(data stored in SCRATCH3701 zone)

EMBL: CP001781

ID   CP001781; SV 1; circular; genomic DNA; STD; PRO; 2824404 BP.
XX
AC   CP001781;
XX
PR   Project:PRJNA39547;
XX
DT   28-OCT-2009 (Rel. 102, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Staphylococcus aureus subsp. aureus ED98, complete genome.
XX
KW   .
XX
OS   Staphylococcus aureus subsp. aureus ED98
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae;
OC   Staphylococcus.
XX
RN   [1]
RP   1-2824404
RX   DOI; 10.1073/pnas.0909285106.
RX   PUBMED; 19884497.
RA   Lowder B.V., Guinane C.M., Ben Zakour N.L., Weinert L.A., Conway-Morris A.,
RA   Cartwright R.A., Simpson A.J., Rambaut A., Nubel U., Fitzgerald J.R.;
RT   "Recent human-to-poultry host jump, adaptation, and pandemic spread of
RT   Staphylococcus aureus";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(46):19545-19550(2009).
XX
RN   [2]
RP   1-2824404
RA   Lowder B.V., Guinane C.M., Ben Zakour N.L., Fitzgerald J.Ross.;
RT   ;
RL   Submitted (30-SEP-2009) to the INSDC.
RL   The Roslin Institute and Centre for Infectious Diseases, Royal (Dick)
RL   School of Veterinary Studies, University of Edinburgh, The Chancellor's
RL   Building, New Royal Infirmary, 49 Little France Crescent, Edinburgh EH16
RL   4SB, Scotland, UK
XX
DR   MD5; fbd00949829c6a76d2e99c389c75a1c6.
DR   BioSample; SAMN02604165.
DR   EnsemblGenomes-Gn; EBG00001206180.
DR   EnsemblGenomes-Gn; EBG00001206181.
DR   EnsemblGenomes-Gn; EBG00001206182.
DR   EnsemblGenomes-Gn; EBG00001206183.
DR   EnsemblGenomes-Gn; EBG00001206184.
DR   EnsemblGenomes-Gn; EBG00001206185.
DR   EnsemblGenomes-Gn; EBG00001206186.
DR   EnsemblGenomes-Gn; EBG00001206187.
DR   EnsemblGenomes-Gn; EBG00001206188.
DR   EnsemblGenomes-Gn; EBG00001206189.
DR   EnsemblGenomes-Gn; EBG00001206190.
DR   EnsemblGenomes-Gn; EBG00001206191.
DR   EnsemblGenomes-Gn; EBG00001206192.
DR   EnsemblGenomes-Gn; EBG00001206193.
DR   EnsemblGenomes-Gn; EBG00001206194.
DR   EnsemblGenomes-Gn; EBG00001206195.
DR   EnsemblGenomes-Gn; EBG00001206196.
DR   EnsemblGenomes-Gn; EBG00001206197.
DR   EnsemblGenomes-Gn; EBG00001206198.
DR   EnsemblGenomes-Gn; EBG00001206199.
DR   EnsemblGenomes-Gn; EBG00001206200.
DR   EnsemblGenomes-Gn; EBG00001206201.
DR   EnsemblGenomes-Gn; EBG00001206202.
DR   EnsemblGenomes-Gn; EBG00001206203.
DR   EnsemblGenomes-Gn; EBG00001206204.
DR   EnsemblGenomes-Gn; EBG00001206205.
DR   EnsemblGenomes-Gn; EBG00001206206.
DR   EnsemblGenomes-Gn; EBG00001206207.
DR   EnsemblGenomes-Gn; EBG00001206208.
DR   EnsemblGenomes-Gn; EBG00001206209.
DR   EnsemblGenomes-Gn; EBG00001206210.
DR   EnsemblGenomes-Gn; EBG00001206211.
DR   EnsemblGenomes-Gn; EBG00001206212.
DR   EnsemblGenomes-Gn; EBG00001206213.
DR   EnsemblGenomes-Gn; EBG00001206214.
DR   EnsemblGenomes-Gn; EBG00001206215.
DR   EnsemblGenomes-Gn; EBG00001206216.
DR   EnsemblGenomes-Gn; EBG00001206217.
DR   EnsemblGenomes-Gn; EBG00001206218.
DR   EnsemblGenomes-Gn; EBG00001206219.
DR   EnsemblGenomes-Gn; EBG00001206220.
DR   EnsemblGenomes-Gn; EBG00001206221.
DR   EnsemblGenomes-Gn; EBG00001206222.
DR   EnsemblGenomes-Gn; EBG00001206223.
DR   EnsemblGenomes-Gn; EBG00001206224.
DR   EnsemblGenomes-Gn; EBG00001206225.
DR   EnsemblGenomes-Gn; EBG00001206226.
DR   EnsemblGenomes-Gn; EBG00001206227.
DR   EnsemblGenomes-Gn; EBG00001206228.
DR   EnsemblGenomes-Gn; EBG00001206229.
DR   EnsemblGenomes-Gn; EBG00001206230.
DR   EnsemblGenomes-Gn; EBG00001206231.
DR   EnsemblGenomes-Gn; EBG00001206232.
DR   EnsemblGenomes-Gn; EBG00001206233.
DR   EnsemblGenomes-Gn; EBG00001206234.
DR   EnsemblGenomes-Gn; EBG00001206235.
DR   EnsemblGenomes-Gn; EBG00001206236.
DR   EnsemblGenomes-Gn; EBG00001206237.
DR   EnsemblGenomes-Gn; EBG00001206238.
DR   EnsemblGenomes-Gn; EBG00001206239.
DR   EnsemblGenomes-Gn; EBG00001206240.
DR   EnsemblGenomes-Gn; EBG00001206241.
DR   EnsemblGenomes-Gn; EBG00001206242.
DR   EnsemblGenomes-Gn; EBG00001206243.
DR   EnsemblGenomes-Gn; EBG00001206244.
DR   EnsemblGenomes-Gn; EBG00001206245.
DR   EnsemblGenomes-Gn; EBG00001206246.
DR   EnsemblGenomes-Gn; EBG00001206247.
DR   EnsemblGenomes-Gn; EBG00001206248.
DR   EnsemblGenomes-Gn; EBG00001206249.
DR   EnsemblGenomes-Gn; EBG00001206250.
DR   EnsemblGenomes-Gn; EBG00001206251.
DR   EnsemblGenomes-Gn; EBG00001206252.
DR   EnsemblGenomes-Gn; EBG00001206253.
DR   EnsemblGenomes-Gn; EBG00001206254.
DR   EnsemblGenomes-Gn; EBG00001206255.
DR   EnsemblGenomes-Gn; EBG00001206256.
DR   EnsemblGenomes-Gn; EBG00001206257.
DR   EnsemblGenomes-Gn; EBG00001206258.
DR   EnsemblGenomes-Gn; EBG00001206259.
DR   EnsemblGenomes-Gn; EBG00001206260.
DR   EnsemblGenomes-Gn; EBG00001206261.
DR   EnsemblGenomes-Gn; EBG00001206262.
DR   EnsemblGenomes-Gn; EBG00001206263.
DR   EnsemblGenomes-Gn; EBG00001206264.
DR   EnsemblGenomes-Gn; EBG00001206265.
DR   EnsemblGenomes-Gn; EBG00001206266.
DR   EnsemblGenomes-Gn; EBG00001206267.
DR   EnsemblGenomes-Gn; EBG00001206268.
DR   EnsemblGenomes-Gn; EBG00001206269.
DR   EnsemblGenomes-Gn; EBG00001206270.
DR   EnsemblGenomes-Gn; EBG00001206271.
DR   EnsemblGenomes-Gn; EBG00001206272.
DR   EnsemblGenomes-Gn; EBG00001206273.
DR   EnsemblGenomes-Gn; EBG00001206274.
DR   EnsemblGenomes-Gn; EBG00001206275.
DR   EnsemblGenomes-Gn; EBG00001206276.
DR   EnsemblGenomes-Gn; EBG00001206277.
DR   EnsemblGenomes-Gn; EBG00001206278.
DR   EnsemblGenomes-Gn; EBG00001206279.
DR   EnsemblGenomes-Gn; EBG00001206280.
DR   EnsemblGenomes-Gn; EBG00001206281.
DR   EnsemblGenomes-Gn; EBG00001206282.
DR   EnsemblGenomes-Gn; EBG00001206283.
DR   EnsemblGenomes-Gn; EBG00001206284.
DR   EnsemblGenomes-Gn; EBG00001206285.
DR   EnsemblGenomes-Gn; EBG00001206286.
DR   EnsemblGenomes-Gn; EBG00001206287.
DR   EnsemblGenomes-Gn; EBG00001206288.
DR   EnsemblGenomes-Gn; EBG00001206289.
DR   EnsemblGenomes-Gn; EBG00001206290.
DR   EnsemblGenomes-Gn; EBG00001206291.
DR   EnsemblGenomes-Gn; EBG00001206292.
DR   EnsemblGenomes-Gn; EBG00001206293.
DR   EnsemblGenomes-Gn; EBG00001206294.
DR   EnsemblGenomes-Gn; EBG00001206295.
DR   EnsemblGenomes-Gn; EBG00001206296.
DR   EnsemblGenomes-Gn; EBG00001206297.
DR   EnsemblGenomes-Gn; EBG00001206298.
DR   EnsemblGenomes-Gn; EBG00001206299.
DR   EnsemblGenomes-Gn; EBG00001206300.
DR   EnsemblGenomes-Gn; EBG00001206301.
DR   EnsemblGenomes-Gn; EBG00001206302.
DR   EnsemblGenomes-Gn; EBG00001206303.
DR   EnsemblGenomes-Gn; EBG00001206304.
DR   EnsemblGenomes-Gn; EBG00001206305.
DR   EnsemblGenomes-Gn; EBG00001206306.
DR   EnsemblGenomes-Gn; EBG00001206307.
DR   EnsemblGenomes-Gn; EBG00001206308.
DR   EnsemblGenomes-Gn; EBG00001206309.
DR   EnsemblGenomes-Gn; EBG00001206310.
DR   EnsemblGenomes-Gn; SAAV_0020.
DR   EnsemblGenomes-Gn; SAAV_0021.
DR   EnsemblGenomes-Gn; SAAV_0416.
DR   EnsemblGenomes-Gn; SAAV_0420.
DR   EnsemblGenomes-Gn; SAAV_0425.
DR   EnsemblGenomes-Gn; SAAV_0425a.
DR   EnsemblGenomes-Gn; SAAV_0426.
DR   EnsemblGenomes-Gn; SAAV_0466.
DR   EnsemblGenomes-Gn; SAAV_0467.
DR   EnsemblGenomes-Gn; SAAV_0468.
DR   EnsemblGenomes-Gn; SAAV_0469.
DR   EnsemblGenomes-Gn; SAAV_0470.
DR   EnsemblGenomes-Gn; SAAV_0471.
DR   EnsemblGenomes-Gn; SAAV_0472.
DR   EnsemblGenomes-Gn; SAAV_0473.
DR   EnsemblGenomes-Gn; SAAV_0474.
DR   EnsemblGenomes-Gn; SAAV_0475.
DR   EnsemblGenomes-Gn; SAAV_0476.
DR   EnsemblGenomes-Gn; SAAV_0477.
DR   EnsemblGenomes-Gn; SAAV_0485a.
DR   EnsemblGenomes-Gn; SAAV_0732.
DR   EnsemblGenomes-Gn; SAAV_0749.
DR   EnsemblGenomes-Gn; SAAV_0988.
DR   EnsemblGenomes-Gn; SAAV_0989.
DR   EnsemblGenomes-Gn; SAAV_1143.
DR   EnsemblGenomes-Gn; SAAV_1622.
DR   EnsemblGenomes-Gn; SAAV_1841.
DR   EnsemblGenomes-Gn; SAAV_1841a.
DR   EnsemblGenomes-Gn; SAAV_1842.
DR   EnsemblGenomes-Gn; SAAV_1843.
DR   EnsemblGenomes-Gn; SAAV_1844.
DR   EnsemblGenomes-Gn; SAAV_1845.
DR   EnsemblGenomes-Gn; SAAV_1846.
DR   EnsemblGenomes-Gn; SAAV_1847.
DR   EnsemblGenomes-Gn; SAAV_1880.
DR   EnsemblGenomes-Gn; SAAV_1881.
DR   EnsemblGenomes-Gn; SAAV_1882.
DR   EnsemblGenomes-Gn; SAAV_1883.
DR   EnsemblGenomes-Gn; SAAV_1884.
DR   EnsemblGenomes-Gn; SAAV_1885.
DR   EnsemblGenomes-Gn; SAAV_1886.
DR   EnsemblGenomes-Gn; SAAV_1887.
DR   EnsemblGenomes-Gn; SAAV_1888.
DR   EnsemblGenomes-Gn; SAAV_1889.
DR   EnsemblGenomes-Gn; SAAV_1890.
DR   EnsemblGenomes-Gn; SAAV_1891.
DR   EnsemblGenomes-Gn; SAAV_1892.
DR   EnsemblGenomes-Gn; SAAV_1893.
DR   EnsemblGenomes-Gn; SAAV_1894.
DR   EnsemblGenomes-Gn; SAAV_1895.
DR   EnsemblGenomes-Gn; SAAV_1896.
DR   EnsemblGenomes-Gn; SAAV_1897.
DR   EnsemblGenomes-Gn; SAAV_1898.
DR   EnsemblGenomes-Gn; SAAV_1899.
DR   EnsemblGenomes-Gn; SAAV_1900.
DR   EnsemblGenomes-Gn; SAAV_1901.
DR   EnsemblGenomes-Gn; SAAV_1902.
DR   EnsemblGenomes-Gn; SAAV_1902a.
DR   EnsemblGenomes-Gn; SAAV_1903.
DR   EnsemblGenomes-Gn; SAAV_1904.
DR   EnsemblGenomes-Gn; SAAV_1905.
DR   EnsemblGenomes-Gn; SAAV_1906.
DR   EnsemblGenomes-Gn; SAAV_1907.
DR   EnsemblGenomes-Gn; SAAV_1907a.
DR   EnsemblGenomes-Gn; SAAV_1908.
DR   EnsemblGenomes-Gn; SAAV_1909.
DR   EnsemblGenomes-Gn; SAAV_1910.
DR   EnsemblGenomes-Gn; SAAV_2082.
DR   EnsemblGenomes-Gn; SAAV_2110.
DR   EnsemblGenomes-Gn; SAAV_2110a.
DR   EnsemblGenomes-Gn; SAAV_2111.
DR   EnsemblGenomes-Gn; SAAV_2112.
DR   EnsemblGenomes-Gn; SAAV_2113.
DR   EnsemblGenomes-Gn; SAAV_2219.
DR   EnsemblGenomes-Gn; SAAV_2220.
DR   EnsemblGenomes-Gn; SAAV_2221.
DR   EnsemblGenomes-Gn; SAAV_2222.
DR   EnsemblGenomes-Gn; SAAV_2223.
DR   EnsemblGenomes-Gn; SAAV_2224.
DR   EnsemblGenomes-Gn; SAAV_2225.
DR   EnsemblGenomes-Gn; SAAV_2225a.
DR   EnsemblGenomes-Gn; SAAV_2226.
DR   EnsemblGenomes-Tr; EBT00001775466.
DR   EnsemblGenomes-Tr; EBT00001775467.
DR   EnsemblGenomes-Tr; EBT00001775468.
DR   EnsemblGenomes-Tr; EBT00001775469.
DR   EnsemblGenomes-Tr; EBT00001775470.
DR   EnsemblGenomes-Tr; EBT00001775471.
DR   EnsemblGenomes-Tr; EBT00001775472.
DR   EnsemblGenomes-Tr; EBT00001775473.
DR   EnsemblGenomes-Tr; EBT00001775474.
DR   EnsemblGenomes-Tr; EBT00001775475.
DR   EnsemblGenomes-Tr; EBT00001775476.
DR   EnsemblGenomes-Tr; EBT00001775477.
DR   EnsemblGenomes-Tr; EBT00001775478.
DR   EnsemblGenomes-Tr; EBT00001775479.
DR   EnsemblGenomes-Tr; EBT00001775480.
DR   EnsemblGenomes-Tr; EBT00001775481.
DR   EnsemblGenomes-Tr; EBT00001775482.
DR   EnsemblGenomes-Tr; EBT00001775483.
DR   EnsemblGenomes-Tr; EBT00001775484.
DR   EnsemblGenomes-Tr; EBT00001775485.
DR   EnsemblGenomes-Tr; EBT00001775486.
DR   EnsemblGenomes-Tr; EBT00001775487.
DR   EnsemblGenomes-Tr; EBT00001775488.
DR   EnsemblGenomes-Tr; EBT00001775489.
DR   EnsemblGenomes-Tr; EBT00001775490.
DR   EnsemblGenomes-Tr; EBT00001775491.
DR   EnsemblGenomes-Tr; EBT00001775492.
DR   EnsemblGenomes-Tr; EBT00001775493.
DR   EnsemblGenomes-Tr; EBT00001775494.
DR   EnsemblGenomes-Tr; EBT00001775495.
DR   EnsemblGenomes-Tr; EBT00001775496.
DR   EnsemblGenomes-Tr; EBT00001775497.
DR   EnsemblGenomes-Tr; EBT00001775498.
DR   EnsemblGenomes-Tr; EBT00001775499.
DR   EnsemblGenomes-Tr; EBT00001775500.
DR   EnsemblGenomes-Tr; EBT00001775501.
DR   EnsemblGenomes-Tr; EBT00001775502.
DR   EnsemblGenomes-Tr; EBT00001775503.
DR   EnsemblGenomes-Tr; EBT00001775504.
DR   EnsemblGenomes-Tr; EBT00001775505.
DR   EnsemblGenomes-Tr; EBT00001775506.
DR   EnsemblGenomes-Tr; EBT00001775507.
DR   EnsemblGenomes-Tr; EBT00001775508.
DR   EnsemblGenomes-Tr; EBT00001775509.
DR   EnsemblGenomes-Tr; EBT00001775510.
DR   EnsemblGenomes-Tr; EBT00001775511.
DR   EnsemblGenomes-Tr; EBT00001775512.
DR   EnsemblGenomes-Tr; EBT00001775513.
DR   EnsemblGenomes-Tr; EBT00001775514.
DR   EnsemblGenomes-Tr; EBT00001775515.
DR   EnsemblGenomes-Tr; EBT00001775516.
DR   EnsemblGenomes-Tr; EBT00001775517.
DR   EnsemblGenomes-Tr; EBT00001775518.
DR   EnsemblGenomes-Tr; EBT00001775519.
DR   EnsemblGenomes-Tr; EBT00001775520.
DR   EnsemblGenomes-Tr; EBT00001775521.
DR   EnsemblGenomes-Tr; EBT00001775525.
DR   EnsemblGenomes-Tr; EBT00001775527.
DR   EnsemblGenomes-Tr; EBT00001775529.
DR   EnsemblGenomes-Tr; EBT00001775530.
DR   EnsemblGenomes-Tr; EBT00001775533.
DR   EnsemblGenomes-Tr; EBT00001775534.
DR   EnsemblGenomes-Tr; EBT00001775536.
DR   EnsemblGenomes-Tr; EBT00001775537.
DR   EnsemblGenomes-Tr; EBT00001775540.
DR   EnsemblGenomes-Tr; EBT00001775542.
DR   EnsemblGenomes-Tr; EBT00001775545.
DR   EnsemblGenomes-Tr; EBT00001775547.
DR   EnsemblGenomes-Tr; EBT00001775550.
DR   EnsemblGenomes-Tr; EBT00001775553.
DR   EnsemblGenomes-Tr; EBT00001775555.
DR   EnsemblGenomes-Tr; EBT00001775556.
DR   EnsemblGenomes-Tr; EBT00001775557.
DR   EnsemblGenomes-Tr; EBT00001775559.
DR   EnsemblGenomes-Tr; EBT00001775561.
DR   EnsemblGenomes-Tr; EBT00001775563.
DR   EnsemblGenomes-Tr; EBT00001775565.
DR   EnsemblGenomes-Tr; EBT00001775567.
DR   EnsemblGenomes-Tr; EBT00001775569.
DR   EnsemblGenomes-Tr; EBT00001775571.
DR   EnsemblGenomes-Tr; EBT00001775573.
DR   EnsemblGenomes-Tr; EBT00001775575.
DR   EnsemblGenomes-Tr; EBT00001775576.
DR   EnsemblGenomes-Tr; EBT00001775578.
DR   EnsemblGenomes-Tr; EBT00001775580.
DR   EnsemblGenomes-Tr; EBT00001775582.
DR   EnsemblGenomes-Tr; EBT00001775584.
DR   EnsemblGenomes-Tr; EBT00001775586.
DR   EnsemblGenomes-Tr; EBT00001775588.
DR   EnsemblGenomes-Tr; EBT00001775590.
DR   EnsemblGenomes-Tr; EBT00001775592.
DR   EnsemblGenomes-Tr; EBT00001775594.
DR   EnsemblGenomes-Tr; EBT00001775596.
DR   EnsemblGenomes-Tr; EBT00001775598.
DR   EnsemblGenomes-Tr; EBT00001775600.
DR   EnsemblGenomes-Tr; EBT00001775602.
DR   EnsemblGenomes-Tr; EBT00001775604.
DR   EnsemblGenomes-Tr; EBT00001775606.
DR   EnsemblGenomes-Tr; EBT00001775609.
DR   EnsemblGenomes-Tr; EBT00001775611.
DR   EnsemblGenomes-Tr; EBT00001775614.
DR   EnsemblGenomes-Tr; EBT00001775616.
DR   EnsemblGenomes-Tr; EBT00001775618.
DR   EnsemblGenomes-Tr; EBT00001775619.
DR   EnsemblGenomes-Tr; EBT00001775622.
DR   EnsemblGenomes-Tr; EBT00001775624.
DR   EnsemblGenomes-Tr; EBT00001775626.
DR   EnsemblGenomes-Tr; EBT00001775627.
DR   EnsemblGenomes-Tr; EBT00001775629.
DR   EnsemblGenomes-Tr; EBT00001775632.
DR   EnsemblGenomes-Tr; EBT00001775634.
DR   EnsemblGenomes-Tr; EBT00001775635.
DR   EnsemblGenomes-Tr; EBT00001775637.
DR   EnsemblGenomes-Tr; EBT00001775638.
DR   EnsemblGenomes-Tr; EBT00001775639.
DR   EnsemblGenomes-Tr; EBT00001775640.
DR   EnsemblGenomes-Tr; EBT00001775641.
DR   EnsemblGenomes-Tr; EBT00001775642.
DR   EnsemblGenomes-Tr; EBT00001775643.
DR   EnsemblGenomes-Tr; EBT00001775644.
DR   EnsemblGenomes-Tr; EBT00001775645.
DR   EnsemblGenomes-Tr; EBT00001775646.
DR   EnsemblGenomes-Tr; EBT00001775647.
DR   EnsemblGenomes-Tr; EBT00001775648.
DR   EnsemblGenomes-Tr; EBT00001775649.
DR   EnsemblGenomes-Tr; EBT00001775650.
DR   EnsemblGenomes-Tr; EBT00001775651.
DR   EnsemblGenomes-Tr; EBT00001775652.
DR   EnsemblGenomes-Tr; EBT00001775653.
DR   EnsemblGenomes-Tr; EBT00001775654.
DR   EnsemblGenomes-Tr; EBT00001775655.
DR   EnsemblGenomes-Tr; SAAV_0020-1.
DR   EnsemblGenomes-Tr; SAAV_0021-1.
DR   EnsemblGenomes-Tr; SAAV_0416-1.
DR   EnsemblGenomes-Tr; SAAV_0420-1.
DR   EnsemblGenomes-Tr; SAAV_0425-1.
DR   EnsemblGenomes-Tr; SAAV_0425a-1.
DR   EnsemblGenomes-Tr; SAAV_0426-1.
DR   EnsemblGenomes-Tr; SAAV_0466-1.
DR   EnsemblGenomes-Tr; SAAV_0467-1.
DR   EnsemblGenomes-Tr; SAAV_0468-1.
DR   EnsemblGenomes-Tr; SAAV_0469-1.
DR   EnsemblGenomes-Tr; SAAV_0470-1.
DR   EnsemblGenomes-Tr; SAAV_0471-1.
DR   EnsemblGenomes-Tr; SAAV_0472-1.
DR   EnsemblGenomes-Tr; SAAV_0473-1.
DR   EnsemblGenomes-Tr; SAAV_0474-1.
DR   EnsemblGenomes-Tr; SAAV_0475-1.
DR   EnsemblGenomes-Tr; SAAV_0476-1.
DR   EnsemblGenomes-Tr; SAAV_0477-1.
DR   EnsemblGenomes-Tr; SAAV_0485a-1.
DR   EnsemblGenomes-Tr; SAAV_0732-1.
DR   EnsemblGenomes-Tr; SAAV_0749-1.
DR   EnsemblGenomes-Tr; SAAV_0988-1.
DR   EnsemblGenomes-Tr; SAAV_0989-1.
DR   EnsemblGenomes-Tr; SAAV_1143-1.
DR   EnsemblGenomes-Tr; SAAV_1622-1.
DR   EnsemblGenomes-Tr; SAAV_1841-1.
DR   EnsemblGenomes-Tr; SAAV_1841a-1.
DR   EnsemblGenomes-Tr; SAAV_1842-1.
DR   EnsemblGenomes-Tr; SAAV_1843-1.
DR   EnsemblGenomes-Tr; SAAV_1844-1.
DR   EnsemblGenomes-Tr; SAAV_1845-1.
DR   EnsemblGenomes-Tr; SAAV_1846-1.
DR   EnsemblGenomes-Tr; SAAV_1847-1.
DR   EnsemblGenomes-Tr; SAAV_1880-1.
DR   EnsemblGenomes-Tr; SAAV_1881-1.
DR   EnsemblGenomes-Tr; SAAV_1882-1.
DR   EnsemblGenomes-Tr; SAAV_1883-1.
DR   EnsemblGenomes-Tr; SAAV_1884-1.
DR   EnsemblGenomes-Tr; SAAV_1885-1.
DR   EnsemblGenomes-Tr; SAAV_1886-1.
DR   EnsemblGenomes-Tr; SAAV_1887-1.
DR   EnsemblGenomes-Tr; SAAV_1888-1.
DR   EnsemblGenomes-Tr; SAAV_1889-1.
DR   EnsemblGenomes-Tr; SAAV_1890-1.
DR   EnsemblGenomes-Tr; SAAV_1891-1.
DR   EnsemblGenomes-Tr; SAAV_1892-1.
DR   EnsemblGenomes-Tr; SAAV_1893-1.
DR   EnsemblGenomes-Tr; SAAV_1894-1.
DR   EnsemblGenomes-Tr; SAAV_1895-1.
DR   EnsemblGenomes-Tr; SAAV_1896-1.
DR   EnsemblGenomes-Tr; SAAV_1897-1.
DR   EnsemblGenomes-Tr; SAAV_1898-1.
DR   EnsemblGenomes-Tr; SAAV_1899-1.
DR   EnsemblGenomes-Tr; SAAV_1900-1.
DR   EnsemblGenomes-Tr; SAAV_1901-1.
DR   EnsemblGenomes-Tr; SAAV_1902-1.
DR   EnsemblGenomes-Tr; SAAV_1902a-1.
DR   EnsemblGenomes-Tr; SAAV_1903-1.
DR   EnsemblGenomes-Tr; SAAV_1904-1.
DR   EnsemblGenomes-Tr; SAAV_1905-1.
DR   EnsemblGenomes-Tr; SAAV_1906-1.
DR   EnsemblGenomes-Tr; SAAV_1907-1.
DR   EnsemblGenomes-Tr; SAAV_1907a-1.
DR   EnsemblGenomes-Tr; SAAV_1908-1.
DR   EnsemblGenomes-Tr; SAAV_1909-1.
DR   EnsemblGenomes-Tr; SAAV_1910-1.
DR   EnsemblGenomes-Tr; SAAV_2082-1.
DR   EnsemblGenomes-Tr; SAAV_2110-1.
DR   EnsemblGenomes-Tr; SAAV_2110a-1.
DR   EnsemblGenomes-Tr; SAAV_2111-1.
DR   EnsemblGenomes-Tr; SAAV_2112-1.
DR   EnsemblGenomes-Tr; SAAV_2113-1.
DR   EnsemblGenomes-Tr; SAAV_2219-1.
DR   EnsemblGenomes-Tr; SAAV_2220-1.
DR   EnsemblGenomes-Tr; SAAV_2221-1.
DR   EnsemblGenomes-Tr; SAAV_2222-1.
DR   EnsemblGenomes-Tr; SAAV_2223-1.
DR   EnsemblGenomes-Tr; SAAV_2224-1.
DR   EnsemblGenomes-Tr; SAAV_2225-1.
DR   EnsemblGenomes-Tr; SAAV_2225a-1.
DR   EnsemblGenomes-Tr; SAAV_2226-1.
DR   EuropePMC; PMC2780746; 19884497.
DR   EuropePMC; PMC2905362; 20550675.
DR   EuropePMC; PMC2905442; 20661294.
DR   EuropePMC; PMC3280451; 22354957.
DR   EuropePMC; PMC3878137; 24359724.
DR   EuropePMC; PMC4036114; 24853639.
DR   EuropePMC; PMC4827694; 27077050.
DR   EuropePMC; PMC4959656; 27150362.
DR   EuropePMC; PMC5736351; 29256859.
DR   EuropePMC; PMC6136393; 30237986.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00503; RNAIII.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01775; RsaOG.
DR   RFAM; RF01797; fstAT.
DR   RFAM; RF01816; RsaA.
DR   RFAM; RF01817; RsaB.
DR   RFAM; RF01818; RsaC.
DR   RFAM; RF01819; RsaD.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01821; RsaH.
DR   RFAM; RF01822; RsaJ.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01858; RsaF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001781.
DR   SILVA-SSU; CP001781.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2824404
FT                   /organism="Staphylococcus aureus subsp. aureus ED98"
FT                   /sub_species="aureus"
FT                   /strain="ED98"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:681288"
FT   gene            517..1878
FT                   /gene="dnaA"
FT                   /locus_tag="SAAV_0001"
FT   CDS_pept        517..1878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SAAV_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09954"
FT                   /protein_id="ACY09954.1"
FT                   /translation="MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSS
FT                   IPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTET
FT                   TEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKT
FT                   HLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQ
FT                   FIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPP
FT                   DYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITT
FT                   ELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLS
FT                   RELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV"
FT   gene            2156..3289
FT                   /gene="dnaN"
FT                   /locus_tag="SAAV_0002"
FT   CDS_pept        2156..3289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SAAV_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09955"
FT                   /protein_id="ACY09955.1"
FT                   /translation="MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVIL
FT                   TGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQ
FT                   TLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVL
FT                   TGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDI
FT                   DIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLL
FT                   AREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKA
FT                   IDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY"
FT   gene            3670..3915
FT                   /locus_tag="SAAV_0003"
FT   CDS_pept        3670..3915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09956"
FT                   /protein_id="ACY09956.1"
FT                   /translation="MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLING
FT                   VRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ"
FT   gene            3912..5024
FT                   /gene="recF"
FT                   /locus_tag="SAAV_0004"
FT   CDS_pept        3912..5024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SAAV_0004"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09957"
FT                   /protein_id="ACY09957.1"
FT                   /translation="MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYT
FT                   LALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRL
FT                   TQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNY
FT                   LKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALS
FT                   LNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQT
FT                   YGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQT
FT                   FVTTTSVDGIDHEIMNNAKLYRINQGEIIK"
FT   gene            5034..6968
FT                   /gene="gyrB"
FT                   /locus_tag="SAAV_0005"
FT   CDS_pept        5034..6968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SAAV_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09958"
FT                   /protein_id="ACY09958.1"
FT                   /translation="MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLH
FT                   HLVWEIVDNSIDEALAGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILT
FT                   VLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLK
FT                   EVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENV
FT                   REDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYA
FT                   NNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGD
FT                   PQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKA
FT                   REVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLR
FT                   GKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIR
FT                   TLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWS
FT                   IARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIED
FT                   NAVYANLDF"
FT   gene            7005..9674
FT                   /gene="gyrA"
FT                   /locus_tag="SAAV_0006"
FT   CDS_pept        7005..9674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="SAAV_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09959"
FT                   /protein_id="ACY09959.1"
FT                   /translation="MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLV
FT                   DGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPAR
FT                   FPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAG
FT                   LILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELV
FT                   RDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVN
FT                   GRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIR
FT                   ESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETI
FT                   LADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFEDLEDEDLIPEEQIVITLSHNNYI
FT                   KRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVP
FT                   ELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRI
FT                   NRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGIT
FT                   LREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGN
FT                   VVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKE
FT                   DAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQD
FT                   FMDRVEEDIQQSSDEDEE"
FT   gene            complement(9762..10463)
FT                   /locus_tag="SAAV_0007"
FT   CDS_pept        complement(9762..10463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09960"
FT                   /protein_id="ACY09960.1"
FT                   /translation="MLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKML
FT                   TKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTC
FT                   RVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIG
FT                   SPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLIN
FT                   EIPYAMKQLES"
FT   gene            10900..12414
FT                   /gene="hutH"
FT                   /locus_tag="SAAV_0008"
FT   CDS_pept        10900..12414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="SAAV_0008"
FT                   /product="histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09961"
FT                   /protein_id="ACY09961.1"
FT                   /translation="MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERI
FT                   IENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRL
FT                   NTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVL
FT                   YRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIA
FT                   ALTHQSLNGIIDAYRHDVHSVRNFQEQINVAARMRDWLEGSTLTTRQAEIRVQDAYTLR
FT                   CIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDH
FT                   LKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTL
FT                   AHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGL
FT                   SPKTRRKYEEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH"
FT   misc_feature    12487..12703
FT                   /product="T-box leader"
FT                   /note="SAAV_0009"
FT   gene            12793..14079
FT                   /gene="serS"
FT                   /locus_tag="SAAV_0010"
FT   CDS_pept        12793..14079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SAAV_0010"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09962"
FT                   /protein_id="ACY09962.1"
FT                   /translation="MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISAT
FT                   EEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRI
FT                   PNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARF
FT                   VYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVE
FT                   KEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQF
FT                   DKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDIEVW
FT                   LPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVEN
FT                   YQNEDGTVTIPEALVPFMGGKTQISKPVK"
FT   gene            14730..15425
FT                   /locus_tag="SAAV_0011"
FT   CDS_pept        14730..15425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09963"
FT                   /protein_id="ACY09963.1"
FT                   /translation="MATHLSFRQGVQECIPTLLGYAGVGISFGIVASSQNFSILEIILL
FT                   CLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGL
FT                   GSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLG
FT                   LDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATIS
FT                   AALGVMMER"
FT   gene            15422..15751
FT                   /locus_tag="SAAV_0012"
FT   CDS_pept        15422..15751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09964"
FT                   /protein_id="ACY09964.1"
FT                   /translation="MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFI
FT                   PITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAT
FT                   LRFFF"
FT   misc_feature    15956..16054
FT                   /product="SAM riboswitch (S box leader)"
FT                   /note="SAAV_0013"
FT   gene            16114..17082
FT                   /locus_tag="SAAV_0014"
FT   CDS_pept        16114..17082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0014"
FT                   /product="homoserine O-acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09965"
FT                   /protein_id="ACY09965.1"
FT                   /translation="MTNYTVDTLNLGKFITESGEVIDNLRLRYEHVGYHGQPLVVVCHA
FT                   LTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLT
FT                   LRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSY
FT                   SRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKE
FT                   HFDLNCYLTLLDVLDSHNIDRGRTDVTHIFKNLETKVLTMGFIDDLLYPDDQVRALGER
FT                   FKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK"
FT   gene            17390..18313
FT                   /locus_tag="SAAV_0015"
FT   CDS_pept        17390..18313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09966"
FT                   /protein_id="ACY09966.1"
FT                   /translation="MFSKIQPKATIIATITLVFVALALYLVPGLGLIFALFATIPGIVL
FT                   WNKSIQSFGVSALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERMLYVTT
FT                   VAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQAT
FT                   VQLPGFIIIITFLIVLINLIVTFPVLRKFKIATPVFKPLFAWQMSGILLWIYIIVIICL
FT                   LFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLIIGTILTPT
FT                   THIVGLLGVIDLSLNLKRIMKNNSKK"
FT   gene            18328..20295
FT                   /locus_tag="SAAV_0016"
FT   CDS_pept        18328..20295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09967"
FT                   /protein_id="ACY09967.1"
FT                   /translation="MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVV
FT                   MIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMT
FT                   NHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQ
FT                   TNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSS
FT                   DQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDSGELSQS
FT                   GLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVII
FT                   MGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFI
FT                   TSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYM
FT                   EPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLR
FT                   AHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADE
FT                   LLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVE
FT                   EAIAQLQQAITEQLSRSEDA"
FT   gene            20292..20738
FT                   /gene="rplI"
FT                   /locus_tag="SAAV_0017"
FT   CDS_pept        20292..20738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="SAAV_0017"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09968"
FT                   /protein_id="ACY09968.1"
FT                   /translation="MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLK
FT                   QLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKA
FT                   QHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ"
FT   gene            20770..22170
FT                   /gene="dnaB"
FT                   /locus_tag="SAAV_0018"
FT   CDS_pept        20770..22170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="SAAV_0018"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09969"
FT                   /protein_id="ACY09969.1"
FT                   /translation="MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYR
FT                   GAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQY
FT                   YTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIR
FT                   DVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALN
FT                   IAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAV
FT                   GKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQE
FT                   VSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLY
FT                   RDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDI
FT                   DYAHADMM"
FT   gene            22448..23731
FT                   /gene="purA"
FT                   /locus_tag="SAAV_0019"
FT   CDS_pept        22448..23731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SAAV_0019"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09970"
FT                   /protein_id="ACY09970.1"
FT                   /translation="MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQF
FT                   GGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQV
FT                   ILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSN
FT                   IEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGA
FT                   QGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTEL
FT                   FDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTV
FT                   KICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLER
FT                   ISELCNVQISIFSVGPDREQTNLLKELW"
FT   gene            24160..24234
FT                   /locus_tag="SAAV_0020"
FT   tRNA            24160..24234
FT                   /locus_tag="SAAV_0020"
FT                   /product="tRNA-Glu"
FT   gene            24242..24317
FT                   /locus_tag="SAAV_0021"
FT   tRNA            24242..24317
FT                   /locus_tag="SAAV_0021"
FT                   /product="tRNA-Asp"
FT   gene            24934..25635
FT                   /gene="yycF"
FT                   /locus_tag="SAAV_0022"
FT   CDS_pept        24934..25635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yycF"
FT                   /locus_tag="SAAV_0022"
FT                   /product="DNA-binding response regulator YycF"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09971"
FT                   /protein_id="ACY09971.1"
FT                   /translation="MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEE
FT                   EPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPF
FT                   STRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREF
FT                   ELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTR
FT                   RGVGYFLQQHE"
FT   gene            25648..27474
FT                   /gene="yycG"
FT                   /locus_tag="SAAV_0023"
FT   CDS_pept        25648..27474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yycG"
FT                   /locus_tag="SAAV_0023"
FT                   /product="sensory box histidine kinase YycG"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09972"
FT                   /protein_id="ACY09972.1"
FT                   /translation="MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNF
FT                   KKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIAT
FT                   TKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGN
FT                   IYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSR
FT                   GNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDR
FT                   RGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGL
FT                   IARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIE
FT                   ALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFIN
FT                   KIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVK
FT                   QNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAH
FT                   NGRIWANSVEGQGTSIFITLPCEVIEDGDWDE"
FT   gene            27467..28801
FT                   /gene="yycH"
FT                   /locus_tag="SAAV_0024"
FT   CDS_pept        27467..28801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yycH"
FT                   /locus_tag="SAAV_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09973"
FT                   /protein_id="ACY09973.1"
FT                   /translation="MNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSE
FT                   TKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRR
FT                   DHNLMIPDLSSDFTLFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVL
FT                   YAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPE
FT                   KLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNL
FT                   SEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKE
FT                   GSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKTLPKLESVRSSLANNSDINFEKVTN
FT                   IAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE"
FT   gene            28802..29590
FT                   /gene="yycI"
FT                   /locus_tag="SAAV_0025"
FT   CDS_pept        28802..29590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yycI"
FT                   /locus_tag="SAAV_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09974"
FT                   /protein_id="ACY09974.1"
FT                   /translation="MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNF
FT                   QQEEIKVPASILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVK
FT                   VSDNNLKDLKDYVNKRVFKGSEYQLSEINSGSVKYEQTYDNFPILNNSKAMLNFNIEDN
FT                   KAASYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVN
FT                   ETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH"
FT   gene            29979..30779
FT                   /gene="yycJ"
FT                   /locus_tag="SAAV_0026"
FT   CDS_pept        29979..30779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yycJ"
FT                   /locus_tag="SAAV_0026"
FT                   /product="metallo-beta-lactamase family protein YycJ"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09975"
FT                   /protein_id="ACY09975.1"
FT                   /translation="MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQ
FT                   IDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFI
FT                   FNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSD
FT                   AFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAGHAMTDVITGNTKRIYLSHLS
FT                   QDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI"
FT   gene            31006..33324
FT                   /locus_tag="SAAV_0027"
FT   CDS_pept        31006..33324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0027"
FT                   /product="5'-nucleotidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09976"
FT                   /protein_id="ACY09976.1"
FT                   /translation="MKALLLKTSVWLVLLFSVMGLWQVSNAAEQYTPIKAHVVTTIDKA
FT                   TTDKQQVTPTKEAAHQFGEEAATNVSASAQGTADEINNKVTSNAFSNKPSTAVSTKVNE
FT                   THDVDTQQASTQKPTQSATFTLSNAKTASLSPRMFAANVPQTTTHKILHTNDIHGRLAE
FT                   EKGRVIGMAKLKTIKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMAKAMNAVGYDAMAVG
FT                   NHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNGIRYGIIGVTTPETK
FT                   TKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPSTQETWRGDYLVKQL
FT                   SQNPQLKKRITVIDGHSHTVLQNGQIYNNDALAQTGTALANIGKVTFNYRNGEVSNIKP
FT                   SLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFKGERDDVRTRETNLG
FT                   NAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLISVLPFGNTIAQIDVK
FT                   GSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDMNKPSGKRINAIQILN
FT                   KETGKFENIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQVLASYLKTANIAKY
FT                   DTTEPQRMLLGKPAVSEQPAKGQQGSKGSESGKDVQPIGDDKAMNPAKQPATGKVVLLP
FT                   THRGTVSSGTEGSGRTLEGATVSSKSGNQLVRMSVPKGSAHEKQLPKTGTNQSSSPAAM
FT                   FVLVAGIGLIATVRRRKAS"
FT   gene            complement(33556..34011)
FT                   /locus_tag="SAAV_0028"
FT   CDS_pept        complement(33556..34011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09977"
FT                   /protein_id="ACY09977.1"
FT                   /translation="MTNTKSLCPWVMRWFNSWANPSEDSIFPCISNVMTVDCGLILASI
FT                   RWPSFSFTCSISLSLIFSGAFSSGTSMMSILVYGPKRFSYSAMACFQYFSFSFPTAKMV
FT                   IFMSFGPPNCYQLSSYPQVINLFTLFPLIIPIFFAVFDIFLTFMPNF"
FT   gene            34474..34566
FT                   /locus_tag="SAAV_0029"
FT   CDS_pept        34474..34566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09978"
FT                   /protein_id="ACY09978.1"
FT                   /translation="MTKNSKYTNEVSKEQFQEIENVNNKVKEFY"
FT   gene            34713..36458
FT                   /locus_tag="SAAV_0030"
FT   CDS_pept        34713..36458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09979"
FT                   /protein_id="ACY09979.1"
FT                   /translation="MKINIYKSIYNFQETNTNFLENLESLNDDNYELLNDKELVSDSNE
FT                   LKLISKVYIRKKDKKLLDWQLLIKNVYLDTEEDDNLFSESGHHFDAILFLKEDTTLQNN
FT                   VYIIPFGQAYHDINNLIDYDFGIDFAERAIKNEDIVNKNVNFFQQNRLKEIVNYRRNSV
FT                   DYVRPSESYISVQGHPQNPQIFGKTMTCGTSISLRVPNRKQQFIDKISVIIKEINAIIN
FT                   LPQKISEFPRIVTLKDLNKIEVLDTLLLKKLSNSSTTENISIDISRFLELSNMILLLDD
FT                   MLDVNIYINSFKNNTLETFDATDPEVDYITEIGDYLLKYDVNSINDVRIEVIDNLGHSN
FT                   NMLLKTILHAEVEMEDGKKYLLQNGKWGYFNREFFDLLNDHLNEIEIRYNTLTPTGLVF
FT                   KEGEEGYIKEIVGRLPEEYLMLHKKFIKPINKNFIVKGNGIELADLYNIKNKELFTIKR
FT                   GINTSLSLYSLEQNIIAINALKYPESYNFEELIEAIPDNSENIFNDIQRSTNFSIVWIL
FT                   PISSIDNMPIKDMVHTSNVINKNFQLTNLGSVLLKNKLVEWSLYLKDQRINPIIYMETP
FT                   TEDRN"
FT   gene            complement(36642..36968)
FT                   /locus_tag="SAAV_0031"
FT   CDS_pept        complement(36642..36968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09980"
FT                   /protein_id="ACY09980.1"
FT                   /translation="MEWDDEINFGKISFLSHSHIPDRKTGLELAEKYGIDGVMIGSGIF
FT                   HNPFAFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRALAN
FT                   FDIN"
FT   gene            complement(37402..38157)
FT                   /locus_tag="SAAV_0032"
FT   CDS_pept        complement(37402..38157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09981"
FT                   /protein_id="ACY09981.1"
FT                   /translation="MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAP
FT                   AYSAYIASGLTSSQVFFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFD
FT                   ATFVNTVYIIIALLALTLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFII
FT                   IPILLVLFKLPMNTVVANSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIG
FT                   LKLSKKVPNIIQKWIISILIVFAIVQLIL"
FT   gene            complement(38157..38417)
FT                   /locus_tag="SAAV_0033"
FT   CDS_pept        complement(38157..38417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09982"
FT                   /protein_id="ACY09982.1"
FT                   /translation="MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSL
FT                   QRLMGIIISENLIECVKVAADDEESSQELINEAVNLLVKSK"
FT   gene            38554..39618
FT                   /locus_tag="SAAV_0034"
FT   CDS_pept        38554..39618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09983"
FT                   /protein_id="ACY09983.1"
FT                   /translation="MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSIL
FT                   HPVDEIESFNKEKNKTYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEENDSYDT
FT                   QEEYKSIEIKADRKQFNYRGFQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSW
FT                   VKQTRHTLVKLDENNNGINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIAN
FT                   GARAAGKDVTIFFTFWGLNALKKVQTVNVKKQGIAKMFDLMLPQKNIRMPLSKMNMFGL
FT                   GNMMMRYVMKKKNVDSLPTLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGT
FT                   YIGATENANHNLFI"
FT   gene            39649..40983
FT                   /locus_tag="SAAV_0035"
FT   CDS_pept        39649..40983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0035"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09984"
FT                   /protein_id="ACY09984.1"
FT                   /translation="MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSE
FT                   GLTITQATETHIHADFASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDII
FT                   QVGNVKLEVLHTPGHTPESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQ
FT                   IKGSTEISAKQMYESVQNIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWA
FT                   FNEIDETKFIESLTSNQPAPPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSK
FT                   EAFHGGHTKGTINIPYNKNFINQIGWYLDFEKDIDLIGDKSTVEKAKHTLQLIGFDKVA
FT                   GYRLPKSGISTQSVHSADMTGKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFN
FT                   KEDKIYVHCQSGVRSSIAVGILESKGFENVVNIREGYQDFPESLK"
FT   gene            41002..42195
FT                   /locus_tag="SAAV_0036"
FT   CDS_pept        41002..42195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09985"
FT                   /protein_id="ACY09985.1"
FT                   /translation="MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYY
FT                   QPLWTLVGAGVSSLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFL
FT                   VVAPGLQINWSSIKGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIK
FT                   CGGAPMKIMYLAEDYFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNY
FT                   NYNLVEIDGDKKVATFEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVN
FT                   PTTLQHKSYSNVFALGDASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTS
FT                   CPIVTGYNRLILAEFDYNKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI"
FT   gene            complement(42862..43794)
FT                   /locus_tag="SAAV_0037"
FT   CDS_pept        complement(42862..43794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09986"
FT                   /protein_id="ACY09986.1"
FT                   /translation="MEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVRGRL
FT                   TFSEDEHPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILR
FT                   PDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMSK
FT                   VDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPF
FT                   AFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQ
FT                   LMNTQSIAEARALLDEFEAQMDEDVKIEL"
FT   gene            44157..44360
FT                   /locus_tag="SAAV_0038"
FT   CDS_pept        44157..44360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09987"
FT                   /protein_id="ACY09987.1"
FT                   /translation="MEDLKESLKSLGWWDLFFAIPMFLLFAYLPNYNFITIFLNIVIII
FT                   FFSIGLILTTHIIIDKIKSNTK"
FT   gene            44409..44705
FT                   /locus_tag="SAAV_0039"
FT   CDS_pept        44409..44705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09988"
FT                   /protein_id="ACY09988.1"
FT                   /translation="MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDSVVIGGLYDNR
FT                   LLVKATKSVRHQLQDNTLVSPYPGAKEMILIPDITEAINLTNLFELIKNDLKN"
FT   gene            44913..45515
FT                   /locus_tag="SAAV_0040"
FT   CDS_pept        44913..45515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09989"
FT                   /protein_id="ACY09989.1"
FT                   /translation="MLISLVIPVFALLVIGGIIWVIIEGIVHISKKNKAIDNFLNQVNK
FT                   VSETYKFATAFLFLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLP
FT                   LYKQKKKKQTFKKYMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGG
FT                   YAYLALAVLSTLLIVAKKATNKNKEIETVDNTNITER"
FT   gene            45782..48934
FT                   /locus_tag="SAAV_0041"
FT   CDS_pept        45782..48934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09990"
FT                   /protein_id="ACY09990.1"
FT                   /translation="MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQL
FT                   QSFDEYFEIWNSERFIISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSDIHNPN
FT                   GTHCYGYTFNTDKHGKVIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFFQKVKE
FT                   ILADEPINEFKLKKMDKAYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFIS
FT                   DIEKARKSPNQTLIDYIEGVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSL
FT                   MQQLAVNQITSGNERISSVNGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKT
FT                   KIHETDDKYVYLLKESIAKYKMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQ
FT                   NYANLAHELKDFAEIAEDLIGESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLL
FT                   QNENNRMSYNELMSEWQSHQRAFLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINS
FT                   EKTSIEEQVYHLDNETLRDNKEIEDLDNRINYIVKQIETLNELIKSIKESNKGFINKLK
FT                   AMFNSEEDESYKDHNKEKQQLLTQQLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQ
FT                   LDELNSQLQELEAYRIESKITIPEKDFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAM
FT                   ILHKLLLIANNTTIYYAINDFKDRRKLIDANPDKVHNAWNVMHLIFPVVSTTFASFKSM
FT                   YGGIPKDFIDYLFIDEAGQAIPQAAVGALYRSKKVVAVGDPIQIEPVVTLESHLIDNIR
FT                   KNYHVPEYLVSKEASVQSVADNANQYGFWKSDATDSNQKTWIGIPLWVHRRCLKPMFTI
FT                   ANQIAYNNKMVLPSNITKVGKTGWYDVKGNAVQKQFVKEHGEKVVGLLADDWIEAIKEG
FT                   KNEPSSFVISPFSAVQQQIKRMLKQQLPTRIDIERTKINQWVDKSIGTVHTFQGKEAQK
FT                   VYFVIGTDNTQDGAVNWSCEKPNLLNVAVTRAKKEFYVIGDMQRIQMKPFYETIFKERN
FT                   VK"
FT   gene            48991..49473
FT                   /locus_tag="SAAV_0042"
FT   CDS_pept        48991..49473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09991"
FT                   /protein_id="ACY09991.1"
FT                   /translation="MEKFNNWILNAISGSQTDKNETTEELKGAKFIILYAYSMLVLLAL
FT                   VISNIFIHILEPKLSITTQIIIVLILIEALIGLRFLKAYDVKRGKDKENKKNSKDFVKL
FT                   KSILVAILFTSLALTAGTVADIYGFTDLGNTRSDLIVWSIGGIIFGLVCYTMEDKK"
FT   gene            49679..50665
FT                   /gene="plc"
FT                   /locus_tag="SAAV_0043"
FT   CDS_pept        49679..50665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plc"
FT                   /locus_tag="SAAV_0043"
FT                   /product="1-phosphatidylinositol phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09992"
FT                   /protein_id="ACY09992.1"
FT                   /translation="MKKCIKTLFLSIILVVMGGWYHSAHASDSLSKSPENWMSKLDESK
FT                   HLTEINMPGSHDSGSFTLTDPVKSVWAKTQGKDYLTQMKSGVRFFDIRGRASADNMISV
FT                   HHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNN
FT                   PQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKIN
FT                   NGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNY
FT                   ASHINPEIAKTIKENGKARTGWLIVDYAGYPWPGYDDIVSEIIDSNK"
FT   gene            50886..51656
FT                   /locus_tag="SAAV_0044"
FT   CDS_pept        50886..51656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09993"
FT                   /protein_id="ACY09993.1"
FT                   /translation="MMKRLNKLVLGIIFLFLVISITAGCGIGKEAEVKKSFEKTLSMYP
FT                   IKNLEDLYDKEGYRDDQFDKNDKGTWIINSEMVIQPNNEDMVAKGMVLYMNRNTKTTNG
FT                   YYYVDVTKDEDEGKPHDNEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFK
FT                   DLSKYKDGDISYNPEVPSYSAKYQVTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKG
FT                   SSVGYKDIEFTFVEKKGENIYFSDSLHLEPSEGK"
FT   gene            51708..52478
FT                   /locus_tag="SAAV_0045"
FT   CDS_pept        51708..52478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0045"
FT                   /product="putative lipoprotein, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09994"
FT                   /protein_id="ACY09994.1"
FT                   /translation="MIKRVNKLVLGISFLFLIISIFAGCGTGKEAEIKKSFEKTLSMYP
FT                   IKNLEDLYDKEGYRDDQFDKNDKGTWIVRSSMSIQSNGKDMNIKGMVLYMNRNTRTTNG
FT                   YYYVDVIEREDKGIHRDNEKRYPVKMVDNKIIPTKEIKDEKIKKEIENFKFFVQYGDFK
FT                   DLSKYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYNIPTNKAPKLLLKGTGNLKG
FT                   SSIGYKKIEFTFVEKKGENIYFSDGLHFNPSEDK"
FT   gene            52546..52881
FT                   /locus_tag="SAAV_0046"
FT   CDS_pept        52546..52881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0046"
FT                   /product="putative lipoprotein, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09995"
FT                   /protein_id="ACY09995.1"
FT                   /translation="MKRLNTLVLYISFLILIISIVAGCGTGKEAEIKKSFEKTLSMYPI
FT                   KNLEDLYDKEGYRDDEFDKNDKGTWTISSEMAIQKKGEALNIKGMVLKLQCVNTKTKIS
FT                   LKNFKFS"
FT   gene            complement(53099..53590)
FT                   /locus_tag="SAAV_0047"
FT   CDS_pept        complement(53099..53590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0047"
FT                   /product="truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09996"
FT                   /protein_id="ACY09996.1"
FT                   /translation="MQLCIGPHSVNERKEYGHYEIDTILSKRPSLACLVTIIERKTRYL
FT                   YACRLDSRCSKDVCDAIVELMRDLSPKTITVDRGKEFSNYLLLESELNCRVYFSDPGCP
FT                   GQRGSIENVNGLLRQYFPKGTDFKNISDDALYKAVERINTRPRAVLNYLTSEEVIQVYR
FT                   "
FT   gene            complement(53556..54062)
FT                   /locus_tag="SAAV_0048"
FT   CDS_pept        complement(53556..54062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0048"
FT                   /product="truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09997"
FT                   /protein_id="ACY09997.1"
FT                   /translation="MTKKRKKRRPVDLTTRLAIAKYLYDGVPIADIARLLDRDYSVILN
FT                   ELKRYTFDDIYDPVLAQEYASVTYNHSEEHKEKSRKLDEKSKVYIEERLACQWSPRQIA
FT                   ERIEKDIGVYISYPTIYRYIREGLVKYVKKDLRQGGKKFNKSTEKRGKIKVGDRAIMYR
FT                   PTFRK"
FT   gene            complement(54174..54536)
FT                   /locus_tag="SAAV_0049"
FT   CDS_pept        complement(54174..54536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0049"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09998"
FT                   /protein_id="ACY09998.1"
FT                   /translation="MTKRFLLITLILVISIALIACGKKYDKEIEEVTSLEAKDRNDSSD
FT                   PEFNKYERKKSNIYVYEDGKVITLTYAPFKGSSELSTRMYIKNETTGNYKEDINGKPKK
FT                   FMKENKPDFKEENLKE"
FT   gene            complement(54585..55178)
FT                   /locus_tag="SAAV_0050"
FT   CDS_pept        complement(54585..55178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0050"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY09999"
FT                   /protein_id="ACY09999.1"
FT                   /translation="MKLKIIGFVIVTILTVSAYFIGTQTTKQQVQKEKNHVSELKQTLQ
FT                   QEKDTNEALNQRVKRQSKTVIAEEEKQIRETAQTFTTELFTLKKGSSFKQKAKPLKPFV
FT                   TEKYYNVLFSDNREKFSIFDDVTVSDIHVYFDQYDPKHDNYKVFVQFNERIDTEGQKEV
FT                   ENRKTSVQLDMVRTNDKWLINDVQRFNLQKNGRG"
FT   gene            complement(55185..56222)
FT                   /locus_tag="SAAV_0051"
FT   CDS_pept        complement(55185..56222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0051"
FT                   /product="putative TraG protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10000"
FT                   /protein_id="ACY10000.1"
FT                   /translation="MVNKKTVVKEVMKQTPIGIKFRLLKIGLILFCVLFFLFPVILMFV
FT                   FSPEEDKQTDGDMSCVGGDVKDKGIAVFEQNAKGGALEGKGKVIVKIAKKHKIPENLFM
FT                   AIIASESGWGKGENATRQKNPLSVMGTKSIHDSTYSTIEDGLEAGAKNLYDVYIKEGLT
FT                   TPEKIGPKYAPVGASNDPNNMNKQWIPTVKSMMKKLSDGDGAVCKSTGGKDIKFNGKLP
FT                   KWSNSDAGKGNLYTAGQCTWYAYGIRQKMGKPISTYWFHAQFWNDRAKDEGYKVNSKPA
FT                   VGALMIAEPGAGGAPPVTGHVAVVIDVKDNKTFTVTEMNIKGPYIVSQREMKVESGISF
FT                   IHDKE"
FT   gene            complement(56212..58125)
FT                   /locus_tag="SAAV_0052"
FT   CDS_pept        complement(56212..58125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0052"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10001"
FT                   /protein_id="ACY10001.1"
FT                   /translation="MKRKSLYLLCFLILPFFLITGATADAVANPVGKPTNAVDAKIEKY
FT                   KVDDKADGDIDLERYRIWFQKDEDWNPFGKDEVAETVNNVTNFFFEIDKLIVSITDYAV
FT                   ENLYQLDVLNDFADKVGQFVGDIYQKLLSNIVMTLFIVICLNAFIVFSVKGNMHEALKR
FT                   VFLIFCLIGFGVGVLANASFVIKGTNNVGKGLNNVIMNSTSSINGDIDYVNENSGINKI
FT                   RNQYFDMALYKPYLIMNYGTVNEDKIKNKGKNRIDNILDVKVKDEKTEKEVKDKIDKEV
FT                   KSYNNTAMKQTHVFGQLGIAMFTLIITIALSIIFLSISFAKVIFSAFALILFLFLAFSW
FT                   LISFIPGFEISVFKALARTLGYIILSACMTFLFVVIGFSIDIANAFVKPESQQAYFLNV
FT                   IFLMIILFVLYKKRSEIIDFVTRGNLSLSPQKLGADVMRKGQDEFNKRRQKRAEDKKNK
FT                   RKNQLDNPEPPMINDNPNKPNRNQQSDPIVSMNHSKEIKRRNQQEEMHGAPNVGVASYV
FT                   SRSGVDPKGYTKSKQIAQDDGMHRDIKHKKDIKRNPQTESFNPTYLSQPPKELSRHSQS
FT                   FNKDIQSSYDKDIEKRRIQTGEDKPYQPRSHENEPTFKRNSQTKHVHDRLKNQKDINKH
FT                   GK"
FT   gene            complement(58141..58308)
FT                   /locus_tag="SAAV_0053"
FT   CDS_pept        complement(58141..58308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0053"
FT                   /product="hypothetical protein, transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10002"
FT                   /protein_id="ACY10002.1"
FT                   /translation="MNKEQVEQLLSELAKEIGMKNVILIALDLAIKEDKTLRSDEVEQL
FT                   IKVQRQIEKI"
FT   gene            complement(58321..59676)
FT                   /locus_tag="SAAV_0054"
FT   CDS_pept        complement(58321..59676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0054"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10003"
FT                   /protein_id="ACY10003.1"
FT                   /translation="MTMNEIALFKGVRIQPYFKYIDFIFAGVFAFIFLAYRILMLWQGY
FT                   ISQQKALNVVEVYQYFKPHFLYLAIGTLVIFIIAKLSSQLILRFREKDLAEMIETQGFH
FT                   NRTVIKKTTEYLDIDYKKTEYDYYPTLFYKRRRKTFVIHVKKDGSRFQDDYLELESIIE
FT                   PMFNCELVEKRHIGRYLRYEFMPLKYKKRIVMEGTEAPETTYYDTKIYITHQILWDFVK
FT                   APHALITGVTGGGKTYFLFYMIRELFKRDAEVRLLDPKVSDLSFMKNVIGAEKVADTKG
FT                   QIFKQLREANEEMEHRFRMMSESKQYQLGSNFRNFDLPPYFVIFDEVTAFTSTLDKKEL
FT                   QEMNDYLINIIMKGRQAGVFMFLTAQRPDADVIKGNVRDQLGLRVSMGNLSADGYRMTF
FT                   GQTDKAFQPIHESDIGRGYISILGQYNEPILFDAPLMEQYDFVADVKQILNK"
FT   gene            complement(59734..59982)
FT                   /locus_tag="SAAV_0055"
FT   CDS_pept        complement(59734..59982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0055"
FT                   /product="hypothetical protein, transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10004"
FT                   /protein_id="ACY10004.1"
FT                   /translation="MRSYKDIMYVSEDIYQYFSKVTKEEARNASEKWNISEARSQSGTL
FT                   ALCLENISKNINDYSQEELGKMIYSISKAQREIFKLL"
FT   gene            60456..60899
FT                   /locus_tag="SAAV_0056"
FT   CDS_pept        60456..60899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0056"
FT                   /product="hypothetical protein, transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10005"
FT                   /protein_id="ACY10005.1"
FT                   /translation="MLLFALKNSILVLLIASIIIGISNIIISFIFYKSKFKRLLIGTIL
FT                   LFTNIIIWSNANDFSESILELSENNFQRYLIIIFLMISLFVIALNNNLLTHYLFNYFNH
FT                   KKDYNNPVKRFCYITLPLPLFFTIKWVILNNGYLRIIEFLKNL"
FT   gene            complement(61090..63585)
FT                   /locus_tag="SAAV_0057"
FT   CDS_pept        complement(61090..63585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0057"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10006"
FT                   /protein_id="ACY10006.1"
FT                   /translation="MELKAPYAGIKNNLLLTKSGEVWAYYRIRSESISTANYDKKEASK
FT                   KRMKYFLESIKGYQDFHFEMYEHDLDLRNKFKEISQDFDDSAFDVANYYAQETIDVLEQ
FT                   ELQMITRNSFVMGVKLRELSDDAISIKEILKSTLSDTAERMISNFGFNVSLDEKVLSRY
FT                   EVFERELADSFLSIEGERLTENELAYIVRKPFISNATHDVQEESSRRAVTDVCNVVIDP
FT                   TNMRVLKVTNENETFYTTTIVVDDFPLDMEFTHIYEKAQNMPFPVECHVKAKIIENDKV
FT                   KKKFDRAKINHKAQAREKQSAGDNASEDIQDNLFVLEQMEKEVTGSGVFMEWSCSFVIK
FT                   SDDLKDCKRKAKRLIKRLKETNIYAVNPLADQLQLYYQILHGNPLFINKYWVQRTTATG
FT                   IAENLFGVSQSLGTKTGFYIGRIDKFIRSVSREEAVASSRDIILFSLLLAAKGISGAVS
FT                   DSPHVLITGQTGKGKSFLAKLLWIYTSFFKGQMIYWDPKSEFADWFNKITESEDMQRKY
FT                   PLFVNHLKTFKYVTLDYKNPSNYGCLDPIVFLDGIEANEMLKSVFDEIKSFENEHRVET
FT                   AIYRAITETVEEREKGQQVGSLDVIKKLQNDEDEHVSQAGDLLFEKTQNNILKLVFSDG
FT                   SNPALNIQEKATILQVQGLDMPKAGDDPSGYSTGEKNGITLMLLIGKFLQKFGSRRQIQ
FT                   TTLFIDEGWAFSASRQGKKVAKGIKRMGRSENNSLVFITQSVKDKADEDGGNFGCHFAF
FT                   DEKDEREDILKSLGLEYSKESPENMEMLKDLKKGQCIFSDFYGRVGKMVVHCPFEEMTE
FT                   AFKTQEDSASSIAEEKFAI"
FT   gene            complement(63620..64009)
FT                   /locus_tag="SAAV_0058"
FT   CDS_pept        complement(63620..64009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0058"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10007"
FT                   /protein_id="ACY10007.1"
FT                   /translation="MDKKAYNLKRTFEQPIVMYEFTGSYRWSKGIRLDWVGTLFVIELI
FT                   LILLYLKAGFNTLTGLIPGLTIIYFTVLPYYMTKQLVKLKQDGKKLIFFLWDFMMYVFN
FT                   IQMRNVHYAYDEEVKYHDKKIIKLK"
FT   gene            complement(64015..64275)
FT                   /locus_tag="SAAV_0059"
FT   CDS_pept        complement(64015..64275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0059"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10008"
FT                   /protein_id="ACY10008.1"
FT                   /translation="MEHLFNLMLVLGDAPSINPLGQWVNKEVGTAIGIIVLVIGCVKWA
FT                   TGKYGHMLVLFVVGGLMFLISKGPETVFNSVSGIWKLIFGS"
FT   gene            complement(64280..65323)
FT                   /locus_tag="SAAV_0060"
FT   CDS_pept        complement(64280..65323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0060"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10009"
FT                   /protein_id="ACY10009.1"
FT                   /translation="MILSRLSKKGKRFDVPEEERKALPKYRNHRKKIVIIFYTILVLLT
FT                   ILLIASFIRASKANNESKEAVNKTQEIQKKYEDNAETVQYNPNLKLYADKYIDAYMTIP
FT                   KDGKAKEERQKALADFYPSDYKTPTENTENVERKLNEKEFFNIKRKDKQTIIQYIVSYD
FT                   LKITEKKEVKVKKKKDKKDKDKKDEYETKTEEKERTETKKALLNIPVKSENNKYVVIEY
FT                   PHFSTIPSNQLKKATLVKDSLENEKREDNPELKTFVEEFFDKYCKSKSDDMAYLMDNPE
FT                   GLEDTREVSKISDLRIYPKGDDYVVKAEVLMKDKGSPLENLEHYTLDITKKDGKYYVKK
FT                   LTTTIGG"
FT   gene            complement(65414..66502)
FT                   /locus_tag="SAAV_0061"
FT   CDS_pept        complement(65414..66502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0061"
FT                   /product="replication initiation factor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10010"
FT                   /protein_id="ACY10010.1"
FT                   /translation="MENQASTPLTNRGVAKPEKCGLEAVVDWVQVTFQVPSIFTIMEDV
FT                   LKLPRAVFKHRNSGLYYYNRGYTFGNIQIFYSDKDEGMGFHLQLSGSGCREFEHYLINR
FT                   NETWQDFFKRCAVKKARFTRIDIAIDDTKTYLKIPRLIKKAERGECISKFRSASSISGF
FT                   KLSDGQSKGSTFYIGSKKSDIYCRFYEKNYEMAYKLKTPVEDFGLWNRYEIQMRRSNAE
FT                   NCAMILTETSSISDIVKGVLNNSMRFVTEPKDVSDSRKSRWPVYQEWSRFIKGADKISL
FT                   SMKPSLKSIEDNIDWLCKQVATTLDTVLTAEAMAQSEGLLEDTDFLNKILAHSSFNDEH
FT                   TDRINHYLEELKRKKNLRQDIS"
FT   gene            complement(66682..66984)
FT                   /locus_tag="SAAV_0062"
FT   CDS_pept        complement(66682..66984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0062"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10011"
FT                   /protein_id="ACY10011.1"
FT                   /translation="MEFYTADNLAPYARTLKLSEGMLSYIASRINTGEALSLMLIAKEI
FT                   QEKFNGDYVKSRLPSGRPRIYTDVCLLCFSLKEAGHGRLLQIDLKDCIYIGDVDS"
FT   gene            complement(66988..67323)
FT                   /locus_tag="SAAV_0063"
FT   CDS_pept        complement(66988..67323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0063"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10012"
FT                   /protein_id="ACY10012.1"
FT                   /translation="MAWSPKFDLKETFGDLYFMGVDEKYKYEDGEKTDQKLYAYKLAST
FT                   GQGEQVTVKVPKEVKLDIMSVCELVGVEAKQYVQSSGDFHSIQPSIKAEDIRQIGTISV
FT                   KKGAQQS"
FT   gene            complement(67362..67664)
FT                   /locus_tag="SAAV_0064"
FT   CDS_pept        complement(67362..67664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0064"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10013"
FT                   /protein_id="ACY10013.1"
FT                   /translation="MIEPVIDIDATMGKEFRYLSHVEKISRFDEAYYLYTIVCVDIGEQ
FT                   VKIRLSNEKHFDALERVDFDNLTIKPRVYQDMNTGYCNLYTSFSADDIYSLDKKV"
FT   gene            complement(67821..68105)
FT                   /locus_tag="SAAV_0065"
FT   CDS_pept        complement(67821..68105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0065"
FT                   /product="conserved hypothetical protein,
FT                   transposon-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10014"
FT                   /protein_id="ACY10014.1"
FT                   /translation="MAEFTPYFYDFKRLDYRNFVILRFHGVSKRHICKMYKIAYFCILD
FT                   VCNKAKNNDYQFTYKDYVFLKRYGVSNTFICKMYHIDKLDLEFFEVMNR"
FT   gene            68265..68648
FT                   /locus_tag="SAAV_0066"
FT   CDS_pept        68265..68648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0066"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10015"
FT                   /protein_id="ACY10015.1"
FT                   /translation="MIDNKIIPTKDIKDEKIKKEIENFKFFAQYGNFKDLTKYKGGDIS
FT                   YNPEAPIYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGSGNLDGSSIGYKKIEFT
FT                   FVEKKGENTYFTANLHFKPSNDE"
FT   gene            68737..69483
FT                   /locus_tag="SAAV_0067"
FT   CDS_pept        68737..69483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10016"
FT                   /protein_id="ACY10016.1"
FT                   /translation="MLGISFLFLVISITAGCGMGKEAEIKKSFEKTMSMYPIKNLEDLY
FT                   DKEGYRDDQFDKNDKGTWIVNSQMAIQNKGEPMKSKGMVLYMNRNTRTTNGYYYVNVIK
FT                   GEDKGKHQDNEKRYPVKMVDNKIILTKEIKDENIKIEIENFKFFVQYGNFKDLENYKDG
FT                   DISYNPEVPSYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDI
FT                   EFTFVEKKEENIYFSDGLIFKPSEDK"
FT   gene            69550..70317
FT                   /locus_tag="SAAV_0068"
FT   CDS_pept        69550..70317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0068"
FT                   /product="staphylococcal tandem lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10017"
FT                   /protein_id="ACY10017.1"
FT                   /translation="MKRLNKLVLYISFLILVISFTAGCGMGKEAEIKKSFEKTLSMYPI
FT                   KNLEDLYDKEGYRDDQFDKNDKGTWIINSEMVVQPKGERMKSKGMVLYMNRNTKTTTGK
FT                   YIVSETLHDEDGRPKSKDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKD
FT                   LSKYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGS
FT                   SVGYKDIEFTFVEKKGENTFFTDSLHLEPSEDK"
FT   gene            70453..72651
FT                   /locus_tag="SAAV_0069"
FT   CDS_pept        70453..72651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0069"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10018"
FT                   /protein_id="ACY10018.1"
FT                   /translation="MPDFKRLNGLMIGFVIKGEAHIYDENNMTQCNSGDIFIINHRDLY
FT                   RFQLQQDGIICYIQFQMKYLADKFDDAHCLYFHLTDATTTKNIHQLRNIMARLVSTHIR
FT                   HNELSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDYIELHFHEDLSLSE
FT                   LSEYVGWSESHLSKKFTESLGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQNGFSSA
FT                   ASFARTFKHFTHQTPKQYRGDRPAITENQQSAQHNYHDRELILLLNDYIEEMNHFIEDI
FT                   EKMNYKEIAFKPTNQQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHHDFQVNEVLAYDVM
FT                   PYIMKKLNAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLNQYDSRDYIDAFKVFIH
FT                   HVALHVSHRKDLKFNLYVTTLHTSLIEMIDYFKALFPNGGLYIHLDQATERHLPLLKRL
FT                   EPHINHFVFDANSNDAVDFNKMNDDEFKTASQMIINKTNYLIDLMHRHNLKRPLILLNW
FT                   NTLTGDTFITNGEYFRGGIIIEQLLKLSTKVEGIGYWLNYDLHVSHCRNERDYMNSIEL
FT                   FHQYNGKRPVYFTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYDAKHFNPYLALDNQ
FT                   MNMRATEMIHLNINALEDGMYKIKHFTLDKENGALFNLWRKHHTIHGMDKDSIDYVNRM
FT                   SFPKLEVYDIDITDTLALNIKMITNGIHLIEVKRYPSS"
FT   gene            72802..73980
FT                   /locus_tag="SAAV_0070"
FT   CDS_pept        72802..73980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0070"
FT                   /product="M20/M25/M40 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10019"
FT                   /protein_id="ACY10019.1"
FT                   /translation="MNQQLIEALKSKEDKMIEIRRYLHQHPELSFHEDETAKYIAEFYK
FT                   GKDVEVETNVGPRGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACG
FT                   HDAHTAYMLVLAETLAEMKDSFTGKVVVIHQPAEEVPPGGAKAMIENGVLDGVDHVLGV
FT                   HVMSTMKTGNVYYRPGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTV
FT                   VSRRLSPFETGVVTIGSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIEKEIKRLSKGL
FT                   EDMYGVTCTLEYNDDYPALYNDPEFTEYVAKTLKEANLDFGVEMCEPQPPSEDFAYYAK
FT                   ERPSAFIYTGAAVEDGEIYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN"
FT   gene            73982..75370
FT                   /locus_tag="SAAV_0071"
FT   CDS_pept        73982..75370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0071"
FT                   /product="drug transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10020"
FT                   /protein_id="ACY10020.1"
FT                   /translation="MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGADMG
FT                   TISIAVSLTALFSGMFVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILG
FT                   RVIQGVSAACIMPSTLAIMKTYYQGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGW
FT                   RWIFIFSIIVAVLSMLLIKGTPETKSEITNTHKFDVAGLIVLVVMLLSLNVVITKGAAL
FT                   GYTSLWFFGLIAIVIVAFFIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGT
FT                   LIVANTFVQQGLGYTALQAGYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVI
FT                   GIALISLVFLPGIFYVISCVVGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKM
FT                   ASSLGGAFGVAISGAVYVGAVAATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRV
FT                   KDAK"
FT   gene            complement(75854..77515)
FT                   /locus_tag="SAAV_0072"
FT   CDS_pept        complement(75854..77515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0072"
FT                   /product="Na/Pi cotransporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10021"
FT                   /protein_id="ACY10021.1"
FT                   /translation="MSVTEVIFSFLGGLGIFLYGLKIMGDGLQASAGDRLRDILNKFTS
FT                   NPVLGVIAGIVVTILIQSSSGTTVITIGLVTAGFMTLKQAIGVIMGANIGTTVTAFIIG
FT                   IDLGEYAMPILALGAFLIFFFKRSKINNIGRILFGFGSLFFGLEFMGDAVKPLASLDGF
FT                   KQLMLDMSSNPILAVIVGAGLTALVQSSSATIGILQEFYQQDLISLNAAIPVLLGDNIG
FT                   TTITAILASLAGSIAAKRAALVHVIFNLIGVIIFTIFLPVVIHLISLLQDVWHLKPAMT
FT                   IAVSHGIFNITNTLIQLPFVAGLAWIVTKLVPGKDIADDYKPQHLNKDLVYHAPGVALQ
FT                   ETQKELQNVGQIVLSMFEDIREITKDDKKLIKKLEQKHQAVETINDSIRNYLVRISTKA
FT                   ITKADVERLAVMFDVNRSILKVAELTEEYVAQLKRQHDEDIRITEDAQRGMDKLFNHVA
FT                   ESFDKAIDMLDVYDKTKKDEIVERSRESFNIEHKLRKGHIKRLNRGECTTKGGLLYIDM
FT                   IGVLERIGYHSRNVSEALVGLNDDVPTDEEIATTEI"
FT   gene            complement(77840..79615)
FT                   /locus_tag="SAAV_0073"
FT   CDS_pept        complement(77840..79615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0073"
FT                   /product="myosin-cross-reactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10022"
FT                   /protein_id="ACY10022.1"
FT                   /translation="MYYSYGNYEAFARPKKPENVENKSAYLIGSGLASLAAACFLIRDG
FT                   QMEGSKIHILEELPKAGGSLDGENMPLKGYVVRGGREMENHFECLWDLFRSIPSLEIDN
FT                   ASVLDEFYWLNKEDPNYSRCRVIEKQGQRLVTDGDFTLTKTAIKEILDLCLTNEEDLDD
FT                   VKITDVFSDDFFNSNFWIYWKTMFAFEPWHSAMEMRRYLMRFVHHIGGLADFSALKFTK
FT                   YNQYESLVLPMVEYLKSHGVQFEYDVKVEDIKVDVTTSQKIAREILIHRHGKAESIKLT
FT                   VDDLVFVTNGSITESSTYGDNDTPAPPTDELGGSWTLWKNLARQSPEFGNPDKFCQNIP
FT                   KKSWFVSATSTTNNKEIIDTIESICKRDPLAGKTVTGGIITINDSAWQMSFTINRQQQF
FT                   KDQPENEISTWIYALYSDVNGDYIKKPITECSGNEICQEWLYHLGVSTDKIEDLAKHVS
FT                   NTIPVYMPYITSYFMTRAIGDRPLVVPHQSQNLSFIGNFAETERDTVFTTEYSVRTAME
FT                   AVYQLLNIDRGIPEVINSTFDLRVLMDAVYELNDHQDLREITKDSKMQKLALAGFLKKI
FT                   KGTYIETLLKEHKLL"
FT   gene            complement(79789..80661)
FT                   /locus_tag="SAAV_0074"
FT   CDS_pept        complement(79789..80661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0074"
FT                   /product="integral membrane domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10023"
FT                   /protein_id="ACY10023.1"
FT                   /translation="MNKLRDTTFLSYLFTIILWGSAFPMIKIALNDFSAESLSAFRLIL
FT                   ATIILLPFVIIKKLPTPELRDIPVIFILGFCGFVIYHTALNFGETLISAGISGILVSTT
FT                   PIFSSALAYIFLKEHFSKWNWLSSLVAFIGISIISISKDDYTTINVLGVFIILLASFSE
FT                   SLYFTFQKKYIEKYGFIAFTLYTIMASSPFMLIFIPEIINDIHGATFTSIVSVLYLAIF
FT                   PTIIPYVLLAYIVKSVGVSDATMSLYLTPIVSLLLSYLLLDELPTTLAIIGGIITLLGV
FT                   SLSNFFQNT"
FT   gene            80843..82171
FT                   /locus_tag="SAAV_0075"
FT   CDS_pept        80843..82171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0075"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10024"
FT                   /protein_id="ACY10024.1"
FT                   /translation="MKIPPQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKVGSGTYVND
FT                   YLNEAHITNKWSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLMPHIQLKK
FT                   AMSNTASHIEDLSFGYNNGYGYIKLRDIIVERMSKQGINVGRENVMITSGALHAIQLLS
FT                   IGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYNQINEINTIIDRFINFKNKAIYI
FT                   EPRFNNPTGRSLTNEQKKNIITYSERHNIPIIEDDIFRDIFFSDPTPAIKTYDKLGKVI
FT                   HISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYEMLKNKSYDKH
FT                   LVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLSKE
FT                   KILINPGYIYGSKEKSIRLSFAFESNENIKHALYKIYTYVKKV"
FT   gene            82361..82834
FT                   /locus_tag="SAAV_0076"
FT   CDS_pept        82361..82834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10025"
FT                   /protein_id="ACY10025.1"
FT                   /translation="MSKIRSFTILSLLIYLAMMCYTVVTYSKLPTKVPIHYNLAGDADN
FT                   FADKWVLLLINSAFIVIWLIFFIAGRYYERFAKWSHYNHTPREIRAIKLFLSTLNLEIM
FT                   SYMSIFTVLEIWQIQHHHQLNLLWFNMIFIIIIGLTLVIFCLLPTIHKMRDSQ"
FT   gene            83096..84688
FT                   /locus_tag="SAAV_0077"
FT   CDS_pept        83096..84688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0077"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10026"
FT                   /protein_id="ACY10026.1"
FT                   /translation="MTLLTVNPFDNVGLSALVAAVPIILFLLCLTVFKMKGIYAALTTL
FT                   VVTLIVALFVFELPARVSAGAITEGVVAGIFPIGYIVLMAVWLYKVSIKTGQFSIIQDS
FT                   IASISEDQRIQLLLIGFCFNAFLEGAAGFGVPIAICAVLLIQLGFEPLKAAMLCLIANG
FT                   AAGAFGAIGLPVSIIDTFNLSGGVTTLDVARYSALTLPILNFIIPFVLVFIVDDMKGIK
FT                   EILPVILTVSGTYTGLQLLLTIFHGPELADIIPSLATMVVLAFVCRKFKPKNIFRLEAS
FT                   EHKIQKRTPKEIVFAWSPFVILTAFVLVWSAPFFKKLFQPGGALESLVIKLPIPNTVSD
FT                   LSPKGIALRLDLIGATGTAILLTVIITILITKLKWKSAGALLVEAIKELWLPILTISAI
FT                   LAIAKVMTYGGLTVAIGQGIAKAGAIFPLFSPVLGWIGVFMTGSVVNNNTLFAPIQATV
FT                   AQQISTSGSLLVAANTAGGVAAKLISPQSIAIATAAVKKVGEESALLKMTLKYSIIFVA
FT                   FICVWTFILTLIF"
FT   gene            complement(85017..86387)
FT                   /pseudo
FT                   /gene="spa"
FT                   /locus_tag="SAAV_0078"
FT                   /note="immunoglobulin G-binding protein A"
FT   gene            complement(86964..87716)
FT                   /gene="sarS"
FT                   /locus_tag="SAAV_0080"
FT   CDS_pept        complement(86964..87716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sarS"
FT                   /locus_tag="SAAV_0080"
FT                   /product="staphylococcal accessory regulator S"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10027"
FT                   /protein_id="ACY10027.1"
FT                   /translation="MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFH
FT                   QQENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKI
FT                   AERVTLFDQIIKQFNLADQSESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTI
FT                   LAIITSQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDD
FT                   AQQDHAEQLLAQVNQLLADKDHLHLVFE"
FT   gene            complement(88085..89083)
FT                   /gene="sirC"
FT                   /locus_tag="SAAV_0081"
FT   CDS_pept        complement(88085..89083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirC"
FT                   /locus_tag="SAAV_0081"
FT                   /product="iron compound ABC transporter, permease protein
FT                   SirC"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10028"
FT                   /protein_id="ACY10028.1"
FT                   /translation="MTEKINKKDNYHLIFALIFLAIVSVVSMMIGSSFIPLQRVLMYFI
FT                   NPNDSMDQFTLEVLRLPRITLAILAGAALGMSGLMLQNVLKNPIASPDIIGITGGVSLS
FT                   AVVFIAFFSHLTIHLLPLFAVLGGAVAMMILLVFQTKGQIRPTILIIIGISMQTLFIAL
FT                   VQGLLITTKQLSAAKAYTWLVGSLYGATFKDTIILGMVILAVVPLLFLVIPKMKISILD
FT                   DPVAIGLGLHVQRMKLIQLITSTILVSMAISLVGNIGFVGLIAPHIAKTIVRGSYAKKL
FT                   LMSAMIGAISIVIADLIGRTLFLPKEVPAGVFIAAFGAPFFIYLLLTVKKL"
FT   gene            complement(89080..90075)
FT                   /gene="sirB"
FT                   /locus_tag="SAAV_0082"
FT   CDS_pept        complement(89080..90075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirB"
FT                   /locus_tag="SAAV_0082"
FT                   /product="iron compound ABC transporter, permease protein
FT                   SirB"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10029"
FT                   /protein_id="ACY10029.1"
FT                   /translation="MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDS
FT                   ENDLHDVVTGARASRTIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIF
FT                   SITFIQIQSFKMIVVIAFLGAIVVTILVVALGMFRQTLFSPHRVILAGAAIAMLFTAFT
FT                   QGILIMNETDLQGLLFWLSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDD
FT                   IATGLGQNIKLIKWMIIMLISMLAGISVAVAGSIVFVGLIVPNISKRLLPPNYKYLIPF
FT                   TALAGAILMIISDIVARIIIKPLELPIGVVTAVIGAIVLIYIMKKGRQRL"
FT   gene            complement(90091..91083)
FT                   /gene="sirA"
FT                   /locus_tag="SAAV_0083"
FT   CDS_pept        complement(90091..91083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="SAAV_0083"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein SirA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10030"
FT                   /protein_id="ACY10030.1"
FT                   /translation="MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMG
FT                   TTEIKGKPKRVVTLYQGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEP
FT                   APNLEEISKLKPDLIVASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEK
FT                   EAEDLLKKYDDKVAAFQKDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGF
FT                   KRNKDLQKQVDNGKDIIQLTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSK
FT                   EWKNLDAVKNNQVSDDLDEITWNLAGGYKSSLKLIDDLYEKLNIEKQSK"
FT   gene            91449..92294
FT                   /locus_tag="SAAV_0084"
FT   CDS_pept        91449..92294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0084"
FT                   /product="cysteine synthase/cystathionine beta-synthase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10031"
FT                   /db_xref="GOA:D0K799"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR023927"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0K799"
FT                   /protein_id="ACY10031.1"
FT                   /translation="MKDRPAKYIIEHGIKHGLITENTHLIESTSGNLGIALAMIAKIKG
FT                   LKLTCVVDPKISPTNLKIIKSYGANVEMVEEPDAHGGYLMTRIAKVQELLATIDDAYWI
FT                   NQYANELNWQSHYHGAGTEIVETIKQPIDYFVAPVSTTGSIMGMSRKIKEVHPNAQIVA
FT                   VDAKGSVIFGDKPINRELPGIGASRVPEILNRSEINQVIHVDDYQSALGCRKLIDYEGI
FT                   FAGGSTGSIIAAIEQLITSIEEGATIVTILPDRGDRYLDLVYSDTWLEKMKSRQGVKSE
FT                   "
FT   gene            92303..93301
FT                   /locus_tag="SAAV_0085"
FT   CDS_pept        92303..93301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0085"
FT                   /product="ornithine cyclodeaminase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10032"
FT                   /protein_id="ACY10032.1"
FT                   /translation="MLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLR
FT                   QDPENGHIADRIIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNY
FT                   PIAVMEASLISSMRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIKR
FT                   VFVYDQFSEACARFVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWL
FT                   QKGAFISNISIMDVHKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELG
FT                   QLVTGDIPGREDDDEIILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY"
FT   gene            93322..95076
FT                   /locus_tag="SAAV_0086"
FT   CDS_pept        93322..95076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0086"
FT                   /product="IucC family siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10033"
FT                   /protein_id="ACY10033.1"
FT                   /translation="MQNHTAVNTAQAIILRDLVDALLFEDIAGIVSNSEITKENGQTLL
FT                   IYERETQQIKIPVYFSALNMFRYESSQPITIEGRVSKQPLTAAEFWQTIANMNCDLSHE
FT                   WEVARVEEGLTTAATQLAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLREAD
FT                   YQVYQAELNQSFPLMVAAVKKTHMIHGDTANIDELENLTVPIKEQATDMLNDQGLSIDD
FT                   YVLFPVHPWQYQHILPNVFATEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKV
FT                   PFAMQSLGALRLTPTRYMKNGEQAEQLLRQLIEKDEALAKYVMVCDETAWWSYMGQDND
FT                   IFKDQLGHLTVQLRKYPEVLAKNDTQQLVSMAALAANDRTLYQMICGKDNISKNDVMTL
FT                   FEDIAQVFLKVTLSFMQYGALPELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAH
FT                   QLSLPKYVVREDTPNTLINEDLETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSL
FT                   LKQILKNEVATISWVTTDQLAVRHILFDKQTWPFKQILLPLLYQRDSGGGSMPSGLTTV
FT                   PNPMVTYD"
FT   gene            95069..96325
FT                   /locus_tag="SAAV_0087"
FT   CDS_pept        95069..96325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0087"
FT                   /product="drug transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10034"
FT                   /protein_id="ACY10034.1"
FT                   /translation="MINQSIWRSNFRILWLSQFIAIAGLTVLVPLLPIYMASLQNLSVV
FT                   EIQLWSGIAIAAPAVTTMIASPIWGKLGDKISRKWMVLRALLGLAVCLFLMALCTTPLQ
FT                   FVLVRLLQGLFGGVVDASSAFASAEAPAEDRGKVLGRLQSSVSAGSLVGPLIGGVTASI
FT                   LGFSALLMSIAVITFIVCIFGALKLIETTHMPKSQTPNINKGIRRSFQCLLCTQQTCRF
FT                   IIVGVLANFAMYGMLTALSPLASSVNHTAIDDRSVIGFLQSAFWTASILSAPLWGRFND
FT                   KSYVKSVYIFATIACGCSAILQGLATNIEFLMAARILQGLTYSALIQSVMFVVVNACHQ
FT                   QLKGTFVGTTNSMLVVGQIIGSLSGAAITSYTTPATTFIVMGVVFAVSSLFLICSTITN
FT                   QINDHTLMKLWELKQKSAK"
FT   gene            96315..98051
FT                   /locus_tag="SAAV_0088"
FT   CDS_pept        96315..98051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0088"
FT                   /product="IucA family siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10035"
FT                   /protein_id="ACY10035.1"
FT                   /translation="MQNKELIQHAAYAAIERILNEYFREENLYQVPPQNHQWSIQLSEL
FT                   ETLTGEFRYWSAMGHHMYHPEVWLIDGKSKKITTYKEAIARILQHMAQSADNQTAVQQH
FT                   MAQIMSDIDNSIHRTARYLQSNTIDYVEDRYIVSEQSLYLGHPFHPTPKSASGFSEADL
FT                   EKYAPECHTSFQLHYLAVHQDVLLTRYVEGKEDQVEKVLYQLADIDISEIPKDFILLPT
FT                   HPYQINVLRQHPQYMQYSEQGLIKDLGVSGDLVYPTSSVRTVFSKALNIYLKLPIHVKI
FT                   TNFIRTNDLEQIERTIDAAQVIASVKDEVETPHFKLMFEEGYRALLPNPLGQTVEPEMD
FT                   LLTNSAMIVREGIPNYHADKDIHVLASLFETMPDSPISKLAQVIEQSGLAPEAWLECYL
FT                   DRTLLPILKLFSNTGISLEAHVQNTLIELKDGIPDVCFVRDLEGICLSRTIATEKQLVP
FT                   NVVAASSPVVYAHDEAWHRLKYYVVVNHLGHLVSTIGKATRNEVVLWQLVAHRLMTWKK
FT                   EYANNAVFVDCVEDLYQTPTIAAKANLMSKLNDCGANPIYTHIPNPICYNKEVSYCESN
FT                   NS"
FT   gene            97960..99810
FT                   /locus_tag="SAAV_0089"
FT   CDS_pept        97960..99810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0089"
FT                   /product="IucC family siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10036"
FT                   /protein_id="ACY10036.1"
FT                   /translation="MIVVQTLFIHIYQIQFVITRRYRIVNQTILNRVKTRVMHQLVSSL
FT                   IYENIVVYKASYQDGVGHFTIEGHDSEYRFTAEKTHSFDRIRITSPIERVVGDEADTTT
FT                   DYTQLLREAVFTFPKNDEKLEQFIVELLQTELKDTQSMQYRESNPPATPETFNDYEFYA
FT                   MEGHQYHPSYKSRLGFTLSDNLKFGPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLR
FT                   QQVGDKTYEHFVQQIEASGKHVNDVEMIPVHPWQFEHVIQVDLAEERLNGTVLWLGESD
FT                   ELYHPQQSIRTMSPIDTTKYYLKVPISITNTSTKRVLAPHTIENAAQITDWLKQIQQQD
FT                   MYLKDELKTVFLGEVLGQSYLNTQLSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFN
FT                   ALYASDKDGLPFIEKWIKQYGSEAWTKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIH
FT                   ENGWPTRIALKDFHDGVRFKREHLSEAASHLTLKPMPEAHKKVNSNSFIETDDERLVRD
FT                   FLHDAFFFINIAEIILFIEKQYGIDEQRQWQWVKDIIEAYQEAFPELNNYQHFDLFEPT
FT                   IQVEKLTTRRLLSDSELRIHHVTNPLGVGGINDATTISET"
FT   gene            99785..100561
FT                   /locus_tag="SAAV_0090"
FT   CDS_pept        99785..100561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0090"
FT                   /product="HPCH/HPAI aldolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10037"
FT                   /protein_id="ACY10037.1"
FT                   /translation="MQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTE
FT                   HVAINDETLAHLIRAAEAAHIIPIVRVTAVIDRDIIKVLDMGARGIIVPHVKDRETVEH
FT                   IVKLSRYYLQGLRSLNGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAIDDIAQ
FT                   VEGLDMIVEGAADLSQSLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAK
FT                   WQAQGVQTFILGDDRGKIYRHLSASLATSKQKGDDG"
FT   gene            100561..101763
FT                   /locus_tag="SAAV_0091"
FT   CDS_pept        100561..101763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0091"
FT                   /product="pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10038"
FT                   /protein_id="ACY10038.1"
FT                   /translation="MRIVQPVIEQLKAQSHPVCHYIYDLVGLEHHLQHITSSLPSNCQM
FT                   YYAMKANSERTILDTISQYVEGFEVASQGEIAKGLAFKPANHIIFGGPGKTDEELRYAV
FT                   SEGVQRIHVESMHELQRLNAILEDEDKTQHILLRVNLAGPFPNATLHMAGRPTQFGISE
FT                   DEVDDVIEAALVMPNIHLDGFHFHSISNNLDSNLHVDVVKLYFKKAKSWSEKHRFPLKH
FT                   INLGGGIGVNYADLTSQFEWDNFVENFKTLIVEQEMEDVTLNFECGRFIVAHIGYYVTE
FT                   VLDIKKVHGAWYAILRGGTQQFRLPVSWQHNHPFEIYRYKDNPYSFEKVSISRQDTTLV
FT                   GQLCTPKDVFAREVQIDAISTGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYLTQTKED
FT                   E"
FT   gene            101767..102531
FT                   /locus_tag="SAAV_0092"
FT   CDS_pept        101767..102531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10039"
FT                   /protein_id="ACY10039.1"
FT                   /translation="MNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPIL
FT                   VTAMQHGRYMVIDGVHRYTSLKALGCKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQ
FT                   EHRLPWTTETRQEAPFITMCHGDTEQYLYTKDLGEAHFQVWEKVVASYSGCCSVERIAQ
FT                   GTYPCLSQQDVLMKYQPLSYKEIEAVVHKGETVPAGVTRFNISGRCLNLQVPLALLKQD
FT                   DDVEQLRNWKQFLADKFANMRCYTEKVYLVEQ"
FT   gene            102727..103353
FT                   /locus_tag="SAAV_0093"
FT   CDS_pept        102727..103353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10040"
FT                   /protein_id="ACY10040.1"
FT                   /translation="MEKNVEKSFIKIGLYFQIAYIVLMAITLCGFVICYGLIFGLFYLL
FT                   SGSRADYLIVTIVISAIISIFVIILSIVPVIVLASDLFKERISKGVILIVLAIIALVLC
FT                   NFVSAILWFVSAISILGRKKLVAAADTTTIQKSKGNANQASHKDTCKKELDSQDMMEHP
FT                   EVKNPTTKNLEGFNEEIHKDEATTKVVSDNTEPPIESKGHVSKKD"
FT   gene            103565..104341
FT                   /locus_tag="SAAV_0094"
FT   CDS_pept        103565..104341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0094"
FT                   /product="acetoin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10041"
FT                   /protein_id="ACY10041.1"
FT                   /translation="MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAVVDFNEEGAKAAA
FT                   LKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQ
FT                   FKTVYGVNVAGVLWGIQAAHEQFKKFNHGGKIINATSQAGVEGNPGLSLYCSTKFAVRG
FT                   LTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGKPEAWGWEQFTSQIALGR
FT                   VSQPEDVSNVVSFLAGKDSDYITGQTIIVDGGMRFR"
FT   gene            104485..104607
FT                   /locus_tag="SAAV_0095"
FT   CDS_pept        104485..104607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10042"
FT                   /protein_id="ACY10042.1"
FT                   /translation="MHQLKALLVLTHPRYYKTSQKHHYLIYLNKNSQSYLILFL"
FT   gene            104686..105657
FT                   /locus_tag="SAAV_0096"
FT   CDS_pept        104686..105657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0096"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10043"
FT                   /protein_id="ACY10043.1"
FT                   /translation="MERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLA
FT                   DDHVFELDIREYDAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLE
FT                   IIKKYNSHIKRFIFASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLY
FT                   NIPTAVVKFFNVFGPRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVV
FT                   QSVRLIMEHKDAIGHGYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYA
FT                   DISNLKALGFVPKYTVETGLKDYFNFEVDNIEEVTAKEVEMS"
FT   gene            105620..106312
FT                   /locus_tag="SAAV_0097"
FT   CDS_pept        105620..106312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0097"
FT                   /product="sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10044"
FT                   /protein_id="ACY10044.1"
FT                   /translation="MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDALEEVRKGYYPIK
FT                   RAIDLVLSIVLLFLTFPIMFIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKN
FT                   AEKNGAQWADKDDDRITNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFS
FT                   SEVIGFEQRCLVTPGLTGLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMV
FT                   VITGEGSR"
FT   gene            106522..107688
FT                   /locus_tag="SAAV_0098"
FT   CDS_pept        106522..107688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0098"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10045"
FT                   /protein_id="ACY10045.1"
FT                   /translation="MKIIYCITKADNGGAQTHLIQLANHFCVHHDVYVIVGNHGPMIEQ
FT                   LDARVNVIILEHLVGPIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFIS
FT                   KSKDTRVVFTAHGWAFTEGVKPAKKFLYLVIEKLMSCITDSIICVSDFDKQLALKYRFN
FT                   RLKLTTIHNGIADVPAVKQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFA
FT                   YPKLPQNLIAAIEILKLHNSNHAHFTFIGDGPTLNDCQQQVVQAGLENDVTFLGNVINA
FT                   SHLLSQYDTFILISKHEGLPISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPET
FT                   IAKVLEKYLIDSDYIKMSNQSRKRYLECFTEEKMIKEVEDVYNGKSTQ"
FT   gene            107669..108907
FT                   /locus_tag="SAAV_0099"
FT   CDS_pept        107669..108907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10046"
FT                   /protein_id="ACY10046.1"
FT                   /translation="MENQHNSKLLTLLLIGLAVFIQQSSVIAGVNVSIADFITLLILVY
FT                   LLFFANHLLKANHFLQFFIILYTYRMIITLCLLFFDDLIFITVKEVLASTVKYAFVVIY
FT                   FYLGMIIFKLGNSKKVIVTSYIISSVTIGLFCIIAGLNKSPLLMKLLYFDEIRSKGLMN
FT                   DPNYFAMTQIITLVLAYKYIHNYIFKVLACGILLWSLTTTGSKTAFIILIVLAIYFFIK
FT                   KLFSRNAVSVVSMLVIMLILLCFTFYNINYYLFQLSDLDAVPSLDRMASIFEEGFASLN
FT                   DSGSERSVVWINAILVIKYTLGFGVGLVDYVHIGSQINGILLVAHNTYLQIFAEWGILF
FT                   GALFIIFMLYLLFELFRFNISGKNVTAIVVMLTMLIYFLTVSFNNSRYVAFILGIIVFI
FT                   VQYEKMERDRNEE"
FT   gene            108897..110327
FT                   /locus_tag="SAAV_0100"
FT   CDS_pept        108897..110327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0100"
FT                   /product="polysaccharide extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10047"
FT                   /protein_id="ACY10047.1"
FT                   /translation="MKSDSLKENIIYQGLYQLIRTMTPLITIPIISRAFGPSGVGIVSF
FT                   SFNIVQYFLMIASVGVQLYFNRVIAKSVNDKRQLSQQFWDIFVSKLFLALTVFAMYMVV
FT                   ITIFIDDYYLIFLLQGIYIIGAALDISWFYAGTEKFKIPSLSNIVASGIVLSVVVIFVK
FT                   DQSDLSLYVFTIAIVTVLNQLPLFIYLKRYISFVSVNWIHVWQLFRSSLAYLLPNGQLN
FT                   LYTSISCVVLGLVGTYQQVGIFSNAFNILTVAIIMINTFDLVMIPRITKMSIQQSHSLT
FT                   KTLANNMNIQLILTIPMVFGLIAIMPSFYLWFFGEEFASTVPLMTILAILVLIIPLNML
FT                   ISRQYLLIVNKIRLYNASITIGAVMNLVLCLVLIYFYGIYGAAIARLITEFILLIWRFV
FT                   DITKINVKLNIVSTIQCVIAAVMMFIVLGVVNHYLPPTMYATLLLIAIGIVVYLLLMMT
FT                   MKNQYVWQILRHLRHKTI"
FT   gene            110595..111194
FT                   /gene="sodA1"
FT                   /locus_tag="SAAV_0101"
FT   CDS_pept        110595..111194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA1"
FT                   /locus_tag="SAAV_0101"
FT                   /product="superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10048"
FT                   /protein_id="ACY10048.1"
FT                   /translation="MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEG
FT                   TELEHQSLADMIANLDKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKA
FT                   QWGTLDEFKNEFANKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVW
FT                   EHAYYLKYQNKRPDYMTAFWNIVNWKKVDELYQAAK"
FT   gene            111562..112287
FT                   /locus_tag="SAAV_0102"
FT   CDS_pept        111562..112287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0102"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10049"
FT                   /protein_id="ACY10049.1"
FT                   /translation="MKKLATVGFLIVTSTLVFSSMPFQNAHADTTSMNVPNKQSQNVQN
FT                   HRPYGGVVPQGMTQAQYTELEKTLPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNV
FT                   GVFKPHAVRDMNGHALPLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQDHMNQNT
FT                   HMNQQPQIQQGHMQSSNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIA
FT                   ALLLVSGLFLAFRRRSTNK"
FT   gene            complement(112478..113233)
FT                   /locus_tag="SAAV_0103"
FT   CDS_pept        complement(112478..113233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0103"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10050"
FT                   /protein_id="ACY10050.1"
FT                   /translation="MEVVYVTQTQPKFLTIYNTLYKEIQIGKYPSGHALPTEKELCARF
FT                   DVSRMTLRQAIKLLAEDGIVESTRGKGHFVIPQTNAQHASSMDQFKHPLDQILLARVSM
FT                   SSINYRVDLESEYTNHLFANHPSAVIAMERYYQKKDNHSKQADAFCFTFIPLNVIDTFK
FT                   VNTQNEDDMKTFVEQTIYSNAYQSDLKMSITKAPHFKNHSHVFDGDTHCWLIIETLYAQ
FT                   TPYPIMINKWYIPQEISELTLTRIRQSDY"
FT   gene            113469..114176
FT                   /gene="deoD1"
FT                   /locus_tag="SAAV_0104"
FT   CDS_pept        113469..114176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD1"
FT                   /locus_tag="SAAV_0104"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10051"
FT                   /protein_id="ACY10051.1"
FT                   /translation="MKSTPHIKPMNDVEIAETVLLPGDPLRAKFIAETYLDDVEQFNTV
FT                   RNMFGFTGTYKGKKVSVMGSGMGMPSIGIYSYELIHTFGCKKLIRVGSCGAMQENIDLY
FT                   DVIIAQGASTDSNYVQQYQLPGHFAPIASYQLLEKAVETARDKGVRHHVGNVLSSDIFY
FT                   NADTTASERWMRMGILGVEMESAALYMNAIYAGVEALGVFTVSDHLIHETSTTPEERER
FT                   AFTDMIEIALSLV"
FT   gene            114183..115535
FT                   /locus_tag="SAAV_0105"
FT   CDS_pept        114183..115535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0105"
FT                   /product="tetracycline resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10052"
FT                   /protein_id="ACY10052.1"
FT                   /translation="MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVT
FT                   TVSWQATLAGLVIGIGAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFPLLLV
FT                   GRIIQTAGLAAAETLYVIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLH
FT                   WTNMFLIALIVVFTLPFLFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLY
FT                   MIGALIAIIVFALYIKNAQRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIME
FT                   QIYHLQLDTTSLLLVPGYIVAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAV
FT                   GNHISIFVISMIFFAGSFALMYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAI
FT                   AAALIDFKALNFPGNDALSSHFGIILIILGLMSIVGLVLFVILNRWTQSEK"
FT   gene            115616..116278
FT                   /gene="deoC1"
FT                   /locus_tag="SAAV_0106"
FT   CDS_pept        115616..116278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC1"
FT                   /locus_tag="SAAV_0106"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10053"
FT                   /protein_id="ACY10053.1"
FT                   /translation="MKFEKYIDHTLLKPESTRTQIDQIIDEAKAYHFKSVCVNPTHVKY
FT                   AAERLADSEVLVCTVIGFPLGASTTATKAFETEDAIQNGADEIDMVINIGALKDGRFDD
FT                   VQQDIEAVVKAAKGHTVKVIIETVLLDHDEIVKASELTKVAGADFVKTSTGFAGGGATA
FT                   EDVKLMKDTVGADVEVKASGGVRNLEDFNKMVEAGATRIGASAGVQIMQGLEADSDY"
FT   gene            116306..117484
FT                   /gene="deoB"
FT                   /locus_tag="SAAV_0107"
FT   CDS_pept        116306..117484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="SAAV_0107"
FT                   /product="phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10054"
FT                   /protein_id="ACY10054.1"
FT                   /translation="MTRPFNRVHLIVMDSVGIGEAPDAADFKDEGSHTLRHTLEGFDQT
FT                   LPNLEKLGLGNIDKLPVVNAVEQPEAYYTKLSEASVGKDTMTGHWEIMGLNIMQPFKVY
FT                   PNGFPEELIQQIEEMTGRKVVANKPASGTQIIDEWGEHQMKTGDLIVYTSADPVLQIAA
FT                   HEDIIPLEELYDICEKVRELTKDPKYLIGRIIARPYVGEPGNFTRTSNRHDYALKPFGK
FT                   TVLDHLKDGGYDVIAIGKINDIYDGEGVTEAVRTKSNMDGMDQLMKIVKKDFTGISFLN
FT                   LVDFDALYGHRRDKPGYAQAIKDFDDRLPELFSNLKEDDLVIITADHGNDPTAPGTDHT
FT                   REYIPVIMYSPKFKGGHALESDTTFSSIGATIADNFNVTLPEFGKSYLKELK"
FT   gene            complement(117613..118428)
FT                   /locus_tag="SAAV_0108"
FT   CDS_pept        complement(117613..118428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0108"
FT                   /product="phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10055"
FT                   /protein_id="ACY10055.1"
FT                   /translation="MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLEL
FT                   KSKSLEILKSIFSGLFHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFL
FT                   GANNMVKLRPVSGVSKFILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGK
FT                   LLAEDIEGLDFSAVESLKASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILG
FT                   LIGAGGIGTPLIFAIQTRSWDRVGIILIGLVLMVAIVDLISGSIRKRIV"
FT   gene            complement(118425..119225)
FT                   /locus_tag="SAAV_0109"
FT   CDS_pept        complement(118425..119225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0109"
FT                   /product="phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10056"
FT                   /protein_id="ACY10056.1"
FT                   /translation="MPLEIPTKYDSLLKKKVSLKTSFTFMLIIVLIIWSFIYTGFNFGD
FT                   LMIGIPQIGDLFKQMIPPDFEYLQQITTPMLDTIRMAIVSTVLGSIVSIPIALLCASNI
FT                   VHQKWISIPSRFILNIVRTIPDLLLAAIFVAVFGIGQIPGILALFILTICIIGKLLYES
FT                   LETIDPGPMEAMTAVGANKIKWIVFGVVPQAISSFMSYVLYAFEVNIRASAVLGLVGAG
FT                   GIGLFYDQTLGLFQYPKTATIILFTLVIVVVIDYISTKVRAHLA"
FT   gene            complement(119227..120000)
FT                   /locus_tag="SAAV_0110"
FT   CDS_pept        complement(119227..120000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0110"
FT                   /product="phosphonate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10057"
FT                   /protein_id="ACY10057.1"
FT                   /translation="MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKST
FT                   LLRSVNRLHDITSGEIFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLS
FT                   GRVGYHPTWKMVLGLFPKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALC
FT                   QESEIILADEPVASLDPLTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLR
FT                   DGEVVYDGPASEATDDVFSEIYGRTIKEDEKLGVN"
FT   gene            complement(120195..121151)
FT                   /locus_tag="SAAV_0111"
FT   CDS_pept        complement(120195..121151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0111"
FT                   /product="phosphonate ABC transporter, phosphonate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10058"
FT                   /protein_id="ACY10058.1"
FT                   /translation="MKNFKYLFVLMLAVIVFAAACGNSSSLDNQKNASNDSDSKSGGYK
FT                   PKELTVQFVPSQNAGTLEAKAKPLEKLLSKELGIPVKVSVSTNYNTIVEAMKSKKVDVG
FT                   FLPPTAYTLAHDQKAADLLLQAQRFGVKEDGSASKELVDSYKSEILVKKDSKIKSLKDL
FT                   KGKKIALQDVTSTAGYTFPLAMLKNEAGINATKDMKIVNVKGHDQAVISLLNGDVDAAA
FT                   VFNDARNTVKKDQPNVFKDTRILKLTQAIPNDTISVRPDMDKDFQEKLKKAFIDIAKSK
FT                   EGHKIISEVYSHEGYTETKDSNFDIVREYEKLVKDMK"
FT   gene            121380..122924
FT                   /locus_tag="SAAV_0112"
FT   CDS_pept        121380..122924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10059"
FT                   /protein_id="ACY10059.1"
FT                   /translation="MKKIYKSLTVSAIVATVSLSALPQSLAITHESQPTKQQRTVLFDR
FT                   SHGQTAGAADWVSDGAFSDYADSIQKQGYDVKAIDGHSNITEASLKSSKIFVIPEANIP
FT                   FKESEQAAIVNYVKQGGNVVFISDHYNADRNLNRIDSSEAMNGYRRGAYEDMSKGMNAE
FT                   EKSSTAMQGVKSSDWLSTNFGVRFRYNALGDLNTSNIVSSKESFGITEGVKSVSMHAGS
FT                   TLAITNPEKAKGIVYTPEQLPAKSKWSHAVDQGIYNGGGKAEGPYVAISKVGKGKAAFI
FT                   GDSSLVEDSSPKYVREDNGEKKKTYDGFKEQDNGKLLNNITAWMSKDSDGKSLKASGLT
FT                   LDTKTKLLDFERPERSTEPEKEPWSQPPSGYKWYDPTTFKAGSYGSEKGADPQPNTPDD
FT                   HTPPNQNVKISFDIPQNVSVNEPFEVTIHLKGFEANQTLENLRVGIYKEGGRQIGQFSS
FT                   KDNDYNPPGYSTLPTVKADENGNATIKINAKVLESMEGSKIRLKLGDKTLITTDFK"
FT   gene            122975..124510
FT                   /locus_tag="SAAV_0113"
FT   CDS_pept        122975..124510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0113"
FT                   /product="5' nucleotidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10060"
FT                   /protein_id="ACY10060.1"
FT                   /translation="MSNIAFYVVSDVHGYIFPTDFTSRNQYQPMGLLLANHVIEQDRRQ
FT                   YDQSFKIDNGDFLQGSPFCNYLIAHSGSSQPLVDFYNQMAFDFGTLGNHEFNYGLPYLK
FT                   DTLRRLNYPVLCANIYENDSTLTDNGVQYFQVGDQTVGVIGLTTQFIPHWEQPEHIQSL
FT                   TFHSAFETLQQHLPEMKRHADIIVVCYHGGFEKDLENGTPTEVLTGENEGYAMLEAFSK
FT                   DIDIFITGHQHRQIAERFKQTAVIQPGTRGTTVGKVVLSTDEYENVSVESCELLPVIDD
FT                   STFTIDEDDQHLRKQLEDWLDYEITTLPYDMTINHAFEARVAPHPFTNFMNYALLEKSD
FT                   ADVACTALFDSANGFKQVVTMRDVINNYPFPNTFKVLAVSGAKLKEAIERSAEYFDVQN
FT                   DEVSVSADFLGPKPQHFNYDIYGGVSYTIHVGRPKGQRVSNMMIQGHAVDLKQTYTICV
FT                   NNYRAVGGGQYDMFIDAPVVKDIQVEGAQLLIDFLSNNNLMRIPQVVDFKVEK"
FT   gene            124667..125434
FT                   /locus_tag="SAAV_0114"
FT   CDS_pept        124667..125434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10061"
FT                   /protein_id="ACY10061.1"
FT                   /translation="METIKQEVRESIVKGIIAGYKDYVNERNEVKKRMVISDAYAFTKS
FT                   NHIESQVAKHLENFVKYIKENAGPSWKYLKFIFNKDEEKNNIMFILKNEDYFDEKNVSV
FT                   GKSLVADKNPKSKNYLEVLMAKNRDINFGTVGEDFEIGHQMTADSILFNIKEGSNRDIN
FT                   SYFLIITYRIDKESKQLAAIKQWLPNPETNSAIMVDDLTELIEKVIVEREDYHIDEEEL
FT                   EVLKNDGELELIDVEHAFGISIDEGNDMIESER"
FT   gene            125440..126615
FT                   /locus_tag="SAAV_0115"
FT   CDS_pept        125440..126615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0115"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10062"
FT                   /protein_id="ACY10062.1"
FT                   /translation="MFIGKNLEYVRKLNALSRKELSEKINVSEQAIWQYETKNMMPEIS
FT                   KIYDMTSIFNVKSSYFISEQPEELLINSVDKHSIAFRAKNYKVSTKLLNKQYYQAMYLS
FT                   NLTSYLFSFVTIPDNIILSLINNLDELLNGNLESLNKKESIKEIAKVVRAKILQDESNE
FT                   ALLFMLEKAGIVIYEKRINDSIDAYSFWSKDQTPFIILGTNRGVAVRRNFDLAHELGHL
FT                   VLHRHIQFDLLSPEEYKTIEHEADIFASEFLLPEEAFKKDFDQMTKKSNPDYLAVLKEK
FT                   WYVSIQAIAMRAYYLGLMSSTQYRYFWASLNKKGYKSKEPLDDVIEMSRPVKMNSLLKL
FT                   YFDRNILTPQKLLNYLKVDETFLNHLAGINLKLFKDYVNENREYNITNLYK"
FT   gene            127000..129609
FT                   /locus_tag="SAAV_0116"
FT   CDS_pept        127000..129609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0116"
FT                   /product="bifunctional acetaldehyde-CoA/alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10063"
FT                   /protein_id="ACY10063.1"
FT                   /translation="MLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDH
FT                   IVHQMSLAAVDQHMVLAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGED
FT                   KEKGLTYVAEPIGVICGVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAE
FT                   VVLEAAMKAGAPKDIIQWIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPAL
FT                   GVGPGNVPSYIEKTAHIKRAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAH
FT                   QAYFVKKDELQRLENAIMNEQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGV
FT                   GSDYPLSREKLSPVLALVKAQSTKQAFQICEDTLHFGGLGHTAVIHTEDETLQKDFGLR
FT                   MKACRVLVNTPSAVGGIGDMYNELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRR
FT                   NNTQIFKVPAQIYFEENAIMSLTTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQRTEQP
FT                   QIKIFSEVEPNPSTNTVYKGLEMMVDFQPDTIIALGGGSAMDAAKAMWMFFEHPETSFF
FT                   GAKQKFLDIGKRTYKIGMPENATFICIPTTSGTGSEVTPFAVITDSETNVKYPLADFAL
FT                   TPDVAIIDPQFVMSVPKSVTADTGMDVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYL
FT                   KSSVEKGDKVSREKMHNASTLAGMAFANAFLGIAHSIAHKIGGEYGIPHGRANAILLPH
FT                   IIRYNAKDPQKHALFPKYEFFRADTDYADIAKFLGLKGNTTEALVESLAKAVYELGQSV
FT                   GIEMNLKSQGVSEEELNESIDRMAELAFEDQCTTANPKEALISEIKDIIQTSYDYKQ"
FT   gene            129952..130620
FT                   /gene="cap5A"
FT                   /locus_tag="SAAV_0117"
FT   CDS_pept        129952..130620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5A"
FT                   /locus_tag="SAAV_0117"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5A"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10064"
FT                   /protein_id="ACY10064.1"
FT                   /translation="MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQ
FT                   ANTQILVNQTKGDNPQFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLS
FT                   SMLTITNQENTQLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKADGT
FT                   AVKVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
FT                   "
FT   gene            130636..131322
FT                   /gene="cap5B"
FT                   /locus_tag="SAAV_0118"
FT   CDS_pept        130636..131322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5B"
FT                   /locus_tag="SAAV_0118"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5B"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10065"
FT                   /protein_id="ACY10065.1"
FT                   /translation="MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLL
FT                   VTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGR
FT                   TTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNT
FT                   VTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYY
FT                   HYYGDE"
FT   gene            131325..132089
FT                   /gene="cap5C"
FT                   /locus_tag="SAAV_0119"
FT   CDS_pept        131325..132089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5C"
FT                   /locus_tag="SAAV_0119"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5C"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10066"
FT                   /protein_id="ACY10066.1"
FT                   /translation="MIDIHNHILPNIDDGPTNETEMMDLLKQATTQGVTEIIVTSHHLH
FT                   PRYTTPIEKVKSCLNHIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVITGINDSRY
FT                   LLIEFPSNEVPHYTDQLFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVT
FT                   TASLAGISGKKIRKLAIQMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMN
FT                   GFISNAKLVVDDKKIPKRMPQQDYKQKRWFGL"
FT   gene            132109..133932
FT                   /gene="cap5D"
FT                   /locus_tag="SAAV_0120"
FT   CDS_pept        132109..133932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5D"
FT                   /locus_tag="SAAV_0120"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5D"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10067"
FT                   /protein_id="ACY10067.1"
FT                   /translation="MAHLSVKLRLLILALIDSLIVTFSVFVSYYILEPYFKTYSVKLLI
FT                   LAAISLFISHHISAFIFNMYHRAWEYASVSELILIVKAVTTSIVITMVVVTIVTGNRPF
FT                   FRLYLITWMMHLILIGGSRLFWRIYRKYLGGKSFNKKPTLVVGAGQAGSMLIRQMLKSD
FT                   EMKLEPVLAVDDDEHKRNITITEGVKVQGKIADIPELVRKYKIKKIIIAIPTIGQERLK
FT                   EINNICHMDGVELLKMPNIEDVMSGELEVNQLKKVEVEDLLGRDPVELDMDMISNELTN
FT                   KTILVTGAGGSIGSEICRQVCNFYPERIILLGHGENSIYLINRELRNRFGKNVDIVPII
FT                   ADVQNRARMFEIMETYKPYAVYHAAAHKHVPLMEDNPEEAVHNNILGTKNTAEAAKNAE
FT                   VKKFVMISTDKAVNPPNVMGASKRIAEMIIQSLNDETHRTNFVAVRFGNVLGSRGSVIP
FT                   LFKSQIEEGGPVTVTHPEMTRYFMTIPEASRLVLQAGALAEGGEVFVLDMGEPVKIVDL
FT                   ARNLIKLSGKKEDDIRITYTGIRPGEKMFEELMNKDEVHPEQVFEKIYRGKVQHMKCNE
FT                   VEAIIQDIVNDFSKEKIINYANGKKGDNYVR"
FT   gene            133922..134950
FT                   /gene="cap5E"
FT                   /locus_tag="SAAV_0121"
FT   CDS_pept        133922..134950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5E"
FT                   /locus_tag="SAAV_0121"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5E"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10068"
FT                   /protein_id="ACY10068.1"
FT                   /translation="MFDDKILLITGGTGSFGNAVMKRFLDSNIKEIRIFSRDEKKQDDI
FT                   RKKYNNSKLKFYIGDVRDSQSVETAMRDVDYVFHAAALKQVPSCEFFPVEAVKTNIIGT
FT                   ENVLQSAIHQNVKKVICLSTDKAAYPINAMGISKAMMEKVFVAKSRNIRSEQTLICGTR
FT                   YGNVMASRGSVIPLFIDKIKAGEPLTITDPDMTRFLMSLEDAVELVVHAFKHAETGDIM
FT                   VQKAPSSTVGDLATALLELFEADNAIEIIGTRHGEKKAETLLTREEYAQCEDMGDYFRV
FT                   PADSRDLNYSNYVETGNEKITQSYEYNSDNTHILTVEEIKEKLLTLEYVRNELNDYKAS
FT                   MR"
FT   gene            134963..136072
FT                   /gene="cap5F"
FT                   /locus_tag="SAAV_0122"
FT   CDS_pept        134963..136072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5F"
FT                   /locus_tag="SAAV_0122"
FT                   /product="capsular polysaccharide synthesis enzyme Cap5F"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10069"
FT                   /protein_id="ACY10069.1"
FT                   /translation="MNIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALL
FT                   KADFIVHLAGVNRPEHDKEFSLGNVSYLDHVLDILTRNTKKPAILLSSSIQATQDNPYG
FT                   ESKLQGEQLLREYAEEYGNTVYIYRWPNLFGKWCKPNYNSVIATFCYKIARNEEIQVND
FT                   RNVELTLNYVDDIVAEIKRAIEGTPTIENGVPTVPNVFKVTLGEIVDLLYKFKQSRLDR
FT                   TLPKLDNLFEKDLYSTYLSYLPSTDFSYPLLMNVDDRGSFTEFIKTPDRGQVSVNISKP
FT                   GITKGNHWHHTKNEKFLVVSGKGVIRFRHVNDDEIIEYYVSGDKLEVVDIPVGYTHNIE
FT                   NLGDTDMVTIMWVNEMFDPNQPDTYFLEV"
FT   gene            136076..137200
FT                   /gene="cap5G"
FT                   /locus_tag="SAAV_0123"
FT   CDS_pept        136076..137200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5G"
FT                   /locus_tag="SAAV_0123"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase Cap5G"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10070"
FT                   /protein_id="ACY10070.1"
FT                   /translation="MEKLKLMTIVGTRPEIIRLSSTIKACDQYFNQILVHTGQNYDYTL
FT                   NQIFFDDLELRQPDHYLEAVGSNLGETMGNIIAKTYDVLLREQPDALLILGDTNSCLAA
FT                   VSAKRLKIPVFHMEAGNRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGFNKA
FT                   NIFVTGSPMTEVIEAHRDKINHSDVLNKLGLEPQQYILVSAHREENIDNEKNFKSLMNA
FT                   INDIAKKYKMPVIYSTHPRSWKKIEESKFEFDPLVKQLKPFGFFDYNALQKDAFVVLSD
FT                   SGTLSEESSILKFPGVLIRTSTERPEVLDKGTVIVGGITYNNLIQSVELAREMQNNNEP
FT                   MIDAIDYKDTNVSTKVVKIIQSYKDIINRNTWRK"
FT   gene            137203..137829
FT                   /gene="cap5H"
FT                   /locus_tag="SAAV_0124"
FT   CDS_pept        137203..137829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5H"
FT                   /locus_tag="SAAV_0124"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5H"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10071"
FT                   /protein_id="ACY10071.1"
FT                   /translation="MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWC
FT                   KIRNSHIGEYSYIGFGSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPF
FT                   NIKQKFIDFNDQPSRTTIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVG
FT                   GVPAKVIKKRFDNKTIEKLLESKWWEKTPDKLKGFSVEYLNKKDT"
FT   gene            137834..138943
FT                   /gene="cap5I"
FT                   /locus_tag="SAAV_0125"
FT   CDS_pept        137834..138943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5I"
FT                   /locus_tag="SAAV_0125"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5I"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10072"
FT                   /protein_id="ACY10072.1"
FT                   /translation="MRILNIVSSNIVQDPRVLKQIETIKGVTNDYKIVGMNNSQATNRR
FT                   LENLDCNYRLLGSKVDPKNILSKLIKRIRFATGVIREIKAFKPDVIHANDFDVLLMVYL
FT                   SNYKKANIVYDAHEIYAKNAFINKVPLISKFVESIEKHIVKHRVNAFVTVSHAAKEYYQ
FT                   SKGYKKEANVITNAPILNDSREFKEIENFKEIVYQGQIVMDRGYEEFIIASSAFKQNAP
FT                   SFIIRGFGPHEEVIKELISYNSENIRLDKPVEVKELVDKLAESNVGVILTKPVSINFEY
FT                   TVSNKIFECIHAGLPVILSPVKEHIYLNEKYKFGIVLKEVTPLEIEKAVRKLRDNHDLF
FT                   NHLRQNAIKASKILNWQIESERLVELYKF"
FT   gene            138957..140123
FT                   /gene="cap5J"
FT                   /locus_tag="SAAV_0126"
FT   CDS_pept        138957..140123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5J"
FT                   /locus_tag="SAAV_0126"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5J"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10073"
FT                   /protein_id="ACY10073.1"
FT                   /translation="MKFFVLCAIISMNIFIVISTFTKEVLGFPIEPVYYSTMVGIALIT
FT                   TVFAIYKIIVTQEIPRGLILLIAICLLYLAFYYFSPDKEEKLAKNNILFFLTWAVPAAI
FT                   SGIYIKYINKATVERFFKLVFFIFSISFIFVILIPKLTGEIPSYINFGLMNYQNASYLS
FT                   AFTAGLGIYFIMKGSVKHKWIYVLFTIIDIPIVFIPGGRGGAILLILYGLFAFILITFK
FT                   RGIPIAVKSIMYIFALSISSVLIYFLFTKGSNTRTFSYLQGGTLNLEGTSGRGPIYEKG
FT                   IYFIQQSPLLGYGPFNYYKLIGNIPHNIIIELILSFGLLGFFIIMICILLLVYKMIRNY
FT                   DPNTIDLLVMFIAIYPITLLMFSSNYLVVSEFWFVLFYFITKGRRHHG"
FT   gene            140116..141321
FT                   /gene="cap5K"
FT                   /locus_tag="SAAV_0127"
FT   CDS_pept        140116..141321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5K"
FT                   /locus_tag="SAAV_0127"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5K"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10074"
FT                   /protein_id="ACY10074.1"
FT                   /translation="MVKKVFIMDSVKTIIGTLLIALGLQFLAYPIINQRVGNEAFGSIL
FT                   TIYTIITITSVVLGNTLNNIRLINMNLYKSNHYYWKFVSILLISILIESIALIIVFLYF
FT                   FNLNTIDIIFLILLNILMCLRIYLNVFFRMTLKYNQILYIALIQFLGLLIGLFLYYLIQ
FT                   NWIVCFITSELFATIYTLVKLRGLTIGEYQSEDNNVVKDYVMLLSTNSLNNLNLYLDRL
FT                   ILLPIIGGTAVTISFLSTFIGKMLATFLYPINNVVLSYISVNESDNIKKQYLKTNLFAI
FT                   AALCLVMIICYPITLIIVSLLYNIDSSLYSKFIILGNIGVLFNAVSIMIQTLNTKHASI
FT                   TLQANYMTLHTITFIFITILMTIAFGLNGFFWTTLFSNIIKYVILNIIGLKSKFINKKD
FT                   VD"
FT   gene            141322..142527
FT                   /gene="cap5L"
FT                   /locus_tag="SAAV_0128"
FT   CDS_pept        141322..142527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5L"
FT                   /locus_tag="SAAV_0128"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5L"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10075"
FT                   /protein_id="ACY10075.1"
FT                   /translation="MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWP
FT                   YEYSNHKQVSKTEMHRGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQ
FT                   ILVYSNPPILPLIPDVLHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRH
FT                   VYKNAENVIVLGTEMKNYLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQ
FT                   YDKILLYSGNMGQLQDMETLISFLKLNKDQPQTLTILCGHGKKFADVKTAIEDHRIENV
FT                   KMFEFLTGTDYADVLKIADVCIASLIKEGVGLGVPSKNYGYLAAKKPLVLIMDKQSDIV
FT                   QHVEQYDAGIQIDNGDAHAIYNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNL
FT                   LK"
FT   gene            142538..143095
FT                   /gene="cap5M"
FT                   /locus_tag="SAAV_0129"
FT   CDS_pept        142538..143095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5M"
FT                   /locus_tag="SAAV_0129"
FT                   /product="capsular polysaccharide biosynthesis
FT                   galactosyltransferase Cap5M"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10076"
FT                   /protein_id="ACY10076.1"
FT                   /translation="MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTI
FT                   NNELFNIYKFRSMKIDTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSI
FT                   VGPRPALYNQYELIEKRTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSM
FT                   MLDMYIIYKTIKNIVTSEGVHH"
FT   gene            143095..143982
FT                   /gene="cap5N"
FT                   /locus_tag="SAAV_0130"
FT   CDS_pept        143095..143982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5N"
FT                   /locus_tag="SAAV_0130"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5N"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10077"
FT                   /protein_id="ACY10077.1"
FT                   /translation="MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFK
FT                   DYDVLIHTAALVHNNSPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKE
FT                   GQVGKSDQIDTQTPMNPTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNF
FT                   QRLMQLSKRLPIIPNINNQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMY
FT                   EIRRQSHRKTVLINMPSVLNKYFNKLSVFRKLFGNLTYSNTLYENNNALEVIPGKMSLV
FT                   IADIMDETTTKDKA"
FT   gene            144036..145298
FT                   /gene="cap5O"
FT                   /locus_tag="SAAV_0131"
FT   CDS_pept        144036..145298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5O"
FT                   /locus_tag="SAAV_0131"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cap5O"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10078"
FT                   /protein_id="ACY10078.1"
FT                   /translation="MKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQSGQIS
FT                   IEEPGLQEVYEEVLSSGKLKVSTTPEASDVFIIAVPTPNNDDQYRSCDISLVMRALDSI
FT                   LPFLEKGNTIIVESTIAPKTMDDFVKPVIENLGFTIGEDICLVHCPERVLPGKILEELV
FT                   HNNRIIGGVTKACIEAGKYVYRTFVQGEMIETDARTAEMSKLMENTYRDVNIALANELT
FT                   KICNNLNINVLDVIEMANKHPRVNIHQPGPGVGGHCLAVDPYFIIAKDPENAKLIQTGR
FT                   EINNSMPAYVVDTTKQIIKALSGNKVTVFGLTYKGDVDDIRESPAFDIYELLNQEPDIE
FT                   VCAYDPHVELDFVEHDMSHAVKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVV
FT                   KSSFEDVSYYNYGNIFNFIDK"
FT   gene            145375..146520
FT                   /gene="cap5P"
FT                   /locus_tag="SAAV_0132"
FT   CDS_pept        145375..146520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap5P"
FT                   /locus_tag="SAAV_0132"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase Cap5P"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10079"
FT                   /protein_id="ACY10079.1"
FT                   /translation="MKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIVITAQHRDMLD
FT                   SVLSIFDIQADHDLNIMQDQQTLADLTANALAKLDSIINEEQPDMILVHGDTTTTFVGS
FT                   LAAFYHQIPVGHVEAGLRTHQKYSPFPEELNRVMVSNIAELNFAPTVIAAKNLLFENKD
FT                   KERIFITGNTVIDALSTTVQNDFVSTIINKHKGKKVILLTAHRRENIGEPMHQIFKAVR
FT                   DLADEYKDVVFIYPMHRNPKVRAIAEKYLSGRNRIELIEPLDAIEFHNFTNQSYLVLTD
FT                   SGGIQEEAPTFGKPVLVLRNHTERPEGVEAGTSRVIGTDYDNIVRNVKQLIEDDEAYQR
FT                   MSQANNPYGDGQASRRICEAIEYYFGLRSDKPDEFVPLRHK"
FT   gene            complement(146585..146911)
FT                   /locus_tag="SAAV_0133"
FT   CDS_pept        complement(146585..146911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0133"
FT                   /product="heme-degrading monooxygenase IsdI"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10080"
FT                   /protein_id="ACY10080.1"
FT                   /translation="MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNT
FT                   EDTDEVKILTIWESEDNFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGY
FT                   HYQK"
FT   gene            complement(146918..147301)
FT                   /locus_tag="SAAV_0134"
FT   CDS_pept        complement(146918..147301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10081"
FT                   /protein_id="ACY10081.1"
FT                   /translation="MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRF
FT                   YNWLINQKIYKEYVENFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMV
FT                   IIQTAVLFTFVKTLPKSNHKIEE"
FT   gene            147728..149215
FT                   /gene="aldA1"
FT                   /locus_tag="SAAV_0135"
FT   CDS_pept        147728..149215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldA1"
FT                   /locus_tag="SAAV_0135"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10082"
FT                   /protein_id="ACY10082.1"
FT                   /translation="MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHIT
FT                   RAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPI
FT                   RETTAIDIPFAARHFHYFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPML
FT                   LAAWKIAPAIAAGNTIVIQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIF
FT                   NHDGVDKLSFTGSTDVGYQVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLG
FT                   ILFNQGEVCSAGSRLLVHEKIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDK
FT                   IQSYIDAAKESDAQILAGGHRLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTV
FT                   IKVKDDQEAIDIANDSEYGLAGGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFG
FT                   GYKKSGIGRETYKGALSNYQQVKNIYIDTSNALKGLY"
FT   gene            149862..150821
FT                   /locus_tag="SAAV_0136"
FT   CDS_pept        149862..150821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0136"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10083"
FT                   /protein_id="ACY10083.1"
FT                   /translation="MNGKKANTINRYKYFHHVNHQKIQQSSKKTLWASLIITLLFTVIE
FT                   FVGGLVSNSLALLSDSFHMLSDVLALGLSMLAIYFASKKPTARYTFGYLRFEILVAFLN
FT                   GLALIVISIWILYEAIVRIIYPQPIESGIMFMIASIGLLVNIILTIILVRSLKQEDNIN
FT                   IQSALWHFMGDLLNSIGVIVAVVLIYFTGWRIIDPIISIVISLIILRGGYKITRNAWLI
FT                   LMESVPQHLDTDQIMADIKNIDGILDVHEFHLWSITTEHYSLSAHVVLDKKYEGDDYQA
FT                   IDQVSSLLKEKYGIAHSTLQIENLQLNPLDEPYFDKLT"
FT   gene            complement(150935..151144)
FT                   /locus_tag="SAAV_0137"
FT   CDS_pept        complement(150935..151144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10084"
FT                   /protein_id="ACY10084.1"
FT                   /translation="MIFSQNLFRCPTPTCIVCRNWESNFSLLGPTPQLALPVEFLFEIL
FT                   CVGAHTPTCIACRISFRNSLCWGP"
FT   gene            151557..152069
FT                   /locus_tag="SAAV_0138"
FT   CDS_pept        151557..152069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10085"
FT                   /protein_id="ACY10085.1"
FT                   /translation="MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLT
FT                   HGYFIVEANDEAEAKQFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEG
FT                   ITMDQYLARKKKNSVHYEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTP
FT                   IDGIEKL"
FT   gene            152411..153151
FT                   /locus_tag="SAAV_0139"
FT   CDS_pept        152411..153151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0139"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10086"
FT                   /protein_id="ACY10086.1"
FT                   /translation="MIKIQQLQHHFGSHKVIHNFNLDISKGEIVTFIGKSGCGKSTLLN
FT                   VIGGFIHPSSGRVIIDNEIKQQPSPDCLMLFQHHNLLPWKTINDNIRIGFQQKISDEEI
FT                   NAQLKLVDLEDRGKHFPEQLSGGMKQRVALCRAHVHKPNVILMDEPLGALDAFTRYKLQ
FT                   DQLVQLKHKTQSTIILVTHDIDEAIYLSDRIVLLGEGCNIISQYEITASHPRSRNDSHL
FT                   LKIRNEIMETFALNHHQVEPEYYL"
FT   gene            153165..154136
FT                   /locus_tag="SAAV_0140"
FT   CDS_pept        153165..154136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10087"
FT                   /protein_id="ACY10087.1"
FT                   /translation="MKRLSIIVIIGIFIITGCDWQRTSKEPSKNAQNQQVIKIGYLPIT
FT                   HSANLMMTKKLLSQYNHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKG
FT                   SNIKAVALGHHEGNVIMGQKGMHLNEFNNGDDYHFGIPHRYSTHYLLLEELRKQLKIKP
FT                   GHFSYHEMSPAEMPAALSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVL
FT                   VLRGELLDQHKDVAQAFVQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYG
FT                   DLTIKPSGYQEITTLVKQHHLFNPPAYDDFVEPSLYKEASRS"
FT   gene            154133..154894
FT                   /locus_tag="SAAV_0141"
FT   CDS_pept        154133..154894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0141"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10088"
FT                   /protein_id="ACY10088.1"
FT                   /translation="MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGK
FT                   SIWTFIVTGEIFQHLAISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRP
FT                   ISPIAWAPFVVLWFGIGSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTG
FT                   WSLYRNILFPGAFKQIMAGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDV
FT                   LAAIFFIGLFGFIIDRFISYIEQFILRRFGE"
FT   gene            154907..155938
FT                   /locus_tag="SAAV_0142"
FT   CDS_pept        154907..155938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10089"
FT                   /protein_id="ACY10089.1"
FT                   /translation="MTLETLIKEQLDPHLVEVDEGTYYPRTFIQQLFVDGYFGEAALRK
FT                   NAEVIEAVSQSCLTTGFCLWCQLAFSTYLENATQPHLNNDLQQQLLSGEILGATGLSNP
FT                   MKSFNDLEKLNLEHTYVDGQLVVSGRMPAVSNIQEDHYFGAISKHESSDEFVMFILRAN
FT                   QDGITLVEKTNFLGVNGSATYQITLNQVVVPQSQIITHDAKQFAATIRPQFIAYQIPIG
FT                   LGSIKSSLELIDAFSNAQNGINQYLEYDVEAFKKRYRQLREEYYAILDDGNLTSHLSEL
FT                   ISLKKDIGYLLLDVNQASVVNGGSRAYTPYSPQVRKLKEGFFFAALTPTLRHLGKLEAE
FT                   LKG"
FT   gene            156227..156514
FT                   /locus_tag="SAAV_0143"
FT   CDS_pept        156227..156514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10090"
FT                   /protein_id="ACY10090.1"
FT                   /translation="MGKGPNSIRVSFKDNWAIAHMTGVLSKVESFYLNDKRNESMLHYT
FT                   RTEKIKQMYKEIDVNEMESLVGAKFVKLFTDIDLNDDEVISIFVFDKSIE"
FT   gene            156589..157712
FT                   /pseudo
FT                   /locus_tag="SAAV_0145"
FT                   /note="NAD-dependent formate dehydrogenase"
FT   gene            158098..159348
FT                   /locus_tag="SAAV_0146"
FT   CDS_pept        158098..159348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0146"
FT                   /product="drug transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10091"
FT                   /protein_id="ACY10091.1"
FT                   /translation="MKRLSTTLKVRLISNFLQLIITTAFIPFIALYLTDMLSQSIVGIY
FT                   LVGLVVLKFPLSIISGYLIEIFPKKLLVLIYQATMVIMLVFMGVFGSHQLWQIIGFCVA
FT                   YAIFTIVWGLQFPVMDTLIMDAITEDVEHYIYKISYWMTNLSVAIGALLGGLMYGYSML
FT                   LLFLIAACIFLIVLFILYIWLPQDRNQVKQSDDKRHASRYQKLQIMNIFRSYKLVLKDR
FT                   NYMLLISGFSIIMMGEFSISSYIAIRLKDQFETISIGSYDITGAKMLAILLMINTVVVI
FT                   LLTYSISKVVLKIDFKKALITGLLIYIVGYSGLTYLNQFGLLVVFMIIATVGEIIYSPI
FT                   VSEQRFKIIPKAKRGTYSAVNALGIHFSETLARLGIVLGVFLTSLQMGLYMFIVLTIGA
FT                   SMLVAGVFGGQKQVNTN"
FT   gene            159777..166970
FT                   /locus_tag="SAAV_0147"
FT   CDS_pept        159777..166970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0147"
FT                   /product="gramicidin S synthetase 2 related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10092"
FT                   /protein_id="ACY10092.1"
FT                   /translation="MKEGLFMIMGNLRFQQEYFRIYKNNTESTTHRNAYWVKLAKNVEA
FT                   TKMMYALSTIVQQHASIRHFFDVTTDDNLTMILHEFLPFIEIKQVPSSSANYDLEAFFK
FT                   QELSTYHFNDSPLFKVKLFQFADAAYILLDFHVSIFDDSQIDIFLDDLCNAYRGNTVIN
FT                   NTRQHAHINRNDDKDNQDASHIALDSNYFRLENNSDIHIDSYFPIKHPFEQALYQTYLI
FT                   DDMTSIDMASLAVSVYLANHIMSQQHDVTLGIHVPSHLPNDLHGNIVPLTLTIDAKDVC
FT                   QRFTTDFNKCVLQNMSQLQCAKSSLSLETIFHCYHHMMSCCNDVIEDVHQIHDAHTSLA
FT                   DIEIFPHQHGFKIIYNSAAYDLLSIETLSDLVRNIYLQITEENGNKRTTVDELNLMTER
FT                   DIQLYDDINLSLPEIDDAQTVVTLFEQQVEATPNHVAVQFDGVFITYQTLNARANDLAH
FT                   RLRNQYGVEPNDRVAVIAEKSIEMIIAMIGVLKAGGAYVPIDPNYPSDRQEYILKDATP
FT                   KVVITYQALYENGKQNINHIDLNKIAWKNIDNLSKCNTLEDHAYVIYTSGTTGNPKGTL
FT                   IPHRGIVRLVHRNHYVPLNEETTILLSGTIAFDAATFEIYGALLNGGKLIVAKKEQLLN
FT                   PIAVEQLINENDVNTMWLTSSLFNQIASERIEVLVPLKYLLIGGEVLNAKWVDLLNQKP
FT                   KHPQIINGYGPTENTTFTTTYNIPNKVPNRIPIGKPILGTHVYIMQGERRCGVGIPGEL
FT                   CTSGFGLAAGYLNQPELTADKFIKDSNINQLMYRSGDIVRLLPDGNIDYLYRKDKQVKI
FT                   RGFRIELSEVEHALERIQGINKAVVIVQNHDQDQYIVAYYEAMHTLSHNKIKSQLRMTL
FT                   PEYMIPVNFMHIEQIPITINGKLDKKALPIMDYVDTDAYVAPSTDTEHLLCQIFADILH
FT                   VNQVGIHDNFFELGGHSLKATLVVNRIEASTGKRLQIGDLLQKPTVFELAQAIAKVQEQ
FT                   NYEVIPEAIVKDDYVLSSAQKRMYLLWKSNHKDTVYNVPFLWRLSSGLNVAQLQQAVQH
FT                   LIARHEILRTQYIVVDDEVRQRIVADVVADFEEVNTHFTDEQEIMRQFVAPFNLEKPSQ
FT                   IRVRYIRSPLHAYLFIDTHHIINDGMSNIQLMNDLNALYQHKLLLPLKLQYKDYSEWMS
FT                   HRDMTKHRQYWLSQFKDEVPILSLPTDYVRPNIKTTNGAMMSFTMNQQMRQLLQKYVEK
FT                   HQITDFMFFMSVVMTLLSRYARKDDVVVGSVMSARMHKGTEQMLGMFANTLVYRGQPSP
FT                   DKMWTQFLQEVKEMSLEAYEHQEYPFECLVNDLDQSHDASRNPLFDVMLVLQNNETNHA
FT                   HFGHSKLTHIQPKSVTAKFDLSFIIEEDRDDYTINIEYNTDLYHSETVRHMGNQCMIMI
FT                   DYILKHQDTLQICDIPNGTEELLNWVNTHVNDRMLNVPGNKSIISYFNEVVSRQGNHVA
FT                   LVMNDLTMTYETLRNYVDAIAHMLLSNGVGNGQRVALFTERSFEMIAAMLATVKVGASY
FT                   IPIDIDFPNKRQGAILEDAKVTAVMSYGVEIETTLPVIQLENAKGFVESKENEQYDDLH
FT                   GNQLENTAMLDNEMYAIYTSGTTGMPKGVAIRQRNLLNLVHAWSTELQLGDNEVFLQHA
FT                   NIVFDASVMEIYCCLLNGHTLVIPDREERVNPEQLQQLINKHRVTVASIPLQMCSIMED
FT                   FYIEKLITGGATSTASFVKYIEKHCGTYFNAYGPSESTVITSYWSHHCGDLIPETIPIG
FT                   KPLSNIQVYIMSDGLLCGIGMPGELCIAGDSLAIGYINRPELMADKWQNNPFGKGKLYH
FT                   SGDLARYTSDGQIEFLGRIDKQVKVNGYRIELDEIENVILAIRGISDCVVTVSHFDTHD
FT                   ILNAYYVGEQQVEQDLKQYLNDQLPKYMIPKTITHIDCMPLTTNDKVDTTRLPNPSPIQ
FT                   QSNKVYSEPSNEIEQTFVDVFGEVLKQNDVGVDDDFFELGGNSLEAMLVVSHLKRFGHH
FT                   ISMQTLYQYKTVRQIVNYMYQNQQSLVALPDNLSELQKIVMSRYNLGILEDSLSHRPLG
FT                   NTLLTGATGFLGAYLIEALQGYSHRIYCFIRADNEEIAWYKLMTNLNDYFSEETVEMML
FT                   SNIEVIVGDFECMDDVVLPENMDTIIHAGARTDHFGDDDEFEKVNVQGTVDVIRLAQQH
FT                   HARLIYVSTISVGTYFDIDTEDVTFSEADVYKGQLLTSPYTRSKFYSELKVLEAVNNGL
FT                   DGRIVRVGNLTSPYNGRWHMRNIKTNRFSMVMNDLLQLDCIGVSMAEMPVDFSFVDTTA
FT                   RQIVALAQVNTPQIIYHVLSPNKMPVKSLLECVKRKEIELVSDESFNEILQKQDMYETI
FT                   GLTSVDREQQLAMIDTTLTLKIMNHISEKWPTITNNWLYHWAQYIKTIFNK"
FT   gene            166983..167627
FT                   /locus_tag="SAAV_0148"
FT   CDS_pept        166983..167627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0148"
FT                   /product="4'-phosphopantetheinyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10093"
FT                   /protein_id="ACY10093.1"
FT                   /translation="MTVFVMQLQSNLKSIEELISQSRWSYKKPRTVNYRYNQDKLMHRL
FT                   GDILVQYGIQHDTGLLPHEWHYHISPRGKADIVQHNRDGQPIYVSLSYSYPYIVCVVDK
FT                   EPVGIDIEKISQRLDWRTLVTCFSTNEAHQICSLNDFYQIWTQKESFTKLIGEGLIKGL
FT                   DIYDMTQSHFYQSREVKFKQFIFDQFMVQVCFLGEAPWGYKKVSVFQLLSS"
FT   gene            complement(167955..168449)
FT                   /locus_tag="SAAV_0149"
FT   CDS_pept        complement(167955..168449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10094"
FT                   /protein_id="ACY10094.1"
FT                   /translation="MTKRQMGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQ
FT                   ELLQQLGFSSEFTHQTYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAIGQGA
FT                   VFGIAIWVLFHLIIMPIMHTVPAVWDQPYQEHLSEFFGHIVWMMTIELVRQHFVYRYKL
FT                   N"
FT   gene            complement(168704..169468)
FT                   /gene="argB"
FT                   /locus_tag="SAAV_0150"
FT   CDS_pept        complement(168704..169468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="SAAV_0150"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10095"
FT                   /protein_id="ACY10095.1"
FT                   /translation="MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFIN
FT                   EALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQ
FT                   LFEITSFDQQYGYVGVPTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYF
FT                   IASSLKAPIYVLSNIAGVLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIEN
FT                   GCPKVIIASGNKPNIIESIYNNDFVGTTILNS"
FT   gene            complement(169484..170725)
FT                   /gene="argJ"
FT                   /locus_tag="SAAV_0151"
FT   CDS_pept        complement(169484..170725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="SAAV_0151"
FT                   /product="bifunctional ornithine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10096"
FT                   /protein_id="ACY10096.1"
FT                   /translation="MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGW
FT                   IYSSSLASSAAVYTLNQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDA
FT                   RQTQTWVAQQLQIPSEHVAVASTGVIGEYLPMDKIKTGTEHIKDTNFATPGAFNEAILT
FT                   TDTCTKHIAVSLKIDGKTVTIGGSAKGSGMIHPNMATMLAFITTDASIESNTLHQLLKS
FT                   STDHTFNMITVDGDTSTNDMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAI
FT                   ARDGEGATKLISVNVSGAKSISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSG
FT                   CEIDPKCTYVQLNQIPVVDKGMAVLFDEQAMSNTLTHEHVTIDVQLGLGNAAATAYGCD
FT                   LSYDYVRINASYRT"
FT   gene            complement(170737..171768)
FT                   /gene="argC"
FT                   /locus_tag="SAAV_0152"
FT   CDS_pept        complement(170737..171768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="SAAV_0152"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10097"
FT                   /protein_id="ACY10097.1"
FT                   /translation="MIKVGIVGGSGYGAIELIRLLQTHPHVTIAHIYSHSKVDEPLKLT
FT                   FPHLQHIMQHFEALTVDNNDCDVIFFATPAPVSKTCIPPLVEKGIHVIDLSGAFRIKNR
FT                   EIYEAYYKETAAAQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALHPLISEK
FT                   IVDLSSIIIDAKTGVSGAGRSLSQRVHFSEMNENLSAYAIGNHKHKPEIEQYLSIIAGQ
FT                   DVSVIFTPHLVPMTRGILSTIYVKFSSEYTTESLHKLMTSYYANQPFVRIRDIGTFPTT
FT                   KEVLGSNYCDIGIYVDETTQTAILVSVIDNLVKGASGQAIQNLNILYDFEVTTGLNQSP
FT                   VYP"
FT   gene            complement(171807..172991)
FT                   /gene="rocD1"
FT                   /locus_tag="SAAV_0153"
FT   CDS_pept        complement(171807..172991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocD1"
FT                   /locus_tag="SAAV_0153"
FT                   /product="ornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10098"
FT                   /protein_id="ACY10098.1"
FT                   /translation="MNSIIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISG
FT                   FSVANQGHCHPTIVKAMTEQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLSLNSGT
FT                   EAVEAAIKIARKWGSEVKGITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKAGFHPLLQ
FT                   GTTTVDFGDIEQLTQAISPNTAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILMIA
FT                   DEIQVGLGRTGKWFAMEWEQVVPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGS
FT                   TFGGNPLAIAISTAALDVLKDEQLVERSERLGSFLLKALLQLKHPSIKEIRGRGLFIGI
FT                   ELNTDAAPFVDQLIQRGILCKDTHRTIIRLSPPLVIDKEEIHQIVAAFQDVFKN"
FT   gene            complement(173250..174599)
FT                   /gene="brnQ1"
FT                   /locus_tag="SAAV_0154"
FT   CDS_pept        complement(173250..174599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ1"
FT                   /locus_tag="SAAV_0154"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10099"
FT                   /protein_id="ACY10099.1"
FT                   /translation="MKKKLTFKENMFIGSMLFGLFFGAGNLIFPIHLGQAAGSNVFIAN
FT                   LGFLITAIGLPFLGIIAIGISKTSGLFEIASRVNKTYAYIFTIALYLVIGPFFALPRLA
FT                   TTSFEIAFSPFLSPKQITLYLFIFSFVFFVIAWFFARKPSRILEYIGKFLNPVFLVLLA
FT                   IILLFAFIHPLGGISDAPISKQYQSHALFNGFLDGYNTLDALASLAFGIIIVATIKKLG
FT                   IENPTDIAKETIKSGTISIIMMGIIYTLLAIMGTLSIGHFKLSENGGIALAQITQYYLG
FT                   NYGIVLLSLIVMVACLKTAIGLITAFSETFEHLFPKMNYLAIATVVSFISFLFANVGLT
FT                   KIIMYSVPVLMFLYPLAIALIVLTLFSSKFHHSKIIYQCTIFFTMIAALVDGLKASPEF
FT                   ISSTSFSQTLINFSQKYLPLSDIGMGWVVLSLIGFIIGFIIYKIKHRKIP"
FT   gene            complement(174878..175375)
FT                   /gene="entB"
FT                   /locus_tag="SAAV_0155"
FT   CDS_pept        complement(174878..175375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="SAAV_0155"
FT                   /product="isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10100"
FT                   /protein_id="ACY10100.1"
FT                   /translation="MDYAPHTAENVVQNANKLIDVFRKNNGFIAFVRVNFYDGKDVLQP
FT                   NAMISLPPKEGDDYSRFHHLLDKRDDDFVIDKRHFSAFVGTDLDLQLRRRGIDTIVLGG
FT                   VATHIGVDTTARDAYQLNYNQFFVTDMMSAQNETLHQFPIDNVFPLMGQTITTNDFLNI
FT                   LN"
FT   gene            complement(175502..177142)
FT                   /gene="ipdC"
FT                   /locus_tag="SAAV_0156"
FT   CDS_pept        complement(175502..177142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipdC"
FT                   /locus_tag="SAAV_0156"
FT                   /product="indole-3-pyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10101"
FT                   /protein_id="ACY10101.1"
FT                   /translation="MKQRIGAYLIDAFHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWV
FT                   GNTNELNASYAADGYARLNGLAALVTTFGVGELSAVNGIAGSYAERIPVIAITGAPTRA
FT                   VEQAGKYVHHSLGEGTFDDYRKMFAHITVAQGYITPENATTEIPRLINTAIAERRPVHL
FT                   HLPIDVAISEIEIPTPFEVTATKDTDASTYIELLATKLHQAKQPIIITGHEINSFHLHQ
FT                   ELEDFVNQTQIPVAQLSLGKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGAK
FT                   LTDSATAGFSYQFNIDDVVMLNHHNIKIDDVTNDEISLPSLLKQLSNISYTNSATFPAY
FT                   HRPTSPDYTVGTEPLTQQTYFKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQ
FT                   PLWGSIGYTLPATLGSQLADKDRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINND
FT                   GYTVERLIHGMYEPYNEIHMWDYKALPAVFGGKNVEIHDVESSKDLQDTFNAINGHPDV
FT                   MHFVEVKMSVEDAPKKLIDIAKAFSQQNK"
FT   gene            177335..177436
FT                   /locus_tag="SAAV_0157"
FT   CDS_pept        177335..177436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10102"
FT                   /protein_id="ACY10102.1"
FT                   /translation="MMPQNTIAKKKQARHLMKVYAPVYSKHYLASNN"
FT   gene            complement(177415..179460)
FT                   /locus_tag="SAAV_0158"
FT   CDS_pept        complement(177415..179460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0158"
FT                   /product="PTS system, IIABC components"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10103"
FT                   /protein_id="ACY10103.1"
FT                   /translation="MRKKLFGQLQRIGKALMLPVAILPAAGLLLAIGTAIQGEALQHYL
FT                   PFIQNGGVQNVAKLMTAAGSIIFENLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKT
FT                   MGDFLQVTPKNVTDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLG
FT                   FFAGKRFVPIMMATTSFILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRL
FT                   LIPFGLHHIFHAPFWFEFGSWKNAAGEIIHGDQRIFIEQIREGAHLTAGKFMQGEFPVM
FT                   MFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFFIHA
FT                   VLDGLSFLTLYLLDVHLGYTFSGGFIDYVLLGVLPNKTQWWLVIPVGLVYAVIYYFVFR
FT                   FLIVKLKYKTPGREDKQSQAVTASATELPYAVLEAMGGKANIKHLDACITRLRVEVNDK
FT                   SKVDVPGLKDLGASGVLEVGNNMQAIFGPKSDQIKHEMQQIMNGQVVENPTTMEDDKDE
FT                   TVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPF
FT                   NGKIQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEGFTLHVEEGQEVKQGDLLINF
FT                   DLDYIRNHAKSDITPIIVTQGNITNLDFKQGEHGNISFGDQLFEAK"
FT   gene            180045..181100
FT                   /locus_tag="SAAV_0159"
FT   CDS_pept        180045..181100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10104"
FT                   /protein_id="ACY10104.1"
FT                   /translation="MTGFSVYLGQPLDEAYIKRMIKQGYQMIFTSVQIPEEDDETKYHY
FT                   FTKLLNLLKYEQVTYLIDANPSILTPSFYEHLRQYDAQFMIRIDHSTSIEAIEAIMAQG
FT                   LKCCLNASIISRELLTSLHQQLNDFTLLSFCHNYYPRPDTGLSVDLVNKKNELIYQFNP
FT                   KAQIYGFIVGSGLRGPLHKGLPTIEATRHSHPVVAAKLLQETGVSEVLVGDSLIEMRQA
FT                   KQLIDFCKHRHFTLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQ
FT                   FTTQRRIGSVTVDNLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDT
FT                   FDFQKTRECKK"
FT   gene            181100..181996
FT                   /gene="murQ"
FT                   /locus_tag="SAAV_0160"
FT   CDS_pept        181100..181996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /locus_tag="SAAV_0160"
FT                   /product="N-acetylmuramic acid-6-phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10105"
FT                   /protein_id="ACY10105.1"
FT                   /translation="MENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQ
FT                   LTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAM
FT                   TMAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFANTIGATTVSIS
FT                   CNEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLM
FT                   IDVKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRR
FT                   LLNNGDIVKRAIRDRQP"
FT   gene            182008..183462
FT                   /locus_tag="SAAV_0161"
FT   CDS_pept        182008..183462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0161"
FT                   /product="PTS system, IIBC components"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10106"
FT                   /protein_id="ACY10106.1"
FT                   /translation="MTKEQQLAERIIAAVGGMDNIDSVMNCMTRVRIKVLDENKVDDQE
FT                   LRHIDGVMGVIHDERIQVVVGPGTVNKVANHMAELSGVKLGDPIPHHHNDSEKMDYKSY
FT                   AADKAKANKEAHKAKQKNGKLNKVLKSIANIFIPLIPAFIGAGLIGGIAAVLSNLMVAG
FT                   YISGAWITQLITVFNVIKDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGIAGK
FT                   NILMNVFTGEPLQPGQGGIIGVIFAVWILSIVEKRLHKIVPNAIDIIVTPTIALLIVGL
FT                   LTIFIFMPLAGFVSDSLVSVVNGIISIGGVFSGFIIGASFLPLVMLGLHHIFTPIHIEM
FT                   INQSGATYLLPIAAMAGAGQVGAALALWVRCKRNTTLRNTLKGALPVGFLGIGEPLIYG
FT                   VTLPLGRPFLTACIGGGIGGAVIGGIGHIGAKAIGPSGVSLLPLISDNMYLGYIAGLLA
FT                   AYAGGFVCTYLFGTTKAMRQTDLLGD"
FT   gene            183465..184340
FT                   /locus_tag="SAAV_0162"
FT   CDS_pept        183465..184340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0162"
FT                   /product="RpiR family phosphosugar-binding transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10107"
FT                   /protein_id="ACY10107.1"
FT                   /translation="MTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADVT
FT                   NVSTASIVRFSRKMTHQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIARA
FT                   TNTMRFVATNIMDAQIDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLLH
FT                   ETHLLVSTFATHDDRDCMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQIA
FT                   DYALIYGRTDENEMRMAATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNYR
FT                   KHLATIDFKH"
FT   gene            185028..187817
FT                   /locus_tag="SAAV_0163"
FT   CDS_pept        185028..187817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0163"
FT                   /product="type I restriction-modification enzyme, R
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10108"
FT                   /protein_id="ACY10108.1"
FT                   /translation="MAYQSEYALENEMMNQLEQLGYERVTIRDNKQLLDNFRTILNERH
FT                   ADKLEGNPLTDKEFQRLLTMIDGKSIFESARILRDKLPLRRDDESEIYLSFLDKKSWCK
FT                   NKFQVTNQVSVEDTYKARYDVTILINGLPLVQVELKRRGIDINEAFNQVKRYRKQNYTG
FT                   LFRYIQMFIISNGVETRYFSNNDSELLKSHMFYWSDKQNNRINTLQSFAESFMRPCQLA
FT                   KMISRYMIINETDRILMAMRPYQVYAVEALIQQATETGNNGYVWHTTGSGKTLTSFKAS
FT                   QILSQQDDIKKVIFLVDRKDLDSQTEEEFNKFAKGAVDKTFNTSQLVRQLNDKSLPLIV
FT                   TTIQKMAKAIQGNAHLLEQYKTNKVVFIIDECHRSQFGDMHRLVKQHFKNAQYFGFTGT
FT                   PRFPENSSQDGRTTADIFGRCLHTYLIRDAIHDGNVLGFSVDYINTFKNKALKAEDNSM
FT                   VEAIDTEEVWLADKRVELVTRHIINNHDKYTRNRQYSSIFTVQSIHALIKYYETFKRLN
FT                   KKLEQPLTIAGIFTFKPNEDDRDGEVPYHSREKLEIMISDYNKKFETNFSTDTTNEYFN
FT                   HISKNVKKGVKDSKIDILIVVNMFLTGFDSKVLNTLYVDKNLMYHDLIQAYSRTNRVEK
FT                   ESKPFGKIVNYRVLKKETDDALRVFSQTNDTDTILMRSYEEYKKEFMDAYRELKMIVPT
FT                   PHMVDDIQDEEELKRFVEAYRLLAKIILRLKAFDEFEFTIDEIGMDEQENEDYKSKYLA
FT                   VYDQVKRATAEKNKVSILNDIDFEIEMMRNDTINVNYIMNILRQIDLEDKAEQRRNQEQ
FT                   IRRILDHADDPTLRLKRDLIREFIDNVVPSLNKDDDIDQEYVNFESIKKEAEFKGFAGE
FT                   RSIDEQALKTISNDYQYSGVVNPHHLKKMIGDLPLKEKRKARKAIESFVAETTEKYGV"
FT   gene            complement(187964..188563)
FT                   /locus_tag="SAAV_0164"
FT   CDS_pept        complement(187964..188563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10109"
FT                   /protein_id="ACY10109.1"
FT                   /translation="MSLSKLPLFNHFANIRIQPKLIIKLFLTLIIIVTYTFVSGLSVDY
FT                   KKLLSEAGLSETSLAQIKIFSQISIFFSRVFSVLFTFLIILVISRIMRSDANTKSIFSA
FT                   TLSYILFTNAISLIILTIQISAGLSLIDYSITSLNIFAKGNRILGTFDLQFFVQAYILT
FT                   VMLIGTSKLSIRASTIWGIIYLILIITFSLISISIQ"
FT   gene            188689..189801
FT                   /locus_tag="SAAV_0165"
FT   CDS_pept        188689..189801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0165"
FT                   /product="putative RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10110"
FT                   /protein_id="ACY10110.1"
FT                   /translation="MRRKRKWLIVICVLLVLITISQILKHFNYGTESKEAYNTYTVEKE
FT                   RQLDLQGKAYPREVKTYYKNNQVGTYLGVQVADGQTVKKGDMLINYKINSNKRQQLVDK
FT                   INDTQHIITEVYLNITKGLNNREIQKKLIEYKQTLYEAQQQLYQYDSQNRDSMYASFDG
FT                   KIMIKNIDNDSDNQPILYLISKESHIKTSVTEFDLNKVKKGDKVNLSITSTGKTGAGII
FT                   KQISELPISYEENLSLHENDALHLPESNNDGELANSKSISASPIFKSNNNSELSKYGVI
FT                   IDDLSLPIRAGYSLEIKVPLNAIKIPKSVLTKGNNVFIVNKNSIVEKRNIRIKRINGDI
FT                   IVEKGLKPGDKLIKQPKSTMNDGDKVEISS"
FT   gene            190475..191653
FT                   /locus_tag="SAAV_0166"
FT   CDS_pept        190475..191653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0166"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10111"
FT                   /protein_id="ACY10111.1"
FT                   /translation="MRKVLNIFTIAFKSILKNKGRNIFTMIGIIIGISSVITIMSLGNG
FT                   FKKTAADQFSDAGAGKQEALISFTFKVDEKIKKYPFNQRDIELVNQVDGVLDAKLKENK
FT                   EEGIEATITNVQKKSDIFIIKKQNLHSFKVGRGFDKEDNELRKKIVVINDQVAKTVFNN
FT                   NAIGKSLYIEGQGFEVIGITDKLYSDSSTVIMPENTFNYYMGHLHQGLPTLQIIIEDGY
FT                   NKKTVVKKVESLLNKKGSGSVLGEYTYTDTEEIIKSIDKIFDSITYFVAAVAGISLFIA
FT                   GIGVMNVMYISVAERTEEIAIRRAFGAKSRDIELQFLIESILICVTSGFIGLILGVVFA
FT                   TIIDVLTPDYIKSVVSLSSVIIAVSVSILIGLLFGWIPARAASKKELIDIIK"
FT   gene            191860..192081
FT                   /locus_tag="SAAV_0167"
FT   CDS_pept        191860..192081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10112"
FT                   /protein_id="ACY10112.1"
FT                   /translation="MLKLHKKIAWTGIKGSAITTFITALYNGSSVWNALAVAGIAFGGG
FT                   AGTAVAALGRATVMRFIKRWGVRKTAAW"
FT   gene            192152..193837
FT                   /locus_tag="SAAV_0168"
FT   CDS_pept        192152..193837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10113"
FT                   /protein_id="ACY10113.1"
FT                   /translation="MNNSIFYTYLKFNLRYFIRRKFEIVKRSRLNVTTKILFLIKLIFS
FT                   SLLLFISTIMLADYFSDYIDFIEYYFYASMFIYIVFIPLIPRTKLLINPMDKQLLYRSS
FT                   LREVDIFNLIYASDVLKKFVGYFNLLIVGMAISLYHISPFIFNLKVFCALIYFSTISYV
FT                   IQIIFINIKVISTKKLFSYHYCVFNFMMGSIVSVIGFVVSFLLVNLLIKPFLVFSTYVI
FT                   KSKKTFEWYSYFQDIKNEVIIINEKVMQLLDYISPHTIFMRLNFVNISFVIITIALFIA
FT                   LYYFNKIGFWYRKEDIYLSSTNINFSLPISIKAITTIQLKHWISNKEEVNLHKPFFYIS
FT                   YSIWFFLGCLIYFSQMAYNQLANAVIFILILNTITRDSFSAGTDFFTKSLRFDSDRKSI
FT                   GLYRMSNTDFKQIYDSKLSLIRFIGFKETILAIILLAIFLNQDIYLYIIGFEIIIINTV
FT                   IIPNLSLLPSYLSPHFNHQHYSELESFEEQIFLEDTVFDKVKNFLSSSYFLILFVGYLS
FT                   QRNYIDIMIFIIIFNILALILVSLFIRFSKQKITKSWRKRDLYL"
FT   gene            193905..194339
FT                   /locus_tag="SAAV_0169"
FT   CDS_pept        193905..194339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10114"
FT                   /protein_id="ACY10114.1"
FT                   /translation="MVYYLLNIDLGKMIVAQDLNLQEIFFHNLIYFFSAIFGFLTLGLL
FT                   NIGMLLINSGMLGFFIAHGIYSNQLKSILLVLAPHAIFEILALLIASTFSLGFLSYLYQ
FT                   RMVKKNKIKNKMFHNFVTTIITVIVLTIIASLLEVYVTIN"
FT   gene            194351..195073
FT                   /locus_tag="SAAV_0170"
FT   CDS_pept        194351..195073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0170"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10115"
FT                   /protein_id="ACY10115.1"
FT                   /translation="MLVLNNLQKKFTNSKMVLNNVNAKFRSGSINCIVGVNGAGKTTLL
FT                   NIISSILMPTKGDVYLNSESIFENSTLKKEIFYTPVNPFFYENLSAKDNLYLICSLYNR
FT                   KIDQITIEKTIKDVGLNIEDLNIPVYNFSSGMKQKLNFASMLLVDSNVLLLDEPFNALD
FT                   HVAQKNFTRILKGLVSKEKIIIFTSHLPNTILELSENIYLLKDGCFTDKRKAQSFNQTT
FT                   LETWLLESQKEVIPYEEK"
FT   gene            complement(195946..197538)
FT                   /locus_tag="SAAV_0171"
FT   CDS_pept        complement(195946..197538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0171"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10116"
FT                   /protein_id="ACY10116.1"
FT                   /translation="MSNLLEVNSLNVQFNYDETTVQAVKNVSFELRKKHILGIVGESGS
FT                   GKSITAKSILGLLPDYPDHTLTGEIIFNGQSLNNLSTSALQQIRGKDISMIFQDPLSSL
FT                   NPRLTIGKQITEVLFQHKRVSKSEAKSMTINILEKVGIKHATRQFDAYPHELSGGMRQR
FT                   VMIAMALILKPQILIADEPTTALDASTQNQLLQLMKSLYEYTETSIIFITHDLGAVYQF
FT                   CDDVIVMKDGSVVESGTVESIFKSPQHTYTKRLIDAIPDIHQTRPPRPLNNDILLKFDR
FT                   VSVDYTSPSGSLYRAVNDINLAIRKGETLGIVGESGSGKSTLAKTVVGLKEVSEGFIWY
FT                   NELPLSLFKDDELKSLRQEIQMIFQDPFASINPRFKVIDVIKRPLIIHGKVKDNDDIIK
FT                   TVVSLLEKVGLDQSFLYRYPHELSGGQRQRVSIARALAVEPKVIVCDEAVSALDVSIQK
FT                   DIIELLKQLQLDFGITYLFITHDMGVINEICDRVAVMKNGEIVELNNTEDIIKHPQSDY
FT                   AKQLISEVAVIAK"
FT   gene            197666..198973
FT                   /locus_tag="SAAV_0172"
FT   CDS_pept        197666..198973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0172"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10117"
FT                   /protein_id="ACY10117.1"
FT                   /translation="MYHKAFYKFVLSVLSLPIFLYAVIKFFFSAKRKNFYANNSEISEI
FT                   ERALHQKYKYLSQQKSSTQIHKEALKIFKAQSSNTSSKNIEQAHFSTYFENLLFHKFIM
FT                   IKVILALPMFILLTIYLQPLVRYIFERIVMAVIVIIGVIVSVFTILYFSPLDAAYSILG
FT                   QNATKAQIHQFNVLHHLNEPYFIQLWDTIKGVFTFDLGTTYKGNEVVTKAVGERIPITI
FT                   IVAVLALIVALIIAIPIGIISAMKRNSWLDITLMIIALIGLSIPSFWQGLLFILAFSLK
FT                   LDILPPSYMPEHPISLILPVLVIGTSIAASITRMTRSSVLEVMRSDYVLTAYAKGLSTT
FT                   QVVIKHILKNAIIPIVTLVGLLVAELLGGSAVTEQVFNINGIGRYIVQKQLIPDIPAVM
FT                   GGVVYISIVISLANLIIDIFYALIDPKLRSEINERK"
FT   gene            198979..200142
FT                   /locus_tag="SAAV_0173"
FT   CDS_pept        198979..200142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0173"
FT                   /product="peptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10118"
FT                   /protein_id="ACY10118.1"
FT                   /translation="MVKLTTKIASLKLFASYAIATYILVMLTSALNLFKGYVADTFYIA
FT                   ETLLIILTIILIIILTTEQTWKHHDLWRRIVEVLLLLMALTGNVFTLLMFVSIRRYQRT
FT                   SQIHSYNGWESFIRKTTRHRIAIIGLLILVYMLTLSIVSQFTFDTTLATKNQFNALLHG
FT                   PSLAYPFGTDDFGRDLFTRVVVGTKLTFSISIISVVIAVIFGVLLGTIAGYFNHIDNLI
FT                   MRILDVVFAIPSLLLAVAIIASFGASIPNLIIALSIGNIPSFARTMRASVLEIKRMEYV
FT                   DAARITGENTWNIIWRYILPNAIAPMIVRFSLNIGVVVLTTSSLSFLGLGVAPDVAEWG
FT                   NILRTGSNYLETHSNLAIVPGVCIMFVVLAFNFIGDAVRDALDPRIH"
FT   gene            200159..201934
FT                   /locus_tag="SAAV_0174"
FT   CDS_pept        200159..201934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0174"
FT                   /product="RGD-containing lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10119"
FT                   /protein_id="ACY10119.1"
FT                   /translation="MKKIISIAIIVLALVLSGCGVPTKSEVAQKSSKVEVKGERPTIHF
FT                   LGQASYENDMNIVKDQLENAGFNVKMNIQPDYGSYRTQRQAGNYDIQIDDWMTVFGDPN
FT                   YAMTALFSSTGSNSLLKDKHVDQLLNKASTQNEADVKQTYKQIEDEVVFDKGYMAPLYG
FT                   SKKNLVYDNKVLDKNSVGLPNSRALIWQQFDYNNSRERDTRPLVITQQDGEIPTLDPIR
FT                   SIAPSVYLINMNMYTRLLLLDENDHLTTKGSLSRDYAVNKDNKAFYFLLRDDDYFAKVV
FT                   NGQARNTGERVSAEDVKFSLDRARDKKSVPNNNTYNMHKHINDIKILKDEDIDQLRKEK
FT                   DKDDKSIYDKLIKAYNVKSLTTDGQKVNNKDGIYQIVKITTDQSMPREVNYLTHSSAGI
FT                   LSKKFVNQVNQEYPKGYGDSSTIPANSDGKNALYASGAYIMTQKNAYQATFQRNPGFNE
FT                   TEKGSYGSPKIKNITLKFNGDPNNALSELRNHSIDMLADVNQKHFDLIKSDKNLSIIRK
FT                   NGRKSVFLMLNIKKGIFKTHPNLRQAVVNAIDQDQFIKFYRGDKFKIASPITPLVDTGN
FT                   EQRQDLEKVEKAINQ"
FT   gene            201972..203978
FT                   /gene="ggt"
FT                   /locus_tag="SAAV_0175"
FT   CDS_pept        201972..203978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="SAAV_0175"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10120"
FT                   /protein_id="ACY10120.1"
FT                   /translation="MVINLNDEQTKTSKEGLISVSHPLAAKIGKDVLDQGGNAMDAVIA
FT                   IQLALNVVEPFASGIGGGGYLLYYEQSTGSITAFDARETAPEHVDKQFYLDDSGEYKSF
FT                   FDMTTHGKTVAVPAIPKLFDYIHKRYAKLSLEDLINPAIELAIEGHAANWATEKYSRQQ
FT                   HARLTKYHETAQVFTHENQYWREGDWIVQPELGKTFQILREQGFNAFYKGDIAKQLVNV
FT                   VKACGGTIILEDLANYDIQIKAPISATFKDYDIYSMGPSSSGGITVIQILKLLEHVDLP
FT                   SMGPRSVDYLHHLIQAMHLAYSDRAQYLADDNFHEVPVQSLIDDDYLKARSTLINSNKA
FT                   NIDIEHGVVSDCISHTDVEENHTETTHFCVIDKEGNIASFTTSIGMIYGSGITIPGYGV
FT                   LLNTTMDGFDVVDGGINEIAPYKRPLSNMAPTIVMHHGKPILTVGAPGAISIIASVAQT
FT                   LINVLVFGMDIQQAIDEPRIYSSHPNRIEWEPQFSQSTILALIARGHAMEHKPDAYIGD
FT                   VHGLQVDLNTRDASGGADDTREGTVIGGDVLSIRKQPLPSPKIYDNDTHRVYFNDMQLP
FT                   LYAEQVRWMHDKYWVDESVIRIIFPEVSVHIEDLRSYEIAGKNYIDIAWLARKKGYQVT
FT                   LKDDSLYLTDETYHSVKANTNAYYRYDRDSITR"
FT   gene            complement(204291..205064)
FT                   /locus_tag="SAAV_0176"
FT   CDS_pept        complement(204291..205064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10121"
FT                   /protein_id="ACY10121.1"
FT                   /translation="MKAHKIFWLNLAAIIIISIVVSGGMFLAMKWEQIHLKDGLKKVLS
FT                   TYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHK
FT                   ITGEYDTTTNDRKDATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDL
FT                   TSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLK
FT                   GNNHQDQKLYFYFSSPGKNQIIYKESLTYNKLSEH"
FT   gene            complement(205253..205879)
FT                   /gene="acpD"
FT                   /locus_tag="SAAV_0177"
FT   CDS_pept        complement(205253..205879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="SAAV_0177"
FT                   /product="azoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10122"
FT                   /protein_id="ACY10122.1"
FT                   /translation="MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLF
FT                   ETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSF
FT                   PPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYL
FT                   RTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF"
FT   gene            206088..206666
FT                   /locus_tag="SAAV_0178"
FT   CDS_pept        206088..206666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0178"
FT                   /product="M23/M37 peptidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10123"
FT                   /protein_id="ACY10123.1"
FT                   /translation="MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKG
FT                   QGHSKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNE
FT                   LGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSGNTGKQTTGAHLHFQRM
FT                   KGGVGNAYAEDPKPFIEQLPDGERSLYDL"
FT   gene            207050..208147
FT                   /locus_tag="SAAV_0179"
FT   CDS_pept        207050..208147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0179"
FT                   /product="maltose ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10124"
FT                   /protein_id="ACY10124.1"
FT                   /translation="MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKST
FT                   TLRMVAGLESITSGDFYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLR
FT                   KVNKKEIEQKVNEAAEILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRTEILKLHKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREI
FT                   YDAPNCIFVAQFIGSPAMNMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIIL
FT                   GIRAEDIHEEPIFIQTSPETQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMT
FT                   NDKITLAFDMNKCHFFDEKTGNRIV"
FT   gene            208160..209431
FT                   /locus_tag="SAAV_0180"
FT   CDS_pept        208160..209431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0180"
FT                   /product="maltose ABC transporter, maltose-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10125"
FT                   /protein_id="ACY10125.1"
FT                   /translation="MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQ
FT                   LTMWVDGDKQMAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLA
FT                   HDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLV
FT                   KNAPQTLEEVEANAAKLTDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIH
FT                   QLGLNSKHVVKNAERLQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQET
FT                   FGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEM
FT                   SEITGRVDVKSSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQAL
FT                   DEATNDITQNIKILHPSQNDKKGD"
FT   gene            209434..210702
FT                   /locus_tag="SAAV_0181"
FT   CDS_pept        209434..210702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0181"
FT                   /product="maltose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10126"
FT                   /protein_id="ACY10126.1"
FT                   /translation="MTKRNPKLAALLSVIPGLGQFYNKRPIKGTIFFIFFISFISVFYS
FT                   FLNIGFWGLFTLGTVPKLDDSRVLLAQGIISILLVAFAIMLYVINILDAYRNAERFNRN
FT                   EEIKDPKARMVATWDKTFPYLLISPGTFLLIFVVVFPLIFMFGVAFTNYNLYNAPPRHT
FT                   LEWVGLDNFKTLFTIGVWRKTFFSVITWTLVWTLVATTLQIALGLFLAIIVNHPVVKGK
FT                   KFIRTVLILPWAVPSFVTILIFVALFNDEFGAINNDILQPLLGVAPAWLSDPFWAKVAL
FT                   IGIQVWLGFPFVFALFTGVLQSISSDWYEAADMDGASSWQKFRNITFPHVIYATAPLLI
FT                   MQYAGNFNNFNLIYLFNKGGPPVSGQNAGSTDILISWVYNLTFEFNNFNMGAVVSLIIG
FT                   FIVAIVAFIQFRRTSTFKDEGGL"
FT   gene            210704..211543
FT                   /locus_tag="SAAV_0182"
FT   CDS_pept        210704..211543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0182"
FT                   /product="maltose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10127"
FT                   /protein_id="ACY10127.1"
FT                   /translation="MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGISLNPGTNLYGA
FT                   KMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTAYAFSRYRFVG
FT                   RKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPMNAFLVKGYF
FT                   DTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFILPKILLRSP
FT                   EKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTTGATKG"
FT   gene            211617..212693
FT                   /locus_tag="SAAV_0183"
FT   CDS_pept        211617..212693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0183"
FT                   /product="Gfo/Idh/MocA family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10128"
FT                   /protein_id="ACY10128.1"
FT                   /translation="MTIKVGIIGCGGIANGKHMPSLQKVENVEMIAFCDVDISKAASAA
FT                   EAYGTDNAKVYDDYKALLKDDTIDVIHVCTPNDSHCEITVAGLHAGKHVMCEKPMAKTT
FT                   AEAQKMIDTAKSTGKKLTIGYQNRFRPDSQFLHQAAQRGDLGDIDFGKAHAIRRRAVPT
FT                   WGVFLNEEAQGGGPLIDIGTHALDLTLWMMDNYEPESVMGSTFHKLNKQHDAANAWGSW
FT                   NPDEFTVEDSAFGFIKMKNGATIILESAWAINSLEVDEAKCSLSGTKAGADMKDGLRIH
FT                   GEDMGTLYTKHVELENKGVDFYEGNEVDEAEEEAKAWIDAVVNDTEPVVKPEQAMVVTK
FT                   ILEAIYQSAKSGKAIYFE"
FT   gene            212718..213758
FT                   /locus_tag="SAAV_0184"
FT   CDS_pept        212718..213758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0184"
FT                   /product="Gfo/Idh/MocA family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10129"
FT                   /protein_id="ACY10129.1"
FT                   /translation="MTKLKVGVIGVGGIAQDRHIPALLKLKDTVSLVAVQDINTVQMID
FT                   VAKRFNIPQAVETPSELFKLVDAVVICTPNKFHADLSIEALNHGVHVLCEKPMAMTTEE
FT                   CDRMIEAANKNHKLLTVAYHYRHTDVAMTAKKAIEAGVVGKPLVARVQAMRRRKVPGWG
FT                   VFTNKALQGGGSLIDYGCHLLDLSLWLLGKDMVPHEVLGKTYNQLSKQPNQINDWGTFD
FT                   HTKFDVDDHVTSYMTFANRASMQFECSWSANIKEDKVHVSLSGEDGGINLFPFEIYEPR
FT                   FGTIFESKANVEHNEDIAGERQARNFVNACLGIEEIVVKPEEARNVNALIEAIYRSDLD
FT                   NKSIQL"
FT   gene            213813..214781
FT                   /locus_tag="SAAV_0185"
FT   CDS_pept        213813..214781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10130"
FT                   /protein_id="ACY10130.1"
FT                   /translation="MKIGVFSVLFYDKNFEDMLDYVAESGLDMIEVGTGGNPGDKFCKL
FT                   DELLENEDKRQAFMKSITDRGLQISGFSCHNNPISPDPIEAKEADETLRKTIRLANLLD
FT                   VPVVNTFSGIAGSDDTAKKPNWPVTPWPTAYSEIYDYQWNEKLIPYWQDLAEFAKEQDV
FT                   KIAIELHAGFLVHTPYTMLKLREATNEYIGANLDPSHLWWQGIDPIAAIRILGQANAIH
FT                   HFHAKDTYINQENVNMYGLTDMQPYGNVATRAWTFRTVGYGHSPYVWADIISQLIINGY
FT                   DYVLSIEHEDPIMSVEEGFQKACQTLKSVNIYDKPADMWWA"
FT   gene            complement(215142..215714)
FT                   /locus_tag="SAAV_0186"
FT   CDS_pept        complement(215142..215714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10131"
FT                   /protein_id="ACY10131.1"
FT                   /translation="MTSFIYKILYVVKINAYTYDIMTEDIMILSILLIFFCIRLVSLKI
FT                   SINHSKQLKADGAVEYGVKNSKFLAITHVLIYVLAGVEAFINKDTFSFANGIGLVILIF
FT                   AYIMLFMVIKTLGGIWTLKLFILPNHPIIKSGLYKITKHPNYFLNIIPELIGVLLLTHA
FT                   TYTTILLVPYAYFLYVRIKQEEKLMNI"
FT   gene            215869..217248
FT                   /gene="uhpT"
FT                   /locus_tag="SAAV_0187"
FT   CDS_pept        215869..217248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpT"
FT                   /locus_tag="SAAV_0187"
FT                   /product="sugar phosphate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10132"
FT                   /protein_id="ACY10132.1"
FT                   /translation="MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIR
FT                   NNFKAAQPFLKEEIGLSTLELGYIGLAFSITYGLGKTLLGYFVDGRNTKRIISFLLILS
FT                   AITVLIMGFVLSYFGSVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYLGFW
FT                   NTSHNIGGAIAGGVALWGANVFFHGNVIGMFIFPSVIALLIGIATLFIGKDDPEELGWN
FT                   RAEEIWEEPVDKENIDSQGMTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPL
FT                   YVSEHLHFSKGDAVNTIFYFEIGALVASLLWGYVSDLLKGRRAIVAIGCMFMITFVVLF
FT                   YTNATSVMMVNISLFALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSM
FT                   AKVGLAAIADPTRNGLNIFGYTLSGWTDVFIVFYVALFLGMILLGIVAFYEEKKIRSLK
FT                   I"
FT   gene            complement(217607..218365)
FT                   /locus_tag="SAAV_0188"
FT   CDS_pept        complement(217607..218365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0188"
FT                   /product="AraC family DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10133"
FT                   /protein_id="ACY10133.1"
FT                   /translation="MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQ
FT                   QHQPELVITDIRMPRKNGVDLLNDIALLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKP
FT                   VDHAQLEVILGRLVRTLLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSY
FT                   QTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIAD
FT                   KVGFSEYKMFSYHFKKYLQMSPSDYCKQAK"
FT   gene            complement(218358..219914)
FT                   /locus_tag="SAAV_0189"
FT   CDS_pept        complement(218358..219914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0189"
FT                   /product="sensor histidine kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10134"
FT                   /protein_id="ACY10134.1"
FT                   /translation="MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRT
FT                   IHQHVDESQSSLHHTEKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATL
FT                   YYELSGPNQFITNNYEHLNTKNMYLFSTHQLKFNNSTYMLKIYMANTPRLSEIKKDSRQ
FT                   FALIVDQYDNILYANDDRFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDG
FT                   ITLLIVMAVVLVLLVIFGFISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSE
FT                   LEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITL
FT                   SPKLAQTVVQQLSQMLRYSLRTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSE
FT                   EARHQTIGKMMLQPLIENAIKHGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQ
FT                   YVRQSLNNDVFDTKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVD
FT                   V"
FT   gene            complement(219911..220879)
FT                   /locus_tag="SAAV_0190"
FT   CDS_pept        complement(219911..220879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0190"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10135"
FT                   /protein_id="ACY10135.1"
FT                   /translation="MKSKIYILLLFLIFLSSCANTRHSESDKNVLTVYSPYQSNLIRPI
FT                   LNEFEKQEHVKIEIKHGSTQVLLSNLHNEDFSERGDVFMGGVLSETIDHPEDFVPYQDT
FT                   SVTQQLEDYRSNNKYVTSFLLMPTVIVVNSDLQGDIKIRGYQDLLQPILKGKIAYSNPN
FT                   TTTTGYQHMRAIYSMHHRVSDVHQFQNHAMQLSKTSKVIEDVAKGKYYAGLSYEQDART
FT                   WKNKGYPVSIVYPIEGTMLNVDGIALVKNAHPHPKRKKLVQYLTSRSVQQRLVAEFDAK
FT                   SIRKDVSEQSDQSIENLKNIPLIPKSKLPDIPHHKFLEMIQ"
FT   gene            221467..223716
FT                   /gene="pflB"
FT                   /locus_tag="SAAV_0191"
FT   CDS_pept        221467..223716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="SAAV_0191"
FT                   /product="formate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10136"
FT                   /protein_id="ACY10136.1"
FT                   /translation="MLETNKNHATAWQGFKNGRWNRHVDVREFIQLNYTLYEGNDSFLA
FT                   GPTEATSKLWEQVMQLSKEERERGGMWDMDTKVASTITSHDAGYLDKDLETIVGVQTEK
FT                   PFKRSMQPFGGIRMAKAACEAYGYELDEETEKIFTDYRKTHNQGVFDAYSREMLNCRKA
FT                   GVITGLPDAYGRGRIIGDYRRVALYGVDFLMEEKMHDFNTMSTEMSEDVIRLREELSEQ
FT                   YRALKELKELGQKYGFDLSRPAENFKEAVQWLYLAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YAERDLKAGVITESEVQEIIDHFIMKLRIVKFARTPDYNELFSGDPTWVTESIGGVGID
FT                   GRPLVTKNSFRFLHSLDNLGPAPEPNLTVLWSVRLPDNFKTYCAKMSIKTSSIQYENDD
FT                   IMRESYGDDYGIACCVSAMTIGKQMQFFGARANLAKTLLYAINGGKDEKSGAQVGPNFE
FT                   GINSEVLEYDEVFKKFDQMMDWLAGVYINSLNVIHYMHDKYSYERIEMALHDTEIVRTM
FT                   ATGIAGLSVAADSLSAIKYAQVKPIRNEEGLVVDFEIEGDFPKYGNNDDRVDDIAVDLV
FT                   ERFMTKLRSHKTYRDSEHTMSVLTITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRD
FT                   QKGALSSLSSVAKIPYDCCKDGISNTFSIVPKSLGKEPEDQNRNLTSMLDGYAMQCGHH
FT                   LNINVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM"
FT   gene            223739..224494
FT                   /gene="pflA"
FT                   /locus_tag="SAAV_0192"
FT   CDS_pept        223739..224494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="SAAV_0192"
FT                   /product="pyruvate formate-lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10137"
FT                   /protein_id="ACY10137.1"
FT                   /translation="MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKIS
FT                   EPSREVTVDEMVNEILPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCL
FT                   DTSAGCANDTKAFQRHFEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSD
FT                   MKQPVWIRHVLVPGYSDDKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYE
FT                   LEDVEAPDDEAVKAAYRYVNFKGKIPVEL"
FT   gene            224816..226579
FT                   /locus_tag="SAAV_0193"
FT   CDS_pept        224816..226579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10138"
FT                   /protein_id="ACY10138.1"
FT                   /translation="MKRISKDIWAVFKLLYQNKGRFSINALLLQLIMIFISSTYLILLF
FT                   NMMLKVAGQSQLTINNWMEIISHPASVILLIIFILSVAFLIYVEFSLLVYMVYAGFDRQ
FT                   IITFKSIFKNAFVNVRKLIGVPVIFFVIYLMLMIPIANLGLSSVLTKNIYIPKFLTEEL
FT                   MKTTKGIIIYGTFMIAVFILNFKLIFTLPLTILNRQSLFKNMRLSWQITKRNKFRLVIE
FT                   IVILELIIGAILTLIISGATYLAICVDEEGDKFLVSSILFVVLKSALFFYYLFTKLSLI
FT                   SVLVLHLKQENVLDQPGLEFKYPKPKRKSRFFIISMVLAVTCFLGYNMYLLYNNTINTN
FT                   ISIIGHRGFEDKGVENSIPSLKAAAKANVEYVELDTIMTKDKQFVVSHDNNLKRLTGVN
FT                   KNISESNFKDVVGLKMRQNGHEAKLVSLDEFIETAKQSNVKLLVELKPHGKEPADYTQR
FT                   VIDILKKHGVEHQYRVMSLDYDVMTKLKKEAPYLKCGYIIPLQFGHFKETSLDFFVIED
FT                   FSYSPRLVNQAHLENKEVYTWTINGEEDLTKYLQTNVDGIITDDPALADQIKEEKKDET
FT                   YFDRSIRILFE"
FT   gene            complement(226743..227087)
FT                   /locus_tag="SAAV_0194"
FT   CDS_pept        complement(226743..227087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10139"
FT                   /protein_id="ACY10139.1"
FT                   /translation="MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVD
FT                   QLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNS
FT                   ISNPLHSQNN"
FT   gene            227277..229253
FT                   /locus_tag="SAAV_0195"
FT   CDS_pept        227277..229253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0195"
FT                   /product="staphylococcus coagulase family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10140"
FT                   /protein_id="ACY10140.1"
FT                   /translation="MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKG
FT                   ATVSDYYYWKIIDSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKI
FT                   DEYELYKKWYKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHK
FT                   NVDLKQFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDN
FT                   PHKITNERIKKEMIDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKL
FT                   VEETKKAVKEADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTAGK
FT                   AEETTQPVAQPLVKIPQETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNRPSLS
FT                   DNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEASQY
FT                   GPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQDGTVSY
FT                   GARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPT
FT                   QKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQKKPS
FT                   ETNAYNVTTHADGTATYGPRVTK"
FT   gene            complement(229840..231024)
FT                   /locus_tag="SAAV_0196"
FT   CDS_pept        complement(229840..231024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0196"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10141"
FT                   /protein_id="ACY10141.1"
FT                   /translation="MQEAYIVAYGRSAAAKAKQGALFHERPDDVAAKVLQGVLKRIDGK
FT                   FNKNMIEDVIVGTAFPEGLQGQNIARTIALRAGLSDTVPGQTVNRYCSSGLQTIAIAAN
FT                   QIMAGQGDILVAGGVELMSAVPMGGNEPTNNPTLQYDDIGASYPMGLTAENVASQFDVS
FT                   REDQDAYAVRSHQRAYDAQRDGRFKDEIIPIRVNSVEYTNAGPKVHTNIFDQDEFIRPD
FT                   TTMEALAKLRTVFKADGTVTAGTSAPLSDGAGFVVLMSGDKVKELGVTPIARFVGYKAV
FT                   GVDPKIMGIGPAYAIPEVLSLSNLSVEDIDLIELNEAFASQTIASIKEVGLDISRTNVN
FT                   GGAIALGHPLGATGAMLTARLLNEMGRRPDSRYGMVTMCIGVGMGAAAIFEYVR"
FT   gene            complement(231054..233315)
FT                   /locus_tag="SAAV_0197"
FT   CDS_pept        complement(231054..233315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0197"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10142"
FT                   /protein_id="ACY10142.1"
FT                   /translation="MTINKVTVLGAGTMGAQLAALFVNAGLKVKLLDIVVDKNDPNLIA
FT                   KKSYDKITDKKRPLLFDLNLVSHLTYGNFDDDLVNDDADLYIEAVKEDIEIKHAVWQQV
FT                   LQHAKEDALFATNTSGIPINAIAQAFNEKDQERFFGLHFFNPPRIMKLVELIPTSHTKE
FT                   SIILDVKNFAQNVLGKGVIVVNDVPGFVANRVGTQTMNDIMYRAEQHKLSIVDVDALTG
FT                   QAIGRPKTGTYALSDLVGLDIAVSVIKGMQQVPEETPYFHDVKIVNTLFDNGALGRKTK
FT                   QGFYKKDKETKARLVYDVEKQDYVPVSQPQLPILNEFNKDLVHNLDVIFNAQDEAGLFL
FT                   WETLRNNFYYSAINVPKATDDFRDIDRALVWGFNWKLGPFQLWDAMGYERVKTRMEDEL
FT                   GDLPQWISDLDGGFYKQDETIEYATPVSHFVKDELWDKGDAKLSVTHDDQLLLKLQSKN
FT                   NVITDEFNDALVDAIDLLENDHYTSMVIYADGNNFSVGANLFLMKKAHEDGLVDDVVAQ
FT                   SIDKLHYSFNRLKYSLKPVVTAVQGRALGGGCELVLYSPIVVAASETYIGLVEAGVGLL
FT                   PSGGGLAEMADRILRTSHKFDDKQASMTKVLTNIAFAKVSTNAFEARRYGYLRDTDTII
FT                   FNTAQRVEVALKRAKYEAETNYIPNPRHQYIALGEDFKALIQGQLDAQRRGHFISDHDY
FT                   HIALNIATILAGGDLPRNTFINQRYIQSLEKIGFIDLLKSKKSYERIAHMLKTGKPLRN
FT                   "
FT   gene            complement(233501..234712)
FT                   /locus_tag="SAAV_0198"
FT   CDS_pept        complement(233501..234712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0198"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10143"
FT                   /protein_id="ACY10143.1"
FT                   /translation="MTFEKETVLKTLFPEDVLSIAKGLTDGEVEFLQQVDSLLESKYRE
FT                   NINQHWIDATVPEDYFKDLGELNYFNNPLLYKDRPNAKMPSQLFQFFMSYLLARFDISL
FT                   ATLLGVHQGLGHNTFYFGGSKEQIAKYVPKLQSHELRTCFALTEPEHGSDVAGGLETVA
FT                   ERQGDTWVINGEKKWIGGAHVSDVIPVFAVNKKTGKPHCFVVRPEQDGVDIEVIDNKIA
FT                   LRIVPNALIKLTNVKVDEADRLQNITSFKDIAKILYSTRAGVAYMATGGMAGALRATLD
FT                   YVTERKQFGKPISKYQLIQEKLAMMQGNLAQAMATCAQLANMQAHGEYDEVATSTAKMM
FT                   NALRLRETVAMGRGITGGNGILADDYDIARFFSDAEAIYTYEGTHEINALVIGRALTGD
FT                   SAFV"
FT   gene            complement(234824..236329)
FT                   /locus_tag="SAAV_0199"
FT   CDS_pept        complement(234824..236329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0199"
FT                   /product="long-chain-fatty-acid--CoA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10144"
FT                   /protein_id="ACY10144.1"
FT                   /translation="MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLT
FT                   SQGVKKGDVIGIFAPNDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLF
FT                   YAEKHLSSLTDIDQNLLHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTG
FT                   SPKGVMFSYESFVHNGANLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLIL
FT                   QRYFNGEELNDMIAQYHPTFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSI
FT                   QAAFKQYGINIINGYGLTEAPLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPT
FT                   GEIGELAIKAKNVTPGYWNKPAETAKAFHGRYLLTGDLAKMDDDGDIFIIDRKKELIIT
FT                   GGENVLPSEVENALAEHPLVDRCVVVGYDHPKYGESIAAAIILREDEPHYAEILDQHMR
FT                   SRLAGYKVPRMYVPVTHMPLNSTQKPDKLAIRQMMNDKVSQTL"
FT   gene            complement(236355..237917)
FT                   /locus_tag="SAAV_0200"
FT   CDS_pept        complement(236355..237917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0200"
FT                   /product="acetyl-CoA/acetoacetyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10145"
FT                   /protein_id="ACY10145.1"
FT                   /translation="MKQITWHDLQHIIKDGDVIGLPALAVANLPAEVLRAVLAQHDTYH
FT                   TPKDLTFILANDIHSLGAAPDLDDFIERRMIKRVIMSILTASSKTAQAMKNNDIEAYFL
FT                   PQGIIATHYRQSNQLLPGVITKIGLNTAVDPRYGGGKVNTRTTDDLVSLVTINDETYLH
FT                   YTFPSVDVALLRGTYADQQGNIYLTQEAYLSECYHVALNAKANHGKVIVQVKALVDDYQ
FT                   LKPNEVVIPGNLVDYVYVTEDEKNHRQVIQSHYLPALSGEERIDGIPEPALPFNSRKLI
FT                   LRRAAQFLTYGDTISIGYGINNELSNLLHEECVEHDVQPILDVGIFGGFVGSREHFGMN
FT                   YNADVRMPHDRAWDFIYNNGVSVAYLSFAEVDQYGNVNVSYFNDRLNGCGGFIDITQSV
FT                   NKIIFSGTFVAGSHVSCHNQRLNIETEGQNQKFVSDVSHIDFNAQYSQLLEQEVYFVTD
FT                   RAVFELTNQGLKLIEIAPGLDLHKDILNQMAFKPIIADHLKLIDTSIYKEKWGQLKQSI
FT                   HKV"
FT   gene            238373..239515
FT                   /locus_tag="SAAV_0201"
FT   CDS_pept        238373..239515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10146"
FT                   /protein_id="ACY10146.1"
FT                   /translation="MSSASTQSTKTSDIHNESINKQMEAKAHETAQNADLKTEARSLFD
FT                   NATKSIGRLAGNDESLNLNLKDMFSEVFKPHTKNEADEIFIAGTAKTTPAICDISEEWG
FT                   KPWLFSRVFIAFTVTFIGLWVMAAIFNNTNAIPGLIFIGALTVPLSGLFFFYESNAFKN
FT                   ISIFEVIIMFFIGGVFSLLSTMVLYRFVVFSDQFERFGSLTFFDAFLVGLVEETGKALI
FT                   IVYFVNKLKTNKILNGLLIGAAIGAGFAVFESAGYILNFALGENVPLLDIVFTRAWTAI
FT                   GGHLVWSAIVGAAIVIAKEQHGFEFKDIFDKRFLIFFLSAVGLHGIWDTSLTVLGSDTL
FT                   KIFILIVIVWILVFILMGAGLKQVNLLQKEFKEQQKKVDE"
FT   gene            complement(239829..241304)
FT                   /locus_tag="SAAV_0202"
FT   CDS_pept        complement(239829..241304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0202"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10147"
FT                   /protein_id="ACY10147.1"
FT                   /translation="MKFKRLATIFSAVLVLSGCGSMHSSGKDLNISLPLKTKSIAPYET
FT                   DVPVKIGAAESLFKTNDQGKIEKALVKSYHQPNDTTLDIELKDNIKFQNGQKLTAEKVK
FT                   SSLENSMKKSDLVKYSLPISSITAKGQKLTIKTNSAYPELVSELANPFMAIYYTDAKSD
FT                   VNQTPVGTGPYQIKDYKQSRKISLSNFKDYWQGKPKLDHITVTYQEDGNNRVRNLESQK
FT                   DDLITDVPVNKVHDIENNQNLKVSKESGFRTSLLMYNHTNKKMTKSVREALDHIIDRQG
FT                   IADHIYQGYAKPATSPFNDKIPYIKEPKLTKQNIEQAKTLLAKDGYTKEHPLKIKLITY
FT                   DGRPELSKIAQVLQSDAKKANIEIDIKSVDDIEGYLKDRSAWDATMYSFGTIPRGDTGY
FT                   FFNQAYKKDGAINKGDYNNSNVDDLINQLNHTVDVKERHNISNDIIKLSSRDVPNSYIA
FT                   YNDQIVAANSKVKNYKVTPEGIYLIDYRTTIER"
FT   gene            complement(241502..241858)
FT                   /locus_tag="SAAV_0203"
FT   CDS_pept        complement(241502..241858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10148"
FT                   /protein_id="ACY10148.1"
FT                   /translation="MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIA
FT                   PSTELRQWFQHDPKLFGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDT
FT                   KHNQAVVLQQLLNT"
FT   gene            complement(242015..242188)
FT                   /locus_tag="SAAV_0204"
FT   CDS_pept        complement(242015..242188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10149"
FT                   /protein_id="ACY10149.1"
FT                   /translation="MKLNQRYVKVFALYFVSIVTANIIVKNNNLIKTLIQTIAGYTVFA
FT                   VGLKYLTKRKNK"
FT   gene            complement(242214..243359)
FT                   /locus_tag="SAAV_0205"
FT   CDS_pept        complement(242214..243359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0205"
FT                   /product="flavohemoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10150"
FT                   /protein_id="ACY10150.1"
FT                   /translation="MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQ
FT                   TNQKRGMQSSALAQAVMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGENLLK
FT                   AIQDVTGLEEHDPVIQAWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESED
FT                   IKSFTVETEEYDFSEFTPGQYITVDVSSDKLPYRAKRHYSIVSGEKNHLTFGVKRDVTT
FT                   EHEGEVSTILHDEIKEGDMINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASA
FT                   KGLDTQMVQVAENEQHLPFKDNFNSIASHYDNAKLYTHLKDKQGYIGTEELQAFLANKP
FT                   EIYICGGTKFLQSMIEALKSLNYDMDRVHYETFIPRLSVAV"
FT   gene            243932..244885
FT                   /gene="ldh1"
FT                   /locus_tag="SAAV_0206"
FT   CDS_pept        243932..244885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh1"
FT                   /locus_tag="SAAV_0206"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10151"
FT                   /protein_id="ACY10151.1"
FT                   /translation="MNKFKGNKVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVR
FT                   GDVMDLKHATPYSPTTVRVKAGEYSDCHDADLVVICAGAAQKPGETRLDLVSKNLKIFK
FT                   SIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTILDSARFRLLLSEA
FT                   FDVAPRSVDAQIIGEHGDTELPVWSHANIAGQPLKTLLEQRPEGKAQIEQIFVQTRDAA
FT                   YDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTVSALLEGEYDEEDVYIGVPAVINRN
FT                   GIRNVVEIPLNDEEQSKFAHSAKTLKDIMAEAEELK"
FT   gene            complement(245053..245178)
FT                   /locus_tag="SAAV_0207"
FT   CDS_pept        complement(245053..245178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10152"
FT                   /protein_id="ACY10152.1"
FT                   /translation="MATMYEVRSDIVAFIFNVTFEALSSSYTVVSPQIASARQSS"
FT   gene            complement(245205..246734)
FT                   /locus_tag="SAAV_0208"
FT   CDS_pept        complement(245205..246734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0208"
FT                   /product="PTS system, IIBC components"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10153"
FT                   /protein_id="ACY10153.1"
FT                   /translation="MKSLFEKAQQFGKSFMLPIAILPAAGLLLGIGGALSNPNTVKAYP
FT                   ILDITLLQNIFTLMSAAGSIVFQNLPVIFAIGVAIGLSRSDKGTAGLAALLGFLIMNAT
FT                   MNGLLTITGTLAKDQLAQNGQGMVLGIQTVETGVFGGIITGIMTAILHNKYHKVVLPPY
FT                   LGFFGGSRFVPIVTAFAAIFLGVLMFFIWPSIQAGIYHVGGFVTKTGAIGTFVYGFILR
FT                   LLGPLGLHHIFYLPFWQTALGGTLEVKGHLVQGTQNIFFAQLGDPDVTKYYSGVSRFMS
FT                   GRFITMMFGLCGAALAIYHTAKPEHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPI
FT                   LYVIHAFFDGLAFMMADIFNITIGQTFSGGFIDFLLFGVLQGNSKTNYLYVIPIGIVWF
FT                   CLYYIVFRFLITKFNFKTPGREDKAAAQQVEATERAQTIVAGLGGKDNIEIVDCCATRL
FT                   RVTLNQNDKVDKVLLESTGAKGVIQQGTGVQVIYGPHVTVIKNEIEELLGD"
FT   gene            247096..248031
FT                   /locus_tag="SAAV_0209"
FT   CDS_pept        247096..248031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0209"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10154"
FT                   /protein_id="ACY10154.1"
FT                   /translation="MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDK
FT                   NTTNALNVLDIMGRQDIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAM
FT                   PASDVIINKVMTSDTPVTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPT
FT                   AEFNIWVDAEAAKRVFESGITINVFGLDVTHQVLADNHVIERFESINNPVAQFVVELLQ
FT                   FFKKTYKTHFNMDGGPIHDACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHV
FT                   TGKPANAYFATAVDVEEVWNLIDHKLRTYE"
FT   gene            248369..250465
FT                   /locus_tag="SAAV_0210"
FT   CDS_pept        248369..250465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0210"
FT                   /product="BglG family transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10155"
FT                   /protein_id="ACY10155.1"
FT                   /translation="MNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINLWL
FT                   EQEGYPKLERTSQGNFIVSSEIMTLFKRDVSEQQMLNGNNVIFSIETRRYYLMLMLFSK
FT                   ENAMSLNHFSIDLQVSKNTVIHDINHVKEQLEDHGLSLKYSRKHGYEIVGDEFEVRRFF
FT                   IKLIDQRLNHDITKSEVLKALNLTFEDIAYQKDKIKQVEQFLKSRFIDKSLSSLPYVLC
FT                   VIRRRIQSGHVMNPLNINYQYLRDTKEYQATEIMTQHEPDLPEAEKLYLTLHLLSTSVQ
FT                   WTDLQESDNISNLTMAIAQMIHHFEQITFINIEDKEKLSQQLLLHLTPAFYRIKYNLTD
FT                   RDELINPLQGNYQSLFHMVKQSCQSLTEYFGKSLPDNEIAYLTMLFGGSLRRQDENFDG
FT                   KIKAIIVCTQGTSVSQMMLYELRNLFPEIIFLDAISLRTFENYTLDYDIVFSPMFVLTH
FT                   KKLFITKVALSENEQRKLRKEVMKYINKESADIDKEINKLMALIERTTTVNDITELRDG
FT                   LEDFIANYNSISTINGSIVTQNKTLDLADLIPARHVKRMHHVENIDEAIAKASDVLVAN
FT                   HFIDIKYIHEMQQVFDDSYMVIMQNIAIPHAYSEKHVHKTAMSMLILQEPIYMSDGTAI
FT                   HIIVPIAAVDKVTHLRALLQLRDVAQDNDAIKRIIQSRKNSDVNEILKNYSNKEARENG
FT                   WDSN"
FT   gene            250450..250917
FT                   /locus_tag="SAAV_0211"
FT   CDS_pept        250450..250917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0211"
FT                   /product="PTS system, sugar-specific IIA component,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10156"
FT                   /protein_id="ACY10156.1"
FT                   /translation="MGQQLVHKENIMLNLSATDKESVLSQMSDVLFQNGFVKSTFKDAV
FT                   IDREKEFATGLPTHLCSVAIPHTDVEHINHRTIGVAVLEKEVPFIEMGTLDQQTEVKIV
FT                   FMLAMDKVDDQLKLLQQLMQIFQSEEKLEQILRTKDETILATLINDYLEYN"
FT   gene            250940..251218
FT                   /locus_tag="SAAV_0212"
FT   CDS_pept        250940..251218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0212"
FT                   /product="PTS system, sorbitol-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10157"
FT                   /protein_id="ACY10157.1"
FT                   /translation="MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGP
FT                   YEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK"
FT   gene            complement(251283..251417)
FT                   /locus_tag="SAAV_0213"
FT   CDS_pept        complement(251283..251417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10158"
FT                   /protein_id="ACY10158.1"
FT                   /translation="MSRYFPIVITFDVTVISTTTLATFDCSPFELQSLRFYVINNHLS"
FT   gene            251445..252704
FT                   /locus_tag="SAAV_0214"
FT   CDS_pept        251445..252704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0214"
FT                   /product="PTS system, sorbitol-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10159"
FT                   /protein_id="ACY10159.1"
FT                   /translation="MSYFTDFVRGFLDLGATVILPVVIFLLGLFFRQKIGAAFRSGLTI
FT                   GVAFVGIFLVIDLLVKNLGPAAQAMVKNLGVSLNVIDVGWPATSSIAWASSVAAFIIPL
FT                   GIIVNVVLLVTKVTKTMNVDIWNFWHYTFTAAMVYAVSGSIWQALLAAVIFQVICLKVA
FT                   DWTAPMMSEFFDLPGVSIATGSTISYAPGIYLVKLLQKVPGLNKLDADPETIQKRFGAF
FT                   GESIFVGLILGLGIGVLAGYKPGDIINLGMSMAAVMVLMPRMVKILMEGLMPVSESART
FT                   WLNKRFGEREIYIGLDAAVALGHPAVISTALILVPITVLLAVILPGNQVLPFGDLATIP
FT                   FVVAFIVGAARGNIIHSVIVGTIMIAISLYIATDVAPIFTDMAKGTNVQMPKGSSEISS
FT                   IDQGGNIVNYLIFKLFSLFN"
FT   gene            252722..253777
FT                   /locus_tag="SAAV_0215"
FT   CDS_pept        252722..253777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0215"
FT                   /product="sorbitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10160"
FT                   /protein_id="ACY10160.1"
FT                   /translation="MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHT
FT                   YEGHYKVNFPVTLGHEFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNL
FT                   CNHRKGIGTQVDGAFTNYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSG
FT                   DVAVVMGPGPIGLLVAQVLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKT
FT                   YINGITDGYGADVVVECSGAVPAARQGLDIIRKKGFYSQIGIFKDAEIPFDMEKVIQKE
FT                   ITVVGSRSQKPADWEPSLQLMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLK
FT                   PLDLDENEGEN"
FT   gene            253779..253925
FT                   /locus_tag="SAAV_0216"
FT   CDS_pept        253779..253925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10161"
FT                   /protein_id="ACY10161.1"
FT                   /translation="MVESMLTFMLGPLRQITDFYMEHLLVSNSIVIAGYFATGIFKKKK
FT                   VVN"
FT   gene            253949..254993
FT                   /pseudo
FT                   /locus_tag="SAAV_0217"
FT                   /note="hexitol dehydrogenase"
FT   gene            255521..256237
FT                   /gene="ispD"
FT                   /locus_tag="SAAV_0219"
FT   CDS_pept        255521..256237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="SAAV_0219"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10162"
FT                   /protein_id="ACY10162.1"
FT                   /translation="MIYAGILAGGIGSRMGNVPLPKQFLDIDNKPILIHTIEKFILVSE
FT                   FNEIIIATPAQWISHTQDILKKYNITDQRVKVVAGGTDRNETIMNIIDHIRNVNGINND
FT                   DVIVTHDAVRPFLTQRIIKENIEVAAKYGAVDTVIEAIDTIVMSKDKQNIHSIPVRNEM
FT                   YQGQTPQSFNIKLLQDSYRALSSEQKEILSDACKIIVESGHAVKLVRGELYNIKVTTPY
FT                   DLKVANAIIQGDIADD"
FT   gene            256230..257255
FT                   /locus_tag="SAAV_0220"
FT   CDS_pept        256230..257255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0220"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10163"
FT                   /protein_id="ACY10163.1"
FT                   /translation="MINQVYQLVAPRQFDVTYNNVDIYGNHVIVRPLYLSICAADQRYY
FT                   TGRRDENVLRKKLPMSLVHEAVGEVVFDSKGVFEKGTKVVMVPNTPTEQHHIIAENYLA
FT                   SSYFRSSGYDGFMQDYVVMAHDRIVPLPNDIDLSTISYTELVSVSYHAIQRFERKSIPL
FT                   KNSFGIWGDGNLGYITAILLRKLYPEAKIYVFGKTDYKLSHFSFVDDIFTVNQIPDDLK
FT                   IDHAFECVGGKGSQVALQQIVEHISPEGSIALLGVSELPVEVNTRLVLEKGLTLIGSSR
FT                   SGSKDFEQVVDLYRKYPDIVEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGKTVLKWT
FT                   I"
FT   gene            257277..258971
FT                   /locus_tag="SAAV_0221"
FT   CDS_pept        257277..258971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0221"
FT                   /product="teichoic acid biosynthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10164"
FT                   /protein_id="ACY10164.1"
FT                   /translation="MTKTKQAIHIDNIYWERVQLYIEGHSEGVDLTSGQFVLRNLTETK
FT                   TLEANEMKIDGNTFICRFNVAILDDGYYLPMDKYLFVYHDQLEYIGQLNPNIIDQAYAA
FT                   LNEEQIEEYNELTTQNGKVNYLLAYDAKVFRKGGVSQHTVYTITPEIASDVNEFVFDIE
FT                   ITLPQEKSGVIATSAHWLHKQGHKASFESRSFLFKAIFNITKLLHIKRSKTILFTSDSR
FT                   PNLSGNFKYVYDELLRQKVDFDYDIKTVFKANITDRRKWRDKFRLPYLLGKADYIFVDD
FT                   FHPLIYTVRFRPSQEIIQVWHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSET
FT                   DIPFYAEAFGIREENVVPTGVPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTF
FT                   RGNGHGTAHYPFFKIDFERLARYCEKHNAVVLFKMHPFVKNRLNISREHRQYFIDVSDH
FT                   REVNDILFVTYLLISDYSSLIYEYAVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKI
FT                   VQSFDALMDALDTEDYEVEKVVPFLDKHFKYQDGRSSERLVKDLFRR"
FT   gene            259399..260568
FT                   /locus_tag="SAAV_0222"
FT   CDS_pept        259399..260568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0222"
FT                   /product="TagF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10165"
FT                   /protein_id="ACY10165.1"
FT                   /translation="MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPK
FT                   ALYEYLTEHSDAQLIWGVKKGYEHIFQQHNVPYVTKFSMKWFLAMPRAKAWMINTRTPD
FT                   WLYKSPRTTYLQTWHGTPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPY
FT                   STSIFQHAFHVSRDKILETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTW
FT                   RDDEAIREGSYQFNVNFDIEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYED
FT                   ISDLYLISDALVTDYSSVMFDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIV
FT                   ENQTALIDALKQIDETANEYIEARTVFYQKFCSLEDGQASQRICQTIFK"
FT   gene            260844..261560
FT                   /gene="ispD_1"
FT                   /locus_tag="SAAV_0223"
FT   CDS_pept        260844..261560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD_1"
FT                   /locus_tag="SAAV_0223"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10166"
FT                   /protein_id="ACY10166.1"
FT                   /translation="MKYAGILAGGIGSRMGNVPLPKQFLDLDNKPILIHTLEKFILIND
FT                   FEKIIIATPQQWMTHTKDTLRKFKISDERIEVIQGGSDRNDTIMNIVKHIESTNGINDD
FT                   DVIVTHDAVRPFLTHRIIKENIQAALEYGAVDTVIDAIDTIVTSKDNQTIDAIPVRNEM
FT                   YQGQTPQSFNINLLKESYAQLSDEQKSILSDACKIIVETNKPVRLVKGELYNIKVTTPY
FT                   DLKVANAIIRGGIADD"
FT   gene            261553..262578
FT                   /locus_tag="SAAV_0224"
FT   CDS_pept        261553..262578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0224"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10167"
FT                   /protein_id="ACY10167.1"
FT                   /translation="MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYY
FT                   TGSRDENVLSQKLPMSLIHEGVGEVVFDSKGVFNKGTKVVMVPNTPTEKDDVIAENYLK
FT                   SSYFRSSGHDGFMQDFVLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKSISN
FT                   KNTFGIWGDGNLGYITAILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLT
FT                   FDHAFECVGGRGSQSAINQMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSR
FT                   SGSKDFQDVVDLYIQYPDIVDKLALLKGQEYEIATINDLTEAFEADLSTSWGKTVLKWI
FT                   M"
FT   gene            262600..264288
FT                   /locus_tag="SAAV_0225"
FT   CDS_pept        262600..264288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0225"
FT                   /product="teichoic acid biosynthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10168"
FT                   /protein_id="ACY10168.1"
FT                   /translation="MVKSKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTM
FT                   KANDVKIDGNQFVCRFNVAILDNGYYLPEDKYLLVNEQELDYIAQLNPDVINDAYQNLK
FT                   PEQEEEYNELETQNGKINFLLQTYLKEFRKGGISKKTVYTVTPEISSDVNEFVLDVVVT
FT                   TPEVKSIYIVRKYKELRKYFRKQSFNTRQFIFKAIFNTTKFFHLKKGNTVLFTSDSRPT
FT                   MSGNFEYIYNEMLRQNLDKKYDIHTVFKANITDRRGIIDKFRLPYLLGKADYIFVDDFH
FT                   PLIYTVRFRRSQEVIQVWHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDI
FT                   PFYAEAFGIKEKNVVPTGVPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRG
FT                   SGHGTAHYPFFKIDFERLARYCEKNNAVVLFKMHPFVKNRLNIADKHKQYFVDVSDFRE
FT                   VNDILFITDLLISDYSSLIYEYAVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQ
FT                   SFDALMDALDNEDYEGEKVIPFLDKHFKYQDGRSSERLVRNLFGS"
FT   gene            264324..266042
FT                   /locus_tag="SAAV_0226"
FT   CDS_pept        264324..266042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0226"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10169"
FT                   /protein_id="ACY10169.1"
FT                   /translation="MKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTDQ
FT                   TLQIVEKYRNKLNLKVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYINKETLKDA
FT                   AAFIDEHHSDVLLIKMKGVNGRGVPQSMFKETAPEVTLLNSRIIYTLSPTKIYRTALLK
FT                   DNDIYFPEELKSAEDQLFTMKAYLNANRISVLSDKAYYYATKREGEHMSSAYVSPEDFY
FT                   EVMRLIAVEILNADLEEAHKDQILAEFLNRHFSFSRTNGFSLKVKLEEQPQWINALGDF
FT                   IQAVPERVDALVMSKLRPLLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFNE
FT                   GEPYFEGIDIAKPKVKMTAFKFDNHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTMY
FT                   VPLSVNANKQYRFNIMLEDIKAYLPKEKIWDVFLEVQIGTEVFEVRVGNQRNKYAYTAE
FT                   TSALIHLNNDFYRLTPYFTKDFNNISLYFTAITLTDSISMKLKGKNKIILTGLDRGYVF
FT                   EEGMASVVLKDDMIMGMLSQTSENEVEILLSKDIKKRDFKNIVKLNTAHMTYSLK"
FT   gene            266186..266860
FT                   /gene="scdA"
FT                   /locus_tag="SAAV_0227"
FT   CDS_pept        266186..266860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scdA"
FT                   /locus_tag="SAAV_0227"
FT                   /product="cell wall biosynthesis protein ScdA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10170"
FT                   /protein_id="ACY10170.1"
FT                   /translation="MINKNDIVADIVIDYPKAADIFRSVGIDFCCGGQVSIEAASLEKK
FT                   NVDLNELLQRLNDVEQTNTPGSLNPKFLNVSSLIQYIQAAYHEPLREEFKNLTPYVTKL
FT                   SKVHGPNHPYLVELKETYDTFKSGMLEHMQKEDDVDFPKLIKYEQGEVVNDINTVIDDL
FT                   VSDHIATGQLLVKMSDLTSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKK
FT                   VS"
FT   gene            267120..268859
FT                   /gene="lytS"
FT                   /locus_tag="SAAV_0228"
FT   CDS_pept        267120..268859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytS"
FT                   /locus_tag="SAAV_0228"
FT                   /product="sensor histidine kinase LytS"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10171"
FT                   /protein_id="ACY10171.1"
FT                   /translation="MLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLCIIFSL
FT                   FALMSNLTGIVIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLFVGVIS
FT                   GIFRVYMGGADAQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEMIQMLS
FT                   ILTFSHDKAYAVDLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHDVLQLM
FT                   NQTLPYFKEGLNRESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPTNEILT
FT                   SLSKDVLKSGKLKEVHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTNPNDLT
FT                   FVERQLAEGLANIFSSQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTISALVR
FT                   INSEKARELLLELSYFFRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFNININV
FT                   EDKYRDVLVPPFLIQILVENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDNGQGIS
FT                   KDKMHLLGETSVESESGTGSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVLPYERQ
FT                   EEE"
FT   gene            268862..269602
FT                   /gene="lytR"
FT                   /locus_tag="SAAV_0229"
FT   CDS_pept        268862..269602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytR"
FT                   /locus_tag="SAAV_0229"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10172"
FT                   /protein_id="ACY10172.1"
FT                   /translation="MKALIIDDEPLARNELTYLLNEIGGFEEINEAENVKETLEALLIN
FT                   QYDIIFLDVNLMDENGIELGAKIQKMKEPPAIIFATAHDQYAVQAFELNATDYILKPFG
FT                   QKRIEQAVNKVRATKAKDDNNASAIANDMSANFDQSLPVEIDDKIHMLKQQNIIGIGTH
FT                   NGITTIHTTNHKYETTEPLNRYEKRLNPTYFIRIHRSYIINTKHIKEVQQWFNYTYMVI
FT                   LTNGVKMQVGRSFMKDFKASIGLL"
FT   gene            269715..270158
FT                   /gene="lrgA"
FT                   /locus_tag="SAAV_0230"
FT   CDS_pept        269715..270158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgA"
FT                   /locus_tag="SAAV_0230"
FT                   /product="murein hydrolase regulator LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10173"
FT                   /protein_id="ACY10173.1"
FT                   /translation="MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPASVI
FT                   GLVLLFVLLCTGAVKLGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLI
FT                   IVSTILLLICTGYVTQIIMKVTSRSKGDKVTKKIKIEEAQAHD"
FT   gene            270151..270852
FT                   /gene="lrgB"
FT                   /locus_tag="SAAV_0231"
FT   CDS_pept        270151..270852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgB"
FT                   /locus_tag="SAAV_0231"
FT                   /product="antiholin-like protein LrgB"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10174"
FT                   /protein_id="ACY10174.1"
FT                   /translation="MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMV
FT                   FGVAFLYLTGIPYKTYKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIG
FT                   TVVALLIILTFAKLAQFANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVI
FT                   IYALGNKFLKLFRITNPIARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVV
FT                   AVVPVFVAIFF"
FT   gene            complement(270960..271664)
FT                   /locus_tag="SAAV_0232"
FT   CDS_pept        complement(270960..271664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0232"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10175"
FT                   /protein_id="ACY10175.1"
FT                   /translation="MLKYEHIAKQLNAFIHQSNFKPGDKLPNVTQLKERYQVSKSTIIK
FT                   ALGLLEQDGLIYQAQGSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEMAT
FT                   PPKSVQDELQLNADDTVYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYL
FT                   ESNMKLRIGFSDIFFNVDKLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFH
FT                   YRHAQFYIPSKK"
FT   gene            271813..272604
FT                   /locus_tag="SAAV_0233"
FT   CDS_pept        271813..272604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0233"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10176"
FT                   /protein_id="ACY10176.1"
FT                   /translation="MSNKYKEQAQDILTAVGGVENIVDATYDTKCITIHMQHTIPSTAN
FT                   EVKQIVDVTSVAENDAQLVIKLNGNVDEVYQQLQRLIKNANVEESENTDNINSQDTSYT
FT                   PQVKVTTPILVKAPIAGRRILLKEVRDSIFREKMVGEGLAIKAHEESKVIAPFNGLISM
FT                   IVPTKHAVGIQSEDGVDIVIHIGVNTVDLEGKGFKCFVKQNDHVEAGQTLLQFDQQYIQ
FT                   QQGYNADVIVVISNSADLGKVELTMNEIITTEDVIFKIFKN"
FT   gene            272620..274056
FT                   /gene="bglA"
FT                   /locus_tag="SAAV_0234"
FT   CDS_pept        272620..274056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="SAAV_0234"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10177"
FT                   /protein_id="ACY10177.1"
FT                   /translation="MTKLPQNFMWGGALAANQFEGGYEKGGKGLSVIDVMTSGAHGKAR
FT                   QITESIDLNHYYPNHEGIDFYHRYKEDIALFKEMGLKCLRTSIAWTRIFPNGDEDVPNE
FT                   EGLAFYDRIFDELIAQGIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFER
FT                   YKDKVTYWMTFNEINNQMDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAV
FT                   RLGKEINPKFKIGTMISHVPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKK
FT                   MLARKGYDVGWQEGDDSILQQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVE
FT                   NPHIATSDWGWAIDPDGLRYTLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEY
FT                   LKAHITAAIEAVDQDGVDLIGYTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMER
FT                   LKKDSFYWYQQVIASNGDKL"
FT   gene            complement(274543..275304)
FT                   /locus_tag="SAAV_0235"
FT   CDS_pept        complement(274543..275304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10178"
FT                   /protein_id="ACY10178.1"
FT                   /translation="MSKEAGHTFLAKLGKTRLRPGGKEATDWLIQQGAFSQDKQVLEVA
FT                   CNMCTTSIYLAHTYGCHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDN
FT                   QFDIVLNEAMLTMLPIAIKEKALREYYRVLKPGGILLTHDIVIVNESHATHVVKSLSAA
FT                   INVNVSPQTKLGWLDLYHQAGFNHVHYHTGPMSLMTPKGLIYDEGIVGTIKIIKNALKK
FT                   ENRPMFCKMFKTMTKLRKDMNYITFVAKKED"
FT   gene            complement(275555..276469)
FT                   /gene="rbsK"
FT                   /locus_tag="SAAV_0236"
FT   CDS_pept        complement(275555..276469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="SAAV_0236"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10179"
FT                   /protein_id="ACY10179.1"
FT                   /translation="MTNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGAN
FT                   QAIATARMQADTTFITKIGTDGVADFILEDFKAAHIDTSYIIKTTEAKTGQAFITVNAE
FT                   GQNTIYVYGGANMTMTPEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTV
FT                   LNPAPAKALPNELLSLIDIIVPNETEAELLSGIKVTNEQSMKDNANYFLSLGIKTVLIT
FT                   LGKQGTYFATKNQSQHIEAYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKA
FT                   SSLTVQKHGAQASIPLLEEVNQV"
FT   gene            complement(276497..276901)
FT                   /locus_tag="SAAV_0237"
FT   CDS_pept        complement(276497..276901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0237"
FT                   /product="D-ribose pyranase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10180"
FT                   /protein_id="ACY10180.1"
FT                   /translation="MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVT
FT                   KNLPRFIDVLATVLEEMEIQKIYLAEEIKEHNPTQLQQIKQLISSEIEIIFIPHEEMKS
FT                   NLAHPLNKGNIRTGETTPYSNIALESNVTF"
FT   gene            complement(276916..277797)
FT                   /locus_tag="SAAV_0238"
FT   CDS_pept        complement(276916..277797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10181"
FT                   /protein_id="ACY10181.1"
FT                   /translation="MSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFA
FT                   IILAVVTSSGFPTGTNLLFALLSGAGWGFGQIITFKAFELIGSSRAMPVTTAFQLLGAS
FT                   LWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEF
FT                   GYWLYSAAPQATSIDGLTAFLPQAMGMVIVAVIYGFMNMKSENPFRNKITWLQIISGFF
FT                   FAFGALTYLISAQPNMNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVL
FT                   ILVAASVTVFIK"
FT   gene            complement(278029..279063)
FT                   /locus_tag="SAAV_0239"
FT   CDS_pept        complement(278029..279063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0239"
FT                   /product="ribose operon repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10182"
FT                   /protein_id="ACY10182.1"
FT                   /translation="MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSER
FT                   LGYAPNKHAKQLRGSKIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDL
FT                   YDNIKHLIDRGIDGLIIAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQ
FT                   GYTDFVRTNEYQGGQLAAQHLIELGHNHMIIVAPYDMMANMSTRVAGFVDTLRANQLPE
FT                   PQIVHTELSKRGGLTIVDDIMVQSATAIFAINDELAIGILRGLIEHGISIPKDISLIGY
FT                   DDIDYAAYVSPPLTTVAQPITDIGKTSLTLLLQRLQHLDKSIDMIELPTTLKIRATTGY
FT                   HLSN"
FT   gene            279280..279393
FT                   /locus_tag="SAAV_0240"
FT   CDS_pept        279280..279393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10183"
FT                   /protein_id="ACY10183.1"
FT                   /translation="MFIVMKNTKVIILKNKIFVFEQSIKKHNEMMYIELCD"
FT   gene            279443..279835
FT                   /locus_tag="SAAV_0241"
FT   CDS_pept        279443..279835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10184"
FT                   /protein_id="ACY10184.1"
FT                   /translation="MQFKLKEEEIISFLELKYPEKEFEYGRLLVGQHKRDDLDVYYFGD
FT                   TFLMCTIISFKTFEIKETVELSYDAVNRIVLKDGWLFRKMRIETMQKVLKYGTSKLMVT
FT                   DFQKENYNKYIQGQKQRVIFENGHFV"
FT   gene            complement(279963..281339)
FT                   /locus_tag="SAAV_0242"
FT   CDS_pept        complement(279963..281339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0242"
FT                   /product="drug transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10185"
FT                   /protein_id="ACY10185.1"
FT                   /translation="MNNTQSSPRSNIIIAIMLSALTYWLFAQSFINIGPLVGQTYQTSP
FT                   AVLNLSISLTSFATGIFMVAAGDIADKIGQLRMTYMGLIISMFASLLLIISDITALLII
FT                   GRILQGLSAAILLPSTVGVLNNQFKGEHLRRAISYLMISTVGGIGLAGVIGGLIATNFG
FT                   WQMNFIISIVIAFIAILLLKGTPEKVSQHSHRHPFDYKGMSIFAVMIGSFTLLLTQGFE
FT                   QGWFSTFSFICLSIFIITTLIFIIIERRHEVPFIDFSVLRNRPFIGAFLNNFVLNSGLG
FT                   VTVVFFIYAQTHLGLSAAQSGLVTLPYAIVAVAMIRLGEKATLRFGGKLMLIIGPLFPV
FT                   IGITIISMTQLSASQYVIAVIIGFVICAIGNGLVATPGLTIAIFSMPNEKVGLATGLYK
FT                   MSGTLGGAFGIALSTTVFSMLQLNYAPSVAATVTFIVSIVLMILGSLSAYMIIPKTVKS
FT                   "
FT   gene            281573..282565
FT                   /locus_tag="SAAV_0243"
FT   CDS_pept        281573..282565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0243"
FT                   /product="choloylglycine hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10186"
FT                   /protein_id="ACY10186.1"
FT                   /translation="MCTGFTIQTLNNQVLLGRTMDYDYPLDGSPAVTPRNYRWTSRTGT
FT                   TGQTQYGFIGTGTDMEGFIYGDGVNEHGVAISTQYFRGYSSYGSTHKADAMNITQNEIV
FT                   TWILGYTTSIEDMKQQASQIHVVAVYLNDIGEVPPLHYHVSDATGHSVEVSFKEGEVVI
FT                   KDNPIGVLTNHPDLDWHYSNLRQYINISPYPATAKLLEGVTIEPLGNEAGTFGLPGGFT
FT                   STERFVRMAFMKANIAQNNDKEMDLMNAFYLLDAVNIPIGIVRPHDADNHYTMYQTVIN
FT                   LTTRTLYIKYYGSNEIVALKLTDDLINRKDMTIFKPEKHITIRKLNDNQ"
FT   gene            282891..283841
FT                   /gene="lytM"
FT                   /locus_tag="SAAV_0244"
FT   CDS_pept        282891..283841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytM"
FT                   /locus_tag="SAAV_0244"
FT                   /product="peptidoglycan hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10187"
FT                   /protein_id="ACY10187.1"
FT                   /translation="MKKLTAAAIATMGFATFTMAHQADAAETTNTQQAHTLMSTQSQDV
FT                   SYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGS
FT                   GQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSHSNNNQAYNSHDGNGKV
FT                   NYPNGTSNQNGGSASKATASGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSP
FT                   VYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYS
FT                   GSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQSR"
FT   gene            complement(283893..284552)
FT                   /locus_tag="SAAV_0245"
FT   CDS_pept        complement(283893..284552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0245"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10188"
FT                   /protein_id="ACY10188.1"
FT                   /translation="MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLR
FT                   MIAGIEKANDGTINYFGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPI
FT                   NDTTINEYLQQLNFDDTSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSR
FT                   HDIHQLLNIMKSKCLIILTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWAYTYY"
FT   gene            complement(284566..285486)
FT                   /locus_tag="SAAV_0246"
FT   CDS_pept        complement(284566..285486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10189"
FT                   /protein_id="ACY10189.1"
FT                   /translation="MKPYIQLVLFKQWLQYILLVTTIVIALVLIGIGYRVAHDNFKIPI
FT                   TIQDLDQTTASKSFVNKIKQSDYVTIKKVDEDESYIEDDVTKKEAILSMQIPKGFSQKL
FT                   KENRLKETIQLYGRDDFIGGIAIEIVSSSLYEQQIPNIIYEHLEDMKQHQSIDAINKSY
FT                   HKHTPESKIKFVSLTKQAQHSISISLIFAVILFVSAVQVVLHYRLNQQAALQRLSQYHL
FT                   SRFKLYSTYVMTHTILLLLVLLAVSLYLSQPLSLIFYLKSLLLILIYEIGIVFILFHIQ
FT                   TISHRLFMTFIYALAMGIVYLIIFM"
FT   gene            complement(285483..286649)
FT                   /locus_tag="SAAV_0247"
FT   CDS_pept        complement(285483..286649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10190"
FT                   /protein_id="ACY10190.1"
FT                   /translation="MKTIHLFRIYHSFLLKKWYLIIYLLFILAALLITLTTIQHVTEDD
FT                   NHFNIGVVDKDQSSETKLILNSIGKGSNLGKNVSIKAYDDKQAHTLLKKHKLQGYFVFD
FT                   KGMTKAFYKQGELPISVYTYDQQSMKSVVLSQLTDSVYQRLMRSMGGILAFQDLAPKAS
FT                   HSDSINVMTDLLITGLNRSGAFNLEPIHLYDTGSYYAITGFLATVFIFALSLFTVLKMN
FT                   QDTVLKARLKMFHFSKERLLIIRALITWFYTMLWSIVGVVWIVFSIPNTFELYNWPTLA
FT                   IHLSYYVTFLILWLLLIELLTTGLLNSISKVILAIVILVLSGLTIPTIFLQHIANGVFN
FT                   IQPFAVVTNQLLEIILNNYILELHPSFYLSFIALLIINLAVLVWRYRQ"
FT   gene            complement(286721..288241)
FT                   /locus_tag="SAAV_0248"
FT   CDS_pept        complement(286721..288241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10191"
FT                   /protein_id="ACY10191.1"
FT                   /translation="MSKKLKIIIPIIIVLLLIGGIAWGVYAFFANTPKNTYLKSEQQTA
FT                   KMYKDYFNDRFENEVKFQEKMKDNSFLSSLELSADASDEIVKGLGIPKSVVNASKIKMS
FT                   YGHDPKKEKSMINLEPTIADSALGKFQLAADKDKHYFESPLFKGKYSVNNSDLLSTYSK
FT                   LTGEDEETAKENGITNQQLNLNTLFSNAQAQQSDYSKIAEKYSELIVDKLDDDNFDKGK
FT                   KEEIKVNGEKYKVRPVTLTLSRADTKKITLAVLEEAKKDKDLKKLMEEQGATKDYDKDI
FT                   KKAIDDVKETKKDEFAKIQSKIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLKL
FT                   DYALDFDQDKYTYAEAKYTIKGVSSKEKDNKYSDKYEFGKKTEYDESKIKLDNQEKVDG
FT                   TKRQDKGKITVALDKYSDENEFTFENNIDSDVKNNTQKSTLNIGIKYAEEPINFILKSS
FT                   TKLKADIDFDDSGAKDFNSLSSKDREKLEKEIEKNGGKMFESILKKGI"
FT   gene            complement(288572..289465)
FT                   /locus_tag="SAAV_0249"
FT   CDS_pept        complement(288572..289465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0249"
FT                   /product="staphyloxanthin biosynthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10192"
FT                   /protein_id="ACY10192.1"
FT                   /translation="MKKTILLTMTTLTLFSMSPNSAQAYTNDSKTLEEAKRAHPNAQFK
FT                   VNKDTGAYTYTYDKNNTPNNNHQNQSRTNDNHQHANQRDFNNNQYHSSLSGQYTHINDA
FT                   IDSHTPPQTSPSNPLTPAIPNVEDNDDELNNAFSKDNKGLITGIDLDELYDELQIAEFN
FT                   DKAKTADGKPLALGNGKIIDQPLITSKNNLYTAGQCTWYVFDKRAKDGHTISTFWGDAK
FT                   NWAGQASSNGFKVDRHPTRGSILQTVNGPFGHVAYVEKVNIDGSILISEMNWIGEYIVS
FT                   SRTISASEVSSYNYIH"
FT   gene            289713..290006
FT                   /locus_tag="SAAV_0250"
FT   CDS_pept        289713..290006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10193"
FT                   /protein_id="ACY10193.1"
FT                   /translation="MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEG
FT                   QAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ"
FT   gene            290089..293118
FT                   /locus_tag="SAAV_0251"
FT   CDS_pept        290089..293118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10194"
FT                   /protein_id="ACY10194.1"
FT                   /translation="MKKKNWIYALIVTLIIIIAIVSMIFFVQTKYGDQSEKGSQSVSNK
FT                   NNKIHIAIVNEDQPTTYNGKKVELGQAFIKRLANEKNYKFETVTRNVAESGLKNGGYQV
FT                   MIVIPENFSKLAMQLDAKTPSKISLQYKTAVGQKEEVAKNTEKVVSNVLNDFNKNLVEI
FT                   YLTSIIDNLHNAQKNVGAIMTREHGVNSKFSNYLLNPINDFPELFTDTLVNSISANKDI
FT                   TKWFQTYNKSLLSANSDTFRVNTDYNVSTLIEKQNSLFDEHNTAMDKMLQDYKSQKDSV
FT                   ELDNYINALKQMDSQIDQQSSMQDTGKEEYKQTVKENLDKLREIIQSQESPFSKGMIED
FT                   YRKQLTESLQDELANNKDLQDALNSIKMNNAQFAENLEKQLHDDIVKEPDTDTTFIYNM
FT                   SKQDFIAAGLNEGEANKYEAIVKEAKRYKNEYNLKKPLAEHINLTDYDNQVAQDTSSLI
FT                   NDGVKVQRTETIKSNDINQLTVATDPHFNFEGDIKINGKKYDIKDQSVQLDTSNKEYKV
FT                   EVNGVAKLKKDAEKDFLKDKTMHLQLLFGQANRQDEPNDKKATSVVDVTLNHNLDGRLS
FT                   KDALSQQLSALSRFDAHYKMYTDTKGREDKPFDNKRLIDMMVDQVINDMESFKDDKVAV
FT                   LHQIDSMEENSDKLIDDILNNKKNTTKNKEDISKLIDQLENVKKTFAEEPQEPKIDKGK
FT                   NDEFNTMSSNLDKEISRISEKSTQLLSDTQESKTIADSVSGQLNQLDNNVNKLHATGRA
FT                   LGVRANDLNRQMAKNDKDNELFAKEFKKVLQNSKDGDRQNQALKAFMSNPVQKKNLENV
FT                   LANNGNTEVISPTLFVLLMYLLSMITAYIFYSYERAKGQMNFIKDDYSSKNHLWNNVIT
FT                   SGVIGTTGLVEGLIVGLIAMNKFHVLAGYRAKFILMVILTMMVFVLINTYLLRQVKSIG
FT                   MFLMIAALGLYFVAMNNLKAAGQGVTNKISPLSYIDNMFFNYLNAEHPIGLALVILTVL
FT                   VIIGFVLNMFIKHFKKERLI"
FT   gene            293118..293576
FT                   /locus_tag="SAAV_0252"
FT   CDS_pept        293118..293576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10195"
FT                   /protein_id="ACY10195.1"
FT                   /translation="MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLF
FT                   NKDSKEVNDAIAKQKKERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKS
FT                   PYIQNKQEKKIFPYILMSVGAFLTLGFVIFSIHKGRRTKNESARKSNI"
FT   gene            293548..293790
FT                   /locus_tag="SAAV_0253"
FT   CDS_pept        293548..293790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10196"
FT                   /protein_id="ACY10196.1"
FT                   /translation="MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIF
FT                   DVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL"
FT   gene            293803..295137
FT                   /locus_tag="SAAV_0254"
FT   CDS_pept        293803..295137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10197"
FT                   /protein_id="ACY10197.1"
FT                   /translation="MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHF
FT                   HLMYLLEQHSPYFIDAELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNL
FT                   EEVNRTRYTFVLAPDELFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFN
FT                   EKQSFDALVEGNLELHKGTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKV
FT                   GHTVFKWVAIGMTTLSVLLIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDL
FT                   DGKKLDKEALYIYAKSYIQTNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDE
FT                   AINIATYLDDNDITKLALINKLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKD
FT                   EKAKSEEEKAKAKDEKLKQQEENEKKQKEQAQKDKEKRQEAERKK"
FT   gene            295159..299598
FT                   /gene="yukA"
FT                   /locus_tag="SAAV_0255"
FT   CDS_pept        295159..299598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yukA"
FT                   /locus_tag="SAAV_0255"
FT                   /product="diarrheal toxin"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10198"
FT                   /protein_id="ACY10198.1"
FT                   /translation="MHKLIIKYNKQLKMLNLRDGKTYTISEDERADITLKSLGEVIHLE
FT                   QNNQGTWQANHTSINKVLVRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNAYDDM
FT                   VIQSLMNAIIIKDFQSIQESQYVRIVHDKNTDVYINYELQEQLTNKAYIGDHIYVEGIW
FT                   LEVQADGLNVLSQNTVASSLIRLTQEMPHAQADDYNTYHRSPRIIHREPTDDIKIERPP
FT                   QPIQKNNTVIWRSIIPPLVMIALTVVIFLVRPIGIYILMMIGMSTVTIVFGITTYFSEK
FT                   KKYNKDVEKREKDYKAYLDNKSKEINKAIKAQRFSLNYHYPTVAEIKDIVETKAPRIYE
FT                   KTSHHHDFLHYKLGIANVEKSFKLDYQEEEFNQRRDELFDDAKELYEFYTDVEQAPLIN
FT                   DLNHGPIAYIGARHLILEELEKMLIQLSTFHSYHDLEFLFVTREDEVETLKWARWLPHM
FT                   TLRGQNIRGFVYNQRTRDQILTSIYSMIKERIQAVRERSRSNEQIIFTPQLVFVITDMS
FT                   LIIDHVILEYVNQDLSEYGISLIFVEDVIESLPEHVDTIIDIKSRTEGELITKEKELVQ
FT                   LKFTPENIDNVDKEYIARRLANLIHVEHLKNAIPDSITFLEMYNVKEVDQLDVVNRWRQ
FT                   NETYKTMAVPLGVRGKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYILSLAINFH
FT                   PHEVAFLLIDYKGGGMANLFKDLVHLVGTITNLDGDEAMRALTSIKAELRKRQRLFGEH
FT                   DVNHINQYHKLFKEGVATEPMPHLFIISDEFAELKSEQPDFMKELVSTARIGRSLGIHL
FT                   ILATQKPSGVVDDQIWSNSKFKLALKVQDRQDSNEILKTPDAADITLPGRAYLQVGNNE
FT                   IYELFQSAWSGATYDIEGDKLEVEDKTIYMINDYGQLQAINKDLSGLEDEETKENQTEL
FT                   EAVIDHIESITTRLEIEEVKRPWLPPLPENVYQEDLVETDFRKLWSDDAKEVELTLGLK
FT                   DVPEEQYQGPMVLQLKKAGHIALIGSPGYGRTTFLHNIIFDVARHHRPDQAHMYLFDFG
FT                   TNGLMPVTDIPHVADYFTVDQEDKIAKAIRIFNDEIDRRKKILSQYRVTSISEYRKLTG
FT                   ETIPYVFILIDNFDAVKDSPFQEVFENMMIKMTREGLALDMQVTLTASRANAMKTPMYI
FT                   NMKTRIAMFLYDKSEVSNVVGQQKFAVKDVVGRALLSSDDNVSFHIGQPFKHDETKSYN
FT                   DQINDEVSAMTEFYKGETPNDIPMMPDEIKYEDYRESLSLPDIVANGALPIGLDYEGVT
FT                   LQKIKLTEPAMISSENPREIAHIAEIMMKEIDILNEKYAICIADSSGEFKAYRHQVANF
FT                   AEEREDIKAIHQLMIEDLKQREMDGPFEKDSLYIINDFKTYIDCTYIPEDDVKKLITKG
FT                   PELGLNILFVGIHKELIDAYDKQIDVARKMINQFSIGIRISDQQFFKFRFIQREPVIKE
FT                   NEAYMVANQAYQKIRWFK"
FT   gene            299628..300020
FT                   /locus_tag="SAAV_0256"
FT   CDS_pept        299628..300020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10199"
FT                   /protein_id="ACY10199.1"
FT                   /translation="MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLE
FT                   FNLSIALDDVESTAKDVQTAKSSANKDSVSVKGKAPNTLYIEKRNLMKQKLEMLGEDID
FT                   KNKESLQKAKGIAGEKASEYFNKAMN"
FT   gene            300036..300350
FT                   /locus_tag="SAAV_0257"
FT   CDS_pept        300036..300350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10200"
FT                   /protein_id="ACY10200.1"
FT                   /translation="MGGYKGIKADGGKVNQAKQLAAKIAKDIEACQKQTQQLAEYIEGS
FT                   DWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP
FT                   "
FT   gene            300350..301024
FT                   /locus_tag="SAAV_0258"
FT   CDS_pept        300350..301024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10201"
FT                   /protein_id="ACY10201.1"
FT                   /translation="MKDVKRIDYFSYEELTILGGSKLPLVNFELFDPSNFEEAKVALIE
FT                   KELVTENDKLTDAGFKVATLVREYISAIVNIRINDMYFAPFSYEKDEYILLSRFKNNGF
FT                   QIRIINKDIAWWSIVQSYPLLMRQEKSNDWDFKQIDDEILENLNNESIDTIGRVLEIEI
FT                   YNHQGDPQQSLYNIYEQNDLLLIRYPLKDKVLNVHIGVINTFIRELFGFDTDENHINKA
FT                   EE"
FT   gene            301024..301341
FT                   /locus_tag="SAAV_0259"
FT   CDS_pept        301024..301341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10202"
FT                   /protein_id="ACY10202.1"
FT                   /translation="MTLSGKISVKAETIAHVVKELESISQKYDEIAQNFGKIAQLNYYS
FT                   SEKAAHSMENGYSSAATVISGLKGPLSTLGGGVMNSAQKFFEADEHWGTEFAKLYYNIE
FT                   G"
FT   gene            301351..303195
FT                   /locus_tag="SAAV_0260"
FT   CDS_pept        301351..303195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10203"
FT                   /protein_id="ACY10203.1"
FT                   /translation="MTKDIEYLTADYDNEKSSIQSVIDAIEGQDFLDVDTTMDDAVSDV
FT                   SSLDEDGAISLTSSVVGPQGSKLMGYYQNELYDYASQLDSKMKEIIDTPFIEDIDKAFK
FT                   GITNVKLENILIKNGGGHGRDTYGASGKIAKGDAKKSDSDVYSIDEILKSDQEFVKVID
FT                   QHYKEMKKEDKKLSKSDFEKMMTQGASCDYMTVAEAEEIEEQKKKEEAIEIAALAGMVV
FT                   LSCINPVAGAVAIGAYSAYSAANAATGKNIVTGRKLSKEERIMEGLSLIPLPGMGFLKG
FT                   AGKSLMKLGFKGGEKFAVKTGLQKTMQQAVSRISPKMGMMKNSVLNQSRNFAQNTHVGQ
FT                   MLSNMRGQATHTVQQSRNWIGQQAQNVKRIVNNGLDKEIAHPFKQQLAPAGMGGIKFAE
FT                   TTTLRNMGQNMKRAVTPQNHVTHGPKDSMVRSEGKHSVSSHEINLSKYVESPNYTKVKY
FT                   GEQYARLRPKKLKANIEYTTPTGHIYRTDHKGRIKEVYVDNLSLKDGGRNNHAQRTVGG
FT                   EDRLPDDDGGHLIARMFGGSKDIDNLVAQSKYINRSFKENGDWYKLEKLWEKAIKSGKS
FT                   IENIKIEVKYKGNSQRPTIFKVEYEINGKRNIRRILNK"
FT   gene            303266..303697
FT                   /locus_tag="SAAV_0261"
FT   CDS_pept        303266..303697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10204"
FT                   /protein_id="ACY10204.1"
FT                   /translation="MIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDIPKEYN
FT                   ISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGKLKVSFDYIDWINTEF
FT                   DQLGRENYYMYKKFGVIPEMEYEMEEVKQIEQYIKEQEE"
FT   gene            303900..304583
FT                   /locus_tag="SAAV_0262"
FT   CDS_pept        303900..304583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10205"
FT                   /protein_id="ACY10205.1"
FT                   /translation="MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNY
FT                   LKITTIIELIIIVISLLQWIRFIDFEKESARKYKKIYARFLVIINVLTTITVVFALCNL
FT                   YYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGKTKTHFGLL
FT                   LTALSSFIYIEKIIEYILIPNVVESKFIIIVSMLVIAGAQFVAFQFIMQYSRFYIFELN
FT                   TEDDD"
FT   gene            304729..305340
FT                   /locus_tag="SAAV_0263"
FT   CDS_pept        304729..305340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10206"
FT                   /protein_id="ACY10206.1"
FT                   /translation="MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAILFVIIGIT
FT                   YIFIGDSYDQLTNFNVILYMGSLFYAWMAIRNLWNRPLLLKYKNITDSSSGIVNKSEYN
FT                   SVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIII
FT                   FAVWDLFIRVRKGAFAFVVIRPILFSCWIFILNMILSRLL"
FT   gene            305475..305693
FT                   /locus_tag="SAAV_0264"
FT   CDS_pept        305475..305693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10207"
FT                   /protein_id="ACY10207.1"
FT                   /translation="MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEK
FT                   GSKLLQIAIIVTIIAFVLNLLAYLGLR"
FT   gene            305825..306325
FT                   /locus_tag="SAAV_0265"
FT   CDS_pept        305825..306325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10208"
FT                   /protein_id="ACY10208.1"
FT                   /translation="MTFEEKLSQMYNEIANKISSMIPVEWEKVYTMAYIDDEGGEVFYY
FT                   YTEPGSNELYYYTSVLNKYDISESEFMDSAYELYKQFQNLRNIFKEEGYEPWTSCEFDF
FT                   TKEGELKVSFDYIDWINTEFDQLGRQNYYMYKKFGVIPEMEYEMEEVKEIEQYIKEQEE
FT                   AEQ"
FT   gene            306396..306836
FT                   /locus_tag="SAAV_0266"
FT   CDS_pept        306396..306836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10209"
FT                   /protein_id="ACY10209.1"
FT                   /translation="MIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDIPKEYN
FT                   ISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTSEGKLKVSLDYIDWINTEF
FT                   DQLGRENYYMYKKFGVIPEMEYEMEEIKEIEQYIKEQDEAEL"
FT   gene            306847..307308
FT                   /locus_tag="SAAV_0267"
FT   CDS_pept        306847..307308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10210"
FT                   /protein_id="ACY10210.1"
FT                   /translation="MTFEEKLSQMYNEIANKISSMIPVEWEKVYAMAYVNERSGEVFYN
FT                   YTEPRSDELFYYTSVLNKYNISRSEFMDSVYELYKQFDKLRDLFKEEGLEPWTSCEFDF
FT                   TRDGKLNVSFDYIDWANSEFGQMGREHYYMYKKFGIWPEKEYAINWVKK"
FT   gene            307357..307857
FT                   /locus_tag="SAAV_0268"
FT   CDS_pept        307357..307857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10211"
FT                   /protein_id="ACY10211.1"
FT                   /translation="MNFEEKLSQMYNEIANEISGMIPVEWEQVFTIAYVTDQAGEVIFN
FT                   YTKPGSDELNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRNAFKEEDLEPWTSCEFDF
FT                   TSEGKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVIPEMEYEMEEVKEIEQYIKEQDE
FT                   AEL"
FT   gene            307868..308353
FT                   /locus_tag="SAAV_0269"
FT   CDS_pept        307868..308353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10212"
FT                   /protein_id="ACY10212.1"
FT                   /translation="MIFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFN
FT                   YTKPGSDELNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRNAFKEDLEPWTSCEFDFT
FT                   REGNLKVSFDYIDWIKLGFGPSGKENYYMYKKFGVLPETEYEMEEIREVEKYVKDQE"
FT   gene            308978..309352
FT                   /locus_tag="SAAV_0270"
FT   CDS_pept        308978..309352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10213"
FT                   /protein_id="ACY10213.1"
FT                   /translation="MKRILVVFLMLAIILAGCSNKGEKYQKDIDKVYKEQNQMNKIASK
FT                   VQNTIKTDIKQEDSNTHVYKDGKVIVIGIQLYKDREKMYYFAYEIKDGKAEINREIDPI
FT                   KYMKDHKADYEDENVEVEKD"
FT   gene            309502..309900
FT                   /locus_tag="SAAV_0271"
FT   CDS_pept        309502..309900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10214"
FT                   /protein_id="ACY10214.1"
FT                   /translation="MEKSIKIMTIIGIVIQGLATVFSLLLMVLAASGVMTTDVSTTVNG
FT                   EVDPVDAETAAAIFTVLFLSLFIFGIISIILGAIGMFKASKNKKMSGILLIIGAVISGN
FT                   IITFALWLVSGIKLLTNNKPKDEISDLS"
FT   gene            complement(310116..310940)
FT                   /locus_tag="SAAV_0272"
FT   CDS_pept        complement(310116..310940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0272"
FT                   /product="formate/nitrite transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10215"
FT                   /protein_id="ACY10215.1"
FT                   /translation="MKEKHIKWDKIFYGDDWVNNVVETIRTKDILQSVYLKRYLLRAMM
FT                   AGFIIGIITVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFT
FT                   VGLYYKVIKPTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLS
FT                   TGFVSILMKAIFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLF
FT                   MGGLIYQVDTLHFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN"
FT   gene            complement(311177..312484)
FT                   /gene="brnQ2"
FT                   /locus_tag="SAAV_0273"
FT   CDS_pept        complement(311177..312484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ2"
FT                   /locus_tag="SAAV_0273"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10216"
FT                   /protein_id="ACY10216.1"
FT                   /translation="MKKQVIISGLMLFSLFFGAGNLIFPPILGHTAGQNMWIGMLGFAL
FT                   TGILLPFITVIVVAFYDEGVESVGNRIHPWFGFIFAVVIYMSIGAFYGIPRAANVAYEI
FT                   GTRHILPVHNQWTLIIFAAIFFAIVYWISLNPSKIVDNLGKLLTPLLLLMVALLSIAVI
FT                   FNPESALSAPKDKYITHPFISGSLEGYFTMDLVAALAFSVVIVNGYKFKGLTDRMKILK
FT                   YVCFSGLIAAILLGMIYFALAYVGASTAPGNFKDGTDILTYNSLRVFGSFGNIVFGMTV
FT                   ILACLTTCIGLVNACATFTKKHVPKFSYKIFALIFSIIGFLFTTLGLEMILKIAVPLLT
FT                   LIYPVSIALVLISFANMFSTFRFSWAYRLATVITLIISILQILNSFNLLHGVILKWFMM
FT                   LPLADIDLAWLVPFMLFAIIGFIIDVVIRRPKQATT"
FT   gene            313068..313958
FT                   /locus_tag="SAAV_0274"
FT   CDS_pept        313068..313958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0274"
FT                   /product="5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10217"
FT                   /protein_id="ACY10217.1"
FT                   /translation="MNKISKYIAIASLSVAVTVSAPQTTNSTAFAKSSAEVQQTQQASI
FT                   PASQKANLGNQNIMAVAWYQNSAEAKALYLQGYNSAKTQLDKEIKKNKGKHKLAIALDL
FT                   DETVLDNSPYQGYASIHNKPFPEGWHEWVQAAKAKPVYGAKEFLKYADKKGVDIYYISD
FT                   RDKEKDLKATQKNLKQQGIPQAKKSHILLKGKDDKSKESRRQMVQKDHKLVMLFGDNLL
FT                   DFTDPKEATAESREALIEKHKDDFGKKYIIFPNPMYGSWEATIYNNNYKASDKAKDKLR
FT                   KNAIKQFDPKTGEVK"
FT   gene            314207..315256
FT                   /locus_tag="SAAV_0275"
FT   CDS_pept        314207..315256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0275"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10218"
FT                   /protein_id="ACY10218.1"
FT                   /translation="MFLAWNEIRRNKLKFGLIIGVLTMISYLLFLLSGLANGLINMNKE
FT                   GIDKWQADAIVLNKDANQTVQQSVFNKKDIENKYKKQATLKQTGEIVSNGHQKDNVLVF
FT                   GVEKSSFLVPSLIEGHKATKDNEVLADETLKNKGFKIGDTLSLSQSDEKLHIVGFTESA
FT                   KYNASPVIFTNDATIAKINPRLTGDKINAVVVRDTNWKDKKLNQELEAVSINDFIENLP
FT                   GYKPQNLTLNFMISFLFVISATVIGIFLYVMTLQKTSLFGILKAQGFTNGYLANVVISQ
FT                   TLILALFGTAFGLLLTGVTGAFLPDAVPVKFDVLTLLVFAIVLMIVSVLGSLFSILTIR
FT                   KIDPLKAIG"
FT   gene            315269..315946
FT                   /locus_tag="SAAV_0276"
FT   CDS_pept        315269..315946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0276"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10219"
FT                   /protein_id="ACY10219.1"
FT                   /translation="MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKS
FT                   TFLTMAGALQTPTSGHILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQF
FT                   TLLKKKNKNVMSNEDYQQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILA
FT                   DEPTAALDTENAIEVIKILRDQAKKRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENE
FT                   TVE"
FT   gene            316154..317185
FT                   /gene="pfoR"
FT                   /locus_tag="SAAV_0277"
FT   CDS_pept        316154..317185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfoR"
FT                   /locus_tag="SAAV_0277"
FT                   /product="perfringolysin O regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10220"
FT                   /protein_id="ACY10220.1"
FT                   /translation="MDLMIGTLFLFLVLVIFTLFTYKAPNGMRAMGALANAAIATFLVE
FT                   AFNKYVGGEVFGIKFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLL
FT                   PGFFAGYMIGYVMKYTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDII
FT                   QSSTNTNPIIMGIILGGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGT
FT                   LFHRLKLGDRKSTIAVSIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDAT
FT                   GTATPIAGFLVMFGFNHPMTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGA
FT                   VDA"
FT   gene            317528..318646
FT                   /locus_tag="SAAV_0278"
FT   CDS_pept        317528..318646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0278"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10221"
FT                   /protein_id="ACY10221.1"
FT                   /translation="MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKE
FT                   YVMGKAYVLNEDYPIVCIGAANVDRKFYVHKDLVAETSNPVTSTRSIGGVARNIAENLG
FT                   RLGETVAFLSASGQDSEWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGL
FT                   ADMEVFDYITPEFLIKRSHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSS
FT                   PKMKNMPDSLHAIDWIITNKDETETYLNLKIESTDDLKIAAKRWNDLGVKNVIVTNGVK
FT                   ELIYRSGEEEIIKSVMPSNSVKDVTGAGDSFCAAVVYSWLNGMSTEDILIAGMVNAKKT
FT                   IETKYTVRQNLDQQQLYHDMEDYKNGKFTKVY"
FT   gene            318621..319544
FT                   /locus_tag="SAAV_0279"
FT   CDS_pept        318621..319544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10222"
FT                   /protein_id="ACY10222.1"
FT                   /translation="MANLQKYIEYSREVQQARENNQPIVALESTIISHGMPYPQNVEMA
FT                   TTVEQIIRNNGAIPATIAIIDGKIKIGLESEDLEILATSKDVAKVSRRDLAEVVAMKCV
FT                   GATTVATTMICAAMAGIQFFVTGGIGGVHKGAEHTMDISADLEELSKTNVTVICAGAKS
FT                   ILDLPKTMEYLETKGVPVIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLTKQQLN
FT                   LEGGIVVANPIPYEHALSKAYIEAIINEAVVEAENQGIKGKDATPFLLGKIVEKTNGKS
FT                   LAANIKLVENNAALGAKIAVAVNKLL"
FT   gene            319555..320775
FT                   /locus_tag="SAAV_0280"
FT   CDS_pept        319555..320775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0280"
FT                   /product="nucleoside permease NupC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10223"
FT                   /protein_id="ACY10223.1"
FT                   /translation="MNILFAITGIAFALFVAFLFSFDRKNIDFKKTLIMIFIQVLIVLF
FT                   MMNTTIGLTILTALGSFFEGLINVSKAGINFVFGDIQNKNGFTFFLNVLLPLVFISVLI
FT                   GIFNYIKVLPFIIKYVGIAINKITRMGRLESYFAISTAMFGQPEVYLTIKDIIPRLSRA
FT                   KLYTIATSGMSAVSMAMLGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDSDVE
FT                   IDNLTKSTETKSVNGKTGKPKKVAFFQMIGDSAMDGFKIAVVVAVMLLAFISLMEAINI
FT                   MFGSVGLNFKQLIGYVFAPIAFLMGIPWSEAVPAGSLMATKLITNEFVAMLDFKNVLGD
FT                   VSARTQGIISVYLVSFANFGTVGIIVGSIKGISDKQGEKVSSFAMRLLLGSTLASIISG
FT                   SIIGLVL"
FT   gene            complement(320880..322412)
FT                   /locus_tag="SAAV_0281"
FT   CDS_pept        complement(320880..322412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0281"
FT                   /product="sodium:solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10224"
FT                   /protein_id="ACY10224.1"
FT                   /translation="MKEVGFGTLNWVAVIIYLLAMLFIGVYFTKRASQSTNSFFTASGR
FT                   LPSWVVGFSIYATTLSAITFMSTPEKAFLTDWSYIAGNIAIVAIIPLLIYFYVPFFKKL
FT                   KVTSAYEYLEARFGPSIRVIGSLLFVVYHLGRVAIVIYLPTLAITSVSDMNPYIVASLV
FT                   GLLCILYTFLGGFEGVVWSDFIQGVILLGGALVIIILGVMNIKGGFGTVFADAIEHKKL
FT                   ISADNWKLNTAAAAIPIIFLGNIFNNLYQYTASQDVVQRYQASDSLKETNKSLWTNGIL
FT                   ALISAPLFYGMGTMLYSFYTHEAVLPKGFNTSSVVPYFILTEMPPFVAGLLIAAIFAAA
FT                   QSTISSSLNSISACISIDIKQRFFGKDSERHEVNFARFIIIIAGIFGFGMSLYLIASNS
FT                   NDLWDLFLFVTGLFGVPLAGVFAVGIFTKRTNTFGVICGLILGIIFAYVYNGVGKGNSP
FT                   FYVSTISFTVAFVFAYILSFIVPSKHKKDITGLTIFEKDKPSTYISKTATNK"
FT   gene            complement(322452..323333)
FT                   /gene="nanA"
FT                   /locus_tag="SAAV_0282"
FT   CDS_pept        complement(322452..323333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanA"
FT                   /locus_tag="SAAV_0282"
FT                   /product="N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10225"
FT                   /protein_id="ACY10225.1"
FT                   /translation="MNKDLKGLYAALLVPFDENGQVNEQGLKQIAQNAIETEELDGLYV
FT                   NGSSGENFLLNTEQKKQVFKVAKEAVGDKVKLIAQVGSLDLNEAIELGKYATELGYDAL
FT                   SAVTPFYYPFTFEEIRDYYFDIIEATQNNMIIYAIPDLTGVNISIEQFSELFNHEKIVG
FT                   VKYTAPNFFLLERIRKAFPDKLILSGFDEMLVQATISGVDGAIGSTYNVNGRRARKIFD
FT                   LARQGQIQEAYQLQHDSNDIIETVLSMGIYPTLKEILRHRDIDAGLPKRPFKPFNEAHR
FT                   QTLDQLIAKYDL"
FT   gene            323491..324351
FT                   /locus_tag="SAAV_0283"
FT   CDS_pept        323491..324351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0283"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10226"
FT                   /protein_id="ACY10226.1"
FT                   /translation="MYYIAIDIGGTQIKSAVIDKQLNMFDYQQISTPDNKSELITDKVY
FT                   EIVTGYMKQYQLIQPVIGISSAGVVDEQKGEIGYAGPTIPNYKGTNFKRLLKSLSPYVK
FT                   VKNDVNAALLGELKLHQYQAERIFCMTLGTGIGGAYKNNQGHIDNGELHKANEVGYLLY
FT                   RPTENTTFEQRAATSALKKRMIDGGFTRSTHVPVLFEAAEEGDDIAKQILNEWAEDVAE
FT                   GIAQIQVMYDPGLILIGGGISEQGDNLIKYIEPKVAHYLPKDYVYAPIQTTKSKNDAAL
FT                   YGCLQ"
FT   gene            complement(324628..325428)
FT                   /locus_tag="SAAV_0284"
FT   CDS_pept        complement(324628..325428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10227"
FT                   /protein_id="ACY10227.1"
FT                   /translation="MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLAHAIG
FT                   TSPATMTRFSHKLDYENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFID
FT                   NDIIQTFIDKLQSSRHILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLL
FT                   SHSDMFIAMSNSGNTSELISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRN
FT                   TDHQFINTQIATLFLIDIVSYHLLENTNLSQTYQHTKSIILDNK"
FT   gene            325568..326236
FT                   /locus_tag="SAAV_0285"
FT   CDS_pept        325568..326236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0285"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10228"
FT                   /protein_id="ACY10228.1"
FT                   /translation="MLPHGLIVSCQALADEPLHSSFIMSKMALAAYEGGAVGIRANTKE
FT                   DILAIKETVDLPVIGIVKRDYDHSDVFITATSKEVDELIESQCEVIALDATLQQRPKET
FT                   LDELVSYIRTHAPNVEIMADIATVEEAKNAARLGFDYIGTTLHGYTSYTQGQLLYQNDF
FT                   QFLKDVLQSVDAKVIAEGNVITPDMYKRVMDLGVHCSVVGGAITRPKEITKRFVQVMED
FT                   "
FT   gene            complement(326367..327680)
FT                   /locus_tag="SAAV_0286"
FT   CDS_pept        complement(326367..327680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10229"
FT                   /protein_id="ACY10229.1"
FT                   /translation="MNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHVH
FT                   LAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTSITNLVITLFKVAGAMIGIMYVFKI
FT                   GPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPIFKT
FT                   PGKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFSTVSATFMIIVAKTL
FT                   GLMPHWNLYFWITLVITFVVTAITAWLPPITNESTEYYNGQEGEQEVAIEGSRLKTAYA
FT                   EAMKQNALTPSLVKNVWDNFKDGLEMTVGILPSILSIGFLGLIVANYTPFIDWLGYIFY
FT                   PFIYIFPIADQAVLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVP
FT                   CILATEIKIPVWKLIIIWFLRVALSLLITIPVALLIFG"
FT   gene            328098..330173
FT                   /locus_tag="SAAV_0287"
FT   CDS_pept        328098..330173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0287"
FT                   /product="lipase precursor, interruption-N"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10230"
FT                   /protein_id="ACY10230.1"
FT                   /translation="MLRGQEERKYSIRKYSIGVVSVLAATMFVVSSHEAQASEKTPTSN
FT                   AAAQKETLNQPGEQGNAITSHQMQSGKQLDDMHKENGKSGTVTEGKDTLQSSKHQSTQN
FT                   SKTIRTQNDNQVKQDSERQGSKQSHQNNATNNTERQNDQVQNTHHAERNGSQSTTSQSN
FT                   DVDKSQPSIPAQKVLPNHDKAAPTSTTPPSNDKTAPKSTKAQDATTDKHPNQQDTHQPA
FT                   HQIIDAKQDDTVRQSEQKPQVGDLSKHIDGQNSPEKPTDKNTDNKQLIKDALQAPKTRS
FT                   TTNAAADAKKVRPLKANQVQPLNKYPVVFVHGFLGLVGDNAPALYPNYWGGNKFKVIEE
FT                   LRKQGYNVHQASVSAFGSNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTYKGIMP
FT                   NWEPGKKVHLVGHSMGGQTIRLMEEFLRNGNKEEIAYHKAHGGEISPLFTGGHNNMVAS
FT                   ITTLATPHNGSQAADKFGNTEAVRKIMFALNRFMGNKYSNIDLGLTQWGFKQLPNESYI
FT                   DYIKRVSKSKIWTSDDNAAYDLTLDGSAKLNNMTSMNPNITYTTYTGVSSHTGPLGYEN
FT                   PDLGTFFLMDTTSRIIGHDAREEWRKNDGVVPVISSLHPSNQPFINVTNDEPATRRGIW
FT                   QVKPIIQGWDHVDFIGVDFLDFKRKGAELANFYTGIINDLLRVEATESKGTQLKAS"
FT   gene            complement(330415..331242)
FT                   /locus_tag="SAAV_0288"
FT   CDS_pept        complement(330415..331242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10231"
FT                   /protein_id="ACY10231.1"
FT                   /translation="MTEIKYKVITKDAFALPYTIIKAKNQPTKGVIVYIHGGGLMFGKA
FT                   NDLSPQYIDILTEHYDLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRS
FT                   SGAYLSLLIARDRDIDGVIDFYGYSRINTEPFKTTNSYYAKIAQSINETMIAQLTSPTP
FT                   VVQDQIAQRFLIYVYARGTGKWINMINIADYTDSKYNIAPDELKTLPPVFIAHCNGDYD
FT                   VPVEESEHIMNHVPHSTFERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITMV"
FT   gene            complement(331315..332514)
FT                   /locus_tag="SAAV_0289"
FT   CDS_pept        complement(331315..332514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0289"
FT                   /product="Oye family NADH-dependent flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10232"
FT                   /protein_id="ACY10232.1"
FT                   /translation="MYRYKPLLQSIHLPNGIKISNRFVLSPMTVNASTKEGYITKADLA
FT                   YAARRSNSAGMQVTGAAYIEPYGKLFEYGFNIDHDACIPGLTNMASTMKQHGSLAIIQL
FT                   AHAGRFSNQAILNFGKVYGPSPMTLHSPIEHVVIAMSHEKINSIIQQYRDATLRAIKAG
FT                   FDGVEISIAQRLLIQTFFSTFSNRRTDHYGADSLKNRARLCLEVMRAVQEVIDKEAPDN
FT                   FILGFRATPEETRGSDLGYTIDEFNQLIDWVMDVSNIQYLAIASWGRHIYQNTSRTPGD
FT                   HFGRPVNQIVYEHLAGRIPLIASGGINSPESALDALQHADMVGMSSPFVTEPDFVHKLA
FT                   EQRPHDINLEFSMADLEDLAIPHAAFKDIVKMMDYGEGLKKHTRDALRQLEQNYHDSSS
FT                   "
FT   gene            332610..332702
FT                   /locus_tag="SAAV_0290"
FT   CDS_pept        332610..332702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10233"
FT                   /protein_id="ACY10233.1"
FT                   /translation="MENIFKIELMNGICRSENMNMKKKNKGEKI"
FT   gene            332816..333817
FT                   /locus_tag="SAAV_0291"
FT   CDS_pept        332816..333817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0291"
FT                   /product="bacterial luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10234"
FT                   /protein_id="ACY10234.1"
FT                   /translation="MVKLSVLDYALIDEGKDAQKALQDSVTLAKLADRLGFKRIWFTEH
FT                   HNVPAFACSSPELLMMHTLAQTNHIRVGSGGVMLPHYRPYKIAEHFRMMAALYPNRIDL
FT                   GIGNNPGTTMVKQALDGINPTYDSYDESISLLRDYLTIKDKPSAHTLGVQPHIDHFPEM
FT                   WLLSSSATSAKIAAELGIGLSVGTFLLPDINAIHAAKDNIDIYKKHFQASTIKMDAKVM
FT                   ASVFVIVADNEAEVAALQHALDVWLLGKLQFAEFEHFPSVDTAQKYKLNDRDKEMIQVH
FT                   QARIIAGTQEQVKAQLDDFIATFEVDEVLVAPLIPGIEQRCKTLKLLAEIYL"
FT   gene            333911..334183
FT                   /locus_tag="SAAV_0292"
FT   CDS_pept        333911..334183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0292"
FT                   /product="glycine cleavage system H protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10235"
FT                   /protein_id="ACY10235.1"
FT                   /translation="MTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVIDVQTPL
FT                   SGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA"
FT   gene            334184..334984
FT                   /locus_tag="SAAV_0293"
FT   CDS_pept        334184..334984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10236"
FT                   /protein_id="ACY10236.1"
FT                   /translation="METLKSNKARLEYLINDMRRERNDNDVLVMPSSFEDLWELYRGLA
FT                   NVRPALPVSDEYLAVQDAMLSDLNHQHVTDLKDLKPIKGDNIFVWQGDITTLKIDAIVN
FT                   AANSRFLGCMQANHDCIDNIIHTKAGVQVRLDCAEIIRQQGRNEGVGKAKKTRGYNLPA
FT                   KYIIHTVGPQIRRLPVSKMNQDLLAKCYLSCLKLADQHSLNHVAFCCISTGVFAFPQDE
FT                   AAEIAVRTVESYLKETNSTLKVVFNVFTDKDLQLYKEALNRDAE"
FT   gene            334974..335918
FT                   /locus_tag="SAAV_0294"
FT   CDS_pept        334974..335918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10237"
FT                   /protein_id="ACY10237.1"
FT                   /translation="MQSSKWNAMSLLMDEKTKQAEVLRTAIDEADAIVIGIGAGMSASD
FT                   GFTYVGERFTENFPDFIEKYRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQS
FT                   YLALKSLVEGKQYHIITTNADNAFDAAEYDMTHVFHIQGEYILQQCSQHCHAQTYRNDD
FT                   LIRKMVVAQQDMLIPWEMIPRCPKCDAPMEVNKRKAEVGMVEDAEFHAQLQRYNAFLEQ
FT                   HQDDKVLYLEIGIGYTTPQFVKHPFQRMTRKNENAIYMTMNKKAYRIPNSIQERTIHLT
FT                   EDISTLITTALRNDSTTQNNNIGETEDVLNRTD"
FT   gene            335896..336918
FT                   /locus_tag="SAAV_0295"
FT   CDS_pept        335896..336918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0295"
FT                   /product="lipoate-protein ligase A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10238"
FT                   /protein_id="ACY10238.1"
FT                   /translation="MYLIEPIRNGEYITDGAIALAMQVYVNQHIFLDEDILFPYYCDPK
FT                   VEIGRFQNTAIEVNQDYIDKHSIQVVRRDTGGGAVYVDKGAVNMCCILEQDTSIYGDFQ
FT                   RFYQPAIKALHTLGATDVIQSGRNDLTLNGKKVSGAAMTLMNNRIYGGYSLLLDVNYEA
FT                   MDKVLKPNRKKIASKGIKSVRARVGHLREALDEKYRDITIEEFKNLMVTQILGIDDIKE
FT                   AKRYELTDADWEAIDELADKKYKNWDWNYGKSPKYEYNRSERLSSGTVDITISVEQNRI
FT                   ADCRIYGDFFGQGDIKDVEEALQGTKMTREDLMHQLKQLDIVYYFGNVTVESLVEMILS
FT                   "
FT   gene            337234..338259
FT                   /locus_tag="SAAV_0296"
FT   CDS_pept        337234..338259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0296"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10239"
FT                   /protein_id="ACY10239.1"
FT                   /translation="MNNKVLVTGGTGFVGMRIISRLLEQGYEVQTTIRDLSKADKVIKT
FT                   MQDNGISTERLMFVEADLSQDEHWDEAMKDCKYVLSVASPVFFGKTDDAEVMAKPAIEG
FT                   IQRILRAAEHAGVKRVVMTANFGAVGFSNKDKNSITNESHWTNEDEPGLSVYEKSKLLA
FT                   EKAAWDFVENENTIVEFATINPVAIFGPSLDAHVSGSFHLLENLLNGSMKRVPQIPLNV
FT                   VDVRDVAELHILAMTNEQANGKRFIATADGQINLLEIAKLIKEKRPEIAQKVSTKKLPD
FT                   FILSLGAKFNHQAKEGKLLLDMNRNVSNERAKTLLGWEPIATQEEAILAAIDSMAKFHL
FT                   I"
FT   gene            complement(338353..339699)
FT                   /gene="ulaA"
FT                   /locus_tag="SAAV_0297"
FT   CDS_pept        complement(338353..339699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ulaA"
FT                   /locus_tag="SAAV_0297"
FT                   /product="ascorbate-specific PTS system enzyme IIC"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10240"
FT                   /protein_id="ACY10240.1"
FT                   /translation="MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTI
FT                   LGFLILSAGADVVVRSLEPFGKIFQHAFGVQGIVPNNEAIVSLALKDFGTTAALIMVCG
FT                   MIVNILIARFTNLKYIFLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVL
FT                   PALLQPTMRKITGNDQVALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRES
FT                   TISISITMALLYFIACLFAGVSYVHESISDGQNFIVFSLIQGVTFAAGVFIILTGVRLI
FT                   LAEIVPAFKGISEKLVPNSKPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGG
FT                   VVILPGVVAHFFLGATAAVFGNARGGIKGAVAGAALNGILITFLPLLFLPFLGELGGAA
FT                   TTFSDTDFLTVGIVFGNAVKYMGLFGAILFIIIVGATAILLKGRQKPQQ"
FT   gene            complement(339714..339998)
FT                   /locus_tag="SAAV_0298"
FT   CDS_pept        complement(339714..339998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10241"
FT                   /protein_id="ACY10241.1"
FT                   /translation="MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTAS
FT                   PEMADLFICGRDLAENAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI"
FT   gene            complement(340000..340443)
FT                   /locus_tag="SAAV_0299"
FT   CDS_pept        complement(340000..340443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0299"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10242"
FT                   /protein_id="ACY10242.1"
FT                   /translation="MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAM
FT                   IDSVNELGPYIVIAPEIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSA
FT                   IDNHSHLSVLQNLATVLGDNQTVQQLLTAKNAQDIKNILKEHD"
FT   gene            complement(340448..342403)
FT                   /locus_tag="SAAV_0300"
FT   CDS_pept        complement(340448..342403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0300"
FT                   /product="BglG family transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10243"
FT                   /protein_id="ACY10243.1"
FT                   /translation="MLSYRQIEILYLLIHEQTFIPINTIANQLGVSPRTIQYDIAYIEQ
FT                   YAETYHYQVSRNKAAGIKVTTAHATLLNELEHNLTNQIHFSKDERLTHIALKLFETTDP
FT                   VSTKQLAQDVNVSRRTIADDIKMIQAQLDQYHLKLNYVHNKGFNVIGEEDHYRKAYAHF
FT                   IHQYMKQAAPFIEADIFNSESIALVRRAIIKTLNSENYHLVQSAIDGLIYHILIAIQRL
FT                   NENFSFDIPINEIDKWRHTNQYAIASKMIENLERSCNVTFPESEIIFITLHLLGSKMTE
FT                   HTASSITFEYHDLSQNIHELITCVSQELGIDMSKDNKLHTSLITHIKPAIHRIKYDMLQ
FT                   PNPLRQEVMRRYPQIIEAVSKHISPIEQDAAIRFNEDELTYITIHFASSIERVATHKQS
FT                   MIKVVLLCGSGIGTSQLLKSKLNHLYPEFHIWDAYSIYQLEESRLLQDNIDYVISTVPC
FT                   EISTVPVIHVDPFINQQSRQKLNQIINDSREQRVMKMATDGKSLADLLPEHRIIINEQP
FT                   LSIESAIAVAVQPLINDGIVYSNYTAAILKQFEQFGSYMVISPHIALIHAGTDYVQNGV
FT                   GFALTYFTEGIIFGSKANDPVHLVITLATDHPNAHLKALGQLSECLSNDLYRQDFLDGN
FT                   IFKIKQHIALTMTKEV"
FT   gene            342615..343034
FT                   /locus_tag="SAAV_0301"
FT   CDS_pept        342615..343034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0301"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10244"
FT                   /protein_id="ACY10244.1"
FT                   /translation="MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQ
FT                   DGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAF
FT                   TSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ"
FT   gene            343141..344496
FT                   /locus_tag="SAAV_0302"
FT   CDS_pept        343141..344496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0302"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10245"
FT                   /protein_id="ACY10245.1"
FT                   /translation="MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGF
FT                   LEDSHMISAISLTLPVFAILMGLGNLFGVGAGTYISRLLGAKDYSKSKFVSSFSIYGGI
FT                   ALGLIVILVTLPFSDQIAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIG
FT                   APMISMIGMLASVGLNIILDPILIFGFDLNVVGAALGTAISNVAAALFFIIYFMKNSDV
FT                   VSVNIKLAKPNKEMLSEIFKIGIPAFLMSILMGFTGLVLNLFLAHYGNFAIASYGISFR
FT                   LVQFPELIIMGLCEGVVPLIAYNFMANKGRMKDVIKAVIMSIGVIFVVCMIAVFTIGHH
FT                   MVGLFTTDQAIVEMATFILKVTMASLLLNGIGFLFTGMLQATGQGRGATIMAILQGAII
FT                   IPVLFIMNALFGLTGVIWSLLIAESLCALAAMLIVYLLRDRLTVDTSELIEG"
FT   gene            344600..345040
FT                   /locus_tag="SAAV_0303"
FT   CDS_pept        344600..345040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10246"
FT                   /protein_id="ACY10246.1"
FT                   /translation="MYKSKILLKYIFSEESEVKDLTEEKYNQDYEALTFSFKEETYQSR
FT                   LAKKTPTKAGYFVTCWTKDENNCNQPYSKEAFADYLMIIVIDEELSGYFLFPRELLVEK
FT                   GILTTFEHKGKMAFRVYPKWCNQLNKTAGQTQKWQCKYFFEY"
FT   gene            complement(345123..346481)
FT                   /gene="glpT"
FT                   /locus_tag="SAAV_0304"
FT   CDS_pept        complement(345123..346481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="SAAV_0304"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10247"
FT                   /protein_id="ACY10247.1"
FT                   /translation="MNFLKPAKHIKPLPENQIDDTYKRLRLQVFLGIFIGYAGYYLLRK
FT                   NFSLAMPALQEQGFTKAELGFALSAVSIAYGFSKFFMGTVSDRSNARIFLVLGLALTAI
FT                   VNLLMGFVPFFTSGIGIMFVLLFLNGWFQGMGWPPSGRVLVHWFSVSERGSKTALWNVA
FT                   HNVGGGIMAPIAAWGITTTAFINFGYLKGFEGVFIYPALLALIIAAISYVLIRDTPQSQ
FT                   GLPPIEIYKNDFATSDKKTLETELTTKEILFKYVLNNKWVWAIAFANIFVYFVRYGVLD
FT                   WAPVYLSEEKHFDLKASGWAYFLYEWAGIPGTLLCGYISDKLFKGRRGPAGFFFMLGVT
FT                   VFVLIYWLNPPGNAWLDNVSLIAIGFLIYGPVMLIGLQALDYVPKKAAGTAAGLTGLFG
FT                   YLFGAVMANIVLGAVVDKFGWDVGFILLTAISVFAMLSFILTWNKVGQETVHH"
FT   gene            346793..347719
FT                   /locus_tag="SAAV_0305"
FT   CDS_pept        346793..347719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0305"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10248"
FT                   /protein_id="ACY10248.1"
FT                   /translation="MNIVGHHHISMYTKDAKRNKDFYTNVLGLRLVEKSVNQDNPSMYH
FT                   LFYGDEVGTAGTILSFFEIPHAGHKQPGTETIYRFSLLVPNQAALHYFEKRLDNNGITS
FT                   ERLYYLGQEGVVFKDEDDLEIILLVNDSFEVPHQWQHNAYSEIPQAYQILGIGPVELRV
FT                   RNAARTVEFLENVLGYRKRDNKSFDVLTLAPQGLYSDFVVIEQQGQRERPGRGYIHHIA
FT                   INTPQMSDLDAIYKKLQQQTQSNSGIIDRYFFKSLYYRHNSIMYEFATEAPGFTIDTPL
FT                   EQLGSQLNLPDFLEAEREQIESKLHEI"
FT   gene            347733..348794
FT                   /locus_tag="SAAV_0306"
FT   CDS_pept        347733..348794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10249"
FT                   /protein_id="ACY10249.1"
FT                   /translation="MAKLEMNKNTPLEFGLYSLGDHLLNPFKGEKVSYEQRINEIIEAS
FT                   KLADETGIDVFAVGESHQEHFTTQAHTVVLGAIAQATKHIKVSSSSTIISATDPVRVFE
FT                   DFATLDLISHGRAEIVAGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWS
FT                   GKYRPELRNMKIFPRPIDNILPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGS
FT                   IDAYRQAATEAGFDASHKSLPVSTASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPK
FT                   QQFANSSDYREALMVGSPQQIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIG
FT                   NEIIPAIKKHLSK"
FT   gene            348808..349374
FT                   /locus_tag="SAAV_0307"
FT   CDS_pept        348808..349374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0307"
FT                   /product="FMN reductase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10250"
FT                   /protein_id="ACY10250.1"
FT                   /translation="MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELEL
FT                   EFSVGKNYLDTTGDVYKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKV
FT                   IGLVATAGSSKHYLIPEMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKA
FT                   LAQFTMRTAKVQQQVFEEENNQYDF"
FT   gene            complement(349433..350428)
FT                   /locus_tag="SAAV_0308"
FT   CDS_pept        complement(349433..350428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10251"
FT                   /protein_id="ACY10251.1"
FT                   /translation="MASLKNKHFMIGLSLTFIVALFSFLAAKLPILDKVGALTIAILIA
FT                   ILYRHFRGYPEQYSSGITFSSKYLLRFAIILYGLKLNIFDIIGQGSKLLAIDVGVVIFS
FT                   IVMMLFVNKLLHGDKNIALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGT
FT                   IFSLIYTAIYAIFSMTTNVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFL
FT                   LIPLTIVLILIMRFRSSESSSKGRISIPYFLIGFVIMALVNTYVTIPSVLLNILNTIST
FT                   ICLLMAMVALGLNVAFKDLKNRALKPLMTIIITSICLSSLAFIVVHWLYS"
FT   gene            350427..350780
FT                   /locus_tag="SAAV_0309"
FT   CDS_pept        350427..350780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10252"
FT                   /protein_id="ACY10252.1"
FT                   /translation="MSSASFNSILALFCRIFKYKFGMVNKVVIKLSCVIGIKDINQSNR
FT                   HYNAYWRGPNKEADEKSAYNNVQVGDGPQHREIGSVISTDNASWRGPNKFKIQCVILIC
FT                   YYYDNLQNYMKNE"
FT   gene            350793..351338
FT                   /locus_tag="SAAV_0310"
FT   CDS_pept        350793..351338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0310"
FT                   /product="ribosomal-protein-serine acetyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10253"
FT                   /protein_id="ACY10253.1"
FT                   /translation="MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATE
FT                   QPSDTRAFIKRGLLQFADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKQFE
FT                   GHGIMTQAVEALIKYCFEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNG
FT                   IYSSSYIYSLLKSEYDQK"
FT   gene            351605..352459
FT                   /locus_tag="SAAV_0311"
FT   CDS_pept        351605..352459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0311"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10254"
FT                   /protein_id="ACY10254.1"
FT                   /translation="MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQAT
FT                   KAYDKYTDEQLNEFLKGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDP
FT                   KIDARLADMKEEKKEKEWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTL
FT                   DITPKLMLQGSVDLLNEVATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKK
FT                   DKKLSDDIQMNFDKVNQLLDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAV
FT                   ITE"
FT   gene            352456..353685
FT                   /locus_tag="SAAV_0312"
FT   CDS_pept        352456..353685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0312"
FT                   /product="Dyp-type peroxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10255"
FT                   /protein_id="ACY10255.1"
FT                   /translation="MTNYEQVNDSTQFSRRTFLKMLGIGGAGVAIGASGVGSMWSFKSM
FT                   FNTPEDPEKDAYEFYGKVQPGITTPTQKTCNFVALDLKSKDRDAIKAMFKKWTVMADRM
FT                   MDGDTVGKTSNNPLMPPVDTGESIGLGASKLTITFGISKSLMKKIGLSSKIPDAFKDLP
FT                   HFPNDQLIDDYSDGDIMIQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQSGFISAKGKE
FT                   TPRNLMAFKDGTINPRKSNQLKDYVFIDDGWAKHGTYCVVRRIQIHIETWDRTALEEQE
FT                   ATFGRKRHSGAPLTGGKEFDEIDLKAKDSHGEYIIDKDAHTRLAKEANTSILRRAFNYV
FT                   DGTDDRTGNFETGLLFIAFQKATKQFIDIQNNLGSNDKLNEYITHRGSASFLVLPGVSK
FT                   GGYLGETLFD"
FT   gene            353666..355378
FT                   /locus_tag="SAAV_0313"
FT   CDS_pept        353666..355378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10256"
FT                   /protein_id="ACY10256.1"
FT                   /translation="MKHYLTKFVAMLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAK
FT                   SALSNNSISNDNKQKAIEQVVSAVKKLSLEDNSEGNAVKSDVRKLEDAKANDNQKDTLS
FT                   QLTKSLIAYEEKLASKDAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIW
FT                   TSNETVIRNYDANQYGQIEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSDT
FT                   SANDQYHVSQLNDALEKAIKAIDDNQLSDADAALTHFIEIWPYVEGQIQTKDGALYTKI
FT                   EDKIPYYQSVLDEHNKSHVKDGLVDINNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVM
FT                   TLTTMTRKVKDNKGTASVIGGAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAV
FT                   ILMFIVGVWMHKRSNAKRWNDMIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYM
FT                   GMIGELATKDFIIGIALAIVILIVFAVLFRFIVRLIPIFYIFRVLSIFIFIMGFKMLGV
FT                   SIQKLQLLGAMPRHVIEGFPTINWLGFYPSYEPLIAQAAYIMVVAILIFKFKK"
FT   gene            complement(355619..356224)
FT                   /locus_tag="SAAV_0314"
FT   CDS_pept        complement(355619..356224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0314"
FT                   /product="MttB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10257"
FT                   /protein_id="ACY10257.1"
FT                   /translation="MTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISPVMFY
FT                   QLWAFIAPGLHNNERQFIYKYSFFSVLLFCAGVAFTFYVGFPIIIQFALKLSLTLNISP
FT                   VIGFKAYLVELIRWLFTFGILFQLPILFIGLAKFGLIDITSLKHYRKYIYFACFVLASI
FT                   IAPPDLTLNILLTLPLILLFEFSMFIVKFTCRGKPPTH"
FT   gene            complement(356337..356552)
FT                   /locus_tag="SAAV_0315"
FT   CDS_pept        complement(356337..356552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0315"
FT                   /product="mttA/Hcf106 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10258"
FT                   /protein_id="ACY10258.1"
FT                   /translation="MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKE
FT                   FKSATEDLDKESHDTPSKESKQQREQ"
FT   gene            complement(356661..357050)
FT                   /locus_tag="SAAV_0316"
FT   CDS_pept        complement(356661..357050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10259"
FT                   /protein_id="ACY10259.1"
FT                   /translation="MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTAT
FT                   YVHQSEDDIVTSSVKSNHPVAQKSNKTIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWH
FT                   IDIQAGTCTYIDLKEQAIISELIPQ"
FT   gene            357290..357493
FT                   /locus_tag="SAAV_0317"
FT   CDS_pept        357290..357493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0317"
FT                   /product="putative transcriptional regulator, Cro/CI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10260"
FT                   /protein_id="ACY10260.1"
FT                   /translation="MRNRLKELRARDGLNQTQLAKLAGVSRQTISLIERNNFMPSVLTA
FT                   IKIARIFNETVETVFIIEEDEA"
FT   gene            357490..358203
FT                   /locus_tag="SAAV_0318"
FT   CDS_pept        357490..358203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10261"
FT                   /protein_id="ACY10261.1"
FT                   /translation="MKILRYIGYLLLGGIVGGIIGGILGNFDGLGIENLTFATYNNVVV
FT                   ISIVATMIIILVEAIVLMNQRRALKYKRLVDEEVDIDATDQYELLANRYVLNGSILSVI
FT                   QTIIAFVVLLIFVVGQAEANAMLFFLIPFFASAIFNTQFTLFNRKFDDRMPKIADKNYT
FT                   EKRLEILDEGERHIELIALFKTYAINLSILILAIIFIGSYSIATGINQSFSLLLIIAIF
FT                   IYNAFSYLLKRRRFY"
FT   gene            358228..359070
FT                   /locus_tag="SAAV_0319"
FT   CDS_pept        358228..359070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0319"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10262"
FT                   /protein_id="ACY10262.1"
FT                   /translation="MTTLLNVDRVNKQYKDSDFKLQDASLTISTNETVGLIGKNGSGKS
FT                   TLINILVGNRHKDNGSIAFFGEEHAADDVEYKEHIGVVFDDLRVPNKLTIKDIDKVFQS
FT                   IYTTWNSQKFFDLIKYFELPLQTKIKTFSRGMRMKIALTIALSHDVKLLILDEATAGMD
FT                   VSGREEVMELLEDFVAQGGGILISSHISEDIEQLADKLVFMKDGRMILTEQKDILLAQY
FT                   GIVTTGDKDVEIPKHLIIASRLSKGKYQILVKDYAEIENAEPLKHIDDATKIIMRGEV"
FT   gene            359070..359699
FT                   /locus_tag="SAAV_0320"
FT   CDS_pept        359070..359699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10263"
FT                   /protein_id="ACY10263.1"
FT                   /translation="MKGMFLSSFYATRKQTYIYFIVAIIAAGYFAVFNPLMSSAMAGVM
FT                   LITPITDNIKHEKDSRWMYYVSTLPVKRSDYIKSYFAFYLILFGASLMIGLVVTTIVTQ
FT                   SVMIGIMSGLMSFGIIGAYSIIFPLTFKFGAENSNVIMIVASILLLFSFVVFFFIYGMV
FT                   SGASALEFEKISTEGWLVVIVYAVIGIVITSVSYILSIKIFNKQEL"
FT   gene            complement(360086..361219)
FT                   /locus_tag="SAAV_0321"
FT   CDS_pept        complement(360086..361219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10264"
FT                   /protein_id="ACY10264.1"
FT                   /translation="MVNALTPKHLAEKRAGFHELFFDLIFVYAIQKIAHVILTTQNGSI
FT                   SADLFFKYIVMSLFLWLMWSHQTFFTNRFGQVTFKDVSFMMFNMFIMVFLSNSLYPDFE
FT                   KTFFPFFLCVAIMYLSIGLQYLLHIRTGLDYGDKRTCQAFASVAFVISFLSFLSLVLPQ
FT                   SIHYIPGFLGVFIAATGLIPFQKYLVLSPVNMMHLVERFSLLTIIIFGEVLVGLASSSF
FT                   SIDHFSYIYIFQFMILISLFGVYWIITENYINHKLSSIGFRLSYTHLLINIALGVINAA
FT                   IVFSNNNKLNDLFEINMMYISVLIFYIGLWLITPYFHNELTNAKYISSSLGILVVSYII
FT                   SLIFKGHDQVMIISVSVATFCIMLIYFKNQRLRNKHE"
FT   gene            361758..362939
FT                   /locus_tag="SAAV_0322"
FT   CDS_pept        361758..362939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0322"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10265"
FT                   /protein_id="ACY10265.1"
FT                   /translation="MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNP
FT                   SEIDEVIIGNVLQAGQGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVT
FT                   GENDIVLAGGMENMSQSPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAEN
FT                   LVEQYGISREEQDTFAVNSQHKAVRAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRE
FT                   NVSVEKLSRLRPAFKKDGTVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGS
FT                   HGVDPSIMGIAPVGAVEKALKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNV
FT                   KGGAIALGHPIGASGARVLVTLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK"
FT   gene            complement(363022..363774)
FT                   /locus_tag="SAAV_0323"
FT   CDS_pept        complement(363022..363774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10266"
FT                   /protein_id="ACY10266.1"
FT                   /translation="MTQYPLWQQLNTLKQATWVDLTHTFDPEIPRFSEFEKGEVSTLFT
FT                   VKDHGFYVQRWNIVTQYGTHIDAPIHFVENKRYLEDIDLKELVLPLIVLDFSTEVANNN
FT                   DFIVTRAHIEAWEKEHGTIEPGTFVALRTDWSKRWPNIEKFENKDANGQQHAPGWGLDA
FT                   LKYLIEERRVEAVGHETFDTDASVDVVKNGDLVGERYILGQDKYQVELLTNLDQLPTRG
FT                   AIIYAISPKPKDAPGFPVRAFAIKPSND"
FT   gene            complement(363817..366045)
FT                   /gene="metE"
FT                   /locus_tag="SAAV_0324"
FT   CDS_pept        complement(363817..366045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SAAV_0324"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10267"
FT                   /protein_id="ACY10267.1"
FT                   /translation="MTTIKTSNLGFPRLGRKREWKKAIESYWAKKISKEELDQTLTDLH
FT                   KENLLLQKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGRTIDDDLLFDIARGNKD
FT                   HVASALIKWFNTNYHYIVPEWDNVEPKVSRNVLLDRFKYAQSLNVNAHPVIVGPITFVK
FT                   LSKGGHQTFEEKVKTLLPLYKEVFESLIDAGAEYIQVDEPILVTDDSESYENITREAYD
FT                   YFEKAGVAKKLVIQTYFERAHLKFLSSLPVGGLGLDFVHDNGYNLKQIEAGDFDKSKTL
FT                   YAGIIDGRNVWASDIEAKKVLIDKLLAHTNELVIQPSSSLLHVPVSLDDETLDTSVGEG
FT                   LSFATEKLDELDALRRLLNQNDSVKYDKLKARYERFQNQSFKNLDYDFESVRTSRQSPF
FT                   AQRIEQQQKRLNLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWI
FT                   KIQEDIGLDVLVHGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKW
FT                   TAPLTVDETVYAQSLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLA
FT                   LEAAGIKVIQVDEPALREGLPLRSEYHEQYLKDAVLSFKLATSSVRDETQIHTHMCYSQ
FT                   FGQIIHAIHDLDADVISIETSRSHGDLIKDFEDINYDLGIGLGVYDIHSPRIPTKEEIT
FT                   TAINRSLQQIDRSLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE"
FT   gene            complement(366042..367883)
FT                   /locus_tag="SAAV_0325"
FT   CDS_pept        complement(366042..367883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0325"
FT                   /product="bifunctional homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10268"
FT                   /protein_id="ACY10268.1"
FT                   /translation="MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVER
FT                   IHRSYIEAGADVIQTNTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTV
FT                   GGFRGIKQEDISLQTILYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDI
FT                   PIIAQLTASNTNYLVNGQAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHA
FT                   FLSCYPNASLLDIENSEFKYSDNAQYFGQVAQNLIREGVRLIGGCCGTTPEHIKFIKES
FT                   IQTLKPVNDKKVIPIPTKALFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFE
FT                   NIAKLDKANVDAVTLADNSLATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSH
FT                   LLGLSLIGVNEILAITGDPSKVGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKK
FT                   RTHFNIAGAFNPNVRKLDGAVKRLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKP
FT                   FFIGIMPIASYKNALFLHNEVPGIKMSDEILQQFEAVKDDKAKTRELSLKLSKDLIDTV
FT                   HEYFNGLYIITPFQNVEDSLELAAYSKSITAHKEAIL"
FT   gene            complement(367852..369012)
FT                   /locus_tag="SAAV_0326"
FT   CDS_pept        complement(367852..369012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0326"
FT                   /product="trans-sulfuration enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10269"
FT                   /protein_id="ACY10269.1"
FT                   /translation="MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDY
FT                   ARSGNPNRELLEEKLARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFR
FT                   LTEQILNRFNIEFTTVDTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEK
FT                   HELLVAVDNTFMTPLGQSPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISEALYL
FT                   IQNGTGNMLSAQDSWTLAKHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTA
FT                   HLEQAKNGGAVIGFRLADESKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEE
FT                   VRQERGITFGLFRLSVGLEDPDELIADIKYALKEAFNESIPHTIER"
FT   gene            complement(369009..370112)
FT                   /locus_tag="SAAV_0327"
FT   CDS_pept        complement(369009..370112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0327"
FT                   /product="trans-sulfuration enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10270"
FT                   /protein_id="ACY10270.1"
FT                   /translation="MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRT
FT                   KNPTRSTFETCFAKLEHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFE
FT                   FYEQQYDIKFKYVDFTDYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGL
FT                   LSIIDNTFLTPYLSTPLAEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHN
FT                   MTGATLSPIDSYLLLRGLKTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSL
FT                   RLNKAYSVAKLLENLDICIFAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRL
FT                   SLGVENYEDIERDIIQALDKAQIGEIV"
FT   gene            370774..371619
FT                   /locus_tag="SAAV_0328"
FT   CDS_pept        370774..371619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0328"
FT                   /product="spoOJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10271"
FT                   /protein_id="ACY10271.1"
FT                   /translation="MSELSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLN
FT                   DLADSIKQYGILQPIVLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMEL
FT                   AVIENLQREDLNAIEEAESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIA
FT                   DMVKDGRLTSAHGRTLLAIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETD
FT                   KVDITKPKFIKQQERQLREQYGTKVDISIKKSVGKISFEFDSQDDFVRIIEQLNRRYGK
FT                   "
FT   gene            371773..372654
FT                   /locus_tag="SAAV_0329"
FT   CDS_pept        371773..372654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10272"
FT                   /protein_id="ACY10272.1"
FT                   /translation="MDQVMSIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKIL
FT                   NKMIEQGFKIQNKSKKSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIAS
FT                   AGVVGLAVGFGAQTIVKDVIIGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRST
FT                   RINTISGELTILPNSSMGEITNYSITNGTAIVKIPVSVDENIDNVEKKLNKLFTSLRSK
FT                   YYLFVSDPVVIGIDAFEDTRVILRVSAETIPGEGFSGARIIRKEVQKMFLQEGIKTPQP
FT                   IMTPFNHSENGV"
FT   gene            372684..372887
FT                   /locus_tag="SAAV_0330"
FT   CDS_pept        372684..372887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10273"
FT                   /protein_id="ACY10273.1"
FT                   /translation="MASKYGINDIVEMKKQHACGTNRFKIIRMGADIRIKCENCQRSIM
FT                   IPRQTFDKKLKKIIVSQDDTQR"
FT   gene            372899..373996
FT                   /locus_tag="SAAV_0331"
FT   CDS_pept        372899..373996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0331"
FT                   /product="GTP-dependent nucleic acid-binding protein EngD"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10274"
FT                   /protein_id="ACY10274.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVE
FT                   VPDARLLKLEEMVQPKKTLPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVV
FT                   RAFDDDNVTHVAGRVDPIDDIEVINMELVLADLESVEKRLPRIEKLARQKDKTAEMEVR
FT                   ILTTIKEALENGKPARSIDFNEEDQKWVNQAQLLTSKKMLYIANVGEDEIGDDDNDKVK
FT                   AIREYAAQEDSEVIVISAKIEEEIATLDDEDKEMFLEDLGIEEPGLDRLIRTTYELLGL
FT                   STYFTAGVQEVRAWTFKQGMTAPQCAGIIHTDFERGFIRAEVTSYDDYVQYGGESGAKE
FT                   AGRQRLEGKEYIMQDGDIVHFRFNV"
FT   gene            complement(374082..374273)
FT                   /locus_tag="SAAV_0332"
FT   CDS_pept        complement(374082..374273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10275"
FT                   /protein_id="ACY10275.1"
FT                   /translation="MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGK
FT                   QFFSTQDIIYASKIIPFF"
FT   gene            374517..374813
FT                   /gene="rpsF"
FT                   /locus_tag="SAAV_0333"
FT   CDS_pept        374517..374813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="SAAV_0333"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10276"
FT                   /protein_id="ACY10276.1"
FT                   /translation="MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGK
FT                   RRLAYEINDFKDGFYNIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK"
FT   gene            374834..375337
FT                   /gene="ssb2"
FT                   /locus_tag="SAAV_0334"
FT   CDS_pept        374834..375337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb2"
FT                   /locus_tag="SAAV_0334"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10277"
FT                   /protein_id="ACY10277.1"
FT                   /translation="MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGERE
FT                   ADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLE
FT                   PKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDD
FT                   DLPF"
FT   gene            375389..375631
FT                   /gene="rpsR"
FT                   /locus_tag="SAAV_0335"
FT   CDS_pept        375389..375631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="SAAV_0335"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10278"
FT                   /protein_id="ACY10278.1"
FT                   /translation="MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKIL
FT                   PRRVTGTSAKYQRMLTTAIKRSRHMALLPYVKEEQ"
FT   gene            complement(375908..376882)
FT                   /locus_tag="SAAV_0336"
FT   CDS_pept        complement(375908..376882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10279"
FT                   /protein_id="ACY10279.1"
FT                   /translation="MEKDDILAEIKPMLNFDEQIAKLKQMNIFFNIIDTEKANEILRKN
FT                   NYFFKLAYFRKNFEKKNGGYFIEFAYLSDLATIDMKLRYTMLHLTLDIEHSLKCLVLKL
FT                   ITENNQEDGYKIIDEFLCIDKSYSNSNFDTNSRTPEEVMETKIKNKNEIFKHMNKRGQL
FT                   PEKLNKYYQNPPAWVCIEFMQLGQFVSFLNFYYKKYNDEELRVANILMPLVKNIRNKSA
FT                   HNQPIIANLNYDSRSPQYLFEKGNNIGISRNMFGIKNFIDTFATLELHNQVCSNAIIQA
FT                   RYHDLDQLQKRYKRNESYYNNALAIKRFFIALDKIIDFNRPKV"
FT   gene            complement(377304..377444)
FT                   /locus_tag="SAAV_0337"
FT   CDS_pept        complement(377304..377444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0337"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10280"
FT                   /protein_id="ACY10280.1"
FT                   /translation="MVKAMVQFQIANDMRIGELLAIKRVNINYEDKTLDIDGKVNWITE
FT                   K"
FT   gene            377804..378415
FT                   /locus_tag="SAAV_0338"
FT   CDS_pept        377804..378415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0338"
FT                   /product="staphylococcal enterotoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10281"
FT                   /protein_id="ACY10281.1"
FT                   /translation="MFKKYDSKNSIVLKSILSLGIIYGGTFGIYPKADASTQNSSSVQD
FT                   KQLQKVEEVPNNSEKALVKKLYDRYSKDTINGKSNKSRNWVYSERPLNENQVRIHLEGT
FT                   YTVADRVYTPKRNITLNKEVVTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGK
FT                   YTLESHKELQKDRENVKINTADIKNVTFKLVKSVNDIEQV"
FT   gene            378784..379152
FT                   /locus_tag="SAAV_0339"
FT   CDS_pept        378784..379152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10282"
FT                   /protein_id="ACY10282.1"
FT                   /translation="MKTILKTITYLALTIIGAYAALFILKTIDSHGITDQFNPLVKEDD
FT                   SYVKTTEVSTRMDDQLRSYTQSAFNKEGKETQLMYTATFDVKPHRYLKITHKGHHVETF
FT                   EEVEKEEVPKKALDKLSR"
FT   gene            379363..379905
FT                   /locus_tag="SAAV_0340"
FT   CDS_pept        379363..379905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10283"
FT                   /protein_id="ACY10283.1"
FT                   /translation="MSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSP
FT                   EDAVKKAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEK
FT                   EDTVNENDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQE
FT                   VTVDAKNGKVLKSEQDH"
FT   gene            complement(380042..380305)
FT                   /locus_tag="SAAV_0341"
FT   CDS_pept        complement(380042..380305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10284"
FT                   /protein_id="ACY10284.1"
FT                   /translation="MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHH
FT                   EPKFKDAMHLADFFDAPYEMFLESKVKEYQKHLEEVDIRMDK"
FT   gene            380605..380856
FT                   /locus_tag="SAAV_0342"
FT   CDS_pept        380605..380856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10285"
FT                   /protein_id="ACY10285.1"
FT                   /translation="MFGFIGMLIVGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGG
FT                   KLFGQWGPELGSIYILPALIGSIILIAIVTLILRAMRK"
FT   gene            381282..381863
FT                   /locus_tag="SAAV_0343"
FT   CDS_pept        381282..381863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0343"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10286"
FT                   /protein_id="ACY10286.1"
FT                   /translation="MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCD
FT                   YFKEKQIKHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPK
FT                   YEKYFNDPNFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVV
FT                   IRCLMVYFNKVSREEAVDLKVENCKPYIIE"
FT   gene            complement(381929..382312)
FT                   /locus_tag="SAAV_0344"
FT   CDS_pept        complement(381929..382312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10287"
FT                   /protein_id="ACY10287.1"
FT                   /translation="MKVRITFIILAILSTIVCLFLAAMHPTGPNTVTFEQPYLFTLNII
FT                   LMVLVALPSLVLAIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSI
FT                   ILFISAIITLAIGGKSVDKNDSH"
FT   gene            complement(382582..383208)
FT                   /locus_tag="SAAV_0345"
FT   CDS_pept        complement(382582..383208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10288"
FT                   /protein_id="ACY10288.1"
FT                   /translation="MKKRLLLSTFLASALILTGCASDQSDNEDHHTSTGIHAPKSAKKL
FT                   ETKDIFNSDKKNSDISDAEMKQAIEKYLSVNSDILDNKYIMQHKLDKQIDSQTKVTEKQ
FT                   AETLSHLSNLAVKNDLHFKKFVTENNIPKEYKKPVELMMNYFKALNSTIANVDEDIEKL
FT                   SYQPQNKINVVDVPTKYAGDVNKKQQDKIKDFLKSKGIKSDVIDK"
FT   gene            complement(383281..383472)
FT                   /locus_tag="SAAV_0346"
FT   CDS_pept        complement(383281..383472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10289"
FT                   /protein_id="ACY10289.1"
FT                   /translation="MNEIIMLLRTIPTSKLIQPIMQLFIDNAILNIVQNDALLIEKATH
FT                   ARNHLRLWSLQGHRDIPN"
FT   gene            complement(383652..385175)
FT                   /gene="ahpF"
FT                   /locus_tag="SAAV_0347"
FT   CDS_pept        complement(383652..385175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="SAAV_0347"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10290"
FT                   /protein_id="ACY10290.1"
FT                   /translation="MLNADLKQQLKQLLELMEGNVEFVASLGSDEKSKELKELLTEISD
FT                   MSPRLSLSEKSLKRTPSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQ
FT                   SIIDQIKNLEGSFHFETFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESEN
FT                   IMAVPAVFLNGEEFGNGRMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAI
FT                   YTARKGLRTGIVADRIGGQVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGI
FT                   RATDIEKTDEAIKVTLENGAVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDG
FT                   PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIK
FT                   TNAKTTEVVGEDHVTGIRYEDMSTGEEHLLNLDGIFVQIGLLPNTSWLKDAVELNERGE
FT                   IVIDRNNNTNVPGIFAAGDVTDQKNKQIIISMGAGANAALNAFDYIIRN"
FT   gene            complement(385191..385760)
FT                   /gene="ahpC"
FT                   /locus_tag="SAAV_0348"
FT   CDS_pept        complement(385191..385760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="SAAV_0348"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10291"
FT                   /protein_id="ACY10291.1"
FT                   /translation="MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADF
FT                   SFVCPTELEDLQNQYEELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQ
FT                   TITRNFDVLDEATGLAQRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKN
FT                   PGEVCPAKWEEGAKTLQPGLDLVGKI"
FT   gene            386252..387007
FT                   /locus_tag="SAAV_0349"
FT   CDS_pept        386252..387007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0349"
FT                   /product="NAD(P)H-flavin oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10292"
FT                   /protein_id="ACY10292.1"
FT                   /translation="MSDYVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQ
FT                   AYSIIGIDDEKIKENLREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGST
FT                   EGLLVGAIDAALVAENIAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAV
FT                   GEPADDENGAAKPHLPFDHVFHHNKYHADKETQYAQMADYDQTISEYYDQRTNGNRKET
FT                   WSQQIEMFLGNKARLDMLEQLQKSGLIQR"
FT   gene            complement(387087..388475)
FT                   /locus_tag="SAAV_0350"
FT   CDS_pept        complement(387087..388475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0350"
FT                   /product="sodium:dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10293"
FT                   /protein_id="ACY10293.1"
FT                   /translation="MNAFLTLINIIVLVIFIVILHMMARKHISFAKRVFTALGIGIVFG
FT                   VLLHLVYGTHSNVITSTSDWFNIVGQGYVALLQMIVMPLIFISIVAAFTKIQIGEKFAK
FT                   IGSLIFIFLIGTVTIAAIVGVVYALVFGLDASTINLGNAEQAHGSEIAKQAKDLTAHTL
FT                   PQQILELLPKNPFLDFTGQRATSTIAVVIFASFIGFAYLRVARKQPDHGELLKRAIDAI
FT                   YSLVMAIVTFVLRLTPYGVLAIMANTLSTSDFGAIWTLGKFLIASYAALITMYIIHLII
FT                   LSLLGISPIRYVKKTLEVLIFAFTSRSSAGALPLNVQTQTRRLGVPEGIANFAATFGLS
FT                   IGQNGCAGIYPAMLAIMVAPVANVEIDLQFIVTLIAVVIISSFGVAGVGGGATFASILV
FT                   LSTLNLPVALAGVLISVEPLIDMGRTALNVNDSMLAGTGTAKLTKHWDKDTFESNDNAA
FT                   LTSH"
FT   gene            complement(389453..390409)
FT                   /locus_tag="SAAV_0351"
FT   CDS_pept        complement(389453..390409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10294"
FT                   /protein_id="ACY10294.1"
FT                   /translation="MLTKEFAQRVELSEKQVRKIVQHLEERGYQLSKTEYRGREATDFK
FT                   EEDIELFKDIADKVKQTNSYDLAFDELEKEKDFLQVIVKNDDKNLPTNQNVAQLVEDLR
FT                   LEIQKMREERHLLGQMMNQVHQQQQELKELQNQLTSKIDSNSESLKAIQTSQEAIQEAQ
FT                   ASQAKVLAESTNKVEKNAVTEDKADSKDSKVAGVNTSTDAKTDTKAENAGDGTATKVDK
FT                   EDQISATEAIEKASVEQSKNENAAETSNKEATVDADAQHDAEQQVAEAHAEASKQATSN
FT                   DSLEAKAENDSTASQSEMSEPKPQEEKKGFFARLFNL"
FT   gene            complement(390527..391189)
FT                   /locus_tag="SAAV_0352"
FT   CDS_pept        complement(390527..391189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10295"
FT                   /protein_id="ACY10295.1"
FT                   /translation="MEFKTIQSVKDPHYNEALKLYDTKLNLSLTEDKRIIKRSLENNKT
FT                   ENDYVFIVGLENDVVVSLATAHYEATTNSAFLIYLFAKDLPNHDELMTQTLHQIEHELN
FT                   LLSNLVHSRSINFLMMEVPKEPADLTQDNGLIIEHRRQFLYEHQFERQTEIDYIHPTND
FT                   GHTKKVDLFLKKNIKLTKDIYGTSVKSNYILKYVFANGIAREIIYALLEEMDLRKPF"
FT   gene            complement(391332..391739)
FT                   /locus_tag="SAAV_0353"
FT   CDS_pept        complement(391332..391739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10296"
FT                   /protein_id="ACY10296.1"
FT                   /translation="MADITVVNDTGELYNVINQKKSEGYLESELTIISKSKLHLNDLHD
FT                   SEISLISTSGTFSDRMTKLLTGEDGEHAVLSRYNLAPDELEKYKQLILDDKMLVVAVRD
FT                   KSSHKEVQEHNSAYEEIDITHFAEASKGPKA"
FT   misc_feature    391919..392022
FT                   /product="Purine riboswitch"
FT   gene            392252..392830
FT                   /gene="xpt"
FT                   /locus_tag="SAAV_0355"
FT   CDS_pept        392252..392830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="SAAV_0355"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10297"
FT                   /protein_id="ACY10297.1"
FT                   /translation="MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQ
FT                   FKDKGITKILTIEASGIAPAIMAALHFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKT
FT                   STVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIAQQANAKTAGIGIVVEKSFQNGHQ
FT                   RLEEAGLTVSSLCKVASLEGNKVTLVGEE"
FT   gene            392830..394098
FT                   /gene="pbuX"
FT                   /locus_tag="SAAV_0356"
FT   CDS_pept        392830..394098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuX"
FT                   /locus_tag="SAAV_0356"
FT                   /product="xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10298"
FT                   /protein_id="ACY10298.1"
FT                   /translation="MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIF
FT                   MCGVATFLQANKVTGTGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIA
FT                   PFFSHLVKFFPPVVTGSVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIII
FT                   LVLQRFTTGFIKSIAILIGLVLGTIGAGLLGMVDINQVNHADWLGIPVPFRFSGFSFDV
FT                   TSTLVFFIVAIVSLIESTGVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPY
FT                   TAYSQNVGLVSLSGAKKNNVIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGM
FT                   VMAYGVSILGHIDFKNQNNLLIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGA
FT                   ISAIILNFFFNGIKYKQTEENVK"
FT   gene            394136..395602
FT                   /gene="guaB"
FT                   /locus_tag="SAAV_0357"
FT   CDS_pept        394136..395602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="SAAV_0357"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10299"
FT                   /protein_id="ACY10299.1"
FT                   /translation="MWESKFAKESLTFDDVLLIPAQSDILPKDVDLSVQLSDKVKLNIP
FT                   VISAGMDTVTESKMAIAMARQGGLGVIHKNMGVEEQADEVQKVKRSENGVISNPFFLTP
FT                   EESVYEAEALMGKYRISGVPIVDNKEDRNLVGILTNRDLRFIEDFSIKIVDVMTQENLI
FT                   TAPVNTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKDIEKVIEFPNAAKDEHGRLLV
FT                   AAAIGISKDTDIRAQKLVEAGVDVLVIDTAHGHSKGVIDQVKHIKKTYPEITLVAGNVA
FT                   TAEATKDLFEAGADIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKAIIAD
FT                   GGIKFSGDIIKALAAGGHAVMLGSLLAGTEESPGATEIFQGRQYKVYRGMGSLGAMEKG
FT                   SNDRYFQEDKAPKKFVPEGIEGRTAYKGALQDTIYQLMGGVRAGMGYTGSHDLRELREE
FT                   AQFTRMGPAGLAESHPHNIQITKESPNYSF"
FT   gene            395627..397168
FT                   /gene="guaA"
FT                   /locus_tag="SAAV_0358"
FT   CDS_pept        395627..397168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="SAAV_0358"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10300"
FT                   /protein_id="ACY10300.1"
FT                   /translation="MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEE
FT                   IKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERAN
FT                   EREYGKAIINAKSDELFAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKK
FT                   RRIYGVQFHPEVRHTEYGNDLLNNFVRRVCDCKGQWTMENFIEIEIEKIRQRVGDRRVL
FT                   CAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNA
FT                   KDRFMNKLKGVSDPEQKRKIIGNEFVYVFDDEASKLKGVDFLAQGTLYTDVIESGTKTA
FT                   QTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIR
FT                   VLGEITEDKLEIVRESDAILRQVIREEGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTV
FT                   GIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE"
FT   gene            complement(397281..397817)
FT                   /locus_tag="SAAV_0359"
FT   CDS_pept        complement(397281..397817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10301"
FT                   /protein_id="ACY10301.1"
FT                   /translation="MHNKNEFNKKLKDFIGSDKRMALVKGYINEYKLTTVLRALNNSDY
FT                   TKGTIHTRSIGNLKQIVDNRIIPKNITQNKIFKLSNLTLEVNLYERNTIYHGDFAIYYP
FT                   VESALIIETDTPRLINHINNNPVQKIFIITTNDWSFNTLELEKIVDETIIYDLKQEDPK
FT                   QYEILYKNKHGKLPY"
FT   gene            complement(398209..398913)
FT                   /locus_tag="SAAV_0360"
FT   CDS_pept        complement(398209..398913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10302"
FT                   /protein_id="ACY10302.1"
FT                   /translation="MSKNINQANSKLNTSNKKLKQAYSKSDSKNMKVIYMPHWLEFYSI
FT                   AIHSDVTSNKKRYYKSFSRGTVVYVKLGSNIGSEFSGNHFCVILDNKDNKGKETVTIVP
FT                   LSSKGNKNYLKLNESVLNLTATDLKKQIIDISSKVQALTQKYRDIDIKLSTEDKKLLSN
FT                   LNQKANELYRVIGVYSKHKGKDTYVNISAITTISKRRISKINDSDPTGTIIISEDDMNE
FT                   IEKQLKIKFFSN"
FT   gene            complement(399312..399584)
FT                   /locus_tag="SAAV_0361"
FT   CDS_pept        complement(399312..399584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0361"
FT                   /product="IS3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10303"
FT                   /protein_id="ACY10303.1"
FT                   /translation="MTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIK
FT                   QHQNTGPFNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI"
FT   gene            complement(399845..399997)
FT                   /locus_tag="SAAV_0362"
FT   CDS_pept        complement(399845..399997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10304"
FT                   /protein_id="ACY10304.1"
FT                   /translation="MVPEEKGSITLSKEAAIIFATAKFKPFKNRIKNNPLKTNPFLKLH
FT                   ENKKS"
FT   gene            complement(400529..400888)
FT                   /locus_tag="SAAV_0363"
FT   CDS_pept        complement(400529..400888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10305"
FT                   /protein_id="ACY10305.1"
FT                   /translation="MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKD
FT                   KNINLLLKNQGVYNGLIGVLLIYGLFISSNPKEICTAILVYIIGVAIYGGLSSNISIFF
FT                   KQGTLPVLALISMLW"
FT   gene            complement(400907..401752)
FT                   /locus_tag="SAAV_0364"
FT   CDS_pept        complement(400907..401752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10306"
FT                   /protein_id="ACY10306.1"
FT                   /translation="MNIMLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGK
FT                   VSVRQLDYFNQESMVEAFKGMDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFI
FT                   GYYADQHNNPFHMSPYFGYASRLLSTSGIDYTYVRMAMYMDPLKPYLPELMNMHKLIYP
FT                   AGDGRINYITRNDIARGVIAIIKNPDTWGKRYLLSGYSYDMKELAAILSEASGTEIKYE
FT                   PVSLETFAEMYDEPKGFGALLASMYHAGARGLLDQESNDFKQLVNDQPQTLQSFLQENI
FT                   "
FT   gene            402224..402904
FT                   /locus_tag="SAAV_0365"
FT   CDS_pept        402224..402904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0365"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10307"
FT                   /protein_id="ACY10307.1"
FT                   /translation="MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHY
FT                   YNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQISLVGSDKDKFKDGDNSNIDVFILR
FT                   EGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELD
FT                   YRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKIL
FT                   VEMK"
FT   gene            403190..403885
FT                   /locus_tag="SAAV_0366"
FT   CDS_pept        403190..403885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0366"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10308"
FT                   /protein_id="ACY10308.1"
FT                   /translation="MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLK
FT                   AYYTQPSIEYKNVTGYISFIQPSIKFMNIIDGNSVNNLALIGKDKQHYHTGVHRNLNIF
FT                   YVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDKEAMSL
FT                   KEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDID
FT                   RIEIKVRKA"
FT   gene            404176..405246
FT                   /locus_tag="SAAV_0367"
FT   CDS_pept        404176..405246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0367"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10309"
FT                   /protein_id="ACY10309.1"
FT                   /translation="MNMKTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLK
FT                   AERLAMINITAGANSATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQK
FT                   SLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTD
FT                   MTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKD
FT                   GPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEY
FT                   MITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMA
FT                   DVIEGTNIDKIEVNIK"
FT   gene            405610..406488
FT                   /locus_tag="SAAV_0368"
FT   CDS_pept        405610..406488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0368"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10310"
FT                   /protein_id="ACY10310.1"
FT                   /translation="MKITTIAKTSLALGLLTTGVITTTTQEANATTPSSTKVEAPQSTP
FT                   PSTKVEAPQSKPNATTPPSTKVETPQQTPNATTPSSTKVETPQSPTTKQVPTEINPKFK
FT                   DLRAYYTKPSLEFKNEIGIILKKWTTIRFMNIVPDYFIYKIALVGKDDKKYDEGVHRNV
FT                   DVFVVLEEKNKYGVERYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKE
FT                   QISLKELDFKLRKQLIENHNLYGNVGSGKIVINMKNGGKYTFELHKKLQENRMADVIDG
FT                   TNIDNIEVNIK"
FT   gene            406852..407556
FT                   /locus_tag="SAAV_0369"
FT   CDS_pept        406852..407556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0369"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10311"
FT                   /protein_id="ACY10311.1"
FT                   /translation="MKMAAIAKASLALGILATGTITSLHQTVNASEHEAKYENVTKDIF
FT                   DLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLD
FT                   IFVVKEAENRNGTVFSYGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKE
FT                   EISLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVID
FT                   GRNIEKIEANIR"
FT   gene            408002..408697
FT                   /locus_tag="SAAV_0370"
FT   CDS_pept        408002..408697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0370"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10312"
FT                   /protein_id="ACY10312.1"
FT                   /translation="MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKD
FT                   LYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGKDKDKYKKGLEGQNVF
FT                   VVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEVSLK
FT                   ELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQ
FT                   NIAVTINQI"
FT   gene            409036..409734
FT                   /locus_tag="SAAV_0371"
FT   CDS_pept        409036..409734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0371"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10313"
FT                   /protein_id="ACY10313.1"
FT                   /translation="MKFTAIAKAIFVLGILTTSVMITENQSVNAKGKYEKMNRLYDTNK
FT                   LHQYYSGPSYELTNVSGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVF
FT                   AVPELVDLDGRIFSVSGVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEV
FT                   SLKELDFKIRKLLIKKYKLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSE
FT                   QIKNIEVNLK"
FT   gene            410111..410809
FT                   /locus_tag="SAAV_0372"
FT   CDS_pept        410111..410809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0372"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10314"
FT                   /protein_id="ACY10314.1"
FT                   /translation="MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINM
FT                   LHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNKTFKVFLLGDDKNKYKEKTHGLDVF
FT                   AVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQKEEV
FT                   SLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSK
FT                   QIKNIEVNLN"
FT   gene            411175..411858
FT                   /locus_tag="SAAV_0373"
FT   CDS_pept        411175..411858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0373"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10315"
FT                   /protein_id="ACY10315.1"
FT                   /translation="MKFTALAKATLALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEAL
FT                   YRYYTGKTMEMKNISALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQ
FT                   EKRDKHDIFYTVGGVIQNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKEL
FT                   DYKLRKHLIEKYGLYKTISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDI
FT                   EVNLK"
FT   gene            412122..413678
FT                   /gene="hsdM1"
FT                   /locus_tag="SAAV_0374"
FT   CDS_pept        412122..413678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM1"
FT                   /locus_tag="SAAV_0374"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10316"
FT                   /protein_id="ACY10316.1"
FT                   /translation="MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYR
FT                   FLSEKAEQEYADALSGEDITYQEAWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREI
FT                   ETQDFDIEHLATAIRKVETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVM
FT                   VNLDDLPFVHSDMEIDMLGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKD
FT                   KLRHVYDPTCGSGSLLLRVGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRN
FT                   DDTLENPAFLGNTFDAVIANPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHM
FT                   VHYLDDEGTMAVVLPHGILFRGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCI
FT                   LVFKKCRQQDDNVLFIDASNDFEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQ
FT                   EIADNDYNLNIPRYVDTFEEEAPIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKD
FT                   E"
FT   gene            413671..414882
FT                   /gene="hsdS1"
FT                   /locus_tag="SAAV_0375"
FT   CDS_pept        413671..414882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS1"
FT                   /locus_tag="SAAV_0375"
FT                   /product="type I restriction-modification system S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10317"
FT                   /protein_id="ACY10317.1"
FT                   /translation="MSNTQKKNVPELRFPGFEGEWEEKQLGDLTDRVIRKNKNLESKKP
FT                   LTISGQLGLIDQTEYFSKSVSSKNLENYTLIKNGEFAYNKSYSNGYPLGAIKRLTRYDS
FT                   GVLSSLYICFSIKSEMSKDFMEAYFDSTHWYREVSGIAVEGARNHGLLNVSVNDFFTIL
FT                   IKYPSLEEQQKIGKFFSKLDRQIELEEQKLELLQQQKKGYMQKIFSQELRFKDENGEDY
FT                   PDWENSKIEKYLKERNERSDKGQMLSVTINSGIIKFSELDRKDNSSKDKSNYKVVRKND
FT                   IAYNSMRMWQGASGKSNYNGIVSPAYTVLYPTQNTSSLFIGYKFKTHRMIHKFKINSQG
FT                   LTSDTWNLKYKQLKNINIDIPVLEEQEKIGDFFKKMDILISKQKMKIEILEKEKQSFLQ
FT                   KMFL"
FT   gene            415265..415948
FT                   /locus_tag="SAAV_0376"
FT   CDS_pept        415265..415948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0376"
FT                   /product="superantigen-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10318"
FT                   /protein_id="ACY10318.1"
FT                   /translation="MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSE
FT                   YYKGRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREG
FT                   SDKSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYKEEISLKE
FT                   LDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEK
FT                   IEVNL"
FT   gene            415970..417457
FT                   /locus_tag="SAAV_0377"
FT   CDS_pept        415970..417457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10319"
FT                   /protein_id="ACY10319.1"
FT                   /translation="MRENFKLRKMKVGLVSVAITMLYIMTNGQAEASETNQKVSTNQES
FT                   KAVSQTEQNSKETKAAESSKNFVNLDPIKPGAQKVTGTTLPNHIILLNIDGKSADSVEG
FT                   GYGDFITANDKGEFEYPLNNRKIVHNQEIEVSSSSPDLGDDEEDEEVEESSTEKAGAEE
FT                   ESTDAKATYTTPRYEKAYEIPKEQLKEKDGHHQVFIEPITEGSGIIKGHTSVKGKVALS
FT                   INNKFINFEERAKGGISKEDTKASSDGVWMPINEKGYFDFDFKKNPFDNLELKKNDEIS
FT                   LTFAPDDEDEALKSLIFKTKVTSLEDIDKAETKYDHTKVEKVKVLKDVKEDIHVDEIYG
FT                   SLYHTEKGKGILDKQGTKEITGKTKFANAVVKVYSDLGDAQLFPDIQVDENGKFSFDAE
FT                   KAGFRLQNGETLNFAVVKPITGDLLHQGFVSKYIDVYESPEEKKEREFEEKLENTPAYH
FT                   KLHGDKIVGYDVQGNPSTWFYPLGEKKVERTTPKLEK"
FT   gene            complement(417566..417874)
FT                   /locus_tag="SAAV_0378"
FT   CDS_pept        complement(417566..417874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10320"
FT                   /protein_id="ACY10320.1"
FT                   /translation="MKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANF
FT                   LEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK"
FT   gene            418211..419014
FT                   /locus_tag="SAAV_0379"
FT   CDS_pept        418211..419014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0379"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10321"
FT                   /protein_id="ACY10321.1"
FT                   /translation="MKYKTKRRETMRYLKRLSWYISILILIVVIAGCGKGNETKEGSKE
FT                   EQIKKSFAKTLDMYPIKNLEDLYDKEGYRDSEFKKSDKGTWTIYTDFAKSNKPDELDDE
FT                   GMVLNLDRNTRTAKGHYFVTTFYRNGKLPDEKNYKIEMKNNKIILLDEVKDDKLKQKIE
FT                   NFKFFGQYANLKELRKYNNGDVSINENVPSYDVEYKMSNKDEIVKELRSRYNISTEKSP
FT                   ILKMHIDGDLKGSSVGYRKLEIDFSKRENSKLSVIEFLSYKPAKK"
FT   gene            419045..419839
FT                   /locus_tag="SAAV_0380"
FT   CDS_pept        419045..419839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0380"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10322"
FT                   /protein_id="ACY10322.1"
FT                   /translation="MGYLKKLALFISVIILGIFIIGCDSSSDTAEKAKEDSKEEQIKKS
FT                   FAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWTLLTSFSKSNKPGEIDDEGMVLYL
FT                   NRNTKKATGYYFVNKIYDDISKNQNEKKYRVELKNNKIILLDNVEDEKLKQKIENFKFF
FT                   SQYADFKDLKNYQDGSITTNENVPRYEAEYKLNNSDTNVKKLRDIYPITTKKAPILKLH
FT                   IDGDIKGSSVGYKKIEYKFSKVKDQETTLRDYLNFGPSDEDS"
FT   gene            419884..420672
FT                   /locus_tag="SAAV_0381"
FT   CDS_pept        419884..420672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0381"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10323"
FT                   /protein_id="ACY10323.1"
FT                   /translation="MMGYSKRFALYISVMILIFAIAGCGKSDETKEVSKEEQIKKSFAK
FT                   TLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWVISSVMVKQPKGEIMKSRGMYLFLNRN
FT                   TRTAKGYFIVDETSNDTLKKTEDKEKRYPVKMVNNKIVPIDPINDKGVKKEIENFKFFS
FT                   QYGDFKELKNYKNGEVSYNSEAPIYSAKYQLKNNDYNVKQLRKRYDISTEKAPKLLLKG
FT                   TGDLKGSSIGHKDIEFTFVENQEENIFFTDSLEFTSSENY"
FT   gene            420717..421478
FT                   /locus_tag="SAAV_0382"
FT   CDS_pept        420717..421478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0382"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10324"
FT                   /protein_id="ACY10324.1"
FT                   /translation="MCVVYRTSVLILLASGCSGVFDTPEDSKETQIKKSFAKTLDMYPI
FT                   KNLEDLYDKEGYRDGEFKKGDKGTWVVRSEMIIQPKGKSLTSRGMILYMNRNTRTTTGY
FT                   FSIEEIDSRKSLDERETEKKYPVKMINNKIIPTEEIKDEKLKKEIENFKFFVQYGSFKG
FT                   IENYENGDISYNSEAPIYSAKYKLKNDDYNVKELRKRYNIPTEKAPKLLLKGSGDLKGS
FT                   SVGYKEIEFIFIENKKENIYFSDGLNLIPSD"
FT   gene            421539..422324
FT                   /locus_tag="SAAV_0383"
FT   CDS_pept        421539..422324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0383"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10325"
FT                   /protein_id="ACY10325.1"
FT                   /translation="MRDSKRVVLYISIMVLSIFIIGCGKGNEIKEDAKEEQIKKSFAKT
FT                   LDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNRPGVLDNEGMVLNLDRNT
FT                   RTAKGYYFVDTIYDNHENSYSKNYRVEMKNNKIILLDKVEDQKLKERIENFKFFGQYAD
FT                   FKSLKSYNHGDVSINSNVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPILKMHIDGDL
FT                   KGSSVGYKKLEIDFSKEENSELSIVDSLNFQPAKNKDDE"
FT   gene            422343..423125
FT                   /locus_tag="SAAV_0384"
FT   CDS_pept        422343..423125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0384"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10326"
FT                   /protein_id="ACY10326.1"
FT                   /translation="MGYSKRFALYISILILIVMVAGCGKSDETKEDSKEEQIKKSFAKT
FT                   LDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWVLYSAIVSQPKGESLKSRGMILKLDRNK
FT                   RTAKGSYIIRELKEDKNHDVQKNEKKYPVKLVNNRIVLVKDVKDKKLKNEIESFELFSQ
FT                   YGNFNHFDRNEITNISYNPNAPNYSAEYKMKKNDRNIQQLKKRFNLKTSKTPKLLFKGS
FT                   GDIKGSSVGYKEIEIIFSRSKEEAFIMLTALSSFQVTK"
FT   gene            423182..423976
FT                   /locus_tag="SAAV_0385"
FT   CDS_pept        423182..423976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0385"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10327"
FT                   /protein_id="ACY10327.1"
FT                   /translation="MMGYLKRLVLYIVIMVMSVFIIGCDKSSDTAENPKEGSKEAQIKK
FT                   SFSKTLDMYPIKNLENLYDKEGYRDGEFKKGDKGTWTISTDFAKSNKQGEMNSEGMVLH
FT                   FNRNTRTATGYYTVRTTYDEVDKLAREKKYRVEFKNNKIVLLDKVEDENLKQKIENFKF
FT                   FGQYADFKDLKNYKNGRISSNENVPYYEAEYKRNNSDGNVKKLREKYPITTKQSPILKL
FT                   HIDGDIKGSSVGYKQIEYTFSKEKDDETFMSDFLNFGPSHSK"
FT   gene            424028..424828
FT                   /locus_tag="SAAV_0386"
FT   CDS_pept        424028..424828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10328"
FT                   /protein_id="ACY10328.1"
FT                   /translation="MGYFKRVVLYIIVMVVSVFIIGCNKSSDTSEKPKEDSKETQIKKS
FT                   FAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYL
FT                   DRNTRTAKGHYFVKTFYNKGKFPDRKNYKVEMKNNKIILLDKVEDINLKKRIENFKFFG
FT                   QYANLKELKNYSNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHI
FT                   DGDLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDDE"
FT   gene            424847..425629
FT                   /locus_tag="SAAV_0387"
FT   CDS_pept        424847..425629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10329"
FT                   /protein_id="ACY10329.1"
FT                   /translation="MKSIKRIGLCISLLILIIFATSCGSNKITGDSKEEQIKKSFAKSL
FT                   DKYPTENLEEFYDKEGYRDGEFEKDDKGTWLIRSEMKIQLKGENLESRGAVIEINRNTR
FT                   TAKGNYIVREVVEDSDGMTHNHTKRYPVKMENNKMIPLKSIDDEKVKKEIEEFKFFVQY
FT                   GNFKELENYKEDEVSYNPEVPIYSAQYQLKNSDYNVEQLRKRYNIPTQKAPKLLLKGSG
FT                   NLKGSSVGYKNIEFTFVENKEENIYFTDSVYFNPSEDK"
FT   gene            425886..426623
FT                   /locus_tag="SAAV_0388"
FT   CDS_pept        425886..426623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10330"
FT                   /protein_id="ACY10330.1"
FT                   /translation="MKEEQKKEANTNKTDSKEEKIKKSFAKTLDMYPIKNLEELYDKEG
FT                   YRDGEFEKGDKGMWTIYTDFAKSNKPGELSNEGMVLYLDRNTRTAKGYYFVRTFYRKDK
FT                   LPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANLKELKNYSNGDVSINEN
FT                   VPSYDVKYKMSNKDENVKQLRSRYNIPTDKSPVLKMHIDGNLKGSSVGDRKLEIDFSKR
FT                   ENSHLSVIDSLDYQPAKVDEDER"
FT   gene            426613..427937
FT                   /pseudo
FT                   /locus_tag="SAAV_0389"
FT                   /note="conserved hypothetical protein"
FT   gene            427934..428257
FT                   /locus_tag="SAAV_0391"
FT   CDS_pept        427934..428257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10331"
FT                   /protein_id="ACY10331.1"
FT                   /translation="MMFNQINNKNELEESYESEKKRIENELHNLNELRHRTRKENERSY
FT                   DVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYEKQLDK
FT                   LSD"
FT   gene            428276..428590
FT                   /locus_tag="SAAV_0392"
FT   CDS_pept        428276..428590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10332"
FT                   /protein_id="ACY10332.1"
FT                   /translation="MTLIEPDMNLRMPDISTTVETLNLISKMEAQKENIRSVIAPEHKH
FT                   KYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKKINS
FT                   "
FT   gene            complement(428879..429073)
FT                   /locus_tag="SAAV_0393"
FT   CDS_pept        complement(428879..429073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10333"
FT                   /protein_id="ACY10333.1"
FT                   /translation="MLFVILVLYVIGIAFILLSVFGSKTEGLSTKHTLYTIGSAIITIA
FT                   IFISIGYAIQYLTAALYGL"
FT   gene            429258..430460
FT                   /locus_tag="SAAV_0394"
FT   CDS_pept        429258..430460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0394"
FT                   /product="cobalamin synthesis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10334"
FT                   /protein_id="ACY10334.1"
FT                   /translation="MAKIPVTVLSGYLGSGKTTLLNHILQNREGRRIAVIVNDMSEVNI
FT                   DKDLVADGGGLSRTDEKLVELSNGCICCTLRDDLLKEVERLVKKGGIDQIVIESTGISE
FT                   PVPVAQTFSYIDDELGIDLTAICRLDTMVTVVDANRFVHDINSEDLLMDRDQSVDETDE
FT                   RSIADLLIDQVEFCDVLIINKIDLISEEELAKLEKVLSALQPIAKIIKTTNSEVDLKEV
FT                   LNTQRFDFEKASESAGWIKELESGGHASHTPETEEYGISSFVYKRRLPFHAKRFNDWLE
FT                   SMSNNVVRSKGIVWLAQYNHVACLLSQAGSSCNIHPVTYWVASMSEAQQTQILAERQDV
FT                   AAEWDPEYGDRHTQFVIIGTELDEEKLTKELDACLVNAQEIDADWQQFEDPYQWQIRPA
FT                   R"
FT   gene            432048..433532
FT                   /gene="nuoF"
FT                   /locus_tag="SAAV_0395"
FT   CDS_pept        432048..433532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="SAAV_0395"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10335"
FT                   /protein_id="ACY10335.1"
FT                   /translation="MLSFQLLFSLFVIALIIALISGLLFLAPVMPMRYIKLHLYILVMP
FT                   ILFAVIGFFGIHGQHVLGPFKIDRLSWLLAGFVMALGFIIQKFSMRYLLGDHHYRHYFP
FT                   LFTAITSFASLAWMSEDLRLMALCWGMTLLCLTLLMNVNRFWKVPRESAKLSSMTFLCG
FT                   WLAFVGAIVTIYIATGEWRVPQHIVHPTWSLLTNVLLVLAVMIPAAQFPFHRWLIESVT
FT                   APTPVSAIMHAGIVNAGGVILTRFAPIFDNGFALSLLLILSSISVLLGSGISLVQVDYK
FT                   RQLVGSTMSQMGFMLVQCALGVYSAAIIHLILHGIFKATLFLQSGSIVKRFNIPKQASA
FT                   KDAYGWIVMGRVLAIIVAFLFWMSSDRSAYEVLSALILAWSLLVSWNQMVAFSKGRMAR
FT                   LVGMILIAIVTFIYVITHNYFYDVLQNITTHATTPPTVSVIISVVILIFGSLLSIWVAR
FT                   HRYSKGFAVLYVWLVNLGEARSKAIESHPNYLKKYL"
FT   gene            433545..436250
FT                   /locus_tag="SAAV_0396"
FT   CDS_pept        433545..436250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10336"
FT                   /protein_id="ACY10336.1"
FT                   /translation="MTTQLNINSVIENAKRVITPLSPISIFAARNPWEGLEADTFEDVA
FT                   KWLRDVRDVDIFPNKALIESAVARGELDESVFNQLVTDMLLEHHYNIPQHYINLYIDNI
FT                   KTLKDVPASYMNHSNVDVVADLLLEKSKRDMAESYHHYDVRPMSDAIIDEQGEPLSEQV
FT                   NRQMIKWTKLYIDQFLSSWTMPKREQSFYHAWLHLAQHDHSFTKAQRQVIKGLPNDPEM
FT                   TIESVLTYFSIDQEDYQAYVEGHLLALPGWAGMLYYRSQQHHFEQHLLTDYLAIRLVVE
FT                   QLLVGDEFKSVTKDCESRSENWFKQTVASLCYYSDMPSDVLLQHDVNEIQTFIHFAATM
FT                   NKNVFKNLWLIAWEMTYESQLKQKIKAGHESVAGALDVNQVNVSENDNANQPHSVLLND
FT                   TQAVDENNSELNQVGTSTKAQIAFCIDVRSEPFRRHIEAAGPFETIGIAGFFGLPIQKD
FT                   AVDEQFKHDSLPVMVPPAYRIKEFADRYDMNVYRQQQQTMSSMFYTFKLMKNNVMPSLL
FT                   LPELSGPFLSLSTIVNSIMPRKSRASLQKIKQKWLKKPETKLTIDREFDRTSDLPVGFT
FT                   EQEQIDFALQALKLMDLTEAFAPFVVLAGHASHSHNNPHHASLECGACGGASSGFNAKL
FT                   LAMICNRPNVRQGLKQSGVYIPETTVFAAAEHHTSTDTLAWVYVPDTLSALALDAYESL
FT                   NDAMPMISEQANRERLDKLPTIGRVNHPVEEAQRFASDWSEVRPEWGLAKNASFIIGRR
FT                   QLTKGIDLEGRTFLHNYDWRKDKDGKLLNTIISGPALVAQWINLQYYASTVAPHFYGSG
FT                   NKATQTVTSGVGVMQGNASDLMYGLSWQSVMAADRTMYHSPIRLLVVIQAPDYVVARLF
FT                   ANNEHFARKVSNHWLRLMSVNEEGRFKSWI"
FT   gene            436412..436774
FT                   /locus_tag="SAAV_0397"
FT   CDS_pept        436412..436774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10337"
FT                   /protein_id="ACY10337.1"
FT                   /translation="MKRTKGEIEAEISKAITQWEKDFLGRGSLSVKSDILRDMVIISLQ
FT                   GILTPAEYRVCSTNEGLLNIKRTRSELVESGEQDLNDIILKITGIKVMSFHSDLSTVTG
FT                   ERIIVFKLEDNLEKHI"
FT   gene            complement(437003..437419)
FT                   /locus_tag="SAAV_0398"
FT   CDS_pept        complement(437003..437419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10338"
FT                   /protein_id="ACY10338.1"
FT                   /translation="MLSIISMCHKFHFTDNIKIIKFILLCILQIKHCIIEITIFCYFQF
FT                   STIYIYYTEGVRRINRVIFVYIALIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVI
FT                   GFKAEKLIATMVIIPNFLGILYRLYAYVTHILFM"
FT   gene            437457..438131
FT                   /locus_tag="SAAV_0399"
FT   CDS_pept        437457..438131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10339"
FT                   /protein_id="ACY10339.1"
FT                   /translation="MIDKKLTSPKMTVPLFLIALIVFIGMFYGVVTNQEWLKNIDMGSL
FT                   TWFTDYFGEPQRQYVNNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVT
FT                   YLVSGVIMNKLIKDTVLRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISVAAKT
FT                   ITKVLSALVMGILWLSILFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQ
FT                   RV"
FT   gene            438168..438902
FT                   /locus_tag="SAAV_0400"
FT   CDS_pept        438168..438902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10340"
FT                   /protein_id="ACY10340.1"
FT                   /translation="MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFS
FT                   CYAPNYPGHGLLLKDFMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLA
FT                   QHYPLKRIAVMSAPKEKSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEIT
FT                   KFQHFIDDIMTNLNVIKIPANILFGGKDEPSYETSAHFIYEHLGSVDKELNGLKDSHHL
FT                   MTHGEGRDILEENVIRFFNALT"
FT   gene            439274..440611
FT                   /locus_tag="SAAV_0401"
FT   CDS_pept        439274..440611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0401"
FT                   /product="sodium-dependent transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10341"
FT                   /protein_id="ACY10341.1"
FT                   /translation="MKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFLA
FT                   MFLIFTIFVGLPLLIMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGFY
FT                   SVIGGWIVIYIGQVLWQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVML
FT                   GVEKGLEKASKVMMPLLFVFLIIIVIKSLTLDGALEGVKFILQPRVSEITADGILFALG
FT                   QSFFTLSLGTTGMITYASYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYEP
FT                   QEGPGLLFKVLPMVFSQMHLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTKR
FT                   KKVAVIGSILVFIISIPATLSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLVI
FT                   GQLLDKKLLQQYFGKDRFRLFNGWYYLIKYAMPVVIILVFIVQLFS"
FT   gene            440828..441733
FT                   /locus_tag="SAAV_0402"
FT   CDS_pept        440828..441733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0402"
FT                   /product="cysteine synthase/cystathionine beta-synthase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10342"
FT                   /protein_id="ACY10342.1"
FT                   /translation="MITYDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKY
FT                   LVEKAIQEGRVRAGQTIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIAL
FT                   GADVSRTSQSEGMHGAQLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSALQQI
FT                   DYFVAGIGSGGTFTGTARYLKQHHVQCYAVEPEGSVLNGGPAHAHDTEGIGSEKWPIFL
FT                   ERRLVDGIFTIKDQDAFRNVKSLAINEGLLVGSSSGAALQGALNLKAQLSEGTIVVVFP
FT                   DGSDRYMSKQIFNYEENDYE"
FT   gene            441726..442868
FT                   /locus_tag="SAAV_0403"
FT   CDS_pept        441726..442868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0403"
FT                   /product="trans-sulfuration enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10343"
FT                   /protein_id="ACY10343.1"
FT                   /translation="MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEY
FT                   SRTANPTRSSVESVIAALENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYR
FT                   ALTKVFTRFGIEVDFVDTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKE
FT                   HGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAF
FT                   ISNSTGGILGPQDSYLLVRGIKTLGLRMKQINRSVIEIIKMLQAHPAVQQVFHPSIESH
FT                   LNHDVHMAQADGHTGVIAFEVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHA
FT                   SIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL"
FT   gene            443163..444188
FT                   /locus_tag="SAAV_0404"
FT   CDS_pept        443163..444188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0404"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10344"
FT                   /protein_id="ACY10344.1"
FT                   /translation="MIEFRQVSKSFHKKKQTIDALKDVSFTVNRNDIFGVIGYSGAGKS
FT                   TLVRLVNHLEAASNGQVIVDGHDITNYSEKGMREIKKDIGMIFQHFNLLNSATVFKNVA
FT                   MPLILSKKSKTEIKQRVTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILL
FT                   CDEATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVET
FT                   GTVKEVFSHPKTTIAQNFVSTVIQTEPSTSLIRRLNDEQVGGFKDYKIFVEETQVTQPI
FT                   INDLIQICGREVKILFSSMSEIQGNTVCYMWLRFNIDQQFDDTAINQYFKEKNIQFEEV
FT                   H"
FT   gene            444192..444851
FT                   /locus_tag="SAAV_0405"
FT   CDS_pept        444192..444851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0405"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10345"
FT                   /protein_id="ACY10345.1"
FT                   /translation="MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRK
FT                   QGIWPNIVIHQVLNPLINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAP
FT                   YIARLVENSLLEVDEGIIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGST
FT                   AMAGAVGGGGIGDLALVYGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH"
FT   gene            444888..445730
FT                   /locus_tag="SAAV_0406"
FT   CDS_pept        444888..445730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0406"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10346"
FT                   /protein_id="ACY10346.1"
FT                   /translation="MKRLIGLVIVALVLLAACGSNNDKKVTIGVASNDTKAWEKVKELA
FT                   KKDDIDVEIKHFFDYNLPNKALNDGDIDMNAFQHFAFLDQYKKAHKGTKISALSTTVLA
FT                   PLGIYSDKIKDVKKVKDGAKVVIPNDVSNQARALKLLEAAGLIKLKKDFGLAGTVKDIT
FT                   SNPKHLKITAVDAQQTARALSDVDIAVINNGVATKAGKDPKNDPIFLEKSNSDAVKPYI
FT                   NIVAVNDKDLDNKTYAKIVELYHSKEAQKALQEDVKDGEKPVNLSKDEIKAIETSLAK"
FT   gene            446062..447066
FT                   /locus_tag="SAAV_0407"
FT   CDS_pept        446062..447066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0407"
FT                   /product="LysM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10347"
FT                   /protein_id="ACY10347.1"
FT                   /translation="MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYG
FT                   ISIAKLKSLNNLTSNLIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLI
FT                   ASKYGTTYQNIMRLNGLNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQ
FT                   AGDSLSLIASKYGTTYQKIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTP
FT                   VFSHQNLYTWGQCTYHVFNRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIA
FT                   QTDVGYYGHVMFVERVNNDGSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH"
FT   gene            complement(447251..447520)
FT                   /locus_tag="SAAV_0408"
FT   CDS_pept        complement(447251..447520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10348"
FT                   /protein_id="ACY10348.1"
FT                   /translation="MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLST
FT                   VGTVLDFYISIKSPRKFKKAVAVVTLITNGARLFTSIRKVKHEY"
FT   gene            447669..448064
FT                   /locus_tag="SAAV_0409"
FT   CDS_pept        447669..448064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0409"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10349"
FT                   /protein_id="ACY10349.1"
FT                   /translation="MIKCVCLVEETADKILLVQVRNREKYCFPGGKIEEGESQVHALLR
FT                   EVKEELNLTLTMDEIEYIGTIVGPAYPQQDMLTELNGFRALTKIDWENVTINNEITDIR
FT                   WIDKDNDALIAPAVKVWIETYGGKHDK"
FT   gene            448054..448539
FT                   /locus_tag="SAAV_0410"
FT   CDS_pept        448054..448539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0410"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10350"
FT                   /protein_id="ACY10350.1"
FT                   /translation="MTNNDTIMLRHYVPQDYSMLEAFQLSESDLKFVKTPEENITAAMS
FT                   DNERYLIVVMDGRQCVAFFTLHRGKGVAPFSDNQDAVFFRSFSVDQRYRNRGIGKVVME
FT                   KLASFITSTFQDINEIVLTVNTDNPHAMALYRQQGYQYMGDSMFIGRPVHIMALTIK"
FT   gene            complement(448708..449490)
FT                   /locus_tag="SAAV_0411"
FT   CDS_pept        complement(448708..449490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10351"
FT                   /protein_id="ACY10351.1"
FT                   /translation="MNAVFILALLLLFLMIIFGGKKGFISYLTLFLNFAILIISIVLII
FT                   FGVPIYVVTFFFCIIIGACNLFVLNSYNVKTQAAFISTIVTTILLITLIYLSVYFGHLQ
FT                   GFSTEQQDETYVYSMNIGIDMVQFMVFTIILAVIAAVIDLTITISSPIYELHQVNPTLT
FT                   QYELFQSGMRVGREILATSANTIYLAFFGGQLALFIWFFKLKYSFGHIINSKIFAQEFI
FT                   SIILGGIAVAISIPITAWITAFLIKRPSRQRKNDESIN"
FT   gene            complement(449487..450599)
FT                   /locus_tag="SAAV_0412"
FT   CDS_pept        complement(449487..450599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10352"
FT                   /protein_id="ACY10352.1"
FT                   /translation="MKYRNLFTKPFNIILGLFCIAFIGAILFTFNNENFYNKPIGQIID
FT                   VKHVSSTPTKDAQNNRDIKYKNQLKVKILNGQFAGETTTINHQYVKSQADSEAFRTHEK
FT                   VLLHISNKPSDAYIIEKKRDTLTVIITGLFLLTVLLVGRKVGLQSILSLILNSIAILIA
FT                   IYIHIQHSNINLFLLMTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTELI
FT                   IYMTDGKGIKYETMNFLSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTPHIS
FT                   MRRWALAGRNIGQDIMGTMTNILLFSYLSGALPMFLIFLKNANTVTYTISMNWSLEIAR
FT                   ALTGGIGIVLTIPITILFMEIFETLRRAKQ"
FT   gene            complement(450720..451604)
FT                   /locus_tag="SAAV_0413"
FT   CDS_pept        complement(450720..451604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0413"
FT                   /product="transcriptional regulatory protein GltC"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10353"
FT                   /protein_id="ACY10353.1"
FT                   /translation="MEIKQLRYFIEVAKREHISETALELNIAQSAISRQITLLEQELNV
FT                   SLFKKQGRNITLTSEGKLLFNEALRIIEHLDSTIEQFQSHGLTKNKSIYIGYDESDVSH
FT                   MLLPLIQTFHLQNDTHVIPSLLDHDTIINSVLNGNIDIGFTELTPEIRKHKQLHMLPLF
FT                   EEHYHLYAPSDDPITMATHPPLIQFEHSHIYCLAPFAETVKKQLRKITKSDVYTISSQP
FT                   LAQYLLRQKEGYIISSQNIHLPESKSWIDIKLDHTELKRTICAITKEPYTKSDIGILLT
FT                   LIQQLMTKTSTFH"
FT   gene            451785..456284
FT                   /gene="gltB"
FT                   /locus_tag="SAAV_0414"
FT   CDS_pept        451785..456284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="SAAV_0414"
FT                   /product="glutamate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10354"
FT                   /protein_id="ACY10354.1"
FT                   /translation="MHNEKLIKGLYDYREEHDACGIGFYANMDNKRSHDIIDKSLEMLR
FT                   RLDHRGGVGADGITGDGAGIMTEIPFAFFKQHVTDFDIPGEGEYAVGLFFSKERILGSE
FT                   HEAVFKKYFEGEGLSILGYRNVPVNKDAIAKHVADTMPVIQQVFIDIRGIEDVEKRLFL
FT                   ARKQLEFYSTQCDLELYFTSLSRKTIVYKGWLRSDQIKKLYTDLSDDLYQSKLGLVHSR
FT                   FSTNTFPSWKRAHPNRMLMHNGEINTIKGNVNWMRARQHKLIETLFGEDQHKVFQIVDE
FT                   DGSDSAIVDNALEFLSLAMEPEKAAMLLIPEPWLYNEANDANVRAFYEFYSYLMEPWDG
FT                   PTMISFCNGDKLGALTDRNGLRPGRYTITKDNFIVFSSEVGVVDVPESNVAFKGQLNPG
FT                   KLLLVDFKQNKVIENNDLKGAIAGELPYKAWIDNHKVDFDFENIQYQDSQWKDETLFKL
FT                   QRQFAYTKEEIHKYIQELVEGKKDPIGAMGYDAPIAVLNERPESLFNYFKQLFAQVTNP
FT                   PIDAYREKIVTSELSYLGGEGNLLAPDETVLDRIQLKRPVLNESHLAAIDQEHFKLTYL
FT                   STVYEGDLEDALEALGREAVNAVKQGAQILVLDDSGLVDSNGFAMPMLLAISHVHQLLI
FT                   KADLRMSTSLVAKSGETREVHHVACLLAYGANAIVPYLAQRTVEQLTLTEGLQGTVVDN
FT                   VKTYTDVLSEGVIKVMAKMGISTVQSYQGAQIFEAIGLSHDVIDRYFTGTQSKLSGISI
FT                   DQIDAENKARQQSDDNYLASGSTFQWRQQGQHHAFNPESIFLLQHACKENDYAQFKAYS
FT                   EAVNKNRTDHIRHLLEFKACTPIDIDQVEPVSDIVKRFNTGAMSYGSISAEAHETLAQA
FT                   MNQLGGKSNSGEGGEDAKRYEVQVDGSNKVSAIKQVASGRFGVTSDYLQHAKEIQIKVA
FT                   QGAKPGEGGQLPGTKVYPWIAKTRGSTPGIGLISPPPHHDIYSIEDLAQLIHDLKNANK
FT                   DADIAVKLVSKTGVGTIASGVAKAFADKIVISGYDGGTGASPKTSIQHAGVPWEIGLAE
FT                   THQTLKLNDLRSRVKLETDGKLLTGKDVAYACALGAEEFGFATAPLVVLGCIMMRVCHK
FT                   DTCPVGVATQNKDLRALYRGKAHHVVNFMHFIAQELREILASLGLKRVEDLVGRTDLLQ
FT                   RSSTLKANSKAASIDVEKLLCPFDGPNTKEIQQNHNLEHGFDLTNLYEVTKPYIAEGRR
FT                   YTGSFTVNNEQRDVGVITGSEISKQYGEAGLPENTINVYTNGHAGQSLAAYAPKGLMIH
FT                   HTGDANDYVGKGLSGGTVIVKAPFEERQNEIIAGNVSFYGATGGKAFINGSAGERFCIR
FT                   NSGVDVVVEGIGDHGLEYMTGGHVINLGDVGKNFGQGMSGGIAYVIPSDVEAFVENNQL
FT                   DTLSFTKIKHQEEKAFIKQMLEEHVSHTNSTRAIHVLKHFDRIEDVVVKVIPKDYQLMM
FT                   QKIHLHKSLHDNEDEAMLAAFYDDSKTIDAKHKPAVVY"
FT   gene            456302..457765
FT                   /gene="gltD"
FT                   /locus_tag="SAAV_0415"
FT   CDS_pept        456302..457765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="SAAV_0415"
FT                   /product="glutamate synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10355"
FT                   /protein_id="ACY10355.1"
FT                   /translation="MGEFKGFMKYDKQYLGELSLVDRLKHHKAYQQRFTKEDASIQGAR
FT                   CMDCGTPFCQTGQQYGRETIGCPIGNYIPEWNDLVYHQDFKTAYERLSETNNFPDFTGR
FT                   VCPAPCESACVMKINRESIAIKGIERTIIDEAFENGWVAPKVPSRRRDEKVAIVGSGPA
FT                   GLTAAEELNLLGYQVTIYERARESGGLLMYGIPNMKLDKDVVRRRIKLMEEAGITFING
FT                   VEVGVDIDKATLESEYDAIILCTGAQKGRDLPLEGRMGDGIHFAMDYLTEQTQLLNGEI
FT                   DDITITAKDKNVIIIGAGDTGADCVATALRENCKSIVQFNKYTKLPEAITFTENASWPL
FT                   AMPVFKMDYAHQEYEAKFGKEPRAYGVQTMRYDVDDKGHIRGLYTQILEQGENGMVMKE
FT                   GPERFWPADLVLLSIGFEGTEPTVPNAFNIKTDRNRIVADDTNYQTNNEKVFAAGDARR
FT                   GQSLVVWAIKEGRGVAKAVDQYLASKVCV"
FT   gene            458034..458126
FT                   /locus_tag="SAAV_0416"
FT   tRNA            458034..458126
FT                   /locus_tag="SAAV_0416"
FT                   /product="tRNA-Ser"
FT   gene            458595..460022
FT                   /locus_tag="SAAV_0417"
FT   CDS_pept        458595..460022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0417"
FT                   /product="PTS system, IIBC components"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10356"
FT                   /protein_id="ACY10356.1"
FT                   /translation="MAVKREDVKAIVSAIGGKENLEAATHCVTRLRLVLKDESKVDKDA
FT                   LSNNALVKGQFKADHQYQIVIGPGTVDEVYKQFIDETGAQEASKDEAKQAAAKKGNPVQ
FT                   RLIKLLGDIFIPILPAIVTAGLLMGINNLLTMKGLFGPKALIEMYPQIADISNIINVIA
FT                   STAFIFLPALIGWSSMRVFGGSPILGIVLGLILMHPQLVSQYDLAKGNIPTWNLFGLEI
FT                   KQLNYQGQVLPVLIAAYVLAKIEKGLNKVVHDSIKMLVVGPVALLVTGFLAFIIIGPVA
FT                   LLIGTGITSGVTFIFQHAGWLGGAIYGLLYAPLVITGLHHMFLAVDFQLMGSSLGGTYL
FT                   WPIVAISNICQGSAAFGAWFVYKRRKMVKEEGLALTSCISGMLGVTEPAMFGVNLPLKY
FT                   PFIAAISTSCVLGAIVGMNNVLGKVGVGGVPAFISIQKEFWPVYLIVTAIAIVVPCILT
FT                   IVMSHFSKQKAKEIVED"
FT   gene            460086..461726
FT                   /locus_tag="SAAV_0418"
FT   CDS_pept        460086..461726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0418"
FT                   /product="alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10357"
FT                   /protein_id="ACY10357.1"
FT                   /translation="MSKEIDWRKSVVYQIYPKSFNDTTGNGIGDINGIIEKLDYIKLLG
FT                   VDYIWLTPVYESPMNDNGYDISNYLEINEAFGTMDDFEKLIKVAHQKDLKVMLDIVINH
FT                   TSTEHEWFKEARKSKDNPYRDYYFFRSSEDGPPTNWHSKFGGNAWKYDSETDEYYLHLF
FT                   DVSQADLNWDNPEVRQSLYRIVNHWIDFGVDGFRFDVINLISKGEFKDSDKIGKEFYTD
FT                   GPRVHEFLHELNRQTFGNTDMMTVGEMSSTTIENCIKYTQPERQELNSVFNFHHLKVDY
FT                   VDGEKWTNAKLDFHKLKEILMQWQRGIYDGGGWNAIFWCNHDQPRVVSRFGDDTSEEMR
FT                   IQSAKMLAIALHMLQGTPYIYQGEEIGMTDPHFTSIAQYRDVESINAYHQLLSEGHAEA
FT                   DVLAILGQKSRDNSRTPMQWSDDVNAGFTAGKPWIDISENYHQVNVRQALQNKESIFYT
FT                   YQKLIQLRHTHDIITYGDIVPRFMDHDHLFVYERHYKNQQWLVIANFSASAVDLPEGLA
FT                   REGCVVIQTGTVENNTISGFGAIVIETNA"
FT   gene            461751..462479
FT                   /locus_tag="SAAV_0419"
FT   CDS_pept        461751..462479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0419"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10358"
FT                   /protein_id="ACY10358.1"
FT                   /translation="MAKQKKFMKIYEALKEDILNGQIQYGEQIPSEHDLVQLYQSSRET
FT                   VRKALDLLALDGMIQKIHGKGSLVIYQEVTEFPFSELVSFKEMQEEMGVAYLTEVVVNE
FT                   VVEAHEVPEVQHALNINSSESLIHIVRTRRLNQHVKIVDEDYFLKSIVSDIGNDVASDS
FT                   IYDYLEKVLNLNISYSSKSITFEPFDEQAYQLFGDVSVAYSATVRSIVYLENTMPFQYN
FT                   ISKHLANEFKFNDFSRRRIK"
FT   gene            462659..462759
FT                   /gene="srpB"
FT                   /locus_tag="SAAV_0420"
FT   ncRNA           462659..462759
FT                   /gene="srpB"
FT                   /locus_tag="SAAV_0420"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            463122..463646
FT                   /locus_tag="SAAV_0421"
FT   CDS_pept        463122..463646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0421"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10359"
FT                   /protein_id="ACY10359.1"
FT                   /translation="MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSP
FT                   CYNFELEVIAKNENNDVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLV
FT                   QAVEERAKAQEYSTVVVDHCFDYFEKLGYQNAAEHDIKLESGDAPLLVKYLWDNLTDAP
FT                   HGIVKFPEHFY"
FT   gene            463715..465412
FT                   /gene="dnaX"
FT                   /locus_tag="SAAV_0422"
FT   CDS_pept        463715..465412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SAAV_0422"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10360"
FT                   /protein_id="ACY10360.1"
FT                   /translation="MNYQALYRMYRPQSFEDVVGQEHVTKTLRNAISKEKQSHAYIFSG
FT                   PRGTGKTSIAKMFAKAINCLNSTDGEPCNECHICKGITQGTNSDVIEIDAASNNGVDEI
FT                   RNIRDKVKYAPSESKYKVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIP
FT                   PTIISRAQRFDFKAISLDQIVERLKFVADAQQIECEDEALAFIAKASEGGMRDALSIMD
FT                   QAIAFGDGTLTLQDALNVTGSVHDEALDHLFDDIVQGDVQASFKKYHQFITEGKEVNRL
FT                   INDMIYFVRDTIMNKTSEKDTEYRALMNLELDMLYQMIDLINDTLVSIRFSVNQNVHFE
FT                   VLLVKLAEQIKGQPQVIANVAEPAQIASSPNTDVLLQRMEQLEQELKTLKAQGVSVAPA
FT                   QKSSKKPARGIQKSKNAFSMQQIAKVLDKANKADIKLLKDHWQEVIDHAKNNDKKSLVS
FT                   LLQNSEPVAASEDHVLVKFEEEIHCEIVNKDDEKRSSIESVVCNIVNKNVKVVGVPSDQ
FT                   WQRVRTEYLQNRKNEGDDMPKQQAQQTDIAQKAKDLFGEETVHVIDEE"
FT   gene            465502..465819
FT                   /locus_tag="SAAV_0423"
FT   CDS_pept        465502..465819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10361"
FT                   /protein_id="ACY10361.1"
FT                   /translation="MRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVT
FT                   VTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPG
FT                   M"
FT   gene            465826..466422
FT                   /gene="recR"
FT                   /locus_tag="SAAV_0424"
FT   CDS_pept        465826..466422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="SAAV_0424"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10362"
FT                   /protein_id="ACY10362.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAK
FT                   ALVDVKRELTYCSVCGHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLY
FT                   HVLHGSISPMDGIGPEDINIPSLIERLKSDEVSELILAMNPNLEGESTAMYISRLVKPI
FT                   GIKVTRLAQGLSVGGDLEYADEVTLSKAIAGRTEM"
FT   gene            467282..468836
FT                   /locus_tag="SAAV_0425"
FT   rRNA            467282..468836
FT                   /locus_tag="SAAV_0425"
FT                   /product="16S ribosomal RNA"
FT   gene            469201..472034
FT                   /locus_tag="SAAV_0425a"
FT   rRNA            469201..472034
FT                   /locus_tag="SAAV_0425a"
FT                   /product="23S ribosomal RNA"
FT   gene            472196..472310
FT                   /locus_tag="SAAV_0426"
FT   rRNA            472196..472310
FT                   /locus_tag="SAAV_0426"
FT                   /product="5S ribosomal RNA"
FT   gene            473213..474550
FT                   /locus_tag="SAAV_0427"
FT   CDS_pept        473213..474550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0427"
FT                   /product="Orn/Lys/Arg decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10363"
FT                   /protein_id="ACY10363.1"
FT                   /translation="MKQPILNKLESLNQEEAISLHVPGHKNMTIGHLSQLSMTMDKTEI
FT                   PGLDDLHHPEEVILESMKQVEKHSDYDAYFLVNGTTSGILSVIQSFSQKKGDILMARNV
FT                   HKSVLHALDISQQEGHFIETHQSPLTNHYNKVNLSRLNNDGHKLAVLTYPNYYGETFNV
FT                   EEVIKSLHQLNIPVLIDEAHGAHFGLQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLY
FT                   IHKNAPYRETIIEYLSYFQTSSPSYLIMASLESAAEFYKTYDSTVFFDKRAQLIECLEK
FT                   KGFEMLQVDDPLKLLIKYEGFTGHDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYL
FT                   FDLLLRKIEDMILPKKSVSKVKQTQLLTTEGNYKPKRFEYVTWCDLKKAKGKVLARHIV
FT                   PYPPGIPIIFKGETITENMIELVNEYLETGMIVEGIKNNKILVEDE"
FT   gene            474552..475169
FT                   /gene="tmk"
FT                   /locus_tag="SAAV_0428"
FT   CDS_pept        474552..475169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SAAV_0428"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10364"
FT                   /protein_id="ACY10364.1"
FT                   /translation="MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
FT                   EIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYA
FT                   RGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKV
FT                   IEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI"
FT   gene            475197..475526
FT                   /locus_tag="SAAV_0429"
FT   CDS_pept        475197..475526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10365"
FT                   /protein_id="ACY10365.1"
FT                   /translation="MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFL
FT                   CGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVD
FT                   AFHQF"
FT   gene            475740..476666
FT                   /locus_tag="SAAV_0430"
FT   CDS_pept        475740..476666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0430"
FT                   /product="DNA polymerase III, delta prime subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10366"
FT                   /protein_id="ACY10366.1"
FT                   /translation="MDEQQQLTNAYHSNKLSHAYLFEGDDAQTMKQVAINFAKLILCQT
FT                   DSQCETKVSTYNHPDFMYISTTENAIKKEQVEQLVRHMNQLPIESTNKVYIIEDFEKLT
FT                   VQGENSILKFLEEPPDNTIAILLSTKPEQILDTIHSRCQHVYFKPIDKEKFINRLVEQN
FT                   MSKPVAEMISTYTTQIDNAIALNEEFDLLALRKSVIRWCELLLTNKPMALIGIIDLLKQ
FT                   AKNKKLQSLTIAAVNGFFEDIIHTKVNVEDKQIYSDLKNDIDQYAQKLSFNQLILMFDQ
FT                   LTEAHKKLNQNVNPTLVFEQIVIKGVS"
FT   gene            476667..477470
FT                   /locus_tag="SAAV_0431"
FT   CDS_pept        476667..477470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10367"
FT                   /protein_id="ACY10367.1"
FT                   /translation="MPNVIGVQFQKAGKLEYYTPNDIQVDIEDWVVVESKRGIEIGIVK
FT                   NPLMDIAEEDVVLPLKNIIRIADDKDIDKFNCNERDAENALILCKDIVREQGLDMRLVN
FT                   CEYTLDKSKVIFNFTADDRIDFRKLVKILAQHLKTRIELRQIGVRDEAKLLGGIGPCGR
FT                   SLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGACGRLMCCLKYENDYYEEVRAQLPDI
FT                   GEAIETPDGNGKVVALNILDISMQVKLEGHEQPLEYKLEEIETMH"
FT   gene            477487..477834
FT                   /locus_tag="SAAV_0432"
FT   CDS_pept        477487..477834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0432"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10368"
FT                   /protein_id="ACY10368.1"
FT                   /translation="MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLEN
FT                   DNLKKVLGNDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGE
FT                   DCLFCLEVLSD"
FT   gene            478108..478833
FT                   /locus_tag="SAAV_0433"
FT   CDS_pept        478108..478833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10369"
FT                   /protein_id="ACY10369.1"
FT                   /translation="MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDI
FT                   VLDLCSGNGVIPLLLFAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNV
FT                   TKVFKPSQYTLVTCNPPYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGR
FT                   LNMVHRADRLMDVLFEMRKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPF
FT                   YIYNEDGNYSEEMKDVYYG"
FT   gene            478826..479074
FT                   /locus_tag="SAAV_0434"
FT   CDS_pept        478826..479074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10370"
FT                   /protein_id="ACY10370.1"
FT                   /translation="MDSHFVYIVKCSDGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRP
FT                   VHLVYQEMYETKSEALKREYEIKTYTRQKKLRLIKER"
FT   gene            479076..479915
FT                   /locus_tag="SAAV_0435"
FT   CDS_pept        479076..479915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0435"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10371"
FT                   /protein_id="ACY10371.1"
FT                   /translation="MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNH
FT                   YDIPTPLKSYHEHNKDKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANI
FT                   KVETVPGPNAGLTALMASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPH
FT                   RVTDTLKTIAKIDATRQVSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIE
FT                   GAKANNEISWFDDLSINEHVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS"
FT   gene            complement(479940..480095)
FT                   /locus_tag="SAAV_0436"
FT   CDS_pept        complement(479940..480095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10372"
FT                   /protein_id="ACY10372.1"
FT                   /translation="MLRYLLLSMYLFYIKKRRCHHFFIIVNIILSVSMQNDNLPFKITA
FT                   CVYKIV"
FT   gene            480200..482173
FT                   /gene="metS"
FT                   /locus_tag="SAAV_0437"
FT   CDS_pept        480200..482173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="SAAV_0437"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10373"
FT                   /protein_id="ACY10373.1"
FT                   /translation="MAKETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVR
FT                   YLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHV
FT                   VEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVE
FT                   LVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNW
FT                   GVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIW
FT                   PILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELP
FT                   FGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEA
FT                   MALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMA
FT                   HLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQFMEFSSLEQYGVLTESIMVTGQPKP
FT                   IFPRLDSEAEIAYIKESMQPPATEEEKEEIPSKPQIDIKDFDKVEIKAATIIDAEHVKK
FT                   SDKLLKIQVDLDSEQRQIVSGIAKFYTPDDIIGKKVAVVTNLKPAKLMGQKSEGMILSA
FT                   EKDGVLTLVSLPSAIPNGAVIK"
FT   gene            482204..482977
FT                   /locus_tag="SAAV_0438"
FT   CDS_pept        482204..482977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0438"
FT                   /product="TatD family deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10374"
FT                   /protein_id="ACY10374.1"
FT                   /translation="MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVVGFNKSTIER
FT                   AMKLIDEYDFLYGIIGWHPVDAIDFTEEHLEWIESLAQHPKVIGIGEMGLDYHWDKSPA
FT                   DVQKEVFRKQIALAKRLKLPIIIHNREATQDCIDILLEEHAEEVGGIMHSFSGSPEIAD
FT                   IVTNKLNFYISLGGPVTFKNAKQPKEVAKHVSMERLLVETDAPYLSPHPYRGKRNEPAR
FT                   VTLVAEQIAELKGLSYEEVCEQTTKNAEKLFNLNS"
FT   gene            483144..483680
FT                   /locus_tag="SAAV_0439"
FT   CDS_pept        483144..483680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10375"
FT                   /protein_id="ACY10375.1"
FT                   /translation="MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNA
FT                   QQSRGVIVLTDPDFPGDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHADLIDIKE
FT                   ALMHVSSPFDEAYESIDKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNA
FT                   FGYTEADVRQALEDE"
FT   gene            483691..484584
FT                   /gene="ksgA"
FT                   /locus_tag="SAAV_0440"
FT   CDS_pept        483691..484584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SAAV_0440"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10376"
FT                   /protein_id="ACY10376.1"
FT                   /translation="MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDA
FT                   SDIDAQTGVIEIGPGMGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINED
FT                   ILKANIKEAVENHLQDCEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGER
FT                   LNAEVGSKAYGSLSIVVQYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDN
FT                   EEAFFKLAKAAFAQRRKTINNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQD
FT                   FAKLYEEKKKFPQLEN"
FT   gene            484684..484947
FT                   /locus_tag="SAAV_0441"
FT   CDS_pept        484684..484947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10377"
FT                   /protein_id="ACY10377.1"
FT                   /translation="MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSV
FT                   FIVELDQDKHNFERVSYTYTDVLTENVQVSFEEDNHHESIAH"
FT   gene            485258..486106
FT                   /gene="ipk"
FT                   /locus_tag="SAAV_0442"
FT   CDS_pept        485258..486106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipk"
FT                   /locus_tag="SAAV_0442"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10378"
FT                   /protein_id="ACY10378.1"
FT                   /translation="MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKR
FT                   KDRKIVVEIEHNYVPSNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSAD
FT                   AAATLRGLNRLFDIGASLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSA
FT                   WVILAKPNLGISSPDIFKLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVS
FT                   KHPQIDKLKNNMLKSGADGALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLL
FT                   G"
FT   gene            486120..486944
FT                   /gene="purR"
FT                   /locus_tag="SAAV_0443"
FT   CDS_pept        486120..486944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="SAAV_0443"
FT                   /product="pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10379"
FT                   /protein_id="ACY10379.1"
FT                   /translation="MRYKRSERIVFMTQYLMNHPNKLIPLTFFVKKFKQAKSSISEDVQ
FT                   IIKNTFQKEKLGTVITTAGASGGVTYKPMMSKEEATEVVNEVITLLEEKERLLPGGYLF
FT                   LSDLVGNPSLLNKVGKLIASIYMEEKLDAVVTIATKGISLANAVANILNLPVVVIRKDN
FT                   KVTEGSTVSINYVSGSSRKIETMVLSKRTLAENSNVLVVDDFMRAGGSINGVMNLMNEF
FT                   KAHVKGVSVLVESKEVKQRLIEDYTSLVKLSDVDEYNQEFNVEPGNSLSKFS"
FT   gene            486961..487341
FT                   /locus_tag="SAAV_0444"
FT   CDS_pept        486961..487341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0444"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10380"
FT                   /protein_id="ACY10380.1"
FT                   /translation="MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNVDGKIVSADV
FT                   QAQTKQVLENLKVVLEEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCV
FT                   EVARLPKDVKVEIELVSKIKEL"
FT   gene            487413..487715
FT                   /gene="spoVG"
FT                   /locus_tag="SAAV_0445"
FT   CDS_pept        487413..487715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="SAAV_0445"
FT                   /product="regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10381"
FT                   /protein_id="ACY10381.1"
FT                   /translation="MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFV
FT                   AMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA"
FT   gene            488080..489432
FT                   /gene="glmU"
FT                   /locus_tag="SAAV_0446"
FT   CDS_pept        488080..489432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="SAAV_0446"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10382"
FT                   /protein_id="ACY10382.1"
FT                   /translation="MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGV
FT                   DQVVTIVGHGAESVKGHLGERSLYSFQEEQLGTAHAVQMAKSHLEDKEGTTIVVCGDTP
FT                   LITKETLETLIAHHEDANAQATVLSASIQQPYGYGRIVRNASGRLERIVEEKDATQAEK
FT                   DINEISSGIFAFNNKTLFEKLTQVKNDNAQGEYYLPDVLSLILNDGGIVEVYRTNDVEE
FT                   IMGVNDRVMLSQAEKAMQRRTNHYHMLNGVTIIDPDSTFIGPDVTIGSDTVIEPGVRIN
FT                   GRTEIGEDVVIGQYSEINNSTIENGACIQQSVVNDASVGANTKVGPFAQLRPGAQLGAD
FT                   VKVGNFVEIKKADLKDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDGENKFKTIVGKD
FT                   SFVGCNVNLVAPVTIGDDVLVAAGSTITDDVPNDSLAVARARQTTKEGYRK"
FT   gene            489579..490544
FT                   /gene="prsA"
FT                   /locus_tag="SAAV_0447"
FT   CDS_pept        489579..490544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="SAAV_0447"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10383"
FT                   /protein_id="ACY10383.1"
FT                   /translation="MLNNEYKNSSLKIFSLKGNEALAQEVADQVGIELGKCSVKRFSDG
FT                   EIQINIEESIRGCDVFIIQPTSYPVNLHLMELLIMIDACKRASAATINIVVPYYGYARQ
FT                   DRKARSREPITAKLVANLIETAGATRMIALDLHAPQIQGFFDIPIDHLMGVPILAKHFK
FT                   DDPNINPEECVVVSPDHGGVTRARKLADILKTPIAIIDKRRPRPNVAEVMNIVGEIEGR
FT                   TAIIIDDIIDTAGTITLAAQALKDKGAKEVYACCTHPVLSGPAKERIENSAIKELIVTN
FT                   SIHLDEDRKPSNTKELSVAGLIAQAIIRVYERESVSVLFD"
FT   gene            490694..491347
FT                   /gene="rplY"
FT                   /locus_tag="SAAV_0448"
FT   CDS_pept        490694..491347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="SAAV_0448"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10384"
FT                   /protein_id="ACY10384.1"
FT                   /translation="MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDE
FT                   VEFIKVIREVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEV
FT                   PVQLVGEAVGAKEGGVVEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTG
FT                   DFKIENDSAESVVTVVAPTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE"
FT   gene            491658..492230
FT                   /gene="pth"
FT                   /locus_tag="SAAV_0449"
FT   CDS_pept        491658..492230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SAAV_0449"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10385"
FT                   /protein_id="ACY10385.1"
FT                   /translation="MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGA
FT                   YTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQ
FT                   KGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIE
FT                   HAARAIEKFVETSRFDHVMNEFNGEVK"
FT   gene            492230..495736
FT                   /gene="mfd"
FT                   /locus_tag="SAAV_0450"
FT   CDS_pept        492230..495736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SAAV_0450"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10386"
FT                   /protein_id="ACY10386.1"
FT                   /translation="MTILTTLIKEDNHFQDLNQVFGQANTLVTGLSPSAKVTMIAEKYA
FT                   QSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRT
FT                   LTALAQGKKGLFIVPLNGLKKWLTPVEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRE
FT                   SVVSHIGEFSLRGGIIDIFPLIGEPIRIELFDTEIDSIRDFDVETQRSKDNIEEVDITT
FT                   ASDYIITEEVIRHLKEELKTAYENTRPKIDKSVRNDLKETYESFKLFESTYFDHQILRR
FT                   LVAFMYEIPSTIIEYFQKDAIIAVDEFNRIKETEESLTVESDSFISNIIESGNGFIGQS
FT                   FIKYDDFETLIEGYPVTYFSLFATTMPIKLNHIIKFSCKPVQQFYGQYDIMRSEFQRYV
FT                   NQNYHIVVLVETETKVERMQAMLSEMHIPSITKLHRSMSSGQAVIIEGSLSEGFELPDM
FT                   GLVVITERELFKSKQKKQRKRTKAISNAEKIKSYQDLNVGDYIVHVHHGVGRYLGVETL
FT                   EVGQTHRDYIKLQYKGTDQLFVPVDQMDQVQKYVASEDKTPKLNKLGGSEWKKTKAKVQ
FT                   QSVEDIAEELIDLYKEREMAEGYQYGEDTAEQTTFELDFPYELTPDQAKSIDEIKDDMQ
FT                   KSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDF
FT                   PVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKLLSKDIQYKDLGLLIVDEEQRFG
FT                   VRHKERIKTLKHNVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVLEQN
FT                   MSFIKEALERELSRDGQVFYLYNKVQSIYEKREQLQMLMPDANIAVAHGQMTERDLEET
FT                   MLSFINNEYDILVTTTIIETGVDVPNANTLIIEDADRFGLSQLYQLRGRVGRSSRIGYA
FT                   YFLHPANKVLTETAEDRLQAIKEFTELGSGFKIAMRDLNIRGAGNLLGKQQHGFIDTVG
FT                   FDLYSQMLEEAVNEKRGIKEPESEVPEVEVDLNLDAYLPTEYIANEQAKIEIYKKLRKT
FT                   ETFDQIIDIKDELIDRFNDYPVEVARLLDIVEIKVHALHSGITLIKDKGKIIDIHLSVK
FT                   ATENIDGEVLFKATQPLGRTMKVGVQNNAMTITLTKQNQWLDSLKFLVKCIEESMRISD
FT                   EA"
FT   gene            495726..497252
FT                   /locus_tag="SAAV_0451"
FT   CDS_pept        495726..497252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0451"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10387"
FT                   /protein_id="ACY10387.1"
FT                   /translation="MKHKEAFNGVVVLTAALIVIKILSAVYRIPYQNILGDTGLYAYQQ
FT                   VYPIVALGMILSMNAIPSAITQNIGKYHSDEAYAKAVAYIQLVGILLFIAIFVFANNIA
FT                   HMMGDSHLTPMIQAASLSFIFIGMLGVLRGYYQSANNMTVPAISQVIEQVIRVGIIIVT
FT                   IVIFVDRGWTIYEAGTIAILASTIGFLGSSIYLVAHRPFKFKMVNNTAKIVWKQFALSV
FT                   LIFAISQLIVILWQVIDSVTIIKSLQAIRVPFDVAITEKGVYDRGASFIQMGLIVTTTF
FT                   SFALIPLLSDAIKMNNQVLMNRYANASLKITILISTAAGIGLINLLPLMNGVFFKTNDL
FT                   TLTLSVYMITVICVSLIMMDMALLQAQHAVRPIFVGMTAGLVIKFILNIILIRLSGIIG
FT                   ASISTVVSLIIFGTIIHIAVTRKYHLHAMRRFFINVVLGMVFMSIVVQCVLNIVTTHGR
FT                   FTGLIELLCAAVLGIIALFFYIFRFNVLTYKELTYLPFGSKLYQIKKGRR"
FT   gene            497252..498445
FT                   /locus_tag="SAAV_0452"
FT   CDS_pept        497252..498445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0452"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10388"
FT                   /protein_id="ACY10388.1"
FT                   /translation="MAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESL
FT                   QDELTFQSFDHVYEAHDQFEDVYNDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLA
FT                   LAKDNTDIDVKVLGGKSFIDDVFEAVNVDPNDGFTLLDATSLQEVILNVRTHTLITQVY
FT                   SAMVAANLKITLMERYPDDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFV
FT                   PKIITSTYLYHDFDFATEVIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNE
FT                   DDWHMIEELGDILLQVLLHTSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETID
FT                   DLKEIWSKAKDAEGKQPRVKFEKVFAEHFLNLYEKTKDKSFDEASLKQWLEKGESNT"
FT   gene            498442..498705
FT                   /locus_tag="SAAV_0453"
FT   CDS_pept        498442..498705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0453"
FT                   /product="S4 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10389"
FT                   /protein_id="ACY10389.1"
FT                   /translation="MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVED
FT                   VLTIRFGQKLVTVKVTALNEHASKDNAKGMYEIIEERRLEEA"
FT   gene            498723..499115
FT                   /locus_tag="SAAV_0454"
FT   CDS_pept        498723..499115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0454"
FT                   /product="cell-division protein divIC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10390"
FT                   /protein_id="ACY10390.1"
FT                   /translation="MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAII
FT                   VVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDY
FT                   YLSNKGEVIFRLPEDKDSSSSKSSKK"
FT   gene            499220..499621
FT                   /locus_tag="SAAV_0455"
FT   CDS_pept        499220..499621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10391"
FT                   /protein_id="ACY10391.1"
FT                   /translation="MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVEN
FT                   VEEHLSVGDEVDVKVLSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKL
FT                   SNFLKDSEDKLTSIKRQTESRRGGKGSRR"
FT   gene            499801..501096
FT                   /locus_tag="SAAV_0456"
FT   CDS_pept        499801..501096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10392"
FT                   /protein_id="ACY10392.1"
FT                   /translation="MQLNSNGWHVDDHIVVAVSTGIDSMCLLYQLLNDYKDSYRKLTCL
FT                   HVNHGVRSASIEEARFLEAYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDE
FT                   MMNVLEADVLLTAHHLDDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSK
FT                   KEIKQFQERYHIPYFEDESNKDNKYIRNDIRNRIIPAIDENNQLKVSHLLKLKQWHDEQ
FT                   YDILQYSAKQFIQEFVKFDEQSKYLEVSRQAFNNLPNSLKMVVLDCLLSKYYELFNISA
FT                   KTYEEWFKQFSSKKAQFSINLTDKWIIQIAYGKLIIMAKNNGDTYFRVQTIKKPGNYFF
FT                   NKYRLEIHSNLPKCLFPLTVRTRQSGDTFKLNGRDGYKKVNRLFIDCKVPQWVRDQMPI
FT                   VLDKQQRIIAVGDLYQQQTIKKWIIISKNGDE"
FT   gene            501101..501640
FT                   /gene="hpt"
FT                   /locus_tag="SAAV_0457"
FT   CDS_pept        501101..501640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SAAV_0457"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10393"
FT                   /protein_id="ACY10393.1"
FT                   /translation="MHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSA
FT                   MFMSDLIKRIDTHLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETG
FT                   TTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELY
FT                   RNLPYIGTLKPEVYSN"
FT   gene            501897..503990
FT                   /locus_tag="SAAV_0458"
FT   CDS_pept        501897..503990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0458"
FT                   /product="cell division protein FtsH, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10394"
FT                   /protein_id="ACY10394.1"
FT                   /translation="MQKAFRNVLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLE
FT                   KGDLKTLEIQPQQNVYMVSGKTKNDEDYSSTILYNNEKELQKITDAAKKQNGVKLTIKE
FT                   EEKQSVFVSILSTLIPVVVIALLFIFFLSQAQGGGSGGRMMNFGKSKAKMYDNNKRRVR
FT                   FSDVAGADEEKQELIEIVDFLKDNKKFKEMGSRIPKGVLLVGPPGTGKTLLARAVAGEA
FT                   GAPFFSISGSDFVEMFVGVGASRVRDLFDNAKKNAPCIIFIDEIDAVGRQRGAGVGGGH
FT                   DEREQTLNQLLVEMDGFGENEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGR
FT                   EAILHVHAKNKPLDETVDLKAISQRTPGFSGADLENLLNEASLIAVREGKKKIDMRDIE
FT                   EATDRVIAGPAKKSRVISKKERNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGY
FT                   AMMLPKQDRFLMTEQELLDKICGLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTQ
FT                   YGMSKKLGPLQFGHSNGQVFLGKDMQGEPNYSSQIAYEIDKEVQRIVKEQYERCKQILL
FT                   EHKEQLILIAETLLTEETLVAEQIQSLFYEGKLPEIDYDAAKVVKDEDSEFNDGKFGKS
FT                   YEEIRKEQLEDGQRDESEDRKEEKDIAEDKKEADKSDEKDEPAHRQAPNIEKPYDPNHP
FT                   DNK"
FT   gene            504218..505099
FT                   /gene="hslO"
FT                   /locus_tag="SAAV_0459"
FT   CDS_pept        504218..505099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="SAAV_0459"
FT                   /product="Hsp33-like chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10395"
FT                   /protein_id="ACY10395.1"
FT                   /translation="MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMG
FT                   RTMTATAMMGAMLKGDQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQG
FT                   KLDVRRAVGTNGSIMVVKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGV
FT                   LVNPDNTIKAAGGFIIQVMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILG
FT                   EDHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYT
FT                   EEELNVLLESLA"
FT   gene            505278..506210
FT                   /gene="cysK"
FT                   /locus_tag="SAAV_0460"
FT   CDS_pept        505278..506210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="SAAV_0460"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10396"
FT                   /protein_id="ACY10396.1"
FT                   /translation="MAQKPVDNITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSV
FT                   KDRIALAMIEKAEREGKIKPGDTIVEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQER
FT                   RNLLKAYGAELVLTPGSEAMKGAIKKAKELKEEHGYFEPQQFENPANPEVHELTTGPEL
FT                   LQQFEGKTIDAFLAGVGTGGTLSGVGKVLKKEYPNIEIVAIEPEASPVLSGGEPGPHKL
FT                   QGLGAGFIPGTLNTEIYDSIIKVGNDTAMEMSRRVAKEEGILAGISSGAAIYAAIQKAK
FT                   ELGKGKTVVTVLPSNGERYLSTPLYSFDD"
FT   gene            506426..507229
FT                   /gene="folP"
FT                   /locus_tag="SAAV_0461"
FT   CDS_pept        506426..507229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="SAAV_0461"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10397"
FT                   /protein_id="ACY10397.1"
FT                   /translation="MTKTKIMGILNVTPDSFSDGGKFNNVETAINRVKAMIDEGADIID
FT                   VGGVSTRPGHEMVTLEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMIND
FT                   QWAGLYDHRMFQIVAKYDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNK
FT                   IWLDPGIGFAKTRNEEAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEV
FT                   TAATTAYGIMKGVRAVRVHNVELNAKLAKGIDFLKENENARHNLS"
FT   gene            507207..507572
FT                   /gene="folB"
FT                   /locus_tag="SAAV_0462"
FT   CDS_pept        507207..507572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="SAAV_0462"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10398"
FT                   /protein_id="ACY10398.1"
FT                   /translation="MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLAEAGRT
FT                   DNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERIANRINSQYNRVMETKVRITKENPP
FT                   IPGHYDGVGIEIVRENK"
FT   gene            507569..508045
FT                   /gene="folK"
FT                   /locus_tag="SAAV_0463"
FT   CDS_pept        507569..508045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SAAV_0463"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10399"
FT                   /protein_id="ACY10399.1"
FT                   /translation="MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAP
FT                   VGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEE
FT                   MIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK"
FT   gene            508439..508531
FT                   /locus_tag="SAAV_0464"
FT   CDS_pept        508439..508531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10400"
FT                   /protein_id="ACY10400.1"
FT                   /translation="MVNDKVLETSKEMYVEQKCLIFYKTLKENV"
FT   gene            508584..510071
FT                   /gene="lysS"
FT                   /locus_tag="SAAV_0465"
FT   CDS_pept        508584..510071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SAAV_0465"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10401"
FT                   /protein_id="ACY10401.1"
FT                   /translation="MSEEMNDQMLVRRQKLQELYDLGIDPFGSKFDRSGLSSDLKEEWD
FT                   QYSKEELVEKEADSHVAIAGRLMTKRGKGKAGFAHVQDLAGQIQIYVRKDQVGDDEFDL
FT                   WKNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKSLRPLPDKFHGLQDIEQRYRQRY
FT                   LDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQIAGGAAARPFVTHHNAL
FT                   DATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHD
FT                   IMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIVDAVKEATGVDFYEVKSDE
FT                   EAKALAKEHGIEIKDTMKYGHILNEFFEQKVEETLIQPTFIYGHPTEISPLAKKNPEDP
FT                   RFTDRFELFIVGREHANAFTELNDPIDQKGRFEAQLVEKAQGNDEAHEMDEDYIEALEY
FT                   GMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK"
FT   gene            510629..510743
FT                   /locus_tag="SAAV_0485a"
FT   rRNA            510629..510743
FT                   /locus_tag="SAAV_0485a"
FT                   /product="5S ribosomal RNA"
FT   gene            510756..510831
FT                   /locus_tag="SAAV_0466"
FT   tRNA            510756..510831
FT                   /locus_tag="SAAV_0466"
FT                   /product="tRNA-Val"
FT   gene            510848..510923
FT                   /locus_tag="SAAV_0467"
FT   tRNA            510848..510923
FT                   /locus_tag="SAAV_0467"
FT                   /product="tRNA-Thr"
FT   gene            510929..511006
FT                   /locus_tag="SAAV_0468"
FT   tRNA            510929..511006
FT                   /locus_tag="SAAV_0468"
FT                   /product="tRNA-Lys"
FT   gene            511036..511110
FT                   /locus_tag="SAAV_0469"
FT   tRNA            511036..511110
FT                   /locus_tag="SAAV_0469"
FT                   /product="tRNA-Gly"
FT   gene            511117..511207
FT                   /locus_tag="SAAV_0470"
FT   tRNA            511117..511207
FT                   /locus_tag="SAAV_0470"
FT                   /product="tRNA-Leu"
FT   gene            511212..511288
FT                   /locus_tag="SAAV_0471"
FT   tRNA            511212..511288
FT                   /locus_tag="SAAV_0471"
FT                   /product="tRNA-Arg"
FT   gene            511309..511385
FT                   /locus_tag="SAAV_0472"
FT   tRNA            511309..511385
FT                   /locus_tag="SAAV_0472"
FT                   /product="tRNA-Pro"
FT   gene            511405..511482
FT                   /locus_tag="SAAV_0473"
FT   tRNA            511405..511482
FT                   /locus_tag="SAAV_0473"
FT                   /product="tRNA-Ala"
FT   gene            511602..513156
FT                   /locus_tag="SAAV_0474"
FT   rRNA            511602..513156
FT                   /locus_tag="SAAV_0474"
FT                   /product="16S ribosomal RNA"
FT   gene            513248..513326
FT                   /locus_tag="SAAV_0475"
FT   tRNA            513248..513326
FT                   /locus_tag="SAAV_0475"
FT                   /product="tRNA-Ile"
FT   gene            513493..516326
FT                   /locus_tag="SAAV_0476"
FT   rRNA            513493..516326
FT                   /locus_tag="SAAV_0476"
FT                   /product="23S ribosomal RNA"
FT   gene            516488..516602
FT                   /locus_tag="SAAV_0477"
FT   rRNA            516488..516602
FT                   /locus_tag="SAAV_0477"
FT                   /product="5S ribosomal RNA"
FT   gene            516763..516861
FT                   /locus_tag="SAAV_0478"
FT   CDS_pept        516763..516861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10402"
FT                   /protein_id="ACY10402.1"
FT                   /translation="MSKREPKKRKEASDCHKSRKVLSEDGSQLTFR"
FT   gene            complement(517125..518507)
FT                   /locus_tag="SAAV_0479"
FT   CDS_pept        complement(517125..518507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0479"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10403"
FT                   /protein_id="ACY10403.1"
FT                   /translation="MKNILYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTV
FT                   EHAYQLLLDEGYIYSRPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAF
FT                   NLDEIDTKHFPIELFRKYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICD
FT                   PNQIIIGSSTEQLVNQLVDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINV
FT                   DEVIKSQKNIVYITPSHQFPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGK
FT                   PIPAIQGLYSRGEKVIYISTFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHM
FT                   QNLIATFISSGGFERHLNKMRRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKN
FT                   GLTLQECLDRANKVKLKLQVYNFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLI
FT                   IK"
FT   gene            518611..519498
FT                   /locus_tag="SAAV_0480"
FT   CDS_pept        518611..519498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0480"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10404"
FT                   /protein_id="ACY10404.1"
FT                   /translation="MSKIIGSDRVKRGMAEMQKGGVIMDVVNAEQARIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARMANPKIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDE
FT                   SEVLTPADEEYHLRKDQFTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVR
FT                   HMRQVNSEVSRLTVMNDDEIMTFAKDIGAPYEILKQIKDNGRLPVVNFAAGGVATPQDA
FT                   ALMMELGADGVFVGSGIFKSEDPEKFAKAIVQATTHYQDYELIGRLASELGTAMKGLDI
FT                   NQLSLEERMQERGW"
FT   gene            519502..520062
FT                   /locus_tag="SAAV_0481"
FT   CDS_pept        519502..520062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0481"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10405"
FT                   /protein_id="ACY10405.1"
FT                   /translation="MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPG
FT                   GESTTLRRLMNLYGFKEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSF
FT                   GRQVDSFETELDIKGIATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVS
FT                   FHPELTDDYRVTDYFINHIVKKA"
FT   gene            complement(520270..521484)
FT                   /gene="nupC"
FT                   /locus_tag="SAAV_0482"
FT   CDS_pept        complement(520270..521484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="SAAV_0482"
FT                   /product="nucleoside permease NupC"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10406"
FT                   /protein_id="ACY10406.1"
FT                   /translation="MHILIGIIGIIFFLALAFLFSSDRKNIRWKYVGILLAIQLIFAFI
FT                   LLKTTMGIKVIGGISNGFNYLLLKAADGVNFVFGGIQYIDPKQPPFFFSVLLPIVFISA
FT                   IIGILQYTKILPLIINVLGFLISKINGMGRLESYNAVAAAILGQSEVFISIKKQLPYIP
FT                   KQRLYTLTASAMSTVSASIIGAYFTLIEPKYVVTAVVLNLFGGFIIASIINPYKVNEED
FT                   DKLLVEETEERQQSFFEMLGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSNIFSTVS
FT                   GGAISWDFQTLIGFVFAPFAFLVGVPWQDAVQAGSVMATKLLSNEFVAMQALGKLSDLS
FT                   EHAKGVTSVFLVSFANFSSIGIISGAIKSLNDKKGDTVARFGLKLLFGATLVSFISAAI
FT                   AGFFI"
FT   gene            521642..522103
FT                   /gene="ctsR"
FT                   /locus_tag="SAAV_0483"
FT   CDS_pept        521642..522103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="SAAV_0483"
FT                   /product="transcriptional regulator CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10407"
FT                   /protein_id="ACY10407.1"
FT                   /translation="MHNMSDIIEQYIKRLFEESNEDVVEIQRANIAQRFDCVPSQLNYV
FT                   IKTRFTNEHGYEIESKRGGGGYIRITKIENKDATGYINHLLQLIGPSISQQQAYYIIDG
FT                   LLDKMLINEREAKMIQAVIDRETLSMDMVSRDIIRANILKRLLPVINYY"
FT   gene            522122..522688
FT                   /locus_tag="SAAV_0484"
FT   CDS_pept        522122..522688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0484"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10408"
FT                   /protein_id="ACY10408.1"
FT                   /translation="MLCENCQLNEAELKVKVTSKNKTEEKMVCQTCAEGHHPWNQANEQ
FT                   PEYQEHQDNFEEAFVVKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFG
FT                   CANCYATFKDDIIDIVRRVQGGQFEHGGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQD
FT                   FEEAAIVRDEIKALKAESEVQHDDA"
FT   gene            522678..523685
FT                   /locus_tag="SAAV_0485"
FT   CDS_pept        522678..523685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0485"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10409"
FT                   /protein_id="ACY10409.1"
FT                   /translation="MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATE
FT                   NDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESL
FT                   SVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGT
FT                   GMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKS
FT                   ELEIIETLTEVVNQIIHDEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYR
FT                   LSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK"
FT   gene            523699..526155
FT                   /locus_tag="SAAV_0486"
FT   CDS_pept        523699..526155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0486"
FT                   /product="ClpA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10410"
FT                   /protein_id="ACY10410.1"
FT                   /translation="MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGI
FT                   AAKVLESFNITEDKVIEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVG
FT                   TEHILLGLIRENEGVAARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTPTL
FT                   DSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QAIVNNEVPETLKDKRVMSLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDEL
FT                   HTLVGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVD
FT                   EPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEAS
FT                   SKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKN
FT                   EWKNAQNGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAV
FT                   NSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSE
FT                   FMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLD
FT                   DGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRFAGFGGSSDGQDYETIRKTMLKELK
FT                   NSFRPEFLNRVDDIIVFHKLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAE
FT                   EGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTVDHDGKEFKYDIAEQTSET
FT                   KTPSQA"
FT   gene            526640..528004
FT                   /gene="radA"
FT                   /locus_tag="SAAV_0487"
FT   CDS_pept        526640..528004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SAAV_0487"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10411"
FT                   /protein_id="ACY10411.1"
FT                   /translation="MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIVEKAANPKH
FT                   GVKTKELAGKVQKLNSIKHETTPRVLTDSAEFNRVLGGGIVSGSLVLIGGDPGIGKSTL
FT                   LLQICASLSQKKKVLYITGEESLSQTKLRAERLDEDSSELQVLAETDLEVIYQTVKEEQ
FT                   PDLLVVDSIQTIYHPEISSAPGSVSQVRESTQSLMNIAKQMNIATFIVGHVTKEGQIAG
FT                   PRLLEHMVDTVLYFEGDEHHAYRILRAVKNRFGSTNEMGIFEMKQSGLKGVNNPSEMFL
FT                   EERSTNVPGSTIVATMEGTRPLLIEVQALVTPTTFNNPRRMATGIDHNRLSLLMAVLEK
FT                   KENYLLQQQDAYIKVAGGVKLTEPAVDLSVIVATASSFKDKAVDGLDCYIGEVGLTGEV
FT                   RRVSRIEQRVQEAAKLGFKRVIIPKNNIGGWTYPEGIQVIGVTTVHEALSFALHS"
FT   gene            528029..529102
FT                   /locus_tag="SAAV_0488"
FT   CDS_pept        528029..529102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0488"
FT                   /product="PIN/TRAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10412"
FT                   /protein_id="ACY10412.1"
FT                   /translation="MNIVKLMVIIIYLIIGSALGIIIIPEIANDLGLQNSIFLKNHYVD
FT                   GIIGSIFMFLIFGVFIRRVTNAIKGLEHFIMRRSAVEILFATIGLIIGLLISVMVSFIL
FT                   ESIGNSIFNHFIPVIITILLCYFGFQFGLKKRDEMLMFLPENIARSMSQHTKSATPKII
FT                   DTSAIIDGRILEVIRCGFIDGNILIPQGVINELQIVADSNDSVKREKGKRGLDILNELY
FT                   DLDYPTKVIHPTKTHSDIDTMLLKLAKQYHASIITTDFNLNKVCHVHGIKALNVNDLSE
FT                   AIKPNVHQGDQLHILLTKMGKEPGQAVGYLDDGTMVVVDNAKNLIGSHVNLEVVSLLQT
FT                   SSGRIVFAKKIEDTVSL"
FT   gene            529659..531113
FT                   /gene="gltX"
FT                   /locus_tag="SAAV_0489"
FT   CDS_pept        529659..531113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="SAAV_0489"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10413"
FT                   /protein_id="ACY10413.1"
FT                   /translation="MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIED
FT                   TDKKRNLEDGETSQFDNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDK
FT                   AYKCYMTEEELEAEREAQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQ
FT                   TYSFDDMVKGNISFDSNGIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNT
FT                   PKQIMIYEAFGWEPPRFGHMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFI
FT                   ALLGWSPEGEEEIFSKEEFIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQL
FT                   ALPHLIKANLIPEVPSEEDLSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEEEQ
FT                   QVINGEQVPELMTHLFSKLEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQ
FT                   MHGPELPNTIEVLGKEKVLNRLKQYK"
FT   gene            531542..532183
FT                   /gene="cysE"
FT                   /locus_tag="SAAV_0490"
FT   CDS_pept        531542..532183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SAAV_0490"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10414"
FT                   /protein_id="ACY10414.1"
FT                   /translation="MLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLY
FT                   NQKKYVAARAISQISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGV
FT                   TLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGI
FT                   PGHIVKQDGVRVGKTFDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII"
FT   gene            532167..533567
FT                   /gene="cysS"
FT                   /locus_tag="SAAV_0491"
FT   CDS_pept        532167..533567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SAAV_0491"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10415"
FT                   /protein_id="ACY10415.1"
FT                   /translation="MITLYNTLTRQKEVFKPIEPGKVKMYVCGPTVYNYIHIGNARPAI
FT                   NYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALN
FT                   VRKATSNPRVMDHMDDIIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLK
FT                   VGARIDAGEHKEDALDFTLWKKAKPGEISWNSPFGEGRPGWHIECSVMAFHELGPTIDI
FT                   HAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIK
FT                   EVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQT
FT                   YIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQI
FT                   FSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNIILEDTP
FT                   QGVRFKRG"
FT   gene            533560..533964
FT                   /locus_tag="SAAV_0492"
FT   CDS_pept        533560..533964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10416"
FT                   /protein_id="ACY10416.1"
FT                   /translation="MDNQQDNHIKLLNPLTLAYMGDAVLDQYVRTYIVLKLKSKPNKLH
FT                   QMSKKYVSAKSQAQTLEYLMEQEWFTDEEMDILKRGRNAKSHTKAKNTDVQTYRKSSAI
FT                   EAVIGFLYLEKREERLEALLNKIITIVNER"
FT   gene            533972..534718
FT                   /locus_tag="SAAV_0493"
FT   CDS_pept        533972..534718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0493"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10417"
FT                   /protein_id="ACY10417.1"
FT                   /translation="MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKD
FT                   QKIIVQTVPKSKLDFLANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLE
FT                   DPHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
FT                   LKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHV
FT                   NSLNASVAASLMMYEVFRKRHDVGEI"
FT   gene            534718..535242
FT                   /locus_tag="SAAV_0494"
FT   CDS_pept        534718..535242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10418"
FT                   /protein_id="ACY10418.1"
FT                   /translation="MKERYLIIDGYNMIGQSPTLSAIAKENLEEARMQLIDAIANYNAV
FT                   ISDEIICVFDAYDQSGVEREYMYHGVKTIFTKEKETADSFIERYVYELYDKHTKHIAVV
FT                   TSDMSEQHAIFGSGAYRISSREMWRDLKENEIDVSKSLDDISENKPRTRIPLSSEILAE
FT                   FEKIRRGHHKK"
FT   gene            535323..535892
FT                   /locus_tag="SAAV_0495"
FT   CDS_pept        535323..535892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10419"
FT                   /protein_id="ACY10419.1"
FT                   /translation="MKYDLTTQDSTIKRNNSINDKDFEKLVMDLQPLIIRRIKTFGFNH
FT                   YDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLI
FT                   NEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQL
FT                   MHVKEKVIYNAIQRCKNKIKRYFKMI"
FT   gene            536007..536150
FT                   /gene="rpmG"
FT                   /locus_tag="SAAV_0496"
FT   CDS_pept        536007..536150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="SAAV_0496"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10420"
FT                   /protein_id="ACY10420.1"
FT                   /translation="MRKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKE
FT                   SK"
FT   gene            536206..536388
FT                   /gene="secE"
FT                   /locus_tag="SAAV_0497"
FT   CDS_pept        536206..536388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="SAAV_0497"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10421"
FT                   /protein_id="ACY10421.1"
FT                   /translation="MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFY
FT                   ALDLGITALKNLLFG"
FT   gene            536401..536949
FT                   /gene="nusG"
FT                   /locus_tag="SAAV_0498"
FT   CDS_pept        536401..536949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="SAAV_0498"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10422"
FT                   /protein_id="ACY10422.1"
FT                   /translation="MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVI
FT                   PEEEETQVKDGKAKTTVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPN
FT                   PLLPEEVRFILKQMGLKEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLV
FT                   DMFGRETPVEVEFDQIEKL"
FT   gene            537130..537552
FT                   /gene="rplK"
FT                   /locus_tag="SAAV_0499"
FT   CDS_pept        537130..537552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SAAV_0499"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10423"
FT                   /protein_id="ACY10423.1"
FT                   /translation="MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TQDQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQ
FT                   VREIANSKMQDLNAADEEAAMRIIEGTARSMGIVVE"
FT   gene            537760..538452
FT                   /gene="rplA"
FT                   /locus_tag="SAAV_0500"
FT   CDS_pept        537760..538452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SAAV_0500"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10424"
FT                   /protein_id="ACY10424.1"
FT                   /translation="MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVA
FT                   FRLGIDTRKNDQQIRGAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEY
FT                   RAEKAGIVHASIGKVSFTDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGV
FT                   KIDTASFK"
FT   misc_feature    538540..538686
FT                   /product="Ribosomal protein L10 leader"
FT                   /note="SAAV_0501"
FT   gene            538724..539224
FT                   /gene="rplJ"
FT                   /locus_tag="SAAV_0502"
FT   CDS_pept        538724..539224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="SAAV_0502"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10425"
FT                   /protein_id="ACY10425.1"
FT                   /translation="MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQL
FT                   REAGVEYKVYKNTMVRRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHE
FT                   ALEIKSGVMEGNVITAEEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEE
FT                   NAE"
FT   gene            539267..539635
FT                   /gene="rplL"
FT                   /locus_tag="SAAV_0503"
FT   CDS_pept        539267..539635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="SAAV_0503"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10426"
FT                   /protein_id="ACY10426.1"
FT                   /translation="MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAG
FT                   GADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEE
FT                   AEKLKEQLEEVGATVELK"
FT   gene            539810..540418
FT                   /locus_tag="SAAV_0504"
FT   CDS_pept        539810..540418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10427"
FT                   /protein_id="ACY10427.1"
FT                   /translation="MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGS
FT                   DVLVQTFLKAHPPGPSKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNK
FT                   KLNGIDNVIVKESDALSAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFV
FT                   VIQKKQGMPSAKKRMNELFGNVEVVNKDKGYYILRSIKA"
FT   gene            540633..544184
FT                   /gene="rpoB"
FT                   /locus_tag="SAAV_0505"
FT   CDS_pept        540633..544184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SAAV_0505"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10428"
FT                   /protein_id="ACY10428.1"
FT                   /translation="MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGL
FT                   IEMFRDISPIEDFTGNLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETG
FT                   EVKEQEVFMGDFPLMTDTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATII
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLE
FT                   KDGTENTEQALLEIYERLRPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHL
FT                   KHRLFNQKLAEPIVNTETGEIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDE
FT                   PVEIQSIKVYVPNDDEGRTTTVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIK
FT                   EFFGSSQLSQFMDQANPLAELTHKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSYARVNEFGFIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQA
FT                   NSKLDENGRFMDDEVVCRFRGNNTVMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPEAPFVGTGMEHVAARDSGAAITAKHRGRVEHVESNEILVRRL
FT                   VEENGVEHEGELDRYPLAKFKRSNSGTCYNQRPIVAVGDVVEYNEILADGPSMELGEMA
FT                   LGRNVVVGFMTWDGYNYEDAVIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVSESALKNLDDRGIVYIGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGAGGIVLDVKVFNREEGDDTLSPGVNQLVRVYIVQKRKIHVGDKMCGRHG
FT                   NKGVISKIVPEEDMPYLPDGRPIDIMLNPLGVPSRMNIGQVLELHLGMAAKNLGIHVAS
FT                   PVFDGANDDDVWSTIEEAGMARDGKTVLYDGRTGEPFDNRISVGVMYMLKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRV
FT                   KTYEAIVKGENISRPSVPESFRVLMKELQSLGLDVKVMDEQDNEIEMTDVDDDDVVEHK
FT                   VDLQQNDAPETQKEVTD"
FT   gene            544321..547944
FT                   /gene="rpoC"
FT                   /locus_tag="SAAV_0506"
FT   CDS_pept        544321..547944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SAAV_0506"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10429"
FT                   /protein_id="ACY10429.1"
FT                   /translation="MIDVNNFHYMKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEKKTLLSEAEFRDYYDKYP
FT                   GQFVAKMGAEGIKDLLEEIDLDEELKLLRDELESATGQRLTRAIKRLEVVESFRNSGNK
FT                   PSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQREIATNIKNAKSKIERMDDEVWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVH
FT                   VPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFN
FT                   NTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFA
FT                   YINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRF
FT                   SITDTSMMLDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRG
FT                   LITEEERYNAVVEIWTDAKDQIQGELMQSLDKTNPIFMMSDSGARGNASNFTQLAGMRG
FT                   LMAAPSGKIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVA
FT                   QDVIVREEDCGTDRGLLVSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDEL
FT                   ITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQS
FT                   IGEPGTQLTMRTFHTGGVAGSDITQGLPRIQEIFEARNPKGQAVITEIEGVVEDIKLAK
FT                   DRQQEIVVKGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATE
FT                   SYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDAN
FT                   REAFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLK
FT                   ENVIIGKLIPAGTGMRRYSDVKYEKTAKPVAEVESQTEVTE"
FT   gene            548081..548335
FT                   /locus_tag="SAAV_0507"
FT   CDS_pept        548081..548335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0507"
FT                   /product="putative ribosomal protein L7Ae-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10430"
FT                   /protein_id="ACY10430.1"
FT                   /translation="MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMT
FT                   RVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK"
FT   gene            548433..548846
FT                   /gene="rpsL"
FT                   /locus_tag="SAAV_0508"
FT   CDS_pept        548433..548846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SAAV_0508"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10431"
FT                   /protein_id="ACY10431.1"
FT                   /translation="MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLP
FT                   GVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN"
FT   gene            548912..549382
FT                   /gene="rpsG"
FT                   /locus_tag="SAAV_0509"
FT   CDS_pept        548912..549382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SAAV_0509"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10432"
FT                   /protein_id="ACY10432.1"
FT                   /translation="MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYS
FT                   AFDLVEQRSGRDALEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW"
FT   gene            549505..551586
FT                   /gene="fusA"
FT                   /locus_tag="SAAV_0510"
FT   CDS_pept        549505..551586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SAAV_0510"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10433"
FT                   /protein_id="ACY10433.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQDRGITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQ
FT                   LPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETS
FT                   DELMEKYLGDEEISVSELKEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSP
FT                   LDVKPIIGHRASNPEEEVIAKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSY
FT                   VKNSTKGKRERVGRLLQMHANSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILE
FT                   SMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHL
FT                   DILVDRMKKEFNVECNVGAPMVSYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNE
FT                   TGAGFEFENAIVGGVVPREYIPSVEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDS
FT                   SEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEP
FT                   RGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE"
FT   gene            551803..552987
FT                   /gene="tuf"
FT                   /locus_tag="SAAV_0511"
FT   CDS_pept        551803..552987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="SAAV_0511"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10434"
FT                   /protein_id="ACY10434.1"
FT                   /translation="MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDSVAQ
FT                   SYDMIDNAPEEKERGITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDDVPVIAGSALKALEGDAQYEEKILELMEAVDTYIPTPERDSDKPFMMPVEDVFSIT
FT                   GRGTVATGRVERGQIKVGEEVEIIGLHDTSKTTVTGVEMFRKLLDYAEAGDNIGALLRG
FT                   VAREDVQRGQVLAAPGSITPHTEFKAEVYVLSKDEGGRHTPFFSNYRPQFYFRTTDVTG
FT                   VVHLPEGTEMVMPGDNVEMTVELIAPIAIEDGTRFSIREGGRTVGSGVVTEIIK"
FT   gene            complement(553269..554444)
FT                   /locus_tag="SAAV_0512"
FT   CDS_pept        complement(553269..554444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0512"
FT                   /product="thermostable carboxypeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10435"
FT                   /protein_id="ACY10435.1"
FT                   /translation="MLDWFQLANNKENKTIQLRRYLHQYPELSFEEFQTHDYIVNQLSQ
FT                   LSCDIETPIGRNGIKATFKGLGTGPTIALRADFDALPVEELNDVPYKSKNPGCMHACGH
FT                   DGHTAILLTVAEILDEHKHLLEGNVVLIFQYGEEIMPGGSQEMIDAGCLENVDRIYGTH
FT                   LWSGYPTGTIHSRAGAIMASPDEFSVTIKGRGGHGAKPHETIDPIVIMAEFILSAQKII
FT                   SRTIDPVKQAVLSFGMIQAGTTDSVIPDQAFCKGTVRTFDSDIQNHVMDKMDKLLQGLA
FT                   IANDINYDLNYIKGYLPVHNNEKAYQVIKEATNDLHVRFNESDLMMIGEDFSHYLKVRP
FT                   GAFFLTGCGNESKGITAPHHNPKFDIDEKSLKYAVAVFLKIIELEQVFKTN"
FT   gene            554615..555802
FT                   /locus_tag="SAAV_0513"
FT   CDS_pept        554615..555802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0513"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10436"
FT                   /protein_id="ACY10436.1"
FT                   /translation="MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYIN
FT                   LSSNNYLGLATNEDLKSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAA
FT                   IAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAK
FT                   AKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGA
FT                   GTVKHFGLQDKIDFQIGTLSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTK
FT                   AITEAVKKLMDSTELHDKLWDNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFS
FT                   KRLKDEGVYVKSIVFPTVPRGTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI"
FT   gene            556072..556950
FT                   /locus_tag="SAAV_0514"
FT   CDS_pept        556072..556950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0514"
FT                   /product="chaperone protein HchA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10437"
FT                   /protein_id="ACY10437.1"
FT                   /translation="MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHK
FT                   GAYKDGKWKVLMIAAEERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGY
FT                   PVKLELWAMPTEDEAVISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAV
FT                   VGISESEDVQQTLDWALDNDRFIVTLCHGPAALLSAGLNREKSPLEGYSVCVFPDSLDE
FT                   GANIEIGYLPGRLKWLVADLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLA
FT                   VNEMLNAIQNK"
FT   gene            557109..558746
FT                   /locus_tag="SAAV_0515"
FT   CDS_pept        557109..558746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0515"
FT                   /product="ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10438"
FT                   /protein_id="ACY10438.1"
FT                   /translation="MSYSIGIDYGTASGRVFLINTTNGQVVSKFVKPYTHGVIESELNG
FT                   LKIPHTYALQNSNDYLEIMEEGISYIVRESKIDPVNIVGIGIDFTSSTIIFTDENLNPV
FT                   HNLKQFKNNPHAYVKLWKHHGAYKEAEKLYQTAIENNNKWLGHYGYNVSSEWMIPKIME
FT                   VMNRAPEIMEKTAYIMEAGDWIVNKLTNKNVRSNCGLGFKAFWEEETGFHYDLFDKIDP
FT                   KLSKVIQDKVSAPVVNIGEVVGKLDDKMAQKLGLSKETMVSPFIIDAHASLLGIGSEKD
FT                   KEMTMVMGTSTCHLMLNEKQHQVPGISGSVKGAIIPELFAYEAGQSAVGDLFEYVAKQA
FT                   PKSYVDEAANRNMTVFELMNEKIKHQMPGESGLIALDWHNGNRSVLSDSNLTGCIFGLT
FT                   LQTKHEDIYRAYLEATAFGTKMIMQQYQDWHMEVEKVFACGGIPKKNAVMMDIYANVLN
FT                   KKLIVMDSEYAPAIGAAILGAVSGGAHNSINDAVDAMKEPILYEINPEAEKVQRYETLF
FT                   KAYKALHDIHGYKKANIMKDIQSLRVEG"
FT   gene            558960..559925
FT                   /locus_tag="SAAV_0516"
FT   CDS_pept        558960..559925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10439"
FT                   /protein_id="ACY10439.1"
FT                   /translation="MKKIMITGALGQIGTELVVKCREIYGTDNVLATDIREPEADSPVQ
FT                   NGPFEILDVTDRDRMFELVRDFEADSLMHMAALLSATAEKNPILAWDLNMGGLMNALEA
FT                   ARTYNLHFFTPSSIGAFGDSTPKVNTPQVTIQQPTTMYGVNKVAGELLCQYYFKRFGVD
FT                   TRSVRFPGLISHVKEPGGGTTDYAVEIYFKAVREGHYTSFIDKGTYMDMMYMDDAIEAI
FT                   IKLMEADDAKLETRNGYNLSAMSFDPEMVKEAIQEYYPNFTLDYDVDPIRQGIANSWPD
FT                   SIDTSCSRGEWGFDPKYDLASMTKLMLEAIEQKDTVKNNN"
FT   gene            560261..561337
FT                   /gene="ilvE"
FT                   /locus_tag="SAAV_0517"
FT   CDS_pept        560261..561337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="SAAV_0517"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10440"
FT                   /protein_id="ACY10440.1"
FT                   /translation="MSQAVKVERRETLKQKPNTSQLGFGKYFTDYMLSYDYDADKGWHD
FT                   LKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKRDGEVALFRPEENFKRLNNSLARLEMP
FT                   QVDEAELLEGLKQLVDIERDWIPEGEGQSLYIRPFVFATEGALGVGASHQYKLLIILSP
FT                   SGAYYGGETLKPTKIYVEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWL
FT                   DGVEQKYIEEVGSMNIFFVENGKVITPELNGSILPGITRKSIIELAKNLGYEVEERRVS
FT                   IDELFESYDKGELTEVFGSGTAAVISPVGTLRYEDREIVINNNETGEITQKLYDVYTGI
FT                   QNGTLEDKNGWRVVVPKY"
FT   gene            561587..562270
FT                   /locus_tag="SAAV_0518"
FT   CDS_pept        561587..562270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0518"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10441"
FT                   /protein_id="ACY10441.1"
FT                   /translation="MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQ
FT                   LGVIKESIDPKSVMGSGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGV
FT                   KEALIDLKAKGYQLGIVTSDTKKGVEQFLAHTNAISLFDLIISTEADAYEKPNPKVLSP
FT                   LFEQYNVDPQKVAIVGDTANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADI
FT                   LEALN"
FT   gene            complement(562386..563048)
FT                   /locus_tag="SAAV_0519"
FT   CDS_pept        complement(562386..563048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0519"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10442"
FT                   /protein_id="ACY10442.1"
FT                   /translation="MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHN
FT                   PYLDKFYSDFERWSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEE
FT                   GTMSKEDFKTYSDLFNAMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEY
FT                   WKKLFKRYDDWINSFNACPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR"
FT   gene            complement(563041..563658)
FT                   /locus_tag="SAAV_0520"
FT   CDS_pept        complement(563041..563658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0520"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10443"
FT                   /protein_id="ACY10443.1"
FT                   /translation="MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDF
FT                   YEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSPVEFQKFS
FT                   KIYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYES
FT                   LQSNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE"
FT   gene            563725..564195
FT                   /locus_tag="SAAV_0521"
FT   CDS_pept        563725..564195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0521"
FT                   /product="putative tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10444"
FT                   /protein_id="ACY10444.1"
FT                   /translation="MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRE
FT                   TLQQPTAHAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADD
FT                   PKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN"
FT   gene            564342..565211
FT                   /locus_tag="SAAV_0522"
FT   CDS_pept        564342..565211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0522"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10445"
FT                   /protein_id="ACY10445.1"
FT                   /translation="MIKLIATDMDGTLLNAAHEISQPNIDAIKYAQEQGITVVIATGRA
FT                   FYEAQAPVADTDLTVPYICLNGAEVRDETFNVMSTSHLNKSLVHKITNVLKDAGIYYQV
FT                   YTSRAIYTEDPQRDLDIYIDIAERAGQHANVERIKNGIQRRIDNGTLKVVDNYDAIENI
FT                   PGELIMKILAFDGNLEKIDKASKILAESPNLAISSSSRGNIEITHSDAQKGIALETIAE
FT                   RLGIEMKDVMAIGDNLNDLSMLEKVGYPVAMENGAEEVKKIAKYVTDTNENSGVGKAIM
FT                   KLLREQQV"
FT   gene            565233..565799
FT                   /locus_tag="SAAV_0523"
FT   CDS_pept        565233..565799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10446"
FT                   /protein_id="ACY10446.1"
FT                   /translation="MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLN
FT                   QLDFSGTTPSIDEIKQNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFK
FT                   MKPVGLIGNSGGIVSSEPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSE
FT                   FQLRARLFVDQIVSFVNNSPYEHLK"
FT   gene            566229..569168
FT                   /gene="sdrC"
FT                   /locus_tag="SAAV_0524"
FT   CDS_pept        566229..569168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdrC"
FT                   /locus_tag="SAAV_0524"
FT                   /product="sdrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10447"
FT                   /protein_id="ACY10447.1"
FT                   /translation="MNNKKTATNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSG
FT                   HEAKAAEHTNGELNQSKNETTAPSENKTTEKVDSRQLKDNTQTATADQPKVTMSDSATV
FT                   KETSSNMQSPQNATASQSTTQTSNVTTNDKSSTTYSNETDKSNLTQAKNVSTTPKTTTI
FT                   KQRALNRMAVNTVAAPQQGTNVNDKVHFTNIDIAIDKGHVNKTTGNTEFWATSSDVLKL
FT                   KANYTIDDSVKEGDTFTFKYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSKTNTTT
FT                   YTFTNYVDQYTNVSGSFEQVAFAKRENATTDKTAYKMEVTLGNDTYSKDVIVDYGNQKG
FT                   QQLISSTNYINNEDLSRNMTVYVNQPKKTYTKETFVTNLTGYKFNPDAKNFKIYEVTDQ
FT                   NQFVDSFTPDTSKLKDVTGQFDVIYSNDNKTATVDLLNGQSSSDKQYIIQQVAYPDNSS
FT                   TDNGKIDYTLETQNGKSSWSNSYSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANE
FT                   KGIKGVYVILKDSNGKELDRTTTDENGKYQFTGLSNGTYSVEFSTPAGYTPTTANAGTD
FT                   DAVDSDGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVK
FT                   VTLQNEKGEVIGTTETDENGKYRFDNLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGG
FT                   EVDVTITDHDDFTLDNGYYEEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPTKPMS
FT                   TVKDQHKTAKALPETGSENNNSNNGTLFGGLFAALGSLLLFGRRKKQNK"
FT   gene            569535..573692
FT                   /gene="sdrD"
FT                   /locus_tag="SAAV_0525"
FT   CDS_pept        569535..573692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdrD"
FT                   /locus_tag="SAAV_0525"
FT                   /product="sdrD protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10448"
FT                   /protein_id="ACY10448.1"
FT                   /translation="MLNRENKTAITRKGMVSNRLNKFSIRKYTVGTASILVGTTLIFGL
FT                   GNQEAKAAESTNKELNEATTSASDNQSSDKVDMQQLNQEDNTKNDNQKEMVSSQGNETT
FT                   SNGNKSIEKESVQSTTGNKVEVSTAKSDEQASPKSTNEDLNTKQTISNQEGLQPDLLEN
FT                   KSVVNVQPTNEENKKVDAKTESTTLNVKSDAIKSNAETLVDNNSNSNNENNADIILPKS
FT                   TAPKSLNTRMRMAAIQPNSTDSKNVNDLITSNTTLTVVDADNSKTIVPAQDYLSLKSQI
FT                   TVDDKVKSGDYFTIKYSDTVQVYGLNPEDIKNIGDIKDPNNGETIATAKHDTANNLITY
FT                   TFTDYVDRFNSVKMGINYSIYMDADTIPVDKKDVPFSVTIGNQITTTTADITYPAYKEA
FT                   DNNSIGSAFTETVSHVGNVEDPGYYNQVVYVNPMDKDLKGAKLKVEAYHPKYPTNIGQI
FT                   NQNVTNIKIYRVPEGYTLNKGYDVNTNDLVDVTDEFKNKMTYGSNQSVNLDFGDITSAY
FT                   VVMVNTKFQYTNSESPTLVQMATLSSTGNKSVSTGNALGFTNNQSGGAGQEVYKIGNYV
FT                   WEDTNKNGVQELGEKGVGNVTVTVFDNNTNTKVGEAVTKEDGSYLIPNLPNGDYRVEFS
FT                   NLPKGYEVTPSKQGNNEELDSNGLSSVITVNGKNNLSADLGIYKPKYNLGDYVWEDTNK
FT                   NGIQDQDEKGISGVTVTLKDENGNVLKTVTTDADGKYKFTDLDNGNYKVEFTTPEGYTP
FT                   TTVTSGSDIEKDSNGLTTTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKDGKQDST
FT                   EKGISGVTVTLKNENGEVLQTTKTDKDGKYQFTGLENGTYKVEFETPSGYTPTQVGSGT
FT                   DEGIDSNGTSTTGVIKDKDNDTIDSGFYKPTYNLGDYVWEDTNKNGVQDKDEKGISGVT
FT                   VTLKDENDKVLKTVTTDENGKYQFTDLNNGTYKVEFETPSGYTPTSVTSGNDTEKDSNG
FT                   LTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKDVKVILLNEK
FT                   GEVIGTTKTDENGKYRFDNLDSGKYKVIFEKPTGLTQTGTNTTEDDKDADGGEVDVTIT
FT                   DHDDFTLDNGYYEEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKGHHN
FT                   KAKALPETGNENSGSNNATLFGGLFAALGSLLLFGRRKKQNK"
FT   gene            574086..577511
FT                   /gene="sdrE"
FT                   /locus_tag="SAAV_0526"
FT   CDS_pept        574086..577511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdrE"
FT                   /locus_tag="SAAV_0526"
FT                   /product="sdrE protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10449"
FT                   /protein_id="ACY10449.1"
FT                   /translation="MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGL
FT                   GNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENDSTNPIKKETNTDSQPEA
FT                   KEESTTSSTQQQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNYTNN
FT                   DVTTKPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKN
FT                   NPEKLKELVRNDNNTDRSTKPVATAPTSVAPKRLNAKMRFAVAQPAAVASNNVNDLITV
FT                   TKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKND
FT                   PIDITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKARLTLYSYIDKQAVPNETSL
FT                   NLTFATAGKETSQNVSVDYQDPMVHGDSNIQSIFTKLDENKQTIEQQIYVNPLKKTATN
FT                   TKVDIAGSQVDDYGNIKLGNGSTIIDQNTEIKVYKVNPNQQLPQSNRIYDFSQYEDVTS
FT                   QFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNY
FT                   AGYSNFIVTSNDTGGGDGTVKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTL
FT                   TYPDGTTKSVRTDANGHYEFGGLKDGETYTVKFETPAGYLPTKVNGTTDGEKDSNGSSV
FT                   TVKINGKDDMSLDTGFYKEPKYNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKV
FT                   IGTTTTDASGKYKFTDLDNGNYTVEFETPAGYTPTVKNTTAEDKDSNGLTTTGVIKDAD
FT                   NMTLDSGFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKDVKVTLLNEKGEVIGTTKTDE
FT                   NGKYRFDNLDSGKYKVIFEKPAGLTQTVTNTTEDDKDADGGEVDVTITDHDDFTLDNGY
FT                   FEEDTSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPET
FT                   GSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK"
FT   gene            577632..579104
FT                   /locus_tag="SAAV_0527"
FT   CDS_pept        577632..579104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0527"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10450"
FT                   /protein_id="ACY10450.1"
FT                   /translation="MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYS
FT                   YTYAKQHQIENDVFTMYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYD
FT                   EEQFVMYAHFLDKQYHQLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENY
FT                   YTPNGEIVIQKYFDDIKGKNTLTKVILNEDQQQQFFDTEDELVQYFLHQLCKNNDQIIL
FT                   DRPHELGNVIAGLNQSIPVVVVLHSTHLSGTGNGIKSFYKTVFNNLTRYKAIVVSTEQQ
FT                   CQDISQYIENKIPVINIPVGYVANLKYQFDINQKEKNHIISIARLVENKQIKHQIEVIK
FT                   QLVTKHPNIQLNIYGHGNGLSEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTS
FT                   KMEGFGLAILESLSVGTPVISYDIDYGPSELIQDGFNGYLVPKGDINQMVEKVDQLLNN
FT                   TQKLQQFSINSIESAQQYNATTISTKWQNILN"
FT   gene            complement(579229..580719)
FT                   /locus_tag="SAAV_0528"
FT   CDS_pept        complement(579229..580719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0528"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10451"
FT                   /protein_id="ACY10451.1"
FT                   /translation="MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYL
FT                   YRNAQNYITSSDYINMYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYD
FT                   QERFLMYAHFQDPKYRILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFF
FT                   YNPEGDTKLEKYFSYKDGKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFS
FT                   DRNVYTAPIFNLTPESIPVVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVS
FT                   TEQQKLDVEKRINHTIPIVNIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQI
FT                   ELIKRLVSYVPKIELHMYGFGSESKKLNELIQKYGLENHVYLRGFLSNLNQEYSDAYLS
FT                   LITSNMEGFSLALLESLAHGVPVISYDIKYGPNELITPDFNGYLITKNDEDALFDKVKY
FT                   VIDHPEVQQRLSKGSLAKAQQYSKASLIKQWDQFVRLI"
FT   gene            complement(581001..581879)
FT                   /locus_tag="SAAV_0529"
FT   CDS_pept        complement(581001..581879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0529"
FT                   /product="putative GTP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10452"
FT                   /protein_id="ACY10452.1"
FT                   /translation="MTEFDLSTREGRWKHFGSVDPIEGTKPTTKNEMTDLQSTHKDFLF
FT                   EIEEVGIKNLVYPVLVDQYQTAGTFSFSTSLTKDEKGINMSRIIESVEKHYDNGIELEF
FT                   NTLYQVLRTLQTNMKQNAAGVDVSGKWFFDRYSPTTNIKAVGNADVTYGLAIDGDKVTR
FT                   KELTIEATVTTLCPCSKEISEYSAHNQRGVVTVKTYINKDQNIVDDYKNKILDAMEANA
FT                   SSILYPILKRPDEKRVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQ
FT                   HDAFAKLKYRK"
FT   gene            complement(581892..582557)
FT                   /locus_tag="SAAV_0530"
FT   CDS_pept        complement(581892..582557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10453"
FT                   /protein_id="ACY10453.1"
FT                   /translation="MTDERHVLVIFPHPDDETFSSAGTLASYIQKGIPVTYACLTLGQM
FT                   GRNLGNPPFATRESLPSIRERELEEACKVIGITDLRKMGLRDKTVEFEPYEHIDGMIKS
FT                   LIDDTNPSLIISFYPGYAVHPDHEATADAVIRTVERMPKEERPRLTLVAFSNDATEALG
FT                   EPDIQNDITDFKELKIKAFEAHASQTGPFLKQLASPEIDGKQHSFLTVEPYWTYHFKS"
FT   gene            complement(582571..582933)
FT                   /locus_tag="SAAV_0531"
FT   CDS_pept        complement(582571..582933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10454"
FT                   /protein_id="ACY10454.1"
FT                   /translation="MLEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAG
FT                   TFLRNIQVTYTHAQLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYE
FT                   GQLAAALQISERPFNL"
FT   gene            583209..583967
FT                   /gene="nagB"
FT                   /locus_tag="SAAV_0532"
FT   CDS_pept        583209..583967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="SAAV_0532"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10455"
FT                   /protein_id="ACY10455.1"
FT                   /translation="MKVLNLGSKKQASFYVACELYKEMAFNQHCKLGLATGGTMTDLYE
FT                   QLVKLLNKNQLNVDNVSTFNLDEYVGLTASHPQSYHYYMDDMLFKQYPYFNRKNIHIPN
FT                   GDADDMNAEASKYNDVLEQQGQRDIQILGIGENGHIGFNEPGTPFDSVTHIVDLTESTI
FT                   KANSRYFKNEDDVPKQAISMGLANILQAKRIILLAFGEKKRAAITHLLNQEISVDVPAT
FT                   LLHKHPNVEIYLDDEACPKNVAKIHVDEMD"
FT   gene            584044..584676
FT                   /gene="hxlA"
FT                   /locus_tag="SAAV_0533"
FT   CDS_pept        584044..584676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlA"
FT                   /locus_tag="SAAV_0533"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10456"
FT                   /protein_id="ACY10456.1"
FT                   /translation="MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVK
FT                   HMAGNISNVKVLADMKIMDAADYEVSQAIKFGADVITILGVAEDASIKAAIEEAHKNNK
FT                   QLLVDMIAVQDLEKRAKELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKNSKVA
FT                   VAGGIKPDTIKDIVAESPDLVIVGGGIANADDPVEAAKQCRAAIEGK"
FT   gene            584678..585226
FT                   /locus_tag="SAAV_0534"
FT   CDS_pept        584678..585226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0534"
FT                   /product="SIS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10457"
FT                   /protein_id="ACY10457.1"
FT                   /translation="MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKG
FT                   RSGFVANSFAMRLNQLGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSV
FT                   GADIVLITTNKDSAIGNLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGL
FT                   MTEMNVTEQTMQQNHANLE"
FT   gene            585339..585986
FT                   /locus_tag="SAAV_0535"
FT   CDS_pept        585339..585986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0535"
FT                   /product="putative hydrolase, haloacid dehalogenase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10458"
FT                   /protein_id="ACY10458.1"
FT                   /translation="MKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHY
FT                   MGIPIEESFLKLADRPLDEAALAKLTDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGK
FT                   KLFVVSSKKSDVLERNLSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQT
FT                   VYIGDSTFDVEMAQHAGVPSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL"
FT   gene            586488..587888
FT                   /gene="proP"
FT                   /locus_tag="SAAV_0536"
FT   CDS_pept        586488..587888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="SAAV_0536"
FT                   /product="osmoprotectant proline transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10459"
FT                   /protein_id="ACY10459.1"
FT                   /translation="MDFNKENINMVDAKKAKKTVVATGIGNAMEWFDFGVYAYTTAYIG
FT                   ANFFSPVENADIRQMLTFAALAIAFLLRPIGGVVFGIIGDKYGRKVVLTSTIILMAFST
FT                   LTIGLLPSYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSLGSGLE
FT                   IGTLSGYIAASIMIAVLTFFLTDEQMASFGWRIPFLLGLFLGLFGLYLRRKLEESPVFE
FT                   NDVATQPERDNINFLQIIRFYYKDIFVCFVAVVFFNVTNYMVTAYLPTYLEQVIKLDAT
FT                   TTSVLITCVMAIMIPLALMFGKLADKIGEKKVFLIGTGGLTLFSIIAFMLLHSQSFVVI
FT                   VIGIFILGFFLSTYEATMPGSLPTMFYSHIRYRTLSVTFNISVSIFGGTTPLVATWLVT
FT                   KTGDPLAPAYYLTAISVIGFLVITFLHLSTAGKSLKGSYPNVDNEQDRAYYAEHPKEAL
FT                   WWVKERKN"
FT   gene            588432..589808
FT                   /locus_tag="SAAV_0537"
FT   CDS_pept        588432..589808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0537"
FT                   /product="substrate--CoA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10460"
FT                   /protein_id="ACY10460.1"
FT                   /translation="MNVILEQLKTHTQNKPNDIALHIDDETITYSQLNARITSAVESLQ
FT                   KYSLNPVVAINMKSPVQSIICYLALHRLHKVPMMMEGKWQSTIHRQLIEKYGIKDVIGD
FT                   TGLMQNIDSPMFIDSTQLQHYPNLLHIGFTSGTTGLPKAYYRDEDSWLASFEVNEMLML
FT                   KNENAIAAPGPLSHSLTLYALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLV
FT                   PTMIKSLLLVYNNEHTIQSFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYN
FT                   LNQQAPVESVGVLFPNVELKTTNHDHNGIGTICIKSNMMFSGYVSEQCINNDEWFVTND
FT                   NGYVKEQYLYLTGRQQDMLIIGGQNIYPAHVERLLTQSSSIDEAIIIGIPNERFGQIGV
FT                   LLYSGDVTLTHKNVKQFLKKKVKRYEIPSMIHHVEKMYYTASGKIAREKMMSMYLRGEL
FT                   "
FT   gene            589810..590949
FT                   /gene="atoB"
FT                   /locus_tag="SAAV_0538"
FT   CDS_pept        589810..590949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoB"
FT                   /locus_tag="SAAV_0538"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10461"
FT                   /protein_id="ACY10461.1"
FT                   /translation="MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVI
FT                   SKIDDVVLGNVVGNGGNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGA
FT                   GKVYIAGGVESTSRAPWKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMY
FT                   DVSRELQDEFAYRSHQLTAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRF
FT                   KPVIKGGTVTAANSCMKNDGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIG
FT                   PVPAISNLLKRNQLTIENIEVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPY
FT                   GASGAQLVTRLFYMFDKETMIASMGIGGGLGNAALFTRF"
FT   gene            590924..591289
FT                   /locus_tag="SAAV_0539"
FT   CDS_pept        590924..591289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10462"
FT                   /protein_id="ACY10462.1"
FT                   /translation="MQHYLLDSNQRLNVSFSKDSVAAYYQCFNQPYRKEVPPLMCASLW
FT                   PKFDLFKKYANSELILTKSAINQTQKIEVDTIYVGHLEDIECRQTRNITRYTMALTLTK
FT                   NDQHVITVTQTFIKAMK"
FT   gene            591292..591561
FT                   /locus_tag="SAAV_0540"
FT   CDS_pept        591292..591561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10463"
FT                   /protein_id="ACY10463.1"
FT                   /translation="MKFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQ
FT                   CQINYVKPILINENIEFIEQHEHEIIAINDDGEIKIKISLSTKK"
FT   gene            complement(591762..591929)
FT                   /locus_tag="SAAV_0541"
FT   CDS_pept        complement(591762..591929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10464"
FT                   /protein_id="ACY10464.1"
FT                   /translation="MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLL
FT                   QDDIDHMKVS"
FT   gene            complement(592436..593266)
FT                   /gene="thiD1"
FT                   /locus_tag="SAAV_0542"
FT   CDS_pept        complement(592436..593266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD1"
FT                   /locus_tag="SAAV_0542"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10465"
FT                   /protein_id="ACY10465.1"
FT                   /translation="MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMD
FT                   KDTWSHDVTPLPMDVFEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVV
FT                   DPVMVCKGEDEVLNPGNTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAAT
FT                   IIFDKGAQHVIIKGGKALDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTA
FT                   YLANGKSPKEAVISAKAFVASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV"
FT   gene            593450..594106
FT                   /gene="ung"
FT                   /locus_tag="SAAV_0543"
FT   CDS_pept        593450..594106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="SAAV_0543"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10466"
FT                   /protein_id="ACY10466.1"
FT                   /translation="MEWSQIFHDITTKHDFKAMHDFLEKEYSTAIVYPDRENIYQAFDL
FT                   TPFENIKVVILGQDPYHGPNQAHGLAFSVQPNAKFPPSLRNMYKELADDIGCVRQTPHL
FT                   QDWAREGVLLLNTVLTVRQGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQ
FT                   KIKLIDTSKHCIIKSVHPSPLSAYRGFFGSKPYSKANAYLESVGKSPINWCESEA"
FT   gene            594107..594487
FT                   /locus_tag="SAAV_0544"
FT   CDS_pept        594107..594487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10467"
FT                   /protein_id="ACY10467.1"
FT                   /translation="MVNRETLIARIEQELVQAEQAQHDHDFEKHMYAIHILTSLYASTS
FT                   NTPHIGEQQMNRRIANHNQMPQSQITQPTHQVTAAEIEAMGGKVNTHSAHHHNKSYSQP
FT                   SNQQQRLATDDDIGNGESIFDF"
FT   gene            594620..594988
FT                   /locus_tag="SAAV_0545"
FT   CDS_pept        594620..594988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10468"
FT                   /protein_id="ACY10468.1"
FT                   /translation="MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQ
FT                   MYHGLALLIIGVISGTTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGV
FT                   LFIIGWIMLIIATFKFAG"
FT   gene            595109..596593
FT                   /locus_tag="SAAV_0546"
FT   CDS_pept        595109..596593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0546"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10469"
FT                   /protein_id="ACY10469.1"
FT                   /translation="MEKKNKQIDRGDLKQNLSEKFVWAIAYGSCIGWGAFILPGDWIKQ
FT                   SGPIAASIGIVIGALLMILIAVSYGALVERFPVSGGAFAFSFLSFGRYVSFFSSWFLTF
FT                   GYVCVVALNATAFSLLVKFLLPDVLNNGKLYTIAGWDVYITEIIIATVLLLVFMLVTIR
FT                   GASVSGSLQYYFCVAMVIVVLLMFFGSFFGNNFALENLQPLAEPSKGWLVSIVVIVSVA
FT                   PWAYVGFDNIPQTAEEFNFAPNKTFKLIVYSLLAASLTYVVMILYTGWLSTSHQSLNGQ
FT                   LWLTGAVTQTAFGYIGLGVLAIAIMMGIFTGLNGFLMSSSRLLFSMGRSGIMPTMFSKL
FT                   HSKYKTPYVAIIFLVGVSLIAPWLGRTALTWIVDMSSTGVSIAYFITCLSAAKLFSYNK
FT                   QSNTYAPVYKTFAIIGSFVSFIFLALLLVPGSPAALTAPSYIALLGWLIIGLIFFVIRY
FT                   PKLKNMDNDELSRLILNRSENEVDDMIEEPEKEKTK"
FT   gene            complement(596734..597186)
FT                   /locus_tag="SAAV_0547"
FT   CDS_pept        complement(596734..597186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10470"
FT                   /protein_id="ACY10470.1"
FT                   /translation="MFWILNFIFSFLASMFFCVIFDAPRKLYLSCGFVGTCGWMVYTLF
FT                   FNGFNVHTIYSSFFGSLALGLLSHYMARKQKEPAIIFMVTGIIPLVPGGLAYDATKNLV
FT                   LLNFSTAINTMLEVTLIAGAIALGLLFADQISKLIVSGFVKSFKRL"
FT   gene            complement(597199..597963)
FT                   /locus_tag="SAAV_0548"
FT   CDS_pept        complement(597199..597963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10471"
FT                   /protein_id="ACY10471.1"
FT                   /translation="MDINSEEYKQEVLIKDVVMLAARILLESGAEGTRVEDTMTRIAKK
FT                   LGYSESNSFVTNTVIQFTLHSESFPRIFRITSRDTNLIKISQANKISRQITNNEISLAE
FT                   AKTQLEKIYVAKRDSSLPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEIL
FT                   DRKLHAQFIPEFIGSLVIGIIAVIGHTLIPTGDLATIIIAAVMPIVPGVLITNAIQDLF
FT                   GGHMLMFTTKSLEALVTAFGIGAGVGSVLILV"
FT   gene            complement(598512..599264)
FT                   /locus_tag="SAAV_0549"
FT   CDS_pept        complement(598512..599264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0549"
FT                   /product="putative heme peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10472"
FT                   /protein_id="ACY10472.1"
FT                   /translation="MSQAAETLDGWYSLHLFYAVDWASLRIVPKDERDALVTEFQSFLE
FT                   NTATVRSSKSGDQAIYNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSY
FT                   VSVIELSNYLAGKSDEDPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTME
FT                   ERQKLMYDHGMIGRKYAGKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDET
FT                   TARYGEFGSFFVGHLINTNEFDQFFAIS"
FT   gene            599432..600418
FT                   /gene="eutD"
FT                   /locus_tag="SAAV_0550"
FT   CDS_pept        599432..600418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutD"
FT                   /locus_tag="SAAV_0550"
FT                   /product="phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10473"
FT                   /protein_id="ACY10473.1"
FT                   /translation="MADLLNVLKDKLSGKNVKIVLPEGEDERVLTAATQLQATDYVTPI
FT                   VLGDETKVQSLAQKLDLDISNIELINPATSELKAELVQSFVERRKGKATEEQAQELLNN
FT                   VNYFGTMLVYAGKADGLVSGAAHSTGDTVRPALQIIKTKPGVSRTSGIFFMIKGDEQYI
FT                   FGDCAINPELDSQGLAEIAVESAKSALSFGMDPKVAMLSFSTKGSAKSDDVTKVQEAVK
FT                   LAQQKAEEEKLEAIIDGEFQFDAAIVPGVAEKKAPGAKLQGDANVFVFPSLEAGNIGYK
FT                   IAQRLGGYDAVGPVLQGLNSPVNDLSRGCSIEDVYNLSIITAAQALQ"
FT   gene            600421..601257
FT                   /locus_tag="SAAV_0551"
FT   CDS_pept        600421..601257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0551"
FT                   /product="lipoate-protein ligase A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10474"
FT                   /protein_id="ACY10474.1"
FT                   /translation="MDLASKYFNGVNWRYIDHSSGLEPMQSFAFDDTFCESVGKDISDN
FT                   VVRTWIHQHTVILGIHDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISL
FT                   MFKGQTETTIDEAFTVMYLLISKMFEDENVDIDTMEIEHSYCPGKFDLSIDGKKFAGIS
FT                   QRRVRGGIAVQIYLCVEGSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLL
FT                   NKTITVQDVMFLLLYAIKDLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ"
FT   gene            601844..602764
FT                   /gene="mvk"
FT                   /locus_tag="SAAV_0552"
FT   CDS_pept        601844..602764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="SAAV_0552"
FT                   /product="mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10475"
FT                   /protein_id="ACY10475.1"
FT                   /translation="MTRKGYGESTGKIILIGEHAVTFGEPAIAVPFNAGKIKVLIEALE
FT                   SGNYSSIKSDVYDGMLYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAA
FT                   VAVAFVRASYDFLGKSLTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAE
FT                   TLKTLSLDGYMVVIDTGVKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVLRASDVIEHH
FT                   NFEALADIFNECHADLKALTVSHDKIEQLMKIGKENGAIAGKLTGAGRGGSMLLLAKDL
FT                   PTAKNIVKAVEKAGAAHTWIENLGG"
FT   gene            602769..603752
FT                   /gene="mvaD"
FT                   /locus_tag="SAAV_0553"
FT   CDS_pept        602769..603752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SAAV_0553"
FT                   /product="mevalonate diphosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10476"
FT                   /protein_id="ACY10476.1"
FT                   /translation="MIKSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTET
FT                   KVTFNDQLTQDQFWLNGEKVSGKELEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGL
FT                   ASSASAYAALAAACNQALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSY
FT                   AVPLESNHFEDDLAMIFVVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKA
FT                   AIQDKDFKRLGEVIEENGLRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFT
FT                   MDAGPNVKILVEKKNKQQIIDKLLTQFDNNQIIDSDIIATGIEIIE"
FT   gene            603765..604841
FT                   /locus_tag="SAAV_0554"
FT   CDS_pept        603765..604841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0554"
FT                   /product="phosphomevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10477"
FT                   /protein_id="ACY10477.1"
FT                   /translation="MIQVKAPGKLYIAGEYAVTEPGYKSVLIALDRFVTATIEEADQYK
FT                   GTIHSKALHHNPVTFSRDEDSIVISDPHAAKQLNYVVTAIEIFEQYAKSCDIAMKHFHL
FT                   TIDSNLDDSNGHKYGLGSSAAVLVSVIKVLNEFYDMKLSNLYIYKLAVIANMKLQSLSS
FT                   CGDIAVSVYSGWLAYSTFDHEWVKHQIEDTTVEEVLIKNWPGLHIEPLQAPENMEVLIG
FT                   WTGSPASSPHFVSEVKRLKSDPSFYGDFLEDSHRCVEKLIHAFKTNNIKGVQKMVRQNR
FT                   TIIQRMDKEATVDIETEKLKYLCDIAEKYHGASKTSGAGGGDCGITIINKDVDKEKIYD
FT                   EWTKHGIKPLKFNIYHGQ"
FT   gene            605018..605359
FT                   /locus_tag="SAAV_0555"
FT   CDS_pept        605018..605359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10478"
FT                   /protein_id="ACY10478.1"
FT                   /translation="MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRR
FT                   KTFTFVNNRPLAALTEEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKE
FT                   KLEKRKAQQ"
FT   gene            complement(605411..606728)
FT                   /pseudo
FT                   /locus_tag="SAAV_0556"
FT                   /note="putative pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT   gene            complement(606715..607155)
FT                   /locus_tag="SAAV_0558"
FT   CDS_pept        complement(606715..607155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10479"
FT                   /protein_id="ACY10479.1"
FT                   /translation="MNLEFNIAVHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQ
FT                   LVDLKMIDTIRGKDGGYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARN
FT                   IATTMSHYQQDEQNIIINFYNEKTIKDVIEDIQKEDLCHENI"
FT   gene            607213..607314
FT                   /locus_tag="SAAV_0559"
FT   CDS_pept        607213..607314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10480"
FT                   /protein_id="ACY10480.1"
FT                   /translation="MCQYLCLKSVELGVVIVMIYCLKVDALTVRLHN"
FT   gene            607780..609174
FT                   /locus_tag="SAAV_0560"
FT   CDS_pept        607780..609174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10481"
FT                   /protein_id="ACY10481.1"
FT                   /translation="MSIDMYLDRSRNQASSVGNLSQTMNSNYDALEKAITQFINDDALK
FT                   GKAYTSAKQFFSTVLIPLSTSMKTLSDLTKQACDNFVSRYTSEVDSISLKESELEEDIR
FT                   SLSQQITRYENLTNNLKKHASDNQQAISSNQQIIQTLGQQKHELEEKLRKLREFNQKSP
FT                   EIFKEVEEFQKIVQQGLTQAQNFWNFSTNQFNIPSGKELDWAKASHEKYLKVAMGKIEH
FT                   KAEKETLNKADFAVIKAYAKEHPEDDIPKSIMKYINDNKDSIKRDIGLDITSTLLEQGG
FT                   INASKFGVFINTAGGVKGPAGPNSFVEVKRTSGNVFIENGSKFAKGGKYLGKGVAGVGF
FT                   GIGMYDDLANDNKTFGEALSHNGMTLAAGSVAAFGVAALVSNPVGWAVVGILTAGIIGS
FT                   TVSDYLYQNNYFGIKDKVDWAGHKIDEGIDAVNKTAEKAVDSVGNAIGDATKSISNHIN
FT                   PMKWSW"
FT   gene            609178..609810
FT                   /locus_tag="SAAV_0561"
FT   CDS_pept        609178..609810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10482"
FT                   /protein_id="ACY10482.1"
FT                   /translation="MLCESKVINKNPKYRIIKYESEYLMIDLASNWIVFFFPFINWLIP
FT                   KTYVKITKNDYEKLNIVKPVKNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEKLIVWSS
FT                   CFIGFLGVIFFYCYLNKKLTLNVYKENKNNELKLRLLPSFKNMCFTIFYYLFTGFMSYG
FT                   AFYLLVFENVQNLILYISWLFMTMLFMLMNMHSIIDKKVHIFLKSNK"
FT   gene            609929..610477
FT                   /locus_tag="SAAV_0562"
FT   CDS_pept        609929..610477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10483"
FT                   /protein_id="ACY10483.1"
FT                   /translation="MIDIISTWISLFFPFINWFIPKRYVKISREEFENLNIVKPAKKNV
FT                   FWPVASISTLFAVTLRKYTLLLDTQLDKKLVIAICCTTFIGILIFYVRLIKKSSLNIYN
FT                   TKNKRSKIILIPTLKNFCFTLFGYVFLIFWTVIFSYALLSMSYQNIIVYFAWITAIIGF
FT                   FLVNIALIIDKNIHVILKN"
FT   gene            610617..611249
FT                   /locus_tag="SAAV_0563"
FT   CDS_pept        610617..611249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0563"
FT                   /product="staphylococcus paralogous family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10484"
FT                   /protein_id="ACY10484.1"
FT                   /translation="MVCEVIAIYKNPKYRIIKYNDEYLMVNIINNWLVLFIPLLNWLTP
FT                   KRYIKISQEELESLNTFKPAKNNAFWPALGSSVLFSVTFRKYMPLFNVRLEKTIVIAIF
FT                   FVVFLGILFFYLNLNRRLALSVFTMNKEKSQKMILLPNLKHFFFIIFAYLYFGGFSFFT
FT                   LYALITIDVQNIIIFICWGAVTMFFFFINIVPIGIKKAHVILLKKAE"
FT   gene            611697..612635
FT                   /locus_tag="SAAV_0564"
FT   CDS_pept        611697..612635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0564"
FT                   /product="aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10485"
FT                   /protein_id="ACY10485.1"
FT                   /translation="MKQFVNLGKSDVEVFPIALGTNAVGGHNLYPNLDEEQGKDVVRQA
FT                   INHGINLLDTAYIYGPERSEELVGEVVKEYPREQIKIATKGSHEFDENQEVHQNNQPEY
FT                   LKQQVENSLKRLQTDYIDLYYIHFPDDNTPKDQAVAALQELKEQGKIKAIGVSNFTLDQ
FT                   LKEANKDGYVDVVQLEYNLLHRENEAVLQYCVDHLITFIPYFPLASGILAGKYDENTKF
FT                   SDHRTTRRDFIPGVFEENVRRVKALESLAAAHQTSIANIVLAFYLTRPAIDVIIPGAKR
FT                   AEQVIENIKAADIVLSDDEIQYIDELFPIED"
FT   gene            613081..613617
FT                   /locus_tag="SAAV_0565"
FT   CDS_pept        613081..613617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10486"
FT                   /protein_id="ACY10486.1"
FT                   /translation="MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVR
FT                   HTAETITSYDDDYLPILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPN
FT                   FKAQMAEKDFRVILVGGDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKD
FT                   NYALARATEWNSILQ"
FT   gene            613785..614261
FT                   /locus_tag="SAAV_0566"
FT   CDS_pept        613785..614261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10487"
FT                   /protein_id="ACY10487.1"
FT                   /translation="MFKVRQATEKDVVQIRDