGSRTIAVNTIVQDVIRRLRETHSGMFDLLNRLATLTNI
FT                   WMTSSLHAGHVQLSYLMSTHAEALVENIAAQQLASPQILLLFGNFAILQRDRGNTLAAE
FT                   QLWRLEMSILDQIEPVKDDDFDSELVTMQIKISLSLLFIDEETRTDVTIDEVIPWLQDS
FT                   LMSAQRLALEKPDGAMELLTPLRNALHNPRGQSLIEHNEEIATLNSAFADLISRLPSTE
FT                   HSDALDAFRQITMELQTGRDYENAERLCRYLIGKANFLGGPQELEARRLLIEVLIRLQR
FT                   WADAKSEHDKIRRRIGATPMLPYTVNMMIHNVGCSCAAAYLLGETLDSDHAAKLLDDLL
FT                   TWPHAKPISGTSDEYTQKFLLLAAINDLANGRLLEGDEKLSRVPRPEANEPHPTNEDLP
FT                   SWRLLWEYTRLALLQRAWHTKQTYNTLD"
FT   gene            complement(472009..477198)
FT                   /locus_tag="Snas_0460"
FT   CDS_pept        complement(472009..477198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0460"
FT                   /product="putative signal transduction protein with Nacht
FT                   domain"
FT                   /note="KEGG: vsp:VS_II0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40175"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40175.1"
FT                   /translation="MSNVGIANSKDRVEALLWAAPTGPVPAPPVDTKSQVLPVRELDWS
FT                   DAERLFLRLLHTVQPVQFAKLFGVPGQSQAGIDAYARLPLDLTDSETNARDYITLQSRR
FT                   VEELTAAKVEKAIDDFVAGEWCSKTSVFYYATSFDLQHTKLDEVIRKQTSRLARMGITF
FT                   VPWGVQETSALLKDHPRIVYDFFGKPWVERFCGMEAARSLDEHLSLQDRRTLRSELRSL
FT                   YQAVFYSQGSGPSADQTEYAKRFIVLGVAPYRERSVVEQDGSQARDERLRPDQGLADGE
FT                   AYVESQPGIERQSFRSARHLLRSAIGNPTHPVDTVEADEWLTDGKYRLLVGRPGAGKSS
FT                   LLRFVATDLLSPQPQSIPLQREHAPDLPIWLPFGYLCRHLEASTENSVVSAMEAWLKAH
FT                   SADHLWPLVKHALRDDRLLLLVDGVDEWSNIGAAEQALGKLETFLGQTKASAILSTRPY
FT                   ALHRLNWRLPWGKAEITLLNDQQRLTIASQLLIPDTLEKSKSSNPLPWVGVEPFLAQLS
FT                   ATAELNDLSRTPLFLSLLATTWQGEPLPQQRFRIYDHLVELLVGKHPQMRRRASHADGG
FT                   PLPASEATTLFSAVAYRLRLKDPSGTVTKSEMRKLIVESMTDEDVLGYDLAEARRLAND
FT                   VLTTAEDEFGLIVSYGAGTYNFLHRTLLDHMAGQYLVTLPPHAQSEAVQQFVGDPAWRD
FT                   VLLALLSAQLSSHGTELLLAAALDAGERMWGDIEGYELLAEALAAGVKLTPKSQTRYIN
FT                   NLVERVETHPSLHHRANLIAALVGMLTNQLARKNLLPAMKRWLTAPRPNPAATMWALRE
FT                   LPIADECALKHLVWGLRHPEDRVKVNAALAIAQRFKGQTHLIDRLVSLAQTGPSSATQA
FT                   AVILALGTGWAEATETSGLIDWARSQPSVPLRLVALHLLQKSTTNGEAALFRPEERAWL
FT                   LSLLHYENWARGPWPADDLVDIAATGDVQVADFALETLTTNGRNGGDRRIAWTLACNEF
FT                   ADDSRFKQWTVAELAQPEERGLILYDPNIIPQQWIDDPEFTSILRSYLETKIGEPGAYS
FT                   VARLATALPPEDAKAVLLQGLNSWRPYSAARQLVEQYLDDEQVSTALIARLRGEYERAA
FT                   PLASIAVDVLGPKEGFGLQVSLLRQQDQTTSSEKRVVVALAVADAWKQFKDEARKVGVK
FT                   GQTARDLLASYDATELATLCTAVKPHPLMWHVPSVITAWPEQATVLEVADNLLYDERPI
FT                   TSGISDTIPVAILQAFCKRTDEPSQRIFNKGLDLLTHLEPELREVLAFELARSMLAAEE
FT                   HINVLSEWRTEPDTEVRRIAFIGLVQAIKNHQQHSETTTGADTPTSEMEWLRLEIKHDL
FT                   CAYGPQLEEHRQLAWIGMLMLGDLTLFDNIQESIGHSGQIPGVSLRLPYRDEKDQILVD
FT                   LVAENWVELCDHFGKDIFDRLISTSDRQRLTKRQRRRAVMSALVTVASRYPSIAEMIRG
FT                   DAGADVELRHDQNFLLWAKEENQGNVEVLRALVSKLGENAHRRQDPIVDSLLDRESWNV
FT                   SDEDFKAAFTEGASPRPFYSNNKLAIYTHMFPGDNISKAVFHELESWFQTEPSTRRYRD
FT                   LSEVLTLALSVASPQDLPAILLRAHARIHMGISDLFLPILTRPLTRRLQIDLEAVEAFK
FT                   SALAEPMAIHETSPILANADDPIIAADPDLQPLQRMYLFAIALKRAGALAQHEATAISH
FT                   LLASASPNTIVHNPFTNHEGPLCLAALDLISR"
FT   gene            477767..478510
FT                   /locus_tag="Snas_0461"
FT   CDS_pept        477767..478510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40176"
FT                   /db_xref="GOA:D3Q4L6"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40176.1"
FT                   /translation="MRPTILSSILSLIVGGLVFPDLRDIAEWAARRLVKWAAPKWTDDE
FT                   TEAEALYEDWQAVIEDRPGAILKLVTATGFCVSAATRSYGRVVKSDYREAFKDQPSFAT
FT                   GLLRLWKIRGDRMQREVTIVIIKRALGNQLTYRQRFTNAVLVLGFLGSFFGWIWFCIGH
FT                   NRVDNQTVSNGTTIVAATYLVLWWLLRRRRRKKFSQVSDPAVALTCSSEAVFTMKDPRS
FT                   GREVMVTIREIPETTPGGLSAGNPG"
FT   gene            complement(478595..479449)
FT                   /locus_tag="Snas_0462"
FT   CDS_pept        complement(478595..479449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40177"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40177.1"
FT                   /translation="MTGSFRRPRTDPRLRECFDDLAPGADIAVRQIHAATANPTFHVAD
FT                   SVIESTRLGWAVEFTIGIDLAPATPYEALIRAHTFDRATTTAPSTRRPRNNPQPLTAAS
FT                   SHDIHVSPEDMRLTYCWDLAKHRQWIQQQLQYRPAVSIRSDSRWNSTAVERYPDALAKL
FT                   SDAYHHHGRQQFQAIPGQIQVAPVLTEDYAIADLIIGSTLIDIKTSRHPAHHARDWISQ
FT                   TLHYAFLAPANSITHIGIYLARHAKLIIWPLTLILGTTDSRLIHYFRNRYLEILQQTDK
FT                   PAT"
FT   gene            complement(479939..480616)
FT                   /locus_tag="Snas_0463"
FT   CDS_pept        complement(479939..480616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40178"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40178.1"
FT                   /translation="MYDIPESERQRIRGAQAGPFVPLVDWEANPFADPPRSQPYDAELP
FT                   LRGFASEKALADRVLARLEPWFVIDREVRGTHCCGKHLRVDAMLRPRNAQVWADPDVAF
FT                   GVEFKQPPLQAGENAYTKWLAQAVDYTHVDWDNYGHRLIFTCPGAAAWLDTAPAPNPHA
FT                   DPNRRRDVHIAKRLAGQLNLGELVLRWSSGLTFLLNGENIWSERFDVSNGRSWKLRRKI
FT                   GSR"
FT   gene            481403..482902
FT                   /locus_tag="Snas_0464"
FT   CDS_pept        481403..482902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0464"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40179"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4L9"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ADD40179.1"
FT                   /translation="MRSRYLWAAAVAVVVASAVTVVSVTANAEDGRGSVDWKPCPDDEK
FT                   VKCASITVPLDWSNPDGEEIDIALAMQPATEPESRIGSILMNPGGPGGSGVDKVASGLP
FT                   IVGEEVAKRFDVVGFDPRGVNKSTPIKCDAALAEEANKMAMPTNQDEFDKVADVNRRLA
FT                   EDCRERTGPLFDHVDNLSVVEDMDAIRSALGEEKLNFLGYSYGTLMGQQYAEKYGDRIR
FT                   TMVLDSNMDHSLATPGEYMETGTAAFEENFVAFADWCDTTKDCALNGDGTRDVYAKLRE
FT                   SAKAGELTDPKTGDPIDFEALSLIAFAANNPEMWDKLDDQLKALRDHKPSATEKLAEPE
FT                   EVNEPFQPIWCQDWDYQVKDFEDWRSLNADVAERHPNVESSPYNRNLLSCVGYPGETTN
FT                   PQRPLEIDDAPSMLMVGSRHDPSTPYPWSTTAARQSGASLVTYEGYGHGLYGFAGDSDC
FT                   VNKAVESYLIDQTTPADDLTCPADGKSRTTTGLTDGSPGPF"
FT   sig_peptide     481403..481489
FT                   /locus_tag="Snas_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 29"
FT   gene            483127..483456
FT                   /locus_tag="Snas_0465"
FT   CDS_pept        483127..483456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40180"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40180.1"
FT                   /translation="MGHEVAAILKARGRPLVDANCLAQAARAHLLGERAERVLEPAERA
FT                   LELIGGLRARVEMELVATLGEALARLGHRERAESCLRRALELSEVHEDAAEGERVWGAL
FT                   SRLRG"
FT   gene            483532..486618
FT                   /locus_tag="Snas_0466"
FT   CDS_pept        483532..486618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0466"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; transcriptional regulator domain
FT                   protein; KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40181"
FT                   /db_xref="GOA:D3Q4M1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M1"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD40181.1"
FT                   /translation="MAVLGPVRVCVGGVPVEVSAGRVRLLLARLALARGRVVTAEVLIE
FT                   ELWGGERLSDAVNTLQALVSRLRKVVGASAVELVGGGYRLAAAVDAERFEELAARGRRE
FT                   LGAGEVAAALVSVDAALGLWRGPALGDLADVGFVRAAAGRLAEARLRAVEDRFEAALRL
FT                   GRHGDVLGELAGAVAEHPVRERLAALRIRALYEVGQQSEALAAYERVRAELGERFGVDP
FT                   GAELRRVHVAMLRGELEPLLERPKPVPGRLPAQLTSFGGRDAELATLAGALAEARLVTV
FT                   VGPGGVGKTRLAVEAAGRLDAHERGRVWFVPLAGAAGDVGGAVLGVLGAERVRPGGGKG
FT                   LDQLVELIGPEAAVLVLDNCEHVVADAADFAGALLERLPLLTILATSREPLAITGEALC
FT                   RLEPLGLPSGVAMAAESAAVRLFVERARAVRPGFALDETTAGPVVDICRRLDGLPLALE
FT                   LAAARLRAMPLTEIVSRLDDRFRLLASGSRTALPRHRTLAGVVEWSWELLTGPEQLLAA
FT                   RLSIFPGGATVAALEEVASDETVPVGEVVYVLGSLVEKSLVHWDGQRYRMLETIRSFAG
FT                   ERLDDAEGFGARFTRYFAAVAEEQEPRLRLAEQLDALRWFDTEYDNLVAALRAAIDGRV
FT                   ADVAARLVGAVQWYWHTMRFDARSDGFVAEVLDFGEALPDHSRAALALSWMLTDDTSAA
FT                   DPERLRSAIEDCVSTGALERYPTLLFLTAPMAYFMGQVELAERLLRGAEERSQPWSAGI
FT                   AAWARSVFRADQGDWAGAAALRLRALRQYETAGDRVGLAFILGRVAQDHALRGEHDEAI
FT                   AALQRCVVLAAEISSAEEISYRSRLGAQRSRAGDADGARRELDVALRQAIERGQPQLRI
FT                   EPLVGLADLHRRAGEADRADALLAELETLVRGLAGAEQTAAAVIAPVRMALRLDTGDAK
FT                   AAETLPVVAATGTLARDLAAPAAELLARLRFRDGDPEGAAVALGMSQVIRGVLDRGDPE
FT                   LRALTDALVARLGADGYAAAFQRGAELPRDEALRRVGTF"
FT   gene            486710..487855
FT                   /locus_tag="Snas_0467"
FT   CDS_pept        486710..487855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0467"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: scl:sce3869 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40182"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M2"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADD40182.1"
FT                   /translation="MADDRYDRIQAALDRVVADGSAPSAVAHLKDGDGTWFGSAGVADL
FT                   ETGRRRDPKDRFQVGSIGKAFTATALLTLEAEGVLNLDDTVDTWLPGVIRGNGNDGTRM
FT                   TLRQLLSNTSGLGTTGLSPEIVRRYHTRSGFAENRYHVWTVDELIRVQLDIPAVFAPGE
FT                   GFSYANGGFQIAGAVIEKATGRSYQQEIDRTVIQPLGLPDTYTQDLSESRFRGQHCKAY
FT                   SKGLFIRDDVDPDILTAENYQSLLEEPAGDPLDITERTYFEGAAGCVVSTTGDLLTVAE
FT                   ALITGSLLPTDQHRAMWTTVATANWLPNARYGLGVSQWRLADGRQLHVMSGMTGGTACL
FT                   ALGTPDGETVLATHVNGDWNWYLAFYQIAEAVFGSPFDVSE"
FT   gene            487883..489250
FT                   /locus_tag="Snas_0468"
FT   CDS_pept        487883..489250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0468"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: pla:Plav_0772
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40183"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M3"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADD40183.1"
FT                   /translation="MSELDTLADRLGARLTELIAECSTPGAVLGVYSKGEFTERGAGVL
FT                   NTRTGVEVTPDAVFQIGSITKVWTAALVMRLVEAGELDLDAPVRSYLPKFRLAEESAAA
FT                   SITTRQLLSHTAGFEGDIFTDTGPGDDSLAKFVDLLHDAPQVFEPGELFSYNNAGYCVL
FT                   GLLVETLRGKPYLQCLREDLIQPLELTHAAVDAAEAILHRAAVGHFQPDPDQPPQPAGV
FT                   WALPRSLAPAGSALTMSARDLLTFARALMSDDGVLGGESIRAMRTEQVRLPVLWGNEDA
FT                   WGLGLRLTLVDGVTVCGHNGDTIGQHAFLRFVPERDLAVVLLTNGGEVAAMFEELFGET
FT                   LRELADVEPPALPVPGSGRIDASRYLGSYGNALMTVTVSQDDDEDVWAELVYTGADGIA
FT                   VPPQRFQLLPYDGDTLVTAQPQRGVHQPRAFVGADEHGRARFLHMGRALARLPETP"
FT   gene            complement(489272..490336)
FT                   /locus_tag="Snas_0469"
FT   CDS_pept        complement(489272..490336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0469"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: dol:Dole_0682 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40184"
FT                   /db_xref="GOA:D3Q4M4"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M4"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADD40184.1"
FT                   /translation="MKATLESLVHKGLEGETPTRDEIGSVLSSPDEALLDVVAAAGQLR
FT                   RRYFGDRVKLNYLVNLKSGLCPEDCGYCSQRLGSQADVLKYTWLKPGEAASAAQAGVSG
FT                   GAKRVCLVASGRGPTDRDLERVGDIISAIREQNPQVEVCACLGLLGDGQAERLSELGVD
FT                   AYNHNLNTSEDQYAGICSTHDYADRVDTVGQAKAAKLSACSGLIAGMGETDDDLMDVLF
FT                   ALRDIGSESVPVNFLIPFDGTPLAGTWELTPRRCLRILAAARFVHPDVEVRLAGGREIH
FT                   LRGLQPLALHIVNSIFLGDYLTSEGAEGKTDLEMIADAGFRVEGADEPTMPADRVDLVN
FT                   ARKRGPGTDRAPNA"
FT   gene            490434..491762
FT                   /locus_tag="Snas_0470"
FT   CDS_pept        490434..491762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0470"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoateamino
FT                   transferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   dvl:Dvul_0689 adenosylmethionine-8-amino-7- oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40185"
FT                   /db_xref="GOA:D3Q4M5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M5"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ADD40185.1"
FT                   /translation="MGETESERWRRRDAAAVWHPFTQHSLWLDDEPTVVDRAEGPWLYD
FT                   VDGNRYLDGVSSLWVTTFGHREPRIDAAIRDQLDRLDHATFLGATHPVGIELAERLLAV
FT                   APRGDRELSKVFYAGDGSSAVEVALKMAYQYSTQTNGPRPQFIRLSQAYHGDTLGAVSV
FT                   GGVELFHDTYRPLLLKTLELGSPGVRRPGQSAAERAAESIEELKRLLAEHGDQVCALIV
FT                   EPLVQGAAGMLTHHPDFLRAARELTDAHGVLLICDEVATGVGRTGRMWASQHADVVPDL
FT                   LVTAKGITGGYLPLSAVLTTQAVYDAFLGAPARARTFFHGHTYTGSPLAAAAALANLRL
FT                   MAETNLVDRAARLGDRLGARLAPLAEHPGVVEIRRLGTMTGVEVRPRGERTGVRVCRFA
FT                   RNRGVWIRPLGDTVILMPPLGLEDTQVDMLVDALAGALDEVYR"
FT   gene            491759..492871
FT                   /locus_tag="Snas_0471"
FT   CDS_pept        491759..492871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0471"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aminotransferase class I and II;
FT                   aminotransferase class-III; aromatic amino acid beta-
FT                   eliminating lyase/threonine aldolase; KEGG: mxa:MXAN_1258
FT                   8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40186"
FT                   /db_xref="GOA:D3Q4M6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M6"
FT                   /inference="protein motif:PRIAM:2.3.1.47"
FT                   /protein_id="ADD40186.1"
FT                   /translation="MIWQSTLDNKARLRRNAGLDRTLRVRAADDPLIDLAGNDYLGLAR
FT                   HPTVTAAAAEALAEYGLGAGGSRLVRGTTDAHVALENRLGELLGGAALVYSSGYLANLG
FT                   AIRALCDASTMLVRDAHAHASLIDGCQLAGARLVTMPHNDIDALDRILAGHNRRSVVVV
FT                   ESVYSVDGDLAPLAELHRVCRAHGAILLVDEAHAVGVLGPGGAGASAASGLKAASDLVI
FT                   TATLSKALGSAGGVVAGPAELRRHLVDTGRTFIFDTAPPPAVAAGALAALELAAADDEL
FT                   RAEVSRRASAAAERLGVAAPAAGVVSVPASDPHAALEWARRCAEAGVAVGCFRPPSTPD
FT                   GSSRLRLTVNAGIPVADFNNAIDVIERERP"
FT   gene            492868..493527
FT                   /locus_tag="Snas_0472"
FT   CDS_pept        492868..493527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0472"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG:
FT                   afw:Anae109_0071 dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40187"
FT                   /db_xref="GOA:D3Q4M7"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M7"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADD40187.1"
FT                   /translation="MILSSTGPVIVTGTDTGVGKTIATAALAVVARAAGKTVAVVKPVQ
FT                   TGDDDDAATIERLAEPDQVATLARFPDPMSPYAAARHRGLPQLPLAEVVEFVAALDKDL
FT                   ILIEGAGGLLVPMGTYSWTMAELCQQLNAPAVVVVRAGLGSINHTALTLEALRSRGILS
FT                   SVIIGSWPRVPGPVEQANQIDLSDMSYGLAGIIPEGAGSLSPEEFRARASGWIQPS"
FT   gene            complement(493434..494732)
FT                   /locus_tag="Snas_0473"
FT   CDS_pept        complement(493434..494732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0473"
FT                   /product="cytochrome P450"
FT                   /note="KEGG: bte:BTH_II0725 cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40188"
FT                   /db_xref="GOA:D3Q4M8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M8"
FT                   /inference="similar to AA sequence:KEGG:BTH_II0725"
FT                   /protein_id="ADD40188.1"
FT                   /translation="MPCEAGFTPRAAVYDRSVTDGDLFRLWRIRRDEAVWRQDGHVVVA
FT                   DPALVRRVLTDPAGFAPANALDAVTPIPATALRILASHGFRLPVTLANNGTDSHPGLRQ
FT                   IVADAMTPRRVEALRPWLTGVVRRRVSGVVHELRDGRSVDLYQRLAADIPLLVLARLVE
FT                   LPVDDVSVVKLFSRSALELFWARPDTARQRELATVVGEHHRWLREVARTGPGLVARLRE
FT                   HCDREGLGEDHVVAALFFLVVAGQETTSQFLTLLLARLAAEPRVREDLVAGVVSAESVV
FT                   EEGLRLVPPIVSWRRTATVDADLGGCGVRAGDSVLLWLAEAGRRVAADGDAFAPGQRGS
FT                   RRHLAFGAGAHRCTGAQLARMEAQVVLAESAPLLRGTRVEAEPRCPANLSFRMPDRLVV
FT                   RRVQEGWIQPEARARNSSGDRLPAPSGMIPARP"
FT   gene            494795..495223
FT                   /locus_tag="Snas_0474"
FT   CDS_pept        494795..495223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0474"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bph:Bphy_5293
FT                   PRC-barrel domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40189"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M9"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADD40189.1"
FT                   /translation="MANETATLVRLRDTGLTLAHEEEDVRGMTVVDRNGDEIGHVEDLF
FT                   IDETQRRLRFLEIGSGGFLGIGKEKRLIPVDAITRVDEQVHIDQERSHVAASPGYDPEL
FT                   TPMPEPPTIEEIYGHYGYIPFWGPGYMYPIFPSRRPKR"
FT   gene            495411..496166
FT                   /locus_tag="Snas_0475"
FT   CDS_pept        495411..496166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0475"
FT                   /product="PE-PPE domain protein"
FT                   /note="PFAM: PE-PPE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40190"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4N0"
FT                   /inference="protein motif:PFAM:PF08237"
FT                   /protein_id="ADD40190.1"
FT                   /translation="MKLRAKKRTVVAVVSGVAAALAVVAGVQVAQADAPQHYYVEIGGT
FT                   GSSLNAPDCTKTYGFANQNLGGAVAVPICYPASFGPLQGGDGTIPAPNAPRYDESVKQG
FT                   VEETLKQIGDIHRNDPAATITVVGYSQGADVGDRVLEKIANGETEIPAEIMSGKLYADP
FT                   RQPDTGIWAKVPAGTSIEGITSPGAGPVEFPGMTVERHCIAKDGVCDATSLDSFRGYFQ
FT                   DHPKYPAEGGIIPSTITAAPNNEVVWHQP"
FT   sig_peptide     495411..495509
FT                   /locus_tag="Snas_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.837 at
FT                   residue 33"
FT   gene            496314..497285
FT                   /locus_tag="Snas_0476"
FT   CDS_pept        496314..497285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0476"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG: mno:Mnod_0475
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40191"
FT                   /db_xref="GOA:D3Q4N1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4N1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD40191.1"
FT                   /translation="MFDVFDPESDHGRVYQALVSAPRSTVDALARRTLLSPSAIRDSLT
FT                   ELQQFDAVTPVDSTKEVWEARRPDLVAAEAMRQFGAWRTQLLEAEERLTTAFRYARYEE
FT                   TSAMDFEILKGADAFFERFKVLQPSARSHVWAIDRPPYYWEPDEIHRQERMQIEQMAAG
FT                   ITYRTIYQESESDSPVRNASMARSVASGENARVLARPPIKMTIIDCEVGVVALDPPEGA
FT                   EGSLSTLLVRRSTLLDAFCNIFESLWSLAVPVNLDRQNQELSKREREILTLMASGAGDD
FT                   AIARRLGVSRRTIVRHIGRLLEHLGSTTRFQAGAQAARRGWL"
FT   gene            497403..498803
FT                   /locus_tag="Snas_0477"
FT   CDS_pept        497403..498803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0477"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; SMART: Integrin alpha
FT                   beta-propellor repeat protein; KEGG: noc:Noc_2093 integrins
FT                   alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40192"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P3"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ADD40192.1"
FT                   /translation="MRKSRLSPRARKAGVITLAVAVGVTTVGAAAVAYADPAESSVPTS
FT                   SDFDGDGKDDLAMSAQKTDEAAEDSVVIDYTTGLANKELYPESAYGTDGFGVGLAAGDL
FT                   NGDGFDDLAVGCVNCDWEWGGATVSIYNGSAEGLKPDSAVNAEVGDPTYAVGIGELNGG
FT                   GSLDVGSTRLGDASAVSSRGDDGWWSDKWVNTGMPTDENRLGSVAIGDVNGDGKDDLVI
FT                   GTPTADGGSITLFPGPVTEGKKDTVKAVELSPTLRDLGASLAVTDVTGDGLADVIAGAP
FT                   TSTVGGTSCGAVQLLIGKTNGIAADFSQRLTQESANIPGVCEAGDDWGRSVAAGNVDGD
FT                   AGAEVVVGVPGEGIDSLGKAGTYTTLQSTSTGLTGTGSFGVSQATANVPGTAESGDGFA
FT                   SALALRDVNDDGRMDVVIGAPTEDVSTVKDAGQVVTALSSATGAPAAGTTEVTGNKYGL
FT                   KRLGWELA"
FT   sig_peptide     497403..497510
FT                   /locus_tag="Snas_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 36"
FT   gene            499203..499637
FT                   /locus_tag="Snas_0478"
FT   CDS_pept        499203..499637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40193"
FT                   /db_xref="GOA:D3Q5P4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40193.1"
FT                   /translation="MSELWTAVAALAAVAAVVTPVLMVLRTRMREAKRPAYEKACENFD
FT                   QLDRMSAAVTRRSFTRSELDDESFDDLLGDLEVVERKTFDGWRTRNAAPVRELISHAKA
FT                   MYHAESADDPDWKLKQGVEAGAIQKTLRRARAALYHQWGR"
FT   sig_peptide     499203..499250
FT                   /locus_tag="Snas_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.422 at
FT                   residue 16"
FT   gene            complement(499708..500454)
FT                   /locus_tag="Snas_0479"
FT   CDS_pept        complement(499708..500454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0479"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: sfu:Sfum_3557 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40194"
FT                   /db_xref="GOA:D3Q5P5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P5"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ADD40194.1"
FT                   /translation="MDEVSLSELAPLKEYSRVVVLTGAGISRPSGLPTYRGDDGTWNDP
FT                   EAARAAEADTVGTDLAAVWRLWGGLAHLAAAAQPNPAHRALAGAEESLLARTASLLVVT
FT                   QNVDGLHQRGGQRDVIELHGNAHRQRCLDAGCALVAPYVGTGETIPSCAGCGGRARPDI
FT                   VLFGEQLDLEDLERAWNTAAEADLLLAVGTSCGVSPAANLVAVARQAGALCVALTREPL
FT                   PFNPGFHAAVTGLAERELPRWVAETR"
FT   gene            complement(500537..501424)
FT                   /locus_tag="Snas_0480"
FT   CDS_pept        complement(500537..501424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40195"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40195.1"
FT                   /translation="MSEQPRGMKTPRSRRWVLSRAAMVAAGVAVPSTWIASNALADPAS
FT                   PKLAEVDMELVLVAALVDPPKPDMAPTDPCGPHVKLVETAMEAKKLLEGKNVDEHFGSA
FT                   TVQAYAKWQEELGYTGIDANGLPGKTTLTKLAEGQFTIVNEVAAGDRNDSYGGERTNTR
FT                   TVEMLTKADELFSAEIGLTQGSYTNSNPGSAGTHDGGGVIDIGVNSLGETERWELVKAL
FT                   RTVGFAAWLRTPDQGFDYHIHAVGVADPDLSSSAQAQVHDYYVGKNGLANHDADNTPDE
FT                   YKVDFTWWEKYKRG"
FT   sig_peptide     complement(501299..501424)
FT                   /locus_tag="Snas_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 42"
FT   gene            complement(501555..502415)
FT                   /locus_tag="Snas_0481"
FT   CDS_pept        complement(501555..502415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGP9; AGP9 (ARABINOGALACTAN PROTEIN 9)"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40196"
FT                   /db_xref="GOA:D3Q5P7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40196.1"
FT                   /translation="MERIIIAASAIAVAGLVLTALSATALGSAKAAAKWPSAERPRMGA
FT                   APARIGVVLGVLLCATAAGVGVSLVPVTKLWVLVPLIAAAGLITLGLTAWAAVKLASKI
FT                   ELSALINAPSPLGGEVQTATRSARTQPPTIQGPPTQVSPEQISYGKPYPGMVTVASPPG
FT                   SPPALDLSAADGVHTTTPDSSPPATQSPVSAPAVDPADVTIPPEALPGWVYTDEADNWY
FT                   LVTSVPEGHRLLRLSDFSVVPPGAAAGALNLAGSIEMTVWPANPDDTDTQEHPVVVEEE
FT                   PPPAN"
FT   sig_peptide     complement(502314..502415)
FT                   /locus_tag="Snas_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.481 at
FT                   residue 34"
FT   gene            502659..502928
FT                   /locus_tag="Snas_0482"
FT   CDS_pept        502659..502928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40197"
FT                   /db_xref="GOA:D3Q5P8"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40197.1"
FT                   /translation="MRDIPFLIALQAETINTKGIIDFFLSKIAPILLAILGIIFIARAN
FT                   KGEVSKVLTSSTIAIVGLAFIAGAVTLVLVGTSLVDILFTDEGN"
FT   gene            503097..503459
FT                   /locus_tag="Snas_0483"
FT   CDS_pept        503097..503459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40198"
FT                   /db_xref="GOA:D3Q5P9"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40198.1"
FT                   /translation="MKLRTDDDIYRARLLYLGPPGYTFPVHLPYAQYGVFAALLALYMF
FT                   IHWLISFEVEIFPAWEIALAMVSTSLIFRYVDPDRPARAVIRTVLTDWRRTREPVAEQR
FT                   DRRYSASRIRIRQELI"
FT   gene            504089..507694
FT                   /locus_tag="Snas_0484"
FT   CDS_pept        504089..507694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC758923"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40199.1"
FT                   /translation="MLEQIRARQRAQAMAAETQVGPPDPQTSRLRPRMADEAPPPSATR
FT                   PKSRKRTPSNPFAETEAANRALDEARRAAAEQARAERARVEATGQISASPASGAPISAQ
FT                   PASPGPVSAQPVSPAPGPQQAPPPAPGMPPVPTSLPPGPQQPVNPPTGQQPVVPQPPAA
FT                   ANPPTGQQPVVQPPAAANPATGQQPVVPPAPQPSAPVNPPTGQQRAVRQPSNPYVEPRS
FT                   GQHSTVDPRLSTRAAQQAAPQSPAPAQAPPPARPAANPPSGQHPTVNPATGQQRTVNPP
FT                   SGQHPTVDPRLSTRTTPPQQAPAPADPSHQQLVPMARPAPGTQPSGKPTKLPKPPKQKD
FT                   RSAAQELAITEIAGHATFTPTAVTAWYRLPEVRWAFRPDAEREALISAIAEQYAGMAGY
FT                   RLHLRRTTRPFPADQWARTVDTNTPQPLPPVAGAPTWGDHLVNAQHHLHNVQHAEGETY
FT                   LGISFARRTLTDTLGEKLGRVFNRGTKRSERSRIERATEQFDEVLSAFGVRARRATSHE
FT                   LEWLIFRSVALGMDPPQLLSGVRDGLWEPGDVLALTEQIERYRTPYGSTVKLVNRLTGE
FT                   ERHVAVLTVGRMEDLDIPERHEPWLHFHERAPWPMELSSRLDILGPGEAFRNLEHRLRM
FT                   IRSQQHDYDEHAMDAPPELERLAQRALNVGDEMTTGLATDAARVHGWHRIAVSADDREE
FT                   CLERARKLIQMYNRELRLSLQHPKNQDWLAREFIPGEPVANTGYLRRMPVRLFAAALPQ
FT                   AASTVGDQRGDLIGRTSGTCRRPVFLDLHFPMEVRERSGLAVFVAEPGGGKSTLMGSLG
FT                   YLAARRGVQVTLLDPSGPLARLCEMPELKPYSKVLNLTGSQPGTLAPYALIPTPKREHW
FT                   DTGPEGDREYNIALSNARAERRMLVQDICSMLVPPQVARESSTARLLRHAARQVPAEET
FT                   STLEDIVDCLQDQGHDGSELAALLLDAAEMPLAMLFFGSPPADMLTDDATLTVITMAGL
FT                   RLPDLKIEREYWSAEEALALPMLHTAHRLAVRRCYGGDIHRRKLVGLDEAHFMEGWRSG
FT                   RSFLVRMARDSRKWNLAALVASQNPTDILGLDVQNLVSTVFVGRIAEDPQIAAEALRML
FT                   RVPRDVGYEQTLAGLSEADIAGSQRLNYREFIMRDVDGRVQRMRADISYVPRLLEYLDT
FT                   TPGGREAAERPANAPTAPGTASQRTGPAGSQMGSG"
FT   gene            507698..509569
FT                   /locus_tag="Snas_0485"
FT   CDS_pept        507698..509569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40200"
FT                   /db_xref="GOA:D3Q5Q1"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40200.1"
FT                   /translation="MTTAPHARQRLRRVLARLALVAVAALAVLFFNPGTANAEDKSKCT
FT                   VEQWHNSPKTCAAKLPKPSGQTCKEPPVPGSPDTGMAGWFAEPDLPKDSDVQGMYTKYG
FT                   YGGYDLNLYGADCTGELPGGAQSGNDLANLEFTLATGIIGSANGLRQAAWEPSGMWGWA
FT                   DNFVEKASSAIYEKVFSVFGAITIGLVGLYLLWRSRQADMSMAVTTAGWAVLVLVVVTA
FT                   VAAYPTESAKYADSALTGSLNVIQDAVGPPAEEDCPGNEDCDDTRAPALRASDMATGEI
FT                   LYNNWVRSVFGQSPEVEYAGNNKKKVTDYNSAYKYGPALYDAQAFSWKEINDLRKAKPE
FT                   EREGMRKDMVDDKKDQWRKVTALIEKEDPEVYYNITGANGWDRVGTGFLALLSAIFFAL
FT                   FDITASILIILGFLIIRWAVVALPLIGTIAMLRPASAGFKRLISAVLAAVINVIVFGVA
FT                   AAVYLFAVSQILAASLPGWLQVLLIGLIGAVAWMLLRPYRRIGSLRGGTSLSDAAFGRK
FT                   SKVEVEQKVVIKKDGRPEDQSDEVESSIDTNTKEPLMAGAKGSRSNAGRAEGDASKGLP
FT                   PRPTPGRSAPESGSGSEARPGYAVYRPSSSGTGQQAGDRPLVAVRPD"
FT   sig_peptide     507698..507814
FT                   /locus_tag="Snas_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 39"
FT   gene            509623..510129
FT                   /locus_tag="Snas_0486"
FT   CDS_pept        509623..510129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40201"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40201.1"
FT                   /translation="MSRKILRILGSRYGIAAILLVVVIIVVGLARANGGTDSDTTVDGS
FT                   DSMGTEDAGEPNDGVVTESDEESAESSLPKKAVDNATEFAKAYIKTDRSAKAWRADVGK
FT                   NATQKVKDELKYIDPEVVPIKEITDDPSAEGQTVRFPTDAGLLILRMKVQDEVWLVDGI
FT                   DLDKS"
FT   sig_peptide     509623..509721
FT                   /locus_tag="Snas_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.970 at
FT                   residue 33"
FT   gene            510162..511301
FT                   /locus_tag="Snas_0487"
FT   CDS_pept        510162..511301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0487"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: maq:Maqu_2444 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40202"
FT                   /db_xref="GOA:D3Q5Q3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q3"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADD40202.1"
FT                   /translation="MDTPAENEESASTVRRWTRKRLWWTIVAATTALLCCGGTTFYVVF
FT                   LTVSNNSDTGAANYAGCGNGTEISISGDMPKINDLNEEQVGNAAIIIQTGQKRNMSPRA
FT                   WVIAVATAMQESTLHNYGHLGDRNDHDSLGLFQQRPSKGWGTPDQVTDPEYASTSFYKR
FT                   LKKVEGWESMDLTAAAQAVQRSAFPDAYAKWEPLATDVVNVLTEGGARTAADGGKSGEC
FT                   AEGAEIAASGWTAPVKDGIVSGFRTPQRPDHYGVDLGSKRGTEIRAAASGVVTTSECNA
FT                   STNNCDVDGSPSVLGCGWYVDIEHANGIITRYCHMVEQPKVDVGQRVKAGEVIGISGSS
FT                   GNSSGPHLHFEVHEGGDASNNGAIDPVAWMKQQGINIDG"
FT   gene            complement(511298..511837)
FT                   /locus_tag="Snas_0488"
FT   CDS_pept        complement(511298..511837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40203"
FT                   /db_xref="GOA:D3Q5Q4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40203.1"
FT                   /translation="MSVQQPRTRQAEGEADSYPDPKRSWGRSGSLLGTWGVLLVAVYLA
FT                   GWMFDGLVDKSPESNLDKPVEDANQTARRVLQFSLVHREPTKADPLLCDGFTGLTPKQL
FT                   TKELTDWEASEGVLSEATVTFENVNGEAVDGGTLFPMRVELEVDPSFIVWNYDVTVKPD
FT                   GDSFCVSKVENVTSDD"
FT   gene            complement(511890..512444)
FT                   /locus_tag="Snas_0489"
FT   CDS_pept        complement(511890..512444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0489"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cvi:CV_4239
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40204"
FT                   /db_xref="GOA:D3Q5Q5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q5"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADD40204.1"
FT                   /translation="MPTLSNRPNSALLVIDVQTGVVAEGHARDAVVANIATLVDQARGA
FT                   DVPVIWIQHSDKQLIEGSPEWHIAPELEPAATEPLIPKNWGDSFEETDLEAVLADLGVG
FT                   HLYISGAQTDACIRSTLHGALARGYDTTLVGDAHTTEDTSKWGSPSPDLVIAHTNLYWS
FT                   HHAAPGRDCATVMTADVDFGS"
FT   gene            complement(512556..514265)
FT                   /locus_tag="Snas_0490"
FT   CDS_pept        complement(512556..514265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0490"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: mlo:mlr2792 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40205"
FT                   /db_xref="GOA:D3Q5Q6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q6"
FT                   /inference="protein motif:TFAM:TIGR00970"
FT                   /protein_id="ADD40205.1"
FT                   /translation="MSAFAAKAARYRPYHEQFTVDLPDRTWPAARLDSAPVWCAVDLRD
FT                   GNQALIDPMSPERKRRMFELLVRMGYKEIEVGFPAASQTDYDFVRTLIEEGLIPDDVTI
FT                   QVLVQCREHLIDRTFDSLRGADKAIVHFYNSTSTLQRRVVFGMDKDGITDIATQGARLC
FT                   QKYAEIHTPDTDIRYEYSPESYTGTELEYAVEVCGAVTDVIDPTPDRPLIINLPATVEM
FT                   ATPNVYADSIEWMSRNLRRRESIVLSVHPHNDRGTGVAAAELALMAGADRVEGCLFGNG
FT                   ERTGNVDLVTLGLNMFSQGVDPGIDFSNIDAVKRAVEHCNQLPVHERHPYAGDLVYTAF
FT                   SGSHQDAINKGFAALEADAADAGVPVTDFAWAVPYLPIDPADLGRSYEAVIRVNSQSGK
FT                   GGVAYILKSEYGLDLPRRMQVEFSHVIQRHTDAAGGEVTPQTMFDIFEREYSVDEQNDR
FT                   RVIIGEHSSAAAADGTVTIDTLITVEGTEHKVSGTGNGPLSAFVDALAGVGVTVSVCDY
FT                   AEHALTAGETARAAAYVECQIGDEILWGAGVHANIVTASMRAVASAINRSGK"
FT   gene            complement(514476..515423)
FT                   /locus_tag="Snas_0491"
FT   CDS_pept        complement(514476..515423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0491"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: noc:Noc_2838
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40206"
FT                   /db_xref="GOA:D3Q5Q7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q7"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADD40206.1"
FT                   /translation="MTSRHAVTSQPLHPLLATRYSTRAFDPSGKVTDAQVTALLEAARW
FT                   APSSGNTQPSRFIVGRRDSPVFARVLATLRPGNQQWARHAALLLVAVRVTANAKGPLPH
FT                   AAYDLGQAMAHLVVQAQAEGLTVRQMAGFSPSAVTEEFGLAEELVPTTVAAIGVAGDPA
FT                   ALPDDLRGPDDNPRRRKPLDELILAELQVRVRRFLGVAQPQRPGGAGALRVAAGGVDRR
FT                   GHELPGDHSRAVVWWTVSIRGHGFHADHVSLGVLAVCYAITVAQLNPHAARPIASAGTD
FT                   HNTVTVPYRLEISPRGRGQRHRNLNPRNTHVRDA"
FT   gene            complement(515435..516220)
FT                   /locus_tag="Snas_0492"
FT   CDS_pept        complement(515435..516220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40207"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40207.1"
FT                   /translation="MVRIFAAISLFTLATVALTGCGSGSAADTAKPSPSPAPAITSDRA
FT                   PIGTSSAAGELAGLAAAAKGRDYSATYELTRPGDKPVEVSVELAADDRWSVEVPGGAQG
FT                   GKADVTIARHRDFYVQCVEGKRDSCARVDTKDDKIPSTIDPVVQHVFTDWLDVMINRSS
FT                   PISVAYAEDVKGVAGQCFWLERNSVTVSSPIPSGVYCLRSDGIVTAAKASFGSLKLKGE
FT                   PGSGPGKLTLPDADEDATPLGTSPPPKPSPSKSKSKKPQ"
FT   sig_peptide     complement(516140..516220)
FT                   /locus_tag="Snas_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.933 at
FT                   residue 27"
FT   gene            516346..517611
FT                   /locus_tag="Snas_0493"
FT   CDS_pept        516346..517611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0493"
FT                   /product="aspartate kinase"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   aeh:Mlg_1480 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40208"
FT                   /db_xref="GOA:D3Q5Q9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Q9"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ADD40208.1"
FT                   /translation="MALVVHKYGGSSVENAERIKRVAERIVSARKRGDDVVVVVSAMGD
FT                   TTDELLDLAAQVSPLPHPRELDMLLTAGERMSMALLAMAINNLGFEARSFTGSQAGMIT
FT                   TSVHGKARIIDVTPGRIRGALDEGAVAIVAGFQGIAQDTKDITTLGRGGSDTTAVALAA
FT                   ALHADRCDIYSDVDGMFTADPRIVPNAKLIDQITYEETLELAASGAKILHLRAVEYARR
FT                   FNLPLRVRSSYSNKPGTLVTGSMEDLPVEQALITGVAHDRSEAKITVLSVPDEPGQAAE
FT                   LFEVVADAEINIDMIVQNISTKDSGRTDISFTLPKDDGPTAMAALQKARDKIGFAGLLY
FT                   DDHIGKVSLVGAGMRSHPGVTATFCKALSQAGVNIEIISTSEIRISVVCRDTELDTAVS
FT                   AVHEAFELGGSEEAVVYAGTGR"
FT   gene            517618..518676
FT                   /locus_tag="Snas_0494"
FT   CDS_pept        517618..518676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0494"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: ccs:CCNA_03599 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40209"
FT                   /db_xref="GOA:D3Q5R0"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R0"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ADD40209.1"
FT                   /translation="MSRKPTLAVVGATGAVGSVMLDVISRRADVWGEIRLIASPRSAGR
FT                   KLRVRGEEVTVQAISEEVFEGVDVAHFDLPDEVSAHWVPIAAAKGVIVVDKSGYFRMDP
FT                   DVPLVVAEANPEAVRNRPKGIIANANCTTLALIPSLAALNRSFGLVSMSVASYQAASGA
FT                   GQAGFDSLYDQLGAVAGKRDLGTVSGDVREAIGEGGDDTFGAPLALNVVPKVGGWRPDG
FT                   WTSEELKVRNESRKILDLPDLKVASTCVRVPVATGHSQAVHATFSSPVSADAARKVLAE
FT                   APGVTVVDDPDNNVYPMPIDATGRDDTLVGRIRTSIDFDNSLEFFVVGDNLLKGAALNS
FT                   AQTAELLLPELS"
FT   sig_peptide     517618..517683
FT                   /locus_tag="Snas_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.753 at
FT                   residue 22"
FT   gene            518783..519145
FT                   /locus_tag="Snas_0495"
FT   CDS_pept        518783..519145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40210"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40210.1"
FT                   /translation="MARLRRRWLVAAAVVGAVAVAGPATVAIAEAAIEPRTGCSDSMNS
FT                   DVPGGLAHWEASCDNGNITVSGWVKDTRTDGKCARVKAFIDQKWEYSDKACPSGDVDKF
FT                   KLTGDGNDAKVYLYTS"
FT   sig_peptide     518783..518872
FT                   /locus_tag="Snas_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.529 at
FT                   residue 30"
FT   gene            complement(519165..520223)
FT                   /locus_tag="Snas_0496"
FT   CDS_pept        complement(519165..520223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3154 flagellar hook-length
FT                   control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40211"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40211.1"
FT                   /translation="MFGLLRPCSRLMDEPMLHEWLSHFCGLCLALRDDFGQSTRLATNY
FT                   DSLVLSALVEAQTGAEPQRRTAGPCALRGLRTASVVHGTAARLSAVASVLLATAKINDH
FT                   IDDGDGLARRRSLATVGRKVSRRLETKALRVGDDIDFDAAALLAAVGRQREVEAGASAS
FT                   TPLTAVTAPTEEATAALFGHTAVMAGRPDNAAPLARAGRAFGRLAHLVDAVSDLEQDGQ
FT                   RGSWNPLAATETPMAEAHRLCHAAIADIDAALAEAGIGPGELARSLLVDHAEHTMRNSY
FT                   PHAHHHQHHGAHPAPRGFWAGCGAALIVACTCQCCCSSNFEGPWSRRPREGCCHKCDCC
FT                   DCPCDGCCCPCD"
FT   gene            complement(520296..523055)
FT                   /locus_tag="Snas_0497"
FT   CDS_pept        complement(520296..523055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0497"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bba:Bd0964 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40212"
FT                   /db_xref="GOA:D3Q5R3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R3"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADD40212.1"
FT                   /translation="MAQTTKRLVIVESPAKARTIAGYLGDGYMVDSSLGHIRDLPRNAK
FT                   EVPPKYAKEPWSRLGVDVDNDFAPLYVVNPDRKAHVKTLKDQLAEADELLLATDEDREG
FT                   EAIAWHLLETLKPKVPVKRMVFHEITKSAITQAVNNPREINRSLVDAQEARRILDRLYG
FT                   YEVSPVLWKKVMPRLSAGRVQSVATRIVVERERARMRFVTADYWGITAQLRTKDGADFA
FT                   ANLLSFDGDRVATGKDFDAETGRPKAGVVHLDEAGARGLAARLANVPYTVGKVDNKPYR
FT                   RRPYPPFMTSTLQQEASRKLRQSSAQTMRLAQRLYENGYITYMRTDSTNLSETALTAAR
FT                   RQAAQLYGERFVPAEPRRYARKVKNAQEAHEAIRPSGDSFRTPSELASELSTEELRVYE
FT                   LIWRRTIASQMTDAVGNSVSVRINVTSATGEDCEFSASGKTITDPGFLKAYVESRDEGE
FT                   ADDAERRLPELERGQALTADSLEPAGHRTQPPARYTEASLVKALEERGIGRPSTYASIM
FT                   QTIQDRGYVFKRGQALIPAFLAFAVVGLLEKHFARLVDYDFTAGMESELDDIAAGEGRS
FT                   LEFLRSFYFGGNNAADGTVAASGGLKKLVAEELGRIDARGVNSIPLFTDEQERRVVARV
FT                   GRYGPYLERFAPTAEPGEPGERVSIPDSLAPDELTQAKAEELYEVGSGERELGEHPETG
FT                   EIVYAKSGRYGPYVTSGEKSASLLSDMKLKDITLDDAVRLLTLPRLVGVDADGEEVRAG
FT                   LGPHGPYVVKKRDYRSLETEEQLFTVTLEQAQALLAQPKKRGRQAARPPLKELGTDPAT
FT                   KLTVVIKDGRFGPYATDGETNASLKKTDTIEDITIDRASELLAERRAKAPVAKKAAKKA
FT                   AKKTTAKKTAKKTVKKAAKKTAKKTTTTKKAAKKSAAKKKTGNPREDA"
FT   gene            complement(523228..523737)
FT                   /locus_tag="Snas_0498"
FT   CDS_pept        complement(523228..523737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40213"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40213.1"
FT                   /translation="MRAVAWLLVAALALSGCGSQVDAEEWAADVCAALEPWKTGIEDLT
FT                   AEANAAMDPESSPTQAKKDLLKLLAGAADISEDARAGIEAAGVPDIADGERMAKRFTES
FT                   LAATRDAYRTAHDRIEKLDAGKGDFYDEVAAAMKQLAKDYDAVPQVAELDSEELKNAFE
FT                   AVKQCQ"
FT   sig_peptide     complement(523666..523737)
FT                   /locus_tag="Snas_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.980 at
FT                   residue 24"
FT   gene            complement(523834..526179)
FT                   /locus_tag="Snas_0499"
FT   CDS_pept        complement(523834..526179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0499"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mno:Mnod_7542 V-type H(+)-translocating
FT                   pyrophosphatase; TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40214"
FT                   /db_xref="GOA:D3Q5R5"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R5"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADD40214.1"
FT                   /translation="MSQSLLADGQGDAVGVNLTYVILAAVLALIALGFAAALVKMVLAT
FT                   GKGTKKMQEIAGAVQEGASAYLKRQFRTLAIFVVIAMVLLWFLPVHDVGDSETMVKAGR
FT                   SAFFVVGAGFSAFIGWAGMGLATRANLRVASAARDGSRTGAMAIAFRTGGVVGFLTVGL
FT                   GLLGAAVVVMVFKGNAATVLEGFGFGAAMLAMFMRVGGGIFTKAADVGADLVGKVEQGI
FT                   PEDDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVASLILGQIAFGDTGLVLPLII
FT                   GAVGIVTAIFGVFITKLRASDKNGLTAINRAFFISAVLAAVLSAGAILATVPNTWAALG
FT                   VEEAVHKGVPFSPQVTAIVAVVIGIVLAAAIMALTGYYTETEKRPVSDVAKTSLTGPAT
FT                   VILSGVSLGFESAVFSALVIGAGVYGAFLLGGATAMFVSLFAIALAGCGLLTTVGVIVA
FT                   MDTFGPISDNAQGIAEMSGDIDEEAARTLTDLDAVGNTTKAITKGIAIATAVLAATALF
FT                   GSYTSAINVALAEGGKLADGGIDVLLNIANPANIVGVIVGAAVVFLFSGLAVNAVSRSA
FT                   GAVVFEVRRQFREFPGIMDGTQRPEYGRVVDICTRDAQRELMTPGLLAILAPIAVGFGL
FT                   GAGALAAYLAGAIACGVLMAIFLANSGGAWDNAKKAVEDGAHGGKGSEAHDATVIGDTV
FT                   GDPFKDTAGPAINPLIKVMNLVSLLIAPAVIMFSSYGENPNPAVRISIAVVALLIIVAA
FT                   VGWSRSKPITVGEDKPSDNGADKEKVDA"
FT   gene            complement(526284..526715)
FT                   /locus_tag="Snas_0500"
FT   CDS_pept        complement(526284..526715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40215"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40215.1"
FT                   /translation="MPTVRFGFTPSPVHVRTARLVAASAAAQAQLAAEFIDEVRQAAGE
FT                   ACSRAVARHRRHGVTKLVRMKLAIGERFVAEVADFAPVSRNSLSIAGNGVTDLAASPSD
FT                   EDALAEEVALTLLAGLVSDLQVIEGEDGVGTIVRMAWPL"
FT   sig_peptide     complement(526617..526715)
FT                   /locus_tag="Snas_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.673 at
FT                   residue 33"
FT   gene            complement(526719..527048)
FT                   /locus_tag="Snas_0501"
FT   CDS_pept        complement(526719..527048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0501"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   scl:sce0880 putative anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40216"
FT                   /db_xref="GOA:D3Q5R7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R7"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADD40216.1"
FT                   /translation="MELTIRTRTDGEYTVVAVGGEIDMFTATELREALHAELAKNVSRL
FT                   AIDVNGVEFCDSTGLGVIIGVLRRLRESGGKLVIVCARQQMLKIFQLTGLDTVLDIRAE
FT                   LPADG"
FT   gene            527125..527604
FT                   /locus_tag="Snas_0502"
FT   CDS_pept        527125..527604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0502"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   gur:Gura_2320 CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40217"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R8"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADD40217.1"
FT                   /translation="MGQTGDGAILECMHAGALAKDFPTVTLDTSALEAAKLMAGNDLPG
FT                   LIVLGSNGCPYTVLGGTQVLRMSVPLYIQDDPTLAGVVDEAAADTFVAGLGNKTVRELL
FT                   PEEPFDLPVVGARATLLEVAALMARVRIPVVAVVDNDTLLGAITVDSLLDHALGT"
FT   gene            complement(527610..528218)
FT                   /locus_tag="Snas_0503"
FT   CDS_pept        complement(527610..528218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0503"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR; KEGG: xcv:XCV4086 LuxR family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40218"
FT                   /db_xref="GOA:D3Q5R9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5R9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD40218.1"
FT                   /translation="MTIRILVADDEAMLRGALVALLDLESDLDVVAEVDTSTAAVTATA
FT                   ESRPDIAVLDLEMPPADGLVAAEQILRQPTPPRIVLVTRHARPGVLRRALAAGVSAFVP
FT                   KTTPAERLAEIIRDVHSGRRYVDPDIAASALTEDECPLTTRELEVLRAARTGASIADIA
FT                   AAVHLAPGTVRNYLSSAMTKLGVSSRHAAAHAAWEQGWI"
FT   gene            complement(528215..529438)
FT                   /locus_tag="Snas_0504"
FT   CDS_pept        complement(528215..529438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0504"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: ccs:CCNA_01207 two-component sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40219"
FT                   /db_xref="GOA:D3Q5S0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S0"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADD40219.1"
FT                   /translation="MPDSPPHTGQRRLTWLRRYTWWFLIPYPLTAATVGTIQAIRHDHP
FT                   GGVLALILIAFAVATVVSVRWFDAVTRHEARDWPTLADWVLFAVAAAGLAGTAWLISPF
FT                   PYRPLGWLLLASALTAAVILRLPARHRLAALVVMTGLIAAATALLARAGLAAPLTVLGV
FT                   AALVASFAAIIWVQWWSFDVARQLEQARSVAAELAVTRERLRFAADLHDIQGHHLQVIA
FT                   LKSELAARLGGRDPDKAVALMREVQDLARDALSDTRAVVAGYRSVSPGTEITNATKVLT
FT                   AAGIEATANLPGTDPGRGFAGERELGLLIREATTNILRHARPTRAEFDLTATGEGLSVR
FT                   IRNDGADSGATSGDGTGLAGLRDRFEAVGGSLDWRSEAGRFTVSARLPRAAAPPDPGRS
FT                   PDTEGSTR"
FT   gene            529595..530566
FT                   /locus_tag="Snas_0505"
FT   CDS_pept        529595..530566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0505"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce5573 putative ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40220"
FT                   /db_xref="GOA:D3Q5S1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40220.1"
FT                   /translation="MTRTHTVSSRRNPELAGARPAIHASGLRCRYGDYLAVDGVDLSVR
FT                   PGELFALLGTNGAGKTTTVETLEGHRRADAGDISVLGRDPYRHRRQLAGQVSMVLQESG
FT                   FTANLTAAETLRLWRHLNRGRTGPADPLADVDLSHRADVRVGQLSGGERRRLDLALAIS
FT                   TAPSVLFLDEPTTGMDPTSRERTWALLRNLVDSGCAVLLTTHYLEEAEELADHLAIMHK
FT                   GRVAVAGTVAQVAASHAAKIGCALPAAIDAASLPRFDGDVSLMDDALTVRTTRLQADLH
FT                   LLLNWANDNRLDLGQLTAAEASLREVFAAVQATDITTDTNGR"
FT   gene            530569..531324
FT                   /locus_tag="Snas_0506"
FT   CDS_pept        530569..531324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0506"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: dol:Dole_0810
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40221"
FT                   /db_xref="GOA:D3Q5S2"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S2"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADD40221.1"
FT                   /translation="MNPTTTNATGPRIPAWLVLTGMELRLILRNRSMALTAIVMPLGFA
FT                   GVILAMSDAATADLATMNLTMLAGFTVYMTATMTLAHHRAALFLKRVRSSPASTTGIVL
FT                   GFATAPILLFVGQSLLFIAITGAVKGILPAQPLILVAAAVIGAVTCAALAFLTASFTKT
FT                   PEAAHFTTMPGFAVLFGGLMWVLSTPPDEVTVPTLALPGTAVTQLLRYAWSGEGSIEMG
FT                   LLWPAVASVTVAVLSCAVAARLFRWEPRD"
FT   gene            531360..531587
FT                   /locus_tag="Snas_0507"
FT   CDS_pept        531360..531587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40222"
FT                   /db_xref="GOA:D3Q5S3"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40222.1"
FT                   /translation="MSHSSFVHTALTGRLADNVKTEVLLSLLVIGLVTGISIARLDGAW
FT                   LYALPAIAVGYSAVRIALVARRTRRRARAD"
FT   gene            complement(531595..533874)
FT                   /locus_tag="Snas_0508"
FT   CDS_pept        complement(531595..533874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40223"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40223.1"
FT                   /translation="MATHSLVPRSLAAALRAVPDETLAALLRARPDLAVPVPADMEALT
FT                   IRARTPASVSRALDRLDEFTLRVLDGLRLVGTEDEDGPVTSVNLLATVTPDLSDVGVAI
FT                   ATLRGLGLVWGPDEELRHPACLAEVCGPYPAGLGRPAAELSSEAGKLVDDAAALRRTVL
FT                   AAPPQSRTVLDKLAAGPPLGTVTDAYAQTPADTPVRWLLAHHLLVPVAADTVELPREVG
FT                   VLLRREAGPLGTLRRQPELPQPISPVAVDSAGTAQVCEVVRLTDLLLEVLTAEAPPEVK
FT                   SGGIGMQALHRLARTCDLSDANAALLLEACFAAGLLGRDGEAWMPSHGYDGWRSAPLSM
FT                   RWSRLARAWLDAERDIRLLGARPGRTRPSTVLSPSLVSHSAPRYRREVLRLLAEQAPGT
FT                   PIDTELTVEVCGWRHPRRRADDAVRAVHTQASFLGIIARDAVTEFGRLLVAEPDHDDPL
FT                   GIHTPETDPLHTTLDDLLPVPIDEMVVQGDLTVIVPGHPSPLLAAELALVAERESPTVH
FT                   RVTEASLRAALDAGYAREDIRGVFARRCPGELPQALDYLIDDVAKRHGGLRAGYAGSYV
FT                   RSEDEALLVQVLADRRLADAALRRLAPTVIVSPMPLPGLLSMLREAGHTPVAEDSSGSI
FT                   VIDKSVAPRATRVVRPDKTADPTPRVEGAPLAALVEHLKHTEPRAETMARGQRLDEDAV
FT                   EVLREAVPDRALVWVEYVDGGGEPIRKLLRPVSMGAGYLRAEDKRTDMLHTIALHTIRS
FT                   ATIASV"
FT   gene            533962..534144
FT                   /locus_tag="Snas_0509"
FT   CDS_pept        533962..534144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40224"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40224.1"
FT                   /translation="MTETRRSRIKPVKDGYLPITELTSPVSAAGSPFGEDGEVFPLPVD
FT                   QLNYEHSEPVPPREH"
FT   gene            complement(534105..535526)
FT                   /locus_tag="Snas_0510"
FT   CDS_pept        complement(534105..535526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: par:Psyc_0871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40225"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40225.1"
FT                   /translation="MNDSGFWADLAENMEPADPWDLTAMSQRVQEAAAEAALAERERFI
FT                   ERLNGGNKSGELLNDATEKLNKDLIDRFSYPADPYDIEQIQQVPSQYEWLHGRDPSSLI
FT                   HKRQVVNRVAKDLAMTVPGGIGSLQTLLTANDAFTGRVADRFADYLGDMVDVAENQGAM
FT                   AAELATALGNMFNLLTAAGKDMRSITDETVTALNAIRDDEYGSSGLMGFAVAGALIGLL
FT                   GSVATGGTTAAIAWSLLSGTVAVAARTTVEASISAGTVEEVLNQMFDAVAERVEEFDHR
FT                   EGQVVKALNADNGLADSHRPELDPDTKPANMYDGRGDLGAADTVLAADLADTHRHATTT
FT                   VPKLAGQFGSASTALSTVSGTAVEPMGNASQPWETLCTKLQRYSALASNHLYDGGEVLA
FT                   KAMVSFAEQDGINAKWVREPLTEHEGPDIPEAYTPPDPRPWMDRPKSDRLALVNSARPA
FT                   AKAQCSRGGTGSECS"
FT   gene            complement(535667..536146)
FT                   /locus_tag="Snas_0511"
FT   CDS_pept        complement(535667..536146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40226"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40226.1"
FT                   /translation="MKGLNQDLGIADEYYRSLDPTRVKANTYEGEDDTKAVGDSLAVNL
FT                   ARTHAAATHAVPRLAEVFGKASESISSATGSGAMALGPAYQPWEELCNRLQRVTAITGN
FT                   HLYEGGHNLAEATVEFARQDGIHAKWVNETIEPVEHIEVPDVYTRPDPNLPPWMR"
FT   gene            complement(536195..536950)
FT                   /locus_tag="Snas_0512"
FT   CDS_pept        complement(536195..536950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40227"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40227.1"
FT                   /translation="MNDGNWLTDFFESYTAGSDSWDIRGKAEQVQEHAADAWLAELADQ
FT                   NRNLPVDELGGAPPPPPDAYAKDFISEIPSHFLWLETRDPSDLPAKLEAMVSATTRLDI
FT                   ELPHGIETLSSRLDDTDHFTGRTPHAFANFLNIAKDAAHAQSSFANELATAVTQMNKLL
FT                   GAARDDVYSIADETIAALDEIRDGGSGDGGAMAFAVAGAIVGVGAAVTGGTAAIAWALV
FT                   SGVVGVTGTAVTSAGVSGDSVEDVLAQMN"
FT   gene            complement(537085..538863)
FT                   /locus_tag="Snas_0513"
FT   CDS_pept        complement(537085..538863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0513"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce8545 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40228"
FT                   /db_xref="GOA:D3Q5S9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5S9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40228.1"
FT                   /translation="MAVNLVNLEAVGKAFPNRTLLEGVSLGIGANERVGVVGRNGDGKS
FT                   TLLRVLARDEPADSGRVTHSSGLRLGLLSQRDDLDPDKTVREQVLRGMAEHEWASDAKT
FT                   RDILTGLFGGLDLPGLEHGLDSTVGPLSGGERRRVALARLLIGEHDLLLLDEPTNHLDI
FT                   EGIAWLARHVRDRRCALAVVTHDRWFLDEVCTRVWDVQDGNVHEYEGGYSAYVLARAER
FT                   ERIAAVEAGKRANLMRKELAWLRRGPPARTSKPKFRIDAANALIADEPPARDSPELMKF
FT                   ANSRLGKTVFELEDVTVTAGDKTLLTDLTWQLGPGDRIGLVGVNGAGKTSLLRTLATAA
FT                   REERQPSTGRVVVGKTVKLAYLSQEVVELDETWRVLEAVQRVREHVDLGKGRTMSAGQL
FT                   CERFGFTGTKQWTVVGDLSGGERRRLQLLRLLMDEPNVLFLDEPTNDLDIETLTQLEDL
FT                   LDDWPGSMIVVSHDRYFVERTTDTVHALLGDQNLRMLPGGIEEYLERRQQQLSGGDEPT
FT                   PTRQRAGDSRAAKKEVARIERQLEKLAAKEKDLHAAMAEHATDAAKLDDLTAQLTQLGI
FT                   QQGELEERWLELASDD"
FT   gene            complement(538863..539867)
FT                   /locus_tag="Snas_0514"
FT   CDS_pept        complement(538863..539867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0514"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: rec:RHECIAT_CH0003526 probable transcriptional
FT                   regulator protein, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40229"
FT                   /db_xref="GOA:D3Q5T0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T0"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADD40229.1"
FT                   /translation="MTHHVAVLLFDDTSGFTAGMAAEVFGRPAPEPGLDWYELSMCAQR
FT                   PGVVTALGGARFDTPHGLDVFAAADTVIVPGVPNMTDPPSPEVVTAVRQAHRRGARVVS
FT                   LCSGTFALAGAGILDGRRAATHWAHAAELRGRHPLVAVDSDVLYIDDGDILTSAGQAAG
FT                   LDLCLHLVRKDFGAAIANRVARRLVVQPHREGGQAQFIETPLSADPEDDRLAASMAWAA
FT                   ANLDKPVTITVLAERAHMSPRHYQRNFARSTGTSPIRWLIEQRVRASLALLETTESSIE
FT                   QVSAAVGFDTSVTFRHHFARLMRTSPSAYRRAFRGGATAQVSLAAVFTVTGAC"
FT   gene            539939..541138
FT                   /locus_tag="Snas_0515"
FT   CDS_pept        539939..541138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0515"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF1228; KEGG: csa:Csal_0040 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40230"
FT                   /db_xref="GOA:D3Q5T1"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40230.1"
FT                   /translation="MTVSIERPTTVRGPAAWQVGLAGTAMIAATFGFARYSYGLYAPAL
FT                   RAEFDLSVGLVGLIGSATYVGYLLSLLVVGVFSQRLGPRPLVVIGGLSAAVGMLAVGLA
FT                   TGPWLLVAGLVLAGTSPGWAWAPYSDAVDRLVEPGKRQRVMGLIPSGTAFGVVLAGPAA
FT                   LFLYGPVWRVAWLVFAVITFAVTVYNALILPGTRRRETPDVETQARVGPSWFLRPGVTR
FT                   HYLTAFSYGLIGAIYWTFAVEAIAADSTRSTAPLFWTLMGAVGMLGALAGVAIGRYGLR
FT                   VVHIGLFASMAAAILLLGLAPGSLAAVIASAVLYGPAFMAGSSLLQVWSYELFPDRPTT
FT                   GFSATVFFIGIGTILGPTLAGQIASGWGLGITFVATATVAAATLAIAPRRQAAIRTPRR
FT                   "
FT   gene            541196..542071
FT                   /locus_tag="Snas_0516"
FT   CDS_pept        541196..542071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Formin Homology 2 Domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40231"
FT                   /db_xref="GOA:D3Q5T2"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40231.1"
FT                   /translation="MTDPLAPYNAGSDPLAPPPATPPASAVPVPEPKSVMEPRPAAPLE
FT                   DAKPRVARPGTSRPDGPPASPGASVHEANVVDLPPLPRKRSLLWRIVSFSWELTIGVTI
FT                   ALVILVAGGVFYVVDWAKSLGPTYSAAELYEDGRYSMTVKDGDKVILDTYLDQVGAWDH
FT                   DGCDSIATDKAVQSAVVEAGCEFGIEGVYERADLHYTIYQRILEFPDAGAAKRGGQALG
FT                   DAEELPGKVSFSVEMPEDGKTGAVVDVEGRFVIFTVAAIEPEGEKNLAEAEEAIDALHT
FT                   EHLNVLVWQD"
FT   gene            542106..542960
FT                   /locus_tag="Snas_0517"
FT   CDS_pept        542106..542960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0517"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40232"
FT                   /db_xref="GOA:D3Q5T3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADD40232.1"
FT                   /translation="MQIEKFVDQFELLAEAHGITTAALLQRLERQDDDRPRWIAVENGR
FT                   GIGVASASMTPDRKVRLWLDCRDSIAYQPLVRAASAAFRTDVYTSVSGSDLLLRRAFTA
FT                   EGFRLDYTEDVFAARFTTAAVALRKARLPDGFSLITADQADGRSWFTLDNTLRQDIRGN
FT                   EGWRGDLKWFAEHTHGASNFDPAAHIIAVDDTNGEYAGLVRFWNRPGASPRLGMLAVLR
FT                   QYRGCGLGSALLARGVEVASTWDHERFTGETAREATEMRALWIAMGGTETDSRQTLVLR
FT                   RGD"
FT   gene            complement(542962..545253)
FT                   /locus_tag="Snas_0518"
FT   CDS_pept        complement(542962..545253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0518"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: dvu:DVU0256 DEAD-box ATP
FT                   dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40233"
FT                   /db_xref="GOA:D3Q5T4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T4"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADD40233.1"
FT                   /translation="MSLAPEDLVRRLAVYRDGEPLRHVHAVPARVAEFADWPDWVPAEL
FT                   RESLAAAGIERPWRHQIEAARRVHDGKHTVIATGTASGKSLAYQLPVLSALATDEGACA
FT                   LYLSPTKALAADQARSVKKLASPGCVAATLDGDTPYEQRQWIGRHANLILTNPDMLHHA
FT                   ILPRHDRWARLLRQLRYIVVDECHAYRGVFGSHVALVLRRLARLARHHGADPVFVAASA
FT                   TTGDPAHGASRLLGVEVEAVTEDHSPHPGVTFGLWEPPLLPDVTGEHDAPVRKSALTET
FT                   SQLLADLVSRQVRTVAFVRSRRGVELVSSLARESLAGTGRSSRVAAYRSGYLREDRRAL
FT                   ENDLRDGLLLGVAATNALELGIDIAGLDAILLCGYPGTLASLWQQSGRAGRGDIPALAI
FT                   LVARDDPLDTYLVHHPEAVFSRPVEATVLDPANPYILGPHLLCAAYEHRLSPTDVDLFG
FT                   GEIAEELLGEFAAAKIVRHRKTGWFYVARDRPEVGLRGGVGTPIDVIDTESGELLGTVD
FT                   TASAHTLVHPGAVYLHQGSSYLVESLDEEDSAAFVTSVRPEWSTYPRDTTDLRILKLRR
FT                   YVDAGPIGLCFGDVEVTNQVVGYQRRKLPGGEFMDEVPLALPPRTLRTVAVWWTISENA
FT                   ILDTGLSKTDIPGALHAAEHAAIGLLPLVATCDRWDIGGLSTAGHPDTGVPTVFVYDGH
FT                   HGGAGFAERGYTAWRDWLSATRDAIEACGCEFGCPSCVQSPKCGNGNDPLDKAGALKVL
FT                   ELILAAEPRH"
FT   gene            complement(545322..545813)
FT                   /locus_tag="Snas_0519"
FT   CDS_pept        complement(545322..545813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0519"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mxa:MXAN_6572 Rieske family iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40234"
FT                   /db_xref="GOA:D3Q5T5"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T5"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADD40234.1"
FT                   /translation="MTDLDTSTALTERARTLAANVISTSRRGVLCGAVGASAAAVLAAC
FT                   GGSTDDTGSGDKETSEDKTSDSGDSGSKALAKEADIPEGGGKVVDDLVIVQPEKGTFKA
FT                   FDRACTHKGVPVEAPKDGVMTCPKHGSKFNVDGTVAGGPATKPLAEVKVTVKDGEIFRA
FT                   "
FT   gene            546012..546569
FT                   /locus_tag="Snas_0520"
FT   CDS_pept        546012..546569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0520"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   rpd:RPD_4377 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40235"
FT                   /db_xref="GOA:D3Q5T6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD40235.1"
FT                   /translation="MDEATPSTGLSASMSADEQLIHALHAEHADALWRYACRLTGGDEA
FT                   RAQDAVQETLLRAWRNSRVLASSPDHARRWLYRTLRSRVIDEWRYRKNRPEVITDTLPE
FT                   RHAADHVDSALQGLLVVEALRKLSPAHREVLMECFYGGRSVNEAAEKLAIPAGTVKSRL
FT                   HYALRALKLALEEAGVVRREER"
FT   gene            546566..547237
FT                   /locus_tag="Snas_0521"
FT   CDS_pept        546566..547237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0521"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: pfo:Pfl01_3667 transmembrane transcriptional
FT                   regulator (anti-sigma-factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40236"
FT                   /db_xref="GOA:D3Q5T7"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40236.1"
FT                   /translation="MSDCAFPHDAAAYVLGALEPAERERFEAHLPECESCAATVREFTE
FT                   LPGVLAHAPVEELSAEPAPETLLPTLVRKVRKDRRRRLFRAVVVTAAAVALFAVGALTA
FT                   VNLFTSEATAPSLDVALQPIAAVQITSEAGMIPQNEGTRIELSCDEKNTDDNPDSGYGG
FT                   KYAYRLVVTNTKGETDVAGSWTGADDGSTRVVLFTRWKPQDIASLEIQTMDKKPIMRWR
FT                   A"
FT   gene            complement(547244..548161)
FT                   /locus_tag="Snas_0522"
FT   CDS_pept        complement(547244..548161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0522"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   xca:xccb100_0749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40237"
FT                   /db_xref="GOA:D3Q5T8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T8"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADD40237.1"
FT                   /translation="MSSPTFRRRTLLGATVAAAALSGGTGFAATAHAGTRAKEEPLIGP
FT                   ATGEQLHVMTFNVRWDTDPSPHSWAERRILIKELLGRERPTILGTQEGLLHQGQHLLAD
FT                   QKGYDWVHLSRRGGGEDEATAVLYDTSRLRVTNYGHLWHSDTPQSMGSTTWGNEIPRMM
FT                   TWLRFTDSASDKEFVLVNTHLDHKSAPSREKSAAQIKELVASFDVPVLVTGDFNTAQGT
FT                   APYTTLVDGTTLEDTWETAEQQLTPAYGTFNGWKPEPVDGGDRIDWVLATPGTAVAKTA
FT                   VNTWSVDGLTPSDHWAVQSLVTLA"
FT   sig_peptide     complement(548060..548161)
FT                   /locus_tag="Snas_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 34"
FT   gene            548490..548630
FT                   /locus_tag="Snas_0523"
FT   CDS_pept        548490..548630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40238"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40238.1"
FT                   /translation="MTINSTPTVPPQAASIEAVPAGNAHPGASPRPKRYHGRHRRPRNA
FT                   G"
FT   gene            complement(548687..549490)
FT                   /locus_tag="Snas_0524"
FT   CDS_pept        complement(548687..549490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0524"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   scl:sce6748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40239"
FT                   /db_xref="GOA:D3Q5U0"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U0"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADD40239.1"
FT                   /translation="MWWQLRAAVILYGGAVRCVAQYRADLVFSMIAGLLFQGSGFLTVW
FT                   VILARFDAIAGWSISDMALLYGMRLCSHGLWVVLLSPLSQLSRYIREGTFDRFLVRPVN
FT                   PLVQLMTTRIWFAPVGDLIGGIVLLGVAVTLVNVEWTAWKVAFLIVALIGGALLEGGVQ
FT                   LGLSCTSFRFVKADQLRFTTDQIFSMFGNYPAKIFGGIGLWALTAVIPVVFVAYLPASV
FT                   LLGHAEATGLPSWLAYASPLAGLVVTVVGYRIWMYQLRNYTGTGT"
FT   gene            complement(549495..550274)
FT                   /locus_tag="Snas_0525"
FT   CDS_pept        complement(549495..550274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0525"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   rle:RL2976 putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40240"
FT                   /db_xref="GOA:D3Q5U1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U1"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADD40240.1"
FT                   /translation="MTPRIAYLGTRFKALLAYRFEIIIWLIGPLLQMLLLATVWRAVYD
FT                   GRSTVDGVSLAVMTTYVTISTIHSLIAHDDMDDWVHERVNTGGVGVDLLRPLPFMEQTL
FT                   WGSVAQLGIKLLMIVVVLPVGAVFAGLSAPAHLGLYLIAAVLAWLVNLCMYLLLSSIVF
FT                   WTLEVHGLNFMYFVVNAFLSGALVPLWFMPDWLATALSWLPFQAIVFTPASIYVGQLTG
FT                   TAAWQAIGVQFTWLVLLSATAVLVWRRAVRKTVVQGG"
FT   gene            complement(550271..551257)
FT                   /locus_tag="Snas_0526"
FT   CDS_pept        complement(550271..551257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0526"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce6750 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40241"
FT                   /db_xref="GOA:D3Q5U2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40241.1"
FT                   /translation="MPLIETRALVKEFRRLRPKTGRFATVRKLFSRDYEAIRAVDGIDF
FT                   AIEPGELVGYLGPNGAGKSTTIKMLTGILTPTSGDIEVAGVVPYKHRQRNARNIGVVFG
FT                   QRTQLWWDLPLIDSFKLIGKLYQVPKAKYAENVERFTELLDMSSFLDTPVRQLSLGQRM
FT                   RGDLAAAMLYEPPILYLDEPTVGLDVIAKERIREFIAELNADTGTTIILTTHDMDDVER
FT                   LCRRLILIDHGLVLYDGPVGPLKEKYSPHRELAVQLTHPADVEVPGAEVVSHEGGAVRL
FT                   SFDPTTTPVARLIAEISARYEITDLSVSEPDLEDVIRKMYAERGDTG"
FT   gene            complement(551325..552332)
FT                   /locus_tag="Snas_0527"
FT   CDS_pept        complement(551325..552332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0527"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mxa:MXAN_0303
FT                   aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40242"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U3"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADD40242.1"
FT                   /translation="MTTAIPSVPLGSHGPTVGAQGLGCMLMMNDANGFDADEARATLET
FT                   AFESGVTLFDTADMYGAGGNEEFLAPFFAAHRDEVVIASKFGIVYDGSPGRPFRGDRAY
FT                   VRQSIEASLRRLNVDVIDLYYMHRLDPETPIEEIVGAMAELVTEGKVRHLGLSEVTAPE
FT                   LRAAAAVHPITAVQSEWSLITRDVETQVVPAAAELGTAFVPYAPLGRGFLAGLFTDAAE
FT                   LGESDHRLGHSRLTGDNALANAKVRDLLAKVAADRGVTWGQVALAWVHQRAEAHGLSVV
FT                   PIPGTRKRSRLTENLGAVGLELTRSELDSLDPIAERMAGTRYPGSGGGTSVTRE"
FT   gene            complement(552332..552763)
FT                   /locus_tag="Snas_0528"
FT   CDS_pept        complement(552332..552763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0528"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; SMART: regulatory protein MerR;
FT                   KEGG: bac:BamMC406_1754 MerR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40243"
FT                   /db_xref="GOA:D3Q5U4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U4"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADD40243.1"
FT                   /translation="MTDTVPADIKPDPDMPMPDGSDAYSIAEAARLTGMSAHTLRWYER
FT                   IGLVTDVHRNHSGERRYRNDDLRWLGFVSRLRQTGMPVAEMVRYAELMRAGEHTSAERR
FT                   DMLLAHRERLRAQLAELRSFETVLDFKIEHYDTVCREEQ"
FT   gene            552930..553898
FT                   /locus_tag="Snas_0529"
FT   CDS_pept        552930..553898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0529"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   scl:sce5141 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40244"
FT                   /db_xref="GOA:D3Q5U5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U5"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ADD40244.1"
FT                   /translation="MNDPTQQFEPHRRELTGYCYRMLGSAFEAEDAVQETMVRAWKNFD
FT                   RFEGRSSVRSWLYRIAGNVCFDMLRSPQRRARPSDLTGPSTADDMPGPPLSESTWIGPI
FT                   PDSLVAADPADRAVTKDSVKLAFIAALQKLPAKQRAVLVLREVLDWSAAETAELLELSV
FT                   ASVNSALQRARATVADLDEGVTDDRDPLDKDQQELLDNYVSAFEAYDLDALTHLLHEDA
FT                   TLSMPPLDLWLRGADQIRAWFLGTGCGCRGSKLVPVAANGVPTFAQYRPSEDPEVWKPW
FT                   ALILLDIRDGQIVAQNNFLDVERLFPLFGLAMEYRLPKATA"
FT   gene            complement(553952..554233)
FT                   /pseudo
FT                   /locus_tag="Snas_0530"
FT   gene            complement(554233..554886)
FT                   /locus_tag="Snas_0531"
FT   CDS_pept        complement(554233..554886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pla:Plav_2389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40245"
FT                   /db_xref="GOA:D3Q5U6"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U6"
FT                   /inference="similar to AA sequence:KEGG:Plav_2389"
FT                   /protein_id="ADD40245.1"
FT                   /translation="MTTQNPRPSPTTRMLLYCGAIGGPLFSLVVVAQELTRPGFDPKVN
FT                   ALSQLSTGEGGWLQIANFVVAGLLVTASAVGIRRTVRTGPGRTWLPILFGIYGVGLVWG
FT                   GVFVTDPAFGYPAGTPQGAPETLTWHGILHGLAPAAIGVALIAASIIVARRYRWQQRGA
FT                   AAVVSWVVPVVYLLSSGLAFGLGDFRYLLAGGIIIWVWAAAVTADLSRVRAATE"
FT   sig_peptide     complement(554788..554886)
FT                   /locus_tag="Snas_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            555473..558034
FT                   /locus_tag="Snas_0532"
FT   CDS_pept        555473..558034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0532"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Lanthionine synthetase C family protein;
FT                   aminoglycoside phosphotransferase; SMART: serine/threonine
FT                   protein kinase; KEGG: smt:Smal_2130 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40246"
FT                   /db_xref="GOA:D3Q5U7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U7"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="ADD40246.1"
FT                   /translation="MDEQYEAFCMADSTFYDAMYSAETAGVSFPVAERELSPEWHRSEQ
FT                   DDWLVFRRPDREIPGQGWKIHASASMESAQRVLEEVWDYCVPRGIAFKFLRSPNALLVR
FT                   VSKYAPRGYSGKLVTIYPADIGQCETILNELGARLEGVDNPYVLSDLRWGTGPLHVRYG
FT                   AFANQYTVDENGQTVEAILDGDGKLVADDRGPVFRIPEWETLPEFLQPHLEARNAVTVA
FT                   ELPYAIDGVLHFSNGGGIYRARDTRDGKRVVLKEGRPHAGLDGKGRDAVQRVEHEYNIL
FT                   KQLSGIEGVPEVYDLFWLGEHRFLAMEYVEGEVLSKAIVLKYPLIDPGATEAEFATFTD
FT                   WALEVHNQVSKTIAEIHARDVVYGDLHLFNIIVDESDRIRLLDFEVADAADSAERPALG
FT                   NQGFTAPRDIVGPAADRYSLACLQLALFMPMTNLLGLHRLKARHFVEIITAHFPVPDGY
FT                   FREALDQIAPATITDAPIRIEPETEQWPRLRDDLAKAIVASATPQREDRLFPGDVQQFA
FT                   VGGLGLGYGAAGVLYALSVTGAGRHERFEDWLIDRSLRPVQGTRLGLYDGLNGAAFTLD
FT                   HLGHRQAALDVVDIFLAEKWESLNTDLASGLAGAGLNLLHLAGPDEPELVERGLRCAEL
FT                   VAADIGELAEATDSSGGGEPWAGLMRGDSGRALLMLRAYAETGDPGFLDRAETALRRDL
FT                   KRCVTSKTGALEVNERWRSMPYLEAGSVGIGLVLRQYLRVRHDEELAQAAEDIDLAAQS
FT                   PMYILPGLYDGRAGILLYLAETLADPLSESSVRRQVRALSWHALPYADGVAFPGNGLLR
FT                   LSMDLATGGAGVLLALGAVLHDQPVHAPLLTLKDTRGARRE"
FT   gene            558070..558222
FT                   /locus_tag="Snas_0533"
FT   CDS_pept        558070..558222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40247"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40247.1"
FT                   /translation="MALLDLQGLESPADLSATRGGSSGSGHSCPSNLSATLCGGTSGLS
FT                   VLICH"
FT   gene            558290..559996
FT                   /locus_tag="Snas_0534"
FT   CDS_pept        558290..559996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0534"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; KEGG: mxa:MXAN_1097 efflux ABC
FT                   transporter, permease/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40248"
FT                   /db_xref="GOA:D3Q5U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40248.1"
FT                   /translation="MTFIRDEERPRKLGDIARRPGAWLPLIGASALIGTASTLSLPTVL
FT                   GHAVDSIVAGADGGGWMWLAMGIIAAGVLSDLTDSYASSASLAGTAAWLRGTVVRHVLA
FT                   LGARPPRRFDTGDLVTRVSANSVDAARTGPGVVSGVSAVVPAAGSLVLLAMMDIWLAVA
FT                   FLGGVALVAIVLRVFTSRTASVTADYQRVQGRLAARLTEATAGARTIAAAGSARREANR
FT                   VLTDLPQLSEHGRRTWRVLASASAQGAVAGPLVLISVLAVGGLGLWQRRLTPGELFAAA
FT                   QYAVIGAGLGGLTSVFAALARSMAGGKRVLELLRLDPVGHGGDELPDGGGELEFRGVSV
FT                   SAPAPETDDEADDADTPASLLTDVNLRLPAGSAVAVVGDDTKSVLAELAARLRDPDCGQ
FT                   VLLDGVPLYRLSRRRLREAVGYAPAQPVLVGATVAEALGPNSSQDDIRDAATATHCHDF
FT                   IAKLPLGYETPLDEVPMSGGERQRLGLARAWRAGRLLVLDDATSSLDTVTELRIGHALF
FT                   NGDNRTRLIVTYRASTAARADLVVWLEAGRVKAVGPHAELWAVPRYREVFG"
FT   gene            560016..561725
FT                   /locus_tag="Snas_0535"
FT   CDS_pept        560016..561725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0535"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mxa:MXAN_1097 efflux ABC transporter,
FT                   permease/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40249"
FT                   /db_xref="GOA:D3Q5V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40249.1"
FT                   /translation="MKRELGVGLRALWRRPLAGLLVWSVPEVLPTAVSGYVVAQAIDSG
FT                   FLAGDLWRGLAWLGALFAASLLGGLGSRGVFRYLGALVEPFRDTLARHIVAGALTNATA
FT                   GRREDGAVARLTRQLEIVRDTYAGLILLTRGFAVTVVGVAAGLLSLSPLVAAVIVPPFL
FT                   LGLGLFAATIGIAAGRYRTAVAADERLASEAGTVLGGARDIVATGTEDHAAGMVADRAT
FT                   AQAKAELALARLAVLRTGCFVVGAWLPLALLLFAGPWLVAGGASAGTIMGGLTYILFGL
FT                   QPALNQFITGTGDSGLRFIVTLRRILDAGGEFPTATTLPESEEPRPDRPVADTSRLRAR
FT                   DLSFRYGPRSERVVDGLDLDIQPGEHLAIVGQSGIGKSTLACLLCGLLPPDTGEVTIGG
FT                   QPVAGLPPRELAELRVLIPQQAYVFSGTVADNLTYLNPYAPGDLIDEALDVVGAAKLVS
FT                   ELGGPTAEVSPAQLTDGQRQLIALARAYLSPAPLVFLDEATCHLDPAAEERAELAFAAR
FT                   GGSLVVIAHRISSALRAKRIMVMDGPRSSIGTHTELLSRSPLYRDLVGYWNG"
FT   gene            complement(561722..562336)
FT                   /locus_tag="Snas_0536"
FT   CDS_pept        complement(561722..562336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0536"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG:
FT                   ccs:CCNA_01208 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40250"
FT                   /db_xref="GOA:D3Q5V1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD40250.1"
FT                   /translation="MIEILYGHENTLWSESLASVLSRESDIKVVGEANRPDEILGLAMD
FT                   SPPDVVVLALYLTEVSVVGELCHKLSEGPGQHRVLVLHERDMPLAPFAEAFRSSPKVSF
FT                   MGTCASAAQFLESVRQIACGHLVMDSDVALGLLRANHSPLTAREREVLSITHGGATPKE
FT                   IASKLQLSVGTVRNYLANACAKLGARNRIEAIRVAQSAGWI"
FT   gene            563063..567607
FT                   /locus_tag="Snas_0537"
FT   CDS_pept        563063..567607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0537"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="PFAM: Kelch repeat-containing protein; Kelch repeat
FT                   protein; SMART: Kelch repeat-containing protein; KEGG:
FT                   slo:Shew_3239 Na-Ca exchanger/integrin-beta4"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40251"
FT                   /db_xref="GOA:D3Q5V2"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V2"
FT                   /inference="protein motif:PFAM:PF01344"
FT                   /protein_id="ADD40251.1"
FT                   /translation="MPGSRFIRRSLASLAGLAIVAATLSASAADPSAEPGEPIVKPAAA
FT                   FDTSTPLRDMDPKGVPEAATVQQDHPLGSLGKSTVDKTAETGSAAVQNDAAANMPGILN
FT                   DFEGVGNTFGGAPPDTNGDVGPDHYMQYINISFAIWNKQGDLLYGPAPNNTLFQGFGGE
FT                   CESHNDGDAIVLYDEQADRWMASQFAIFTDSGVNHQCIAVSATGDPLGAWHRYDFEYPA
FT                   DAINDYPKFGIWPDGYYMTANEFDNQTFEFLGAGALVYERERMLAGAPANQIYFHLDQR
FT                   FGGLLPADAEGLSPPDGAPNPFTAMNDDAWGTVTQDTLHVWNFKTDWNVPGNSSFGNAL
FT                   EPDQNLVTEPFDSDLCQYERDCVPQQGTDVGLDAISDRLMYRAGYRNFDDHQSIVLNQS
FT                   VDANGADHAGVRWYELRNTGGDWKIHQQSTFAPDADHRWMGSIGMDVSGNIAMGYTISN
FT                   TNRYPSIGYAGRLADDPLGQLSQGEAVMTEGTGSQTGFNRWGDYSSMSVDPTDGCTFWY
FT                   TSEYVPETGAATWSTRIGSFRFDNCSDGASGVVSGVVTDAKSGKPVPGAKISASGDGST
FT                   VTDAKGGYTLRLPVGDYQLRATAFGYKTQTSNVKITRDSETRVDFALPRAPRATLSGKV
FT                   TDGGGHGWPVYSAITIEGFADPVYTDPVTGEFEIEVPEGGYALTATAEYPGYEPRTEAV
FT                   EVDGNTEVEFALSTTPDCTASGYTPKFDDLQLSESFNGGTPSGWEVVNNGGALPWAFDD
FT                   PGGRGNLTGGEGGFAIGDSDLPGRGTFVDTYLISPKLDLSSLDSPVLRFKTDYRSISDD
FT                   IARVEVSGPDDTWSTIWDSSGVSVRNTQVEIPLVPTLSAAELAASETRLRFHYRGEYAW
FT                   WWQLDDIQVGDGACELVQGGRVVGQVTDTSGKALDGAKVRDSVSGESATTGATPGDPAL
FT                   GDGFYALFTTTTTNHDLVASKSKYAEVARKVDVKKDAVVRADFKLGAGHFAVEPGEIDT
FT                   NVTLGGSWTEQLKVTNTGDAKATLDIKEAEGGFDPMSADDGAARLVKPVQGEASQGMET
FT                   KADTKSGAVTAAEVPDDAEWGALPEYPTTISSNAAARGEDAIYVVGGFDGNETTTASFK
FT                   YDLVDGGWSPIAPLPTPLQKPAAAFIDGTLYVYGGWNPDGSTSTKLFKYDPAGDSWSQG
FT                   ANGPTGVSAPGQAVVDGKLYIVGGCRNDVCDKSAQTQVYDPSGDSWANEAYYPVDLAWA
FT                   SCGGIGDTLVCAGGAGAEGSGLRGVSVLKPGDDEWSEAASLPIDLWGSAYDVANGMLVV
FT                   NSGITGGTSVTNASFGYDLTADEWVTLPNSSQTRFRAAGACGFARIGGSDANRQPVNDA
FT                   ELLSGFDDCGDGTADISWLKPSKTSVTLDPGKSTTVDVTLSATVADGVEQPGTYTAELR
FT                   FGSDTPFRVDPIPVTMSVAPKANMGKLLGTVSGTKCDGTAVMIPEAQVQVKNAAGKRFD
FT                   LYTGADGRYQYWFTKGKYTIIVHKDGWSAEARSVTVKQGQLNLADFVLDKLGC"
FT   sig_peptide     563063..563149
FT                   /locus_tag="Snas_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 29"
FT   gene            complement(567667..569157)
FT                   /locus_tag="Snas_0538"
FT   CDS_pept        complement(567667..569157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0538"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vei:Veis_4674 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40252"
FT                   /db_xref="GOA:D3Q5V3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V3"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADD40252.1"
FT                   /translation="MGTPVYPQTLLDALRREPESPAFEHGARVVARGELLDVIAGYVAG
FT                   LRAAGVGPGKGVAIATATTAEGFAAQIAAHVVGSRVVGVLPDLPSGHLRHIFDDVEYLL
FT                   VDAETGTPDLLGAAKGCQVLTVGADLAGDGGSLVPQGRRETIAYITFTSGSTGSPRGIA
FT                   FTYAAMSGNWSLQPEVWGSRTEELAETHNRFLLYGSLSSAIVFEQLGLTLLSGGTAVIP
FT                   EGPVEFPDVIERLGITMCLLSVPRYHRVLDALRDKEVDISSLRCAIVAGSPVSPRRLAE
FT                   GFERLGPVLRQTYGQTEDGTLTMLTKDDVDQWPEALSSVGRVWENVQLEIRDAVGRAVP
FT                   PGRSGEVWVRTPGQLCGYWDDEEETVEVLRDGWVRTRDLGYLSGDGFVFLTGRSRDIII
FT                   VNAVLHYAGPIERALMEHPDVDQAFVVGTPDEDAGEAIHAIILPVKESHPEPQELRELV
FT                   TRELGASAAPGHLHFVTEIPVAPGGKPDKRALLARVLG"
FT   gene            complement(569318..571264)
FT                   /locus_tag="Snas_0539"
FT   CDS_pept        complement(569318..571264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_2405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40253"
FT                   /db_xref="GOA:D3Q5V4"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40253.1"
FT                   /translation="MTEPKHHRAQTLVIVVAALVAASVAIVLASLGGTRDLYVSTSGDD
FT                   SWDGSLERPFASLKRAQKEVRALTDSMGADITVHVRGGTYRLSQPLKFNGEADSGRNGH
FT                   RVVYQAYGYGTSEPERVTISGGHKVSGWNTDDGVWSAKVGDLRTRQLYVDGDRAPRAGL
FT                   GGGIPGDAIATKTGYTTDSTAPQSWKDPENIEFVYTLALYTDRRCGVKDVTGDESGSTI
FT                   TMDSECWGLMLAEADDPVLGEKGELPSEPTDIVNSRSFLDKAGSWFLDRTGSGEHTLFY
FT                   KPLPGQEPGSTEVVAPRLETLVDGSGGSGKRLHDVDLNGFTFAEATWLAPDEPSGFVSS
FT                   WSSYSLPGEQARRTVPGNVRFRDSDRIGLRGNTFTRLGGQGLEISSSSSGFVVAGNEFT
FT                   DISDGGIVMGLLPPDTAGEHRDNRIADNWVHDIGVENRAASGIWLMGTKDATIEHNQVN
FT                   DVPHMGILAGRDPDVPAATSGTRILGNLVIDAMQRIGDGGGIYLRGSQGDSYADGALVK
FT                   GNVVTNARTDTGGFFNIGIYTDDGSKWVTVADNATYDNLAAIGGCDESPRRPVDRIRFT
FT                   GNFWDDAVPEGIDRMDFPGAWPCGQPHHVSFAGNTTLSQTAPARACRSNLDCVTILKRA
FT                   GLSDEYRELLRDK"
FT   sig_peptide     complement(571175..571264)
FT                   /locus_tag="Snas_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.723 at
FT                   residue 30"
FT   gene            571277..572638
FT                   /locus_tag="Snas_0540"
FT   CDS_pept        571277..572638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0540"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40254"
FT                   /db_xref="GOA:D3Q5V5"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V5"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADD40254.1"
FT                   /translation="MAVTARFPAPGGRSTPSFRKGSYPCGRRRRLITEGEDDRRNHPYR
FT                   ELVSTRIAGLPWSWRPSRRAAIAASAILAVATTVAALAHVSHFEPPGAQPWIDYALALA
FT                   GSLPLALLYRRPLAVCSIVVASDLAVWFFRPSWTMAGALVLPVVIYAATSRHGRPVAAV
FT                   SWLVCATGLATATAVVAPVFLADGTWVVVALLAAVGAIAGDAAHARRRWHAHDRAARQR
FT                   RAALEERLRLSRDLHDVVGHHLTAIALQADAATRRLQHDAAAHAGASEPTPTPADPASA
FT                   DAVTSSIPPAANHFAVVADTARTALAETRRLIAYLRQGTDHPTADQPGIDELPQLIAEA
FT                   LRDGLIVDLHTTAPAAVPPAIGLAAYRVVQEALTNVRKHSGAPTARVEISGPPELLTIR
FT                   VADSGPAAEATTRTGFGLTGLRERVEAQGGQLLAGPRDSGGFEVLASIPLTSGP"
FT   gene            572638..573303
FT                   /locus_tag="Snas_0541"
FT   CDS_pept        572638..573303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0541"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   sigma-70 region 4 domain protein; SMART: response regulator
FT                   receiver; regulatory protein LuxR; KEGG: scl:sce5431
FT                   two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40255"
FT                   /db_xref="GOA:D3Q5V6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD40255.1"
FT                   /translation="MDEPLRLLVVDDQTLVREALAGLLDAEPEFTVVGQAADGSEVPAL
FT                   ARDSDPDIVIMDVRMPDVDGVEATARLTRERPQSKVILLTTFDVDAYVYAGLRAGASGF
FT                   LLKDSHAATLIAAVHTVASGNAVLSPWATSRLVSTFAPLLPEPLATPPRLKALTARERD
FT                   VLSLTGRGLSNNEIATELGIGYETVKSHLRSVMTKLRLRDRVHAVIVAYETGLLRPSE"
FT   gene            573344..573820
FT                   /locus_tag="Snas_0542"
FT   CDS_pept        573344..573820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0542"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: bja:blr4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40256"
FT                   /db_xref="GOA:D3Q5V7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V7"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADD40256.1"
FT                   /translation="MEPVETAKHVIDSNKYLTLGSVLDDGNPWTTPVYFTPDGYHRFYW
FT                   VSNPDSVHSRNIAARSRVRIVVFDSSVRIGGAEAVFMDAEATLVPEAELADASALYSGR
FT                   FPELREFGVDELTAPNSLRLYRADALNHEILVRGSDPVFGKGTDSRLLVDIPRG"
FT   gene            complement(573794..574795)
FT                   /locus_tag="Snas_0543"
FT   CDS_pept        complement(573794..574795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: NAR1.1; high affinity nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40257"
FT                   /db_xref="GOA:D3Q5V8"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40257.1"
FT                   /translation="MSQQPYDPAVTGGFTVADGFSVIPPKRPTAVTLASAIMLAIAGLS
FT                   GLGALVLIVVEVLDNPDPGSVLQSVRFDLGLWLFLLAVGVAPCALLVRNGSDGGRLATF
FT                   TLLGIATLSCFGNAMQTLVELSGSIDVAIVAVPLWLLAAALTVTPVVALASPAASRWFW
FT                   EQRREVSIMDPAVAVPRPTMFTVGVAFVALTALLDIAAKAAYLALMFNTSGIDIATYYL
FT                   GFFASSAAPLIAVLVATVGLAVRSDLARVLAFGACGFYVYSGLRSQIGLVTNLDMYAID
FT                   VWFVVTFALGLLAAVSSTVALVALYRPQVSLWLGQNRFGVEPAGSASGDVHQ"
FT   gene            complement(574824..575585)
FT                   /locus_tag="Snas_0544"
FT   CDS_pept        complement(574824..575585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0544"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40258"
FT                   /db_xref="GOA:D3Q5V9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5V9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADD40258.1"
FT                   /translation="MSRTFEELVAEAEAVSVAGWDFSWLDGRATEQRPSWGYQRLMGER
FT                   MASASAALDIQTGGGEVLAGVETLPPLTVATESWPPNIDKATRLLHPRGVAVVVDEDEP
FT                   PLPFGAEAFDLVVSRHPVSTWWEEIARVLRPGGTYLSQQVGPASVFEVVEFFLGPQPPE
FT                   VRRGRQPEDAQALAEAAGLEVVELRSESLRTEFFDVGAVIYFLRKVIWMVPGFTVEQYR
FT                   DRLRDMHELIQAEGPFLAHTTRFLIEARKPG"
FT   gene            complement(575675..576901)
FT                   /locus_tag="Snas_0545"
FT   CDS_pept        complement(575675..576901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0545"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bxe:Bxe_C0945 putative
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40259"
FT                   /db_xref="GOA:D3Q5W0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W0"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADD40259.1"
FT                   /translation="MNQMGDVPRGLPVERDAGPFDPPSGLTRLRETRPVSPLVFPSGHE
FT                   GWVVTGYEAVRQLMADTRFSSRQDIGVVHDLIPMEGLEVPTDPGPQQPGLFIAMDPPDH
FT                   GRIRGKLTGTFTVKRMKTLEEGIVAIVERQLDHLASLTPPVDLVAEFALPVPSLVICEM
FT                   LGVPYEDRETFQVNTNTFLNTDVTFEEKMAALTELTTYLAGLVTGKRAQPDDDILSDLA
FT                   RDEDLTIEELVGIGFLLLLAGHETTANMLGLGTFALLEHPEQLAELRQNPELMPNAVEE
FT                   LMRYLSIADNFYRYAIEDIEFGGETIPEGSTVVVSLLAANRDPKKFENPDLLDINRKAR
FT                   GHMSFGHGVHQCLGQQLARIEMRAGFNGLLRRIPSLKLAIPADEVKLRTNMRIYGVHEL
FT                   PVTWTETAA"
FT   gene            complement(577037..578752)
FT                   /locus_tag="Snas_0546"
FT   CDS_pept        complement(577037..578752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0546"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF11; KEGG: wsu:WS1797
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40260"
FT                   /db_xref="GOA:D3Q5W1"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W1"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ADD40260.1"
FT                   /translation="MRAVRQNSRLRYLTAAVLTTAAAVLAPTVTATPASASEITPFKKV
FT                   YDKAFYGDFQTVGNGVLDCPNDSTESDCRDTQAGNGNLNNNNFVMTNADMAGLGGFNSS
FT                   SATATIPSGATVDYARLHWGGNNGKYGYASGTTRERCDSSANVVAKPDGSAKSTEVKVK
FT                   VDGGSTTSVAPEVFNQSGNSVNGPHYYGAEADITSLFGSASGSTSVAVGDVWAPTGLGC
FT                   VGGWSLTIVYKYTNPDPDTQDMHNFYIYSGLVVQRSADAPTDIGIDGFYATDGAASHAS
FT                   VTAYEGDRSTQGDRFLVNGKNIAEPGTNATKNFFNSSSDGAATPDNANNLNIDAKDFDL
FT                   PSTAIPPGSTSAKLTLETSGDTYVAQQVAFAVPVPDLEVAKTSSPATVYAGDTVTYTVK
FT                   IKNISNLDYPNAKFSDDLTDVLDDGTVGTPTATTGDAEFDSPKIKWTGDVAAGKTESVT
FT                   YKVKVNDPISGDGKLVNNVVAPGSRPTTCDWHLTVKECKTSQPIKDSSDRPDSPTGKPS
FT                   DRPGDKPGDTAGGPSNLSITGGSYTVPILIALALISAGVATLWYMRRRTRKAEE"
FT   sig_peptide     complement(578642..578752)
FT                   /locus_tag="Snas_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 37"
FT   gene            complement(578898..580994)
FT                   /locus_tag="Snas_0547"
FT   CDS_pept        complement(578898..580994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0547"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: protein of unknown function DUF839; KEGG:
FT                   mes:Meso_0954 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40261"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W2"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ADD40261.1"
FT                   /translation="MTRPRRQLPLLNSGTRHANRSNMTCRFRCGNACDHPAPNRSLNTY
FT                   FGDLFASRRNVLRAGSVGAIAIGAGTAGLLATGNAAADPVSEPAGPAAPDPRHHSGKLT
FT                   FEPVPPNTDDKVTVPSGYEHSVIIEWGTPIIEGAPEFDIDNQTAKAQRGQFGYNNDYLG
FT                   VLPLGRGDHKALMVVNHEYTDEILMFREYPGGSEADPEQIKIAMAAHGLSVVEIRRDRE
FT                   TGQWRTIMDAKGRFSEYNRRIHLDTKFKFTGPATGDDLVKTKADPRGTTPIGTQNNCSG
FT                   GLTPWGTVLSGEENFNQYFVGGDAAPDEAKPALKRYGFNLDVHHDEENRRFDRVQERFD
FT                   LSKHPNEANRFGWIIEIDPHNPNSKPRKHTMLGRFKHEGANPIIAKNGKVVVYMGDDER
FT                   FDYLYKFVSDEKYRKHDREHNLRLLERGTLYVAKLSFTSEDEIDGSGKLPSDGAFDGAG
FT                   KWIKLAHNDESFVDGFTAAEVLVNTRLAADKVGATKMDRPEDVEPNRLTGKIYAALTNN
FT                   SDRGKDGKPGADEANPRNKNKHGQIIEITENRGDNTSKEFNWTLPIVCGDPNDESTFFS
FT                   GFDKSKVSPISCPDNVAFDSSGKNLWISTDGNALGSHDGLFAVPLTGEHKGWLRQFLSV
FT                   PVGAETCGPFISEDNKTVFVSVQHPGEVDGATVDKPASVWPNGDYAKPAVVCAWRPDGK
FT                   DVGR"
FT   gene            complement(581105..581515)
FT                   /locus_tag="Snas_0548"
FT   CDS_pept        complement(581105..581515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0548"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   rfr:Rfer_2723 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40262"
FT                   /db_xref="GOA:D3Q5W3"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W3"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADD40262.1"
FT                   /translation="MKILLKILVTAATLWITTLIFDDIVIDTDSPLTYVGTLLFVALVF
FT                   GLVNAIVKPIAKFMLKASCLYYLSLGILGLVLNALLFLLVIFVADQFGLPFTIEGEGFH
FT                   RFWIALLASIVITVVSWVLNLVIPDKNDKKNS"
FT   gene            complement(581621..582223)
FT                   /locus_tag="Snas_0549"
FT   CDS_pept        complement(581621..582223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40263"
FT                   /db_xref="GOA:D3Q5W4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40263.1"
FT                   /translation="MTYPQQPGYGQQPGYGQQPQQPGYGQQQPGYGQQPQQPAYGQPQQ
FT                   PGYGQQQPGYSSPDYGQPPQQPGGGGQAWITVDAQYFVLNFILSFFKPKIFIDGQQMQG
FT                   TEWKANTFPVVPGTHHVKVVTPYLWDFGEAETQVTVGPGQNVPLEYKSPLVAFFVPGSL
FT                   GPSPQQYNGMGLMIGLMAVPLALLVLVCICSLGGFWI"
FT   gene            582433..583116
FT                   /locus_tag="Snas_0550"
FT   CDS_pept        582433..583116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0550"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: tgr:Tgr7_2634 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40264"
FT                   /db_xref="GOA:D3Q5W5"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W5"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADD40264.1"
FT                   /translation="MASTLALGGTMPLDISAPPARGGNRPTGKMAPVAVDNAVGGERVG
FT                   VVERDGVRVRSESEFIALYESRFSELAAQVYAYTSDASEAQDLVQEAFLRAWQRWDTIG
FT                   GYDEPLAWIRRVAWNLATSRHRRNAVARRFLQRAQPPEPHPGMSPDHVALVEALRQVPE
FT                   KQRRAVVLHYLGDMSVADIAAQTGAKEGTVKSWLHRGRSELARYLNEYEATGEFRRSGE
FT                   VSPHG"
FT   gene            583109..584059
FT                   /locus_tag="Snas_0551"
FT   CDS_pept        583109..584059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40265"
FT                   /db_xref="GOA:D3Q5W6"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40265.1"
FT                   /translation="MADFQPARDPDEELITAAFSSYRAQAPKNFPHPPAAEVMAKADTA
FT                   RPRKRALTVSLAALAFTGLIAGGAAVAQTVASSGEMPDDRGDGSSSVASGEDGGSSSKD
FT                   PSSSSKPDDDKTEDDDLHGLAITLPDWPEAAADCPAGTYTFSKEGVSKPDSKWSLASDG
FT                   TVTALDDDGVSNDLIVEIDCDELSGVIALERDDDEATAKDFVDTAEPGTAIDVVSVDGN
FT                   KVTVDTGPSTEGQTQETFVYDGDGFNEAPDEEPSDEPSSSSGTPSEEPSTSSPGSESTS
FT                   GLLDPGDRVANGSAEPSVARRTPNDPPYDDVRSRG"
FT   gene            584102..585955
FT                   /locus_tag="Snas_0552"
FT   CDS_pept        584102..585955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0552"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: afw:Anae109_1891 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40266"
FT                   /db_xref="GOA:D3Q5W7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W7"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADD40266.1"
FT                   /translation="MNTVRQLDRVVIRFAGDSGDGMQLTGDRFTAETAKLGNDLSTLPN
FT                   FPAEIRAPAGTLPGVSSFQIHFADTDILTPGDAPGVLVAMNPAALKANLPDLPRGATIV
FT                   VNSDEFTPRNLKKVGYAANPLEDGTVESYQVHAVPLTSLTIEALAEFDIGKNEAARAKN
FT                   MFALGLVSWLYSRPTETTESFIKRKFAARPEIAAANIAALRAGHAYGETTETFAVRYEV
FT                   PPAKLPSGTYRNITGNVALAYGLVAAGVRAQLPVFLGAYPITPASDILHELSKHKKLGV
FT                   TTFQAEDEIAAVGAALGASYGGALGITTSSGPGIALKSETISLAVAFELPLVVVDVQRA
FT                   GPSTGMPTKTEQADLLMALHGRHGEAPVAVIAAQSPSDCFHAAIEACRIALHHRTPVML
FT                   LSDGYLANGSEPWSLPEVADLPDLRVEFASALNHVDEDGTEAFWPYKRDPETLVRPWAV
FT                   PGTPGLQHRIGGLEKKDGTGDISYDPANHDFMVRTRAARIEAIKVPDLTVDDPDGDSRV
FT                   LVLGWGSTWGPIGAACRALRGRGVHIAQAHLRHLNPLPANVSDVLSSYDKVVIPEMNLG
FT                   QLSSLLRSRFDADIVGYNQVRGLPFTSHELESMLEEVVKNV"
FT   gene            585948..586973
FT                   /locus_tag="Snas_0553"
FT   CDS_pept        585948..586973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0553"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: eba:ebA3150 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40267"
FT                   /db_xref="GOA:D3Q5W8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W8"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADD40267.1"
FT                   /translation="MSEPVALTLKPKDFKSDQEVRWCPGCGDYAILAAMQSFLPSLGLE
FT                   REKIAFVSGIGCSSRFPYYLNTYGMHSIHGRAPAIATGLATTRPDLSVWVVTGDGDALS
FT                   IGGNHLIHALRRNVNFKILLFNNRIYGLTKGQYSPTSEVGKITKSTPAGSVDAPFNPLS
FT                   LALGAEASFVARTLDSDRKHLQQVLTTAAQHEGSAFVEIYQNCPIFNDDAFEVLKNPDS
FT                   RDETLIRLTHGEPITFGPEGKYAVVRNGWGIKVAETASVPPSDIVVHDETVTDPSYAFA
FT                   LSRLSGENLDHTPIGVLRNVKRDTYDASVRRQVEAAKPVDTTPEQELTKLLTGGDTWTI
FT                   L"
FT   gene            587167..588879
FT                   /locus_tag="Snas_0554"
FT   CDS_pept        587167..588879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0554"
FT                   /product="LamG domain protein jellyroll fold domain
FT                   protein"
FT                   /note="SMART: LamG domain protein jellyroll fold domain
FT                   protein; KEGG: cps:CPS_4562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40268"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W9"
FT                   /inference="protein motif:SMART:SM00560"
FT                   /protein_id="ADD40268.1"
FT                   /translation="MLRFRLRSHARKLLSSLVIVSVAGAGIGLASTPAAAAEPVITSTD
FT                   FPDGDVISPMVGEVGELTIDSPDDVVSYRVTFSEGGRVEDVEPESPGAPVTVSYMPRMS
FT                   GRHLVSVSALHADGTGSSSSYAFRVSARGPVSSYDLSEAPGSDTAADSAGSNPGKPGSG
FT                   VAFGVAGPKEPTAASFDGGANAYISTEASGLVPTDEGFAAAAWVKIDDLGRDQTIVSVD
FT                   GTEEAGFVLGYRSTSSDSGTWTLQVPGEDGDSAAHTVSGGVVSQTNHDQWVHVAGVYDD
FT                   HERTMELYLNGRSVGTENRDSSWKADNTIQIGRSLHSGEYGRHLDGSLAEVRLFDRVVF
FT                   AHETDHLNTIAPHRAAYWQLNANGAEYTGKSPLTLDGGASIYTRTSSSSPRPLMGAGHL
FT                   KLDGETGFAHTGDTLVDTRLSFSVTTRVRLTDVTPGRDMTVFALPGQNANLVEVKYSAE
FT                   ADAWRLVVAKDDSASAETITVDHGIAPYGSFGQAVSLTFDAFTGELVLWVNGEASQPLA
FT                   FTTPWATTGIQLGRSGPGSGHLDGAIDDVRVYQGACDADLVSTLANRSEQPNL"
FT   sig_peptide     587167..587277
FT                   /locus_tag="Snas_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 37"
FT   gene            589006..589476
FT                   /locus_tag="Snas_0555"
FT   CDS_pept        589006..589476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0555"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function DUF1801; KEGG:
FT                   AER150Wp; K01802 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40269"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X0"
FT                   /inference="protein motif:PFAM:PF08818"
FT                   /protein_id="ADD40269.1"
FT                   /translation="MATAKKSAKQNSADGKYVGFDDAEKAAMKERAAELKKETKRGAKK
FT                   SKDGEADVLAKIAEMPEEDRVIAEGIHALMKEVAPQLTSKTWYGMPAYAKDGKNVCFFQ
FT                   AASKFKVRYATFGFEVNANLDDGTMWPTSFAVTEWNDANRQRIAALVKQAVG"
FT   gene            589561..590034
FT                   /locus_tag="Snas_0556"
FT   CDS_pept        589561..590034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0556"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: pla:Plav_3503 3-demethylubiquinone-9 3-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40270"
FT                   /db_xref="GOA:D3Q5X1"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X1"
FT                   /inference="protein motif:PFAM:PF06983"
FT                   /protein_id="ADD40270.1"
FT                   /translation="MSKISTSLWFDTQAEEAVNFYTSLIPNSKIKTVTRYGDENPDRSG
FT                   QVMTIDFELDGQQYNALNGGPEFTFNEAASILVDCESQEEIDRLWAALSEGGEEGPCGW
FT                   LKDKYGLSWQINSTLLMDYIVNGEPEAKLRAVQAMYKMSKLDNAVLKAAYEGE"
FT   gene            complement(590100..591209)
FT                   /locus_tag="Snas_0557"
FT   CDS_pept        complement(590100..591209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0557"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V; KEGG: sil:SPO3354 phosphoserine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40271"
FT                   /db_xref="GOA:D3Q5X2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X2"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ADD40271.1"
FT                   /translation="MADIRIPTNLLPADGRFGSGPSKVPAAAITALAQAAPDFLGTSHR
FT                   QARVRDQVARLRRGLSDFFRLPDGYEVVLGNGGTTAFWEAAVFGLVRETAQVASFGEFG
FT                   AKFAKAIKTAPFVGDPTVITAEPGTAAYLSQQDGVDVYATPHNETSTGVAIDVKRVPGD
FT                   GLMLHDATSAAGGLNFDVTETDVYYLAPQKGLASDGGLWIALMSPAALTRVEQIAASGR
FT                   YIPEFLNLSTAVDNSRKEQTYNTPALATIFLAAEQVDTMNAAGGLDAAAARCADSADRL
FT                   YTWAEKSPVASPFVTDPNLRSNVVATIDFADSVDAKELAKVLRANGVLDTEPYRKLGRN
FT                   QLRIAMYPAIDPDDISALTACVDHVIDRL"
FT   gene            591368..592474
FT                   /locus_tag="Snas_0558"
FT   CDS_pept        591368..592474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0558"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40272"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X3"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADD40272.1"
FT                   /translation="MAAISVPPLGEKPLLVKSWWEALGNGERLGLLADRPERIGGMDGI
FT                   PVEVRDRANRADLTAILEAIEVWGKKAEQLPFGQLASEVGERMARILQKRASRQSLRIL
FT                   SDWIERPSPVDGLAYFLIDFDVSGDGKAVVALGNPDISDNVAVFVPGAFAAVDEALDDY
FT                   ARMDAMAGDAASRDGGKKTAVVRWLGYDAPDSIVPDAASPRFAENAAVSLDRFIAGLRV
FT                   TRDGPRTRITMVGHSYGSTVIGIADRERRLSVDGMVFVGAPGVGVVQADKLSVGAEKVW
FT                   ATVAPGDLIIKTPPGLLGIPPCKPGFGAKIFTCADTGRQPWFLSMFGIPRDAIKAHNGY
FT                   WNPGNVARDNIAAIVLGHRDKVKLKKSQ"
FT   gene            592561..593661
FT                   /locus_tag="Snas_0559"
FT   CDS_pept        592561..593661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0559"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: afw:Anae109_3487 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40273"
FT                   /db_xref="GOA:D3Q5X4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X4"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADD40273.1"
FT                   /translation="MSFQAEAVVDLGTIAANVEALAGRTSAAVMPALKANGYGHGLVPA
FT                   ARACLDGGASRLGVATLDEAMELRNSGVAAPILAWLVAPGLDLAAAVDADIELAVASRE
FT                   QLSAVADAGARHPARIHLKADTGMGRGGAPRAEWQTLVDLAAKAQADGRIEIVGAFSHL
FT                   ACADEPGNPLTQSQDDNFRDFLDLLWAADVQPQWQHLANSAGLLAHPDTHYNLVRPGIA
FT                   VYGYPPVATEAPLRPAMTLRARVVLVKTLPAGHGIGYGHTYVTKRPTRVAIVPLGYADG
FT                   IPRSTSNRAEVLVGGRRCPIRGRVSMDQVVVEVDEGDVRAGDVVEFFGDGDITAEDWAT
FT                   WHDTISYEILTSIGPRIPRRYVGKNT"
FT   gene            593658..594830
FT                   /locus_tag="Snas_0560"
FT   CDS_pept        593658..594830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0560"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mpt:Mpe_A3531
FT                   hydrolase or acyltransferase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40274"
FT                   /db_xref="GOA:D3Q5X5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADD40274.1"
FT                   /translation="MSPKEIVGNKKTSRAGIIGAVAGLAAAGIAAGVATERYLIKRARS
FT                   DPNDPYAEEPFANLHADDIRTITTADGIDVHVETVDSRGVGEAEATAVFVHGFCLDMGT
FT                   FHFQRRALTESTMPLRAVYYDQPGHGQSGELPLPEYDIESLAEALYAVLAKAVPTGPVF
FT                   LVGHSMGGMTILAFARRYPELFASRVRGVALLSTTAGGLDKVSFGAPKALARARKVFLP
FT                   ALSKAIALTPGVIDGARRVASDLAWRLTRRYGFATRKPSPSLVSYVEKMNTATPIKTVI
FT                   GFSKALLEHDEHDVLPQLASIPVFISCGDSDQFTPPEHSVALAEALPHAKLNIVPEAGH
FT                   VALLEKPELVTDPLFAHLSECLDALERDRQPAEPVKRRKPWLRKKKRTGD"
FT   sig_peptide     593658..593756
FT                   /locus_tag="Snas_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.455 at
FT                   residue 33"
FT   gene            594831..595367
FT                   /locus_tag="Snas_0561"
FT   CDS_pept        594831..595367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0561"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   geo:Geob_2940 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40275"
FT                   /db_xref="GOA:D3Q5X6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X6"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADD40275.1"
FT                   /translation="MLLETVEDTWAFGARLAALLRPGDLLILTGSLGAGKTALTQGIGE
FT                   GLKVEGTVASPTFVIARIHKGSTPLVHVDAYRLGGLDELDDLDLDATVEDSVTVVEWGA
FT                   GVAEQLSSDHLEIRIDRRPDDVRELTLHPTGGDWAERLRALALSPVSARLSLASVVRGY
FT                   RQKWGGGRRPRGLNC"
FT   gene            595369..596025
FT                   /locus_tag="Snas_0562"
FT   CDS_pept        595369..596025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0562"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   cak:Caul_0015 peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40276"
FT                   /db_xref="GOA:D3Q5X7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X7"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADD40276.1"
FT                   /translation="MLILVVDTSTPAVTAAIAEFDGTTMSMPEGSVVVNPRAHGEQLAP
FT                   LIQGELAARGAVPGDVGAVVAGLGPGPFTGLRAGLVTAAAMAHALDVPVYGVCSLDGIG
FT                   AMTSGRVFVATDARRKEVYWAVYEDGVRVEGPEVAAPETLVERAKAADGAYGDGVHRYA
FT                   DVLGVAPAGAPRYPHPGRLAWVARERIVAKEPSESLTPLYLRRPNVNIGGVQQRA"
FT   gene            596018..596467
FT                   /locus_tag="Snas_0563"
FT   CDS_pept        596018..596467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0563"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: glo:Glov_2306 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40277"
FT                   /db_xref="GOA:D3Q5X8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X8"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADD40277.1"
FT                   /translation="MPDWDIAPLRWWHIEQLLPIEDELFGAEAWNAAMFWSELAAGHYY
FT                   RVVLDDERVLGYAGLALSGDDGWVNNIAVRKAAQRRGVARALLNDLIGRAEGQGVRRLA
FT                   LEVAVDNAAAQRLYDAFGFEGVAIRKGYYQPSNTDAVVMMKELRQ"
FT   gene            596464..597516
FT                   /locus_tag="Snas_0564"
FT   CDS_pept        596464..597516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0564"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mxa:MXAN_2051 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40278"
FT                   /db_xref="GOA:D3Q5X9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X9"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADD40278.1"
FT                   /translation="MREPLILGIESSCDETGVGIVRGLELLANEVASSVEQHARFGGVI
FT                   PEVASRAHLEAMVPTMRRALDVAGVKLSDVDAIAVTAGPGLSGALLVGLAAAKAYALAA
FT                   GKPLYGVNHLDAHIAVDTLENGPLPKPSLGLLVSGGHTELLYVEDLAGKVRLLGQTLDD
FT                   AAGEAYDKVGRILGMPYPAGPHIDAAARLGDPTAIDFPRGLTGPRDLAKHRYDFSFSGL
FT                   KTAVARWIEARQREGAEIPVNDVAASFQEAVCDVLTAKAIDAAREHGIDTLLLGGGVAA
FT                   NSRLRELAQERCDAAGLTLRFPSRKLCTDNGAMVAALGSHLVAAGVTESRMDIPADSSL
FT                   AVETVSLANA"
FT   gene            complement(597586..597846)
FT                   /locus_tag="Snas_0565"
FT   CDS_pept        complement(597586..597846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0565"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: reu:Reut_B5221
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40279"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y0"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADD40279.1"
FT                   /translation="MYIVELSFDGSPERLELRPAHREKLAALHAKGTCPMAGPFPDQSG
FT                   AALIFDVDSEAEVDAILDDDPYYRAKGVTVVRKQPWNPLPL"
FT   gene            complement(597858..598439)
FT                   /locus_tag="Snas_0566"
FT   CDS_pept        complement(597858..598439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0566"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce5559
FT                   HTH-type transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40280"
FT                   /db_xref="GOA:D3Q5Y1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD40280.1"
FT                   /translation="MQRRSAERVNRMLDACAVLLDEIGYQKLTTTLIAQRAEVAIGSVY
FT                   QFFGDKRAVVRALDVRYLDEYMSRLENYITAEKPQHWSQFVDAAIDEYIDMHRTVPGFR
FT                   TLHFGDTVDIHLMDEERSNDDVLTERLLELIFGHFSFPDQQVVRLTLTVAVATGDALIK
FT                   LAFRHDPEGDDTILNEAKVLLRDYLSRHIA"
FT   gene            598615..599922
FT                   /locus_tag="Snas_0567"
FT   CDS_pept        598615..599922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0567"
FT                   /product="FAD-linked oxidoreductase"
FT                   /EC_number="1.1.3.8"
FT                   /note="KEGG: bur:Bcep18194_B3008 FAD-linked oxidoreductase;
FT                   TIGRFAM: FAD-linked oxidoreductase; PFAM:
FT                   D-arabinono-14-lactone oxidase; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40281"
FT                   /db_xref="GOA:D3Q5Y2"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y2"
FT                   /inference="protein motif:TFAM:TIGR01679"
FT                   /protein_id="ADD40281.1"
FT                   /translation="MRSIHFLVREGTRWTNWAGTAKTTPRRVLSPTGPDDIAKLVSEAA
FT                   GRGGRLKAAGSGHSFTGIAVADDILLRLDGYRPEPVVDRETSRVTVPAGITLRELNPLL
FT                   AHHGLALPNLGDIDAQTLAGATSTGTHGTGAKLNGIAAAIVGARLVDGTGTVRDFGPED
FT                   PELAAVALGLGALGVVTDLTIQCVPAFRLLAEEHPMPLDAAIAEFDTLAATNDHLDLYW
FT                   FPRADRVLVKRNNRAGAGRPLSGIKRWWEDEVMSNAVYGTACHIGKTFPATVPAITSMS
FT                   ARLMSSRTFMDESYRVFCTPRRVRFVEMEYALPRAAFAPAFAALRGAANKRRIIFPVEI
FT                   RVTAPDDLWLSTAHGRDSVYFAVHQFRGMPYRDYFAEVEAVMREHDGRPHWGKLHTRTA
FT                   ADLAGVYPRFADFQRLRDRLDPQRVFANSYLDRVLG"
FT   gene            complement(599943..600569)
FT                   /locus_tag="Snas_0568"
FT   CDS_pept        complement(599943..600569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_3990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40282"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40282.1"
FT                   /translation="MPSQQSRELVELFYRRLTDDLGDRSGLVDRIRELQARLVAETGEL
FT                   PDPPAHDNVLYTAAVLAAYRVLRQHEAAHPDGRGLIAWLTAAFTEPLAEQVREGTEAML
FT                   DGSPDPFAVMTELAKRVEGEQYGAQFAFEHSQDDERGFHTDVHRCGYHDFFVKHDAAEL
FT                   TPVLCAFDANWYEAIDPERHGFRFTRSTTIGLGGRICPFHFDRQD"
FT   gene            complement(600665..601090)
FT                   /locus_tag="Snas_0569"
FT   CDS_pept        complement(600665..601090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0569"
FT                   /product="phenazine biosynthesis protein"
FT                   /note="KEGG: scl:sce0708 phenazine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40283"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y4"
FT                   /inference="similar to AA sequence:KEGG:sce0708"
FT                   /protein_id="ADD40283.1"
FT                   /translation="MTHPSPRQVWEACVNAAITGDIAAQTAFYAEDAVLEFPFLFADGL
FT                   PNRFEGRAAIGEFFAAMQSGVGATGVRVDRENSTLTLHDTTDPEVLIAEIELAVEPAGT
FT                   SRYVQVVRVRDGQIVSMRDYFAGAVTGIVTGILREAR"
FT   gene            601189..601755
FT                   /locus_tag="Snas_0570"
FT   CDS_pept        601189..601755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0570"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bra:BRADO6662
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40284"
FT                   /db_xref="GOA:D3Q5Y5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD40284.1"
FT                   /translation="MPKPLRADARRNRERILDVAEAVFDAKGTRASTEDVASGAGVGIG
FT                   TVFRHFPTKTDLLKAIIGRGVERMAAQIQVLVDEGDPATAFFEFFTRMVAEASSKKTVV
FT                   DLLGEAAEDLRADKPIGVWRSAIEALLAKAQDAGAVRADVQPPEVLALLLGTCQAAVSA
FT                   GWDERLRDRTLAIVFDGLRARGPQP"
FT   gene            complement(601752..603053)
FT                   /locus_tag="Snas_0571"
FT   CDS_pept        complement(601752..603053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0571"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   acp:A2cp1_4410 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40285"
FT                   /db_xref="GOA:D3Q5Y6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40285.1"
FT                   /translation="MRTVRAWFTETTGGLPRAFWHLWTVTLINRLGSFVLIYMTLYLSV
FT                   VRDFTPTTIGMLVGAQGAGAVVGTQLSGVLTDRWGRRKTLLLSNFSSVAVLTGLAFVQN
FT                   VWTIGALLAAMGATLNMARPAFSAMIADLVPPADRVRAYTLNYWAINLGFSGAALLAGV
FT                   AAGLSFQLIFFINAGAVAASGLLILFKLPETRPAPSPVPDNPAGVKPRGSIRVIAADRV
FT                   FLAFVGLTFLPALLLMLLESLLPLQVTGAGLSQQEYGWIIATNGVVIVAGQLFIPKLVD
FT                   GKRRSRVLAVSCLFWAAGVGATGLVASVPMFMLTVLIWTFGEMLQTPANSATIADLSPV
FT                   DMRGRYQSVFALSFQASTMIAPTLGGLGLEYLGAGLWGVGAVIGVVAAVGNLIAEPARE
FT                   RRLARLLAEAETPEVRPVRTDLPDDTGELKAVRA"
FT   gene            complement(603175..604407)
FT                   /locus_tag="Snas_0572"
FT   CDS_pept        complement(603175..604407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0572"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_4255 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40286"
FT                   /db_xref="GOA:D3Q5Y7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40286.1"
FT                   /translation="MSPRPARLPRAFWIIWSALLISKAGGFVVIIMTLYLTAQRGLTES
FT                   RAGLIVGLFGIGGAAGVLVGGVCADRIGRKPTMVASAGVSAVALATLGQLTDPVWIAVF
FT                   VAVFGFANAAFGPAGIAAMADVLRPEDRDRAFNLMFWAINLGMGAASLLAGFLAQFSYS
FT                   LLFWLDAGTALLAGVLILLAVPETLRHKRSGAEPVHRGRFVDVWRDGVYMTFVSLVFLQ
FT                   SFVWAQAQTTLPLAMTRDGLSESDYGVVLAIGSAMIIGGQLIVPKLTTRFSKATALAMA
FT                   LAFFAAGFGAVGLVAGFTGYVVCAVIWTIGNMMAAPPNATVIADLSPDGMRGRYQGVFS
FT                   LTHSAAAFAAPAIGGFTFQFLGDGHWAVIFAVGVLAAAGHLLAGPARERATKRRAREAS
FT                   VLIDQSEKVTA"
FT   gene            604573..605325
FT                   /locus_tag="Snas_0573"
FT   CDS_pept        604573..605325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0573"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.4"
FT                   /note="KEGG: hypothetical protein ; K01834 phosphoglycerate
FT                   mutase; TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40287"
FT                   /db_xref="GOA:D3Q5Y8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y8"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ADD40287.1"
FT                   /translation="MTATLVLLRHGESEWNAKNLFTGWVDVDLTAKGEDEARRGGALLV
FT                   ENDLLPDVVHTSRQRRAIRTAEISLHACDRHWIDVKRSWRLNERHYGALQGKNKAETLA
FT                   QYGEEQFMTWRRSYDVPPPPIDRDDEYSQADDPRYAELPPELAPLTECLKDVLDRSLPY
FT                   WYDSIVPDLKAGKTVLVAAHGNSLRALVKHLDGISDAEISKLNIPTGMPLRYDLDLDTM
FT                   RPLKTGGVYLDPEAAEKAAAAVAAQGKK"
FT   gene            complement(605329..606282)
FT                   /locus_tag="Snas_0574"
FT   CDS_pept        complement(605329..606282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0574"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: ank:AnaeK_3981 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40288"
FT                   /db_xref="GOA:D3Q5Y9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Y9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD40288.1"
FT                   /translation="MGVDEYEEGNRGTVSTIDLPEPGLDVIMGERRQLTNLAYRLLGSL
FT                   AEAEDVVQEAYARWFAMSRQRREAVVSPGAWLTTVAGRICLDVLGSARARRERYVGEWL
FT                   PEPLPDRREWTSGGTPVDPADRVTLDESVNMAFMVVLESMTPAERVAFVLHDVFGYRFA
FT                   EVAEIVGRSPAACRKLASSARHRLDAPRPVPAVAPAKHRGIVKQVKQAWEANDIGALIG
FT                   LLDAEATMVADGGGKVRAALRPIEGAERIATFFTKFGGKSAGVTLLERTVNGQPGLVVS
FT                   QDGVIVSVCAFEVADDRVTRIWAVRNPDKLRAWTTG"
FT   gene            606394..606807
FT                   /locus_tag="Snas_0575"
FT   CDS_pept        606394..606807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40289"
FT                   /db_xref="GOA:D3Q5Z0"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40289.1"
FT                   /translation="MFTTGTTTKPGSLKLLRLAITLQTLSVFATPVTAGLLLTTPSGHV
FT                   LHSGSSYTLFFVTLFHLIAAILAWRPGGGSATPVAAAAGFFALTLAQVFIGIAHLTTVH
FT                   VPLGVLLFGLSVLQLAWVWNLRRADRIREGKPA"
FT   sig_peptide     606394..606498
FT                   /locus_tag="Snas_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.731 at
FT                   residue 35"
FT   gene            606804..607310
FT                   /locus_tag="Snas_0576"
FT   CDS_pept        606804..607310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0576"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   scl:sce6833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40290"
FT                   /db_xref="GOA:D3Q5Z1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z1"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ADD40290.1"
FT                   /translation="MTTTATTETGEITSRLPDLTKEFPELAALSGALHKAIRDSPVPQT
FT                   TIRLALLRAAQIVGSTYHTIRMTAEMRKADETEERITAVATWQGAPYFTDAERVALELA
FT                   EAVLTPNPFGERVSDELFARASVHYDDRAMWALTIALGQLCLFIPVAVIAKPIPGRPFG
FT                   KNYSR"
FT   gene            complement(607307..607882)
FT                   /locus_tag="Snas_0577"
FT   CDS_pept        complement(607307..607882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0577"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470; KEGG:
FT                   bpe:BP3097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40291"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z2"
FT                   /inference="protein motif:PFAM:PF07336"
FT                   /protein_id="ADD40291.1"
FT                   /translation="MEIAHNVIRLAPLITELVNLVTPRWRGGSELPRLPEGRLADAFTA
FT                   LLDSRSAADIRAVSDVETRLTALAWALRDAITAPSPSVMAARVNDMIERYRARPYLVDD
FT                   MDQPFHIHFDGDGETPVESMGGEFASAVALIVDGYGVERFGSCEAHQCEAVYIDLTRNG
FT                   SRRYCSSGCTARAKTAAYRKRRAGETGR"
FT   gene            607948..609225
FT                   /locus_tag="Snas_0578"
FT   CDS_pept        607948..609225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0578"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_3030 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40292"
FT                   /db_xref="GOA:D3Q5Z3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40292.1"
FT                   /translation="MFGSYRRLFARPGVMGMTGLSLSVKLGPPTLSLALLLVVFDDTGS
FT                   YAVAGLTLTGHALALALCAPLGGRLVDRFSPRKVLPPYLLVHAAAYTLVLLSIHLPVPA
FT                   PLVVAAAAVLGATSPPAGAVIRGAWPRLVAPGSLNTAYALDNAINELMFIAGPVLVAGL
FT                   LLVMPASAIIIVTGTVFLAAVAAVTMSRVVRTAAPGAPTGDGPSRGRLTRLVGPLAHRP
FT                   TLILLFIAALGTFTFGSLRVAMVASATVLGSAGAAGIFAGLLSAGTLAAGLGYGGRHWS
FT                   ITGRRLLGILFAADCVLLFAGVFDVGYLWLAVVITAIGAVSGPRDTLIPVILTEHAPAT
FT                   ARTEVFAWLNTFMWIGYGLGTAVAGQLTGPKDSGAAAFVTAGIVAAGGILVSALLPRAT
FT                   TAPDPAERSGESGEVLVEHAESRGRR"
FT   gene            609322..610527
FT                   /locus_tag="Snas_0579"
FT   CDS_pept        609322..610527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0579"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; KEGG: geo:Geob_3554 PAS/PAC sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40293"
FT                   /db_xref="GOA:D3Q5Z4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADD40293.1"
FT                   /translation="MTFSNVPRAGRAAATFAVGLAAGAAAGYALNGRRRTLEPASDEEF
FT                   SRTQVGAWHKVFEALRTGVCVVDADNQVTYANTGARALGVDAETELEPASLRSLAEHVR
FT                   ATGAPRQVELELNQGGDPTAVRVDVAPLPDGHVAVELTDISELHRVERVRRDFVANVGH
FT                   ELKTPVGALQLLAEALADAVDDPAAAARFTTRIQHESARMSRLVSELLELSRLQGAEPM
FT                   PAPVTVWIDRVVNEAVDRGRTAASAKDITINRTGRRRLAVSGSENQLATALGNLVGNAI
FT                   AYSPEGTSVTVDTTVKDDSVLIAVTDEGIGIDPSEQHRIFERFYRSDPARSRATGGTGL
FT                   GLAIVKHIAGNHGGRVDVSSMPGNGATFTLTLPSVTADADEAELSPGEIDTLTTHIEEG
FT                   RQ"
FT   sig_peptide     609322..609405
FT                   /locus_tag="Snas_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.463 at
FT                   residue 28"
FT   gene            610524..611204
FT                   /locus_tag="Snas_0580"
FT   CDS_pept        610524..611204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0580"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: sat:SYN_00981 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40294"
FT                   /db_xref="GOA:D3Q5Z5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD40294.1"
FT                   /translation="MTRVLVVEDEESFSDALSYMLRKEGFEVAVAATGNEALKEYEKAG
FT                   ADIVLLDLMLPEKSGTEVCRELRTTSNVPIIMVTARDSEVDKVVGLEIGADDYITKPYS
FT                   PRELVARIRAVLRRNAEPTDPMVTVLESGPVRMDVDRHVVSVGGAEIPLPLKEFELLEM
FT                   FLRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIETEPGRPRHLVTVRGLGY
FT                   KFES"
FT   gene            611360..612232
FT                   /locus_tag="Snas_0581"
FT   CDS_pept        611360..612232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0581"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce9074 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40295"
FT                   /db_xref="GOA:D3Q5Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40295.1"
FT                   /translation="MLEIRNLRKRFGEKTALDDVSLTVEPGQVFGFVGANGAGKTTTMR
FT                   IAMGVLIADSGDVLWDGEPMGHAQRLRTGYMPEERGLYPKMKIGEQLAYFAELHGETPG
FT                   GSKKAAATWLERLGLSDRSGDFVQDLSLGNQQRVQLAVSLVHDPKLLILDEPFSGLDPI
FT                   AVDTMATVLSERSAAGVPVIFSSHQLDLVERLSDSVGIIAAGNIVASGSVDDLRRRGNR
FT                   KLRVSIDGAAPTWADALPGEVANVDEGEWVIDSGDDQKVLAAAMAAGRVTRFGFDEPSL
FT                   VDIFRETVS"
FT   gene            612229..613392
FT                   /locus_tag="Snas_0582"
FT   CDS_pept        612229..613392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0582"
FT                   /product="ABC-type Na+ efflux pump permease component-like
FT                   protein"
FT                   /note="KEGG: scl:sce9075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40296"
FT                   /db_xref="GOA:D3Q5Z7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z7"
FT                   /inference="protein motif:COG:COG1668"
FT                   /protein_id="ADD40296.1"
FT                   /translation="MKGLWLVARREILVRGKSKSYLIGLLASAVLVVVVSLLPTFLGGD
FT                   DTYKIAVTGTDAPVLAESVPEVGEAHGMKIEADEVDDAAAAKAAISDDKADIAIVDNKT
FT                   VIADGEPDQGLLTVVEAVHQRVIAERQLVDAGADPDKVSDAMKVDTLKTEQVNGEDNTA
FT                   RQVIGYFLTIILFFMVMMPTMYVAMGVVEEKSSRIVEILLSSLRTWQLLGGKILGLGVL
FT                   GFLNLAVPAGVGLIAATATGAIDYLPSGMGVTIVTALGWWVLGFAFYAAMAGSLGSLVS
FT                   RQEDINSAIGPMTMLMVASYVVTSIYVWDPTATVSKVLSFIPPFSMLMMPVRAAVNDAA
FT                   PWEQLLSAAVLAAAAVGMLSIGATIYKRSVMRIGSKVKLTEIFTKSA"
FT   sig_peptide     612229..612363
FT                   /locus_tag="Snas_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.524 at
FT                   residue 45"
FT   gene            complement(613774..615564)
FT                   /locus_tag="Snas_0583"
FT   CDS_pept        complement(613774..615564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0583"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proteophosphoglycan ppg1"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40297"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40297.1"
FT                   /translation="MPGASASAPLTGEAAPDASSQYAPPPMPPAPEAPVAQARVEYPPA
FT                   APESQAPESWPRVAEPVASGSASVPPAPEAVAPAAEAPVAQPEPAPAPPPAPEAADDQP
FT                   PPPPAEGAALWAGMATPAGPGGDAELSAEDAKAMADLADVDMGDFEDDDDDDDAPAPQQ
FT                   TDKAEADRDRDGAEAADENRAAPAATGEAAESGESGETEAVRGSADAPAGDDDASSVPA
FT                   RASVSVPNLVVQDDDNVPVGRRFDGQTYRAGEVQSAPESNVTEAPDIGDWEARAEAPQE
FT                   AGPDEQRDSQPVADLHSGSTWNAFAAGESNAADQPSGSERDDHAAEAATGDSSGSDERS
FT                   SGESSFQAGQTWNAFAEGDRDADAGHSSDAAAESQSGSAADDGEPARQSESTWNAFDGE
FT                   RAEERQAEPADDGRPSESAHGDSEPAAAGEQSSGGSWSAFGDDESSGRDGADEGQPSAV
FT                   AGEVESHEAQPADDQRPSEAADRPDDNGQQASSSGDGQQAGSAWDAFGEPWLEGGSEQS
FT                   SQPESGQQAAAEPVSPAAASAEPSAAEPVGAAKGVASVPSAQLLSAGDLPAQLPTPVAQ
FT                   VYGGAPEPENESAWPPPADS"
FT   gene            615908..616018
FT                   /locus_tag="Snas_0584"
FT   CDS_pept        615908..616018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40298"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40298.1"
FT                   /translation="MIPVPGSSDGTANGTAADGATGGADSGGDGTSAGGS"
FT   gene            616059..617315
FT                   /locus_tag="Snas_0585"
FT   CDS_pept        616059..617315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40299"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q600"
FT                   /inference="similar to AA sequence:KEGG:LmjF35.0290"
FT                   /protein_id="ADD40299.1"
FT                   /translation="MAAGETRAAYPRRSTARRAVAEAAAPTAPAAAAHPAADHRAGSTA
FT                   ERRAVAVAAVAPTAGYPEPAAVEAGAAGPTGPDRPRTAHRKPVLPEVAVAAPTEPVHPK
FT                   KARPKPVPREEAAAPTGMAPRKRALPGAAADPTEPVHPKKAPQRPAPQAEAAAPTAVHR
FT                   RAARTSAVRAEAADRQPVPTVARPLADRKPVARTSAVTAAGEDPRPDPTAAADPRRARR
FT                   KPAGHPTAARSRADPRPDRAGPTAVHPEAEAGRRRAAPTAGSAAAAATASHHPRAVAVA
FT                   AEPHRASTRYWCAAPHREAACSSTAATVATAAAATARAGREPAAQAASRRAAAAGPTAA
FT                   DTGHRPAGARTAAARLRAEPGAHHTAGTVACQVRRACHRPRNCCCPFAWLPAQVFRFTG
FT                   ARRPRDGRSTHRRMNSAAL"
FT   gene            complement(617405..618703)
FT                   /locus_tag="Snas_0586"
FT   CDS_pept        complement(617405..618703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0586"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: yen:YE2156 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40300"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q601"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADD40300.1"
FT                   /translation="MKTTPSRVVMCLGTAVLLGISTPVPALADPVTVVPDDGSRPEGGA
FT                   PAGDQEPGEVPISGPGISRGPYADKIAEQTRSLADLGERTTDAEEQLKLRKDETSLSRL
FT                   NWRDLDGEAKATEELAADMAAAAYQEKAAEIPGLTDKFEDLFEVNPELLNLNQNAIMEE
FT                   AEDARSDAGVAKATLDAAEATEAIAEGEHKDLSKKLDKKTKSLEKLIERNREAITLEEQ
FT                   QAEANNERETGQISIDIDGAEAAEEAKQAVKFALKQTGKSYVWGDEGPNTYDCSGLTQT
FT                   SYGQPGVRLPRIAKQQFRDTSQARVPMEKLLPGDLIFYGDVPEDWTSVYHVGMYIGDGQ
FT                   MVHAPRPGDVVRVAPVWFDEFVGAHRVVQAVDTKPAESKEKKDKKEKKRADSPSETPAT
FT                   KPESPPVPGSDEETTSGPGGGDAPTPTPTPWRG"
FT   sig_peptide     complement(618617..618703)
FT                   /locus_tag="Snas_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            618878..620050
FT                   /locus_tag="Snas_0587"
FT   CDS_pept        618878..620050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0587"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   glo:Glov_0625 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40301"
FT                   /db_xref="GOA:D3Q602"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q602"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADD40301.1"
FT                   /translation="MTAEAFKADIEEKVANGQRLSYEDGVALYECDDLNWLGRMAHQVR
FT                   TDKNGERVMFNINRHLNLTNVCSASCAYCSFQRKPGEKDAYTMRVEEAVQLAKQMEGEK
FT                   LTELHIVNGLHPTLPWRYYPRVLKELKAALPGVSLKAFTATEVQWFEKISGLSASDILD
FT                   ELIEAGLASLTGGGAEIFDWEVRQHIVDHDCHWEDWSRIHKLAHEKGLRTPATMLYGHI
FT                   EERRHRVDHVMRLREMQDETGGFVVFIPLRYQHDFVDAKDGKIRNRIQAQTTMASAAES
FT                   LRTFAVSRLMLDNFDHVKCFWVMHGLDVAQLSLNYGADDLDGSVVEYKITHDADSYGTP
FT                   NTMHREDLLDLIRDAGFTPVERNTRYEVVHTYDPPQSLAERRAEPQDVWA"
FT   gene            620054..620491
FT                   /locus_tag="Snas_0588"
FT   CDS_pept        620054..620491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40302"
FT                   /db_xref="GOA:D3Q603"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q603"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40302.1"
FT                   /translation="MSAKQAKQPSFPQRDDNGRIVLLTQLLGFIAMSVALGVVMLAVID
FT                   GLLALLGFTEFGKDISGWICGVLAVFVFVDEFRAYKGQSVRYWLAPVAGLLALAFGIVI
FT                   SAVLPTGWLPLFTGAIGVAAAMLAYGALWFVGTRLTGADIS"
FT   gene            620488..620736
FT                   /locus_tag="Snas_0589"
FT   CDS_pept        620488..620736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40303"
FT                   /db_xref="GOA:D3Q604"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q604"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40303.1"
FT                   /translation="MSPLWKFTLGRVGLCVLIGALLWPTGLHILVIAMAALLGSFLLSF
FT                   VVLKKWRTEMLADVDEAVKRRRAQKEELRSALAGEDE"
FT   sig_peptide     620488..620595
FT                   /locus_tag="Snas_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.802 at
FT                   residue 36"
FT   gene            complement(620785..621558)
FT                   /locus_tag="Snas_0590"
FT   CDS_pept        complement(620785..621558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0590"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dat:HRM2_23010 GlnQ5"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40304"
FT                   /db_xref="GOA:D3Q605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q605"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40304.1"
FT                   /translation="MSEQSTVDPQVQIRGLHKSFGKLKVLKGIDISIRSGEVVCVIGPS
FT                   GSGKSTLLRCVNLLEQPTAGEIVVDGYLLTDRDADLNLARRHIGMVFQQFNLFPHLNVL
FT                   DNVAVAQRKVLKTPKATARKVAMEQLEKVGVAEKAKEFPARLSGGQQQRVAIARALSME
FT                   PDLMLFDEPTSALDPELVGDVLTVMRELAADGMTMMVVTHEMGFARDVADRVVFMDGGV
FT                   IVEEGQPADVLENPSAERTREFLKRVLDPTHADEA"
FT   gene            complement(621555..622412)
FT                   /locus_tag="Snas_0591"
FT   CDS_pept        complement(621555..622412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0591"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ara:Arad_9253
FT                   glutamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40305"
FT                   /db_xref="GOA:D3Q606"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q606"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADD40305.1"
FT                   /translation="MNPKSEPKSVAVEAATDFRKHPGLSPRKKYQISMTVQYVVIAAVI
FT                   LFVIFGADWADLSEKFFNAELIERSFPELFTVALANTVIYTASGYVVGFALGILIAVMR
FT                   LSSAAVNRWIATGFIEIFRGLPALLILTFLAFFWPVAFPNLIIPGGNYGTVALGLGLCS
FT                   AAYMAETFRAGIQAVPKGQMEAARSLGMSHTRAMVTIILPQAVRIVIPPLTNELILLTK
FT                   DSSLVLTVGIAAKESDLVKFGNDLANETGNSTPLVVAGLAFLVITIPLSILVRRLEARQ
FT                   AKAR"
FT   gene            complement(622409..623227)
FT                   /locus_tag="Snas_0592"
FT   CDS_pept        complement(622409..623227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0592"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: eta:ETA_22070
FT                   glutamine high-affinity transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40306"
FT                   /db_xref="GOA:D3Q607"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q607"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADD40306.1"
FT                   /translation="MIRPNYARLLAVGLVVAVGMTVAACGGGAEKTKTPGGYTVELIDA
FT                   KKLTVCTNIPYVPFQFEKNGKTVGFDVDMVDLAADELGVKQDVIDVKWDNIENGSALSG
FT                   GKCDLAAAAMTITPEREKNLTFSEPYFDEVIAFVAPKGKAPKSVEDVGDRKLGVQASTT
FT                   SLEYAKKHKLEPQEFEDSAKQRAGLESGKVEVVLQDYPVITEWMKDEKFAAKYEVGQII
FT                   ETGSQYGFGFKKSADKTLVKVVNDQIKKAKDSKKYDELYKKWFGTEPKAS"
FT   sig_peptide     complement(623153..623227)
FT                   /locus_tag="Snas_0592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.544 at
FT                   residue 25"
FT   gene            complement(623392..623847)
FT                   /locus_tag="Snas_0593"
FT   CDS_pept        complement(623392..623847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A2727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40307"
FT                   /db_xref="GOA:D3Q608"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q608"
FT                   /inference="similar to AA sequence:KEGG:H16_A2727"
FT                   /protein_id="ADD40307.1"
FT                   /translation="MSSLKTRLETDMKTALKSRDELVLNTLRMALTAVRTEEVSGKQAR
FT                   ELDDAEVMKVIAKQAKQREEAAEAFEAAGRTESAARERAEEEVLGRYLPKALSEDELTA
FT                   IVEEVFAAEGFSEPKQMGQAMKAVQAKVAGRADGKAVAALVKARLAS"
FT   gene            623873..624763
FT                   /locus_tag="Snas_0594"
FT   CDS_pept        623873..624763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0594"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mno:Mnod_8081
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40308"
FT                   /db_xref="GOA:D3Q609"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q609"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADD40308.1"
FT                   /translation="MKKRSLIATAGVLAAGGAAALAYASLIERFRFQLRRFDVPVLAPD
FT                   TEPLRILHISDLHLSPNSHKEVEWVASLAALDPDLVVLTGDNLAHPEAVSTVSAALEPL
FT                   FTYPGVFVFGSNDYYAPVLKNPFTYFNPNREHKYGEELPTEELRKMLTGAGWRDLNNAT
FT                   TTIPIADRTIAVAGVDDPHFDLDDYDLIAGEAPTDASVTLGLTHSPEPRVLDQMAADGY
FT                   QLLLAGHTHGGQVCVPGYGALVTNCGIDRKRVKGLHRYGSSWLHVSAGLGTSPYAPIRF
FT                   ACHPEASILTLIPRT"
FT   sig_peptide     623873..623941
FT                   /locus_tag="Snas_0594"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.574 at
FT                   residue 23"
FT   gene            624815..624891
FT                   /locus_tag="Snas_R0011"
FT                   /note="tRNA-Pro1"
FT   tRNA            624815..624891
FT                   /locus_tag="Snas_R0011"
FT                   /product="tRNA-Pro"
FT   gene            complement(625124..626119)
FT                   /locus_tag="Snas_0595"
FT   CDS_pept        complement(625124..626119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40309"
FT                   /db_xref="GOA:D3Q610"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q610"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40309.1"
FT                   /translation="MPTEEGSINSNTDRQTSRIKPRWMALSVIGILCLGVCIWWFADSK
FT                   PESTSSSIEDSFILENASFYLFDQGVPQEKVQLNQGKYSPPGNADNGAHVRVDSKVQFA
FT                   DLDGDQDIDASAILEWVDNSGDKYSSWRALYFWLWDDNKVVPVKWPGAWQWNCVTKDQP
FT                   KGGALSITSPASPFGVVIERNTNNLCGDDILDKKARTDASYFIGVKKGYPVVTAGQDLA
FT                   LATESCTGGDSDDPASSLKYTNITDTLKSDPRVQPFKNAPVVDGPRPPKKSPSKPTAQA
FT                   PKIEYMIDKEFEPSDRYLRVHDGFVPVVIVWGYDYQGCGWASWDNVKKLL"
FT   gene            complement(626163..627032)
FT                   /locus_tag="Snas_0596"
FT   CDS_pept        complement(626163..627032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40310"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q611"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40310.1"
FT                   /translation="MTTPSEIRQIAQQIYELAQEKRMIEWVRDHPDSTDTKEDLGLAEK
FT                   YAYIEGEFERFTEPNLTPFDDISKQLEDAYDKIAGKDASYLSSDSSLKIAEWRGTAKTS
FT                   FDDNYITPWETYREFHKELIRALKSAADSHRDLYSRMRGRAYSIGEATVEGLKGIDGWP
FT                   PFLSEKEGKDILFKVAGLLSIAASASPMGAVAKAVAVIQIADASRTVTEAAGSIEAKFV
FT                   NEILDQMKKKLDELEDDSQAEEKTISKGLKKNIDAIEKKLDDIVPPSPELADVNPDDPG
FT                   GKLKPPAS"
FT   gene            complement(627038..627571)
FT                   /locus_tag="Snas_0597"
FT   CDS_pept        complement(627038..627571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0597"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to S. cerevisiae YLR106C"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40311"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q612"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40311.1"
FT                   /translation="MGDEDYTGFATDCYNLWKAGHVYIPIVADTYAEASRSLGSIYAWH
FT                   DGEAMGTNEEDVVFRNKMARGQSEAKQEFKDLRDLIQTILARTSQNLYDVGEVLEDAAK
FT                   GFADRDKDNANEIGSARDQLDQQIDDYEKKVKEDEKDADRDDEPIAPEGEAETKPDNSR
FT                   DDSDVVKDILPEEE"
FT   gene            628821..631415
FT                   /locus_tag="Snas_0598"
FT   CDS_pept        628821..631415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0598"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Lanthionine synthetase C family protein;
FT                   SMART: serine/threonine protein kinase; KEGG: smt:Smal_2130
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40312"
FT                   /db_xref="GOA:D3Q613"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q613"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="ADD40312.1"
FT                   /translation="MTARGAKASVPAIKATVSDLVLADGRYRIRRDANWLYADLVGHGL
FT                   ADHGWKFHVSSRPVDFRELMAVLVPFLLERGCVFKVARSLRVLGELNDGASAPASVGKA
FT                   VTIYPEQDRVARLGGELVELLRGWVGPRILSDRRVAVDAPVYYRYGPFRTTLVANRLGN
FT                   LTSVMAGPDGESFDGWATTAYQQPSWVVDPFRLGGEVGDVVGGRAVRLGTHYEPLAGLA
FT                   ESARGNVYTATDVRTGEVVVVKQARAYVAESLDGFDARTQLRNERFVLGALHDVAGVAR
FT                   FRDHFRHGEDEYLVTSFDGRFSLSEYVTRKGRYVPVERSEGGAGASELEESRSLDGLAH
FT                   RLAKTLRDIHARGFLLRDLSPKNLIVNATGDGVTFIDFGHCNHHDVVIRGGTKGYAPAR
FT                   QFDDEPAEPRDDLHALGMTLFAATIGAEPVVDEDDADASRVMALRVLGRMYGDRPPAVI
FT                   AAVADLLSADPETMTTAFTALVEGRLAGATRRPRFPAAVVHRRGPGTAALVERVLAQLV
FT                   SRANRIVDDGREPDPGVYRGAAGIGLCLLPHLERPGVADTVARLAKFSSLAADQVSLRP
FT                   GLYLGSTGVEVFLRRAIAAGVAATPLSPERLFGVADDGFEGVDVINGAAGIGLGHLLLN
FT                   EWDPRPEHEDVVRRCLEALGEPGAVFDPAEEAEVPGRDTTLGVSHGEGGVVEFLRHHHR
FT                   LAPSEESRRRLNTRVAVFAEQVRRFVEASAKPSAVPLCTSWCRGMAGMGRVVLAAGRQL
FT                   GDSSLVDLAVECADGCLRWLPQLATAGQCCGVAGIGELFCDLVSHDDRFLAAAESAATQ
FT                   LLILNADAPPAPPGRNQVQPGSTSWASGAAGVLDFLTRLRDLTPRGTAIAAF"
FT   gene            631438..632904
FT                   /locus_tag="Snas_0599"
FT   CDS_pept        631438..632904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0599"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: scl:sce2246
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40313"
FT                   /db_xref="GOA:D3Q614"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q614"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADD40313.1"
FT                   /translation="MDAIEHDVVIAGGGPTGLMLAGELALAGVDVAVVERRVGQELPES
FT                   RAGGLHSRTIEVLDQRGIADRFLSRGKRSRAVGFATSQVDIGDLPTRHGYLLGLWQNHT
FT                   EHELAGWVGELDVPVYRGREVIGFAQDDSGVDIEVSDGGPMRARYLVGCDGGRSLVRKT
FT                   AGIDFPGWDPTFSCLVAEVEVERVPDWLSRQPVGPARRRAGSGKGTPVRIVVAESRVGR
FT                   TGEASLHDLSEALIAEYGTDYGVSNPSWISRFGDTSRQAASYRDRRVLLAGDAAHVHAP
FT                   VSGQGLNLGVQDAVNLGWKLAQVVAGASAESLLDTYHAERHPVAARVLRHTMAQHALLR
FT                   TDERTRSLRDIMSELLSLYEPRQRVAAMIAGLDIRYDCGEGHPLLGRRMPDLDLVTADG
FT                   PRRVFTLLHQARPVLLNLGEPNGFDVTPWAGRIRSVDAKAAATWELPLLGEVAAPAALV
FT                   IRPDGYVAWAGELTDASLPDALTSWFGEPE"
FT   gene            complement(632994..633827)
FT                   /locus_tag="Snas_0600"
FT   CDS_pept        complement(632994..633827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0600"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; SMART:
FT                   peptidase S1 and S6 chymotrypsin/Hap; KEGG: similar to
FT                   transmembrane protease, serine 4"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40314"
FT                   /db_xref="GOA:D3Q615"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q615"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADD40314.1"
FT                   /translation="MRRKFALTAAAVVVAVAALGVGGMAYADREYGSGNGDDASTKIIG
FT                   GQPASEEYKFHASMQYKEPGERPNPQRCGGSLIAPEWVLTAAHCVSKVEDGALLNPADY
FT                   HIRIGSNDNLAGEQIEIESFTTHPYWATDNESVADIALIKLKTAAKEKPVAMSGHPSGD
FT                   KPIRIIGWGRTDRDDPNSISQQAQELDTTLLNFDDCKFGEPGFDISPGDLCVDTPDGKA
FT                   GPCSGDSGSPAMHKVGDQWRIFGITSRGGGDKCLSTPEVYTNIDWWSDWIAETTG"
FT   sig_peptide     complement(633744..633827)
FT                   /locus_tag="Snas_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.860 at
FT                   residue 28"
FT   gene            634081..636867
FT                   /locus_tag="Snas_0601"
FT   CDS_pept        634081..636867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0601"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; SMART: Tetratricopeptide domain
FT                   protein; KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40315"
FT                   /db_xref="GOA:D3Q6R6"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6R6"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADD40315.1"
FT                   /translation="MLVRLLGSVEIASATGWARAGPAKRSCVLAALAVTPRVPVTLATL
FT                   TERVWGTGAPSSAHSTLYGHIAHLRTLLRDCPGEVTLRRSGIDGYVLDVEPELIDVHAL
FT                   RSLVHAARDQLLVGDGERAVERWRRAGELVRGEALAGVKGDWAAEVRSGLRREHAALLA
FT                   ERFTVELELNRHNEIIDELADQVARHPLSESLVECLMTALYRSGRPAEALSCFAEARFR
FT                   LAERLGADPGTRLRELNRRILKQDPELARPTPASAPVARGGHPFAQLPAAPRLFTGRAA
FT                   ELSELDNALDAPDGARLWTVSGPGGIGKSWLALHWSHRRRDAFADGQLYVNLHGFDPGT
FT                   APTPPETALRGLLETLGVAPAAIPTSLDAMSGLYRSLLVGKRVLILVDDARDSRQVIPL
FT                   LPGDDAAFTVVTGRPGLATLATSHGAAGLRLDTLSHNESREAFSRHLGHDRIAAEPEAT
FT                   AELVGSCAGLPLALGILAARAAAHPGLPLAALAESVRDDSARLDALDTGELSASLRAVL
FT                   EGSLAAVRPEAARLFALLGLAPGIDAERHAVASLAAASLGHSDALLRELDSANLVEQRV
FT                   PGRYRMHDLTRLYAAERAEVDLDESDRDAALRRVVDHYLYTAAAGRELMQRGLIPRDLG
FT                   QPAPGCVTRPLTDLEAAKRWFAAEHVNIVAAQRKAAELGWDASVWRLAWALTTFQILRR
FT                   RSDEGVPVWRRAVAAAENLDDLFGQVVAHHTLSQMLIYAGDYDDAATHAARALDRAEAS
FT                   GDVHQLVGAHDAMSKAYVRQGDYRLALRHSTRSLDLARRTGNQILEAQAHNSVGWHLAH
FT                   LGEYAAARGHCEQALDKARAIPDDYLAALILDSLGFVASRDDRPADASVHYRQALELVR
FT                   RFGATEQEPTTMVALAEAEEALGRRDEAERLRREAADLYEAQGYAEEAALLRKPASG"
FT   gene            complement(636883..637512)
FT                   /locus_tag="Snas_0602"
FT   CDS_pept        complement(636883..637512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0602"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rpt:Rpal_1006
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40316"
FT                   /db_xref="GOA:D3Q6R7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6R7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD40316.1"
FT                   /translation="MATNTGPGTLRPGGRTARVREAVLRAAGDALAEHGFTGLDLGDIA
FT                   RRADVGRTTVYRRWGTVTAVVADLLTDMAEQSLPRTETGSLLGDLRANARLVQRTLVDP
FT                   RQGALFKAVIAAATSDPDTRRSLARFYRARLDEWSPCVTQAIERGELPADTDPAEVIRA
FT                   VSAPLYYRLLATDEPLDASVADRAAEAAAAAARAGAYVRPAEAKPE"
FT   gene            637604..638641
FT                   /locus_tag="Snas_0603"
FT   CDS_pept        637604..638641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0603"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bam:Bamb_5127
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40317"
FT                   /db_xref="GOA:D3Q6R8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6R8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADD40317.1"
FT                   /translation="MEYRQLGNSGLKVPELSFGAGTFGGQGPLFGAWGNTDAEQARRML
FT                   DIALDAGLNMFDTADVYSDGASEEVLGAAIKGRRDQVILSTKAGLPMGDGPGQAGTSRA
FT                   RLITAVDDALRRLGTDYIDLFQLHAFDAATPVAEVVATLDDLVRAGKIRYTGVSNFSGW
FT                   QLMKSLATADAHGRTRYVANQVYYSLVGRDYEWELMPLGAAEGVGAVVWSPLGWGRLTG
FT                   KIRRGQPIPDGSRLHDTASFGPPVDEELLYDVVDVLDELAAETGRTVPQLAINWLLRRP
FT                   TVSSVIIGARNEQQLRQNLDAVGWSLTDEQVARLDKASARTAPYPYFPYRRQEGFARLN
FT                   PPLAG"
FT   gene            638803..639981
FT                   /locus_tag="Snas_0604"
FT   CDS_pept        638803..639981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0604"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: cja:CJA_1508 succinyl-CoA synthetase beta
FT                   chain; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40318"
FT                   /db_xref="GOA:D3Q6R9"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6R9"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ADD40318.1"
FT                   /translation="MDLYEYQGRALFARHGVPVLDGGVAETVEEAVELAGKLDGRVVVK
FT                   AQVKVGGRGKAGGVKLADNVDEAREHATNILGMDIKGHTVHKVMLTVTADIDTEFYFSF
FT                   LLDRANRTFLCIASTEGGVEIEQVAAETPDKVLKLPINALTGVDATVAGEIADKAGFPA
FT                   DLRPQLVDMFVKLWETFVSEDATLVEVNPLVRTPEGRALALDAKVTLDENAAFRHLDHA
FT                   ELEDKAAVDPLEQRAKEADLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHDNVKPA
FT                   NFLDIGGGASAAVMASGLEVVLSDPAVKSVFVNVFGGITACDEVANGIVGALTMLAERG
FT                   ETVDKPLVVRLDGNNAELGRSILDGANHPLVTRVDTMDGAADKAAELAAQGA"
FT   gene            639983..640870
FT                   /locus_tag="Snas_0605"
FT   CDS_pept        639983..640870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0605"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; CoA- binding
FT                   domain protein; KEGG: gbm:Gbem_1465 succinyl-CoA
FT                   synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40319"
FT                   /db_xref="GOA:D3Q6S0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q6S0"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ADD40319.1"
FT                   /translation="MTIFLNENSKIIVQGMTGAEGTKHTRRMLASGANVVGGVNPRKAG
FT                   SKVDFDGTELPVFATVAEAMTETGADTTVVFVPPKFAKDAVLEAVNAEIGLCVVITEGI
FT                   PVHDSVTFWAQSQAKGGKTRIIGPNCPGVISPGKSNAGIIPADITKPGKIGLVSKSGTL
FT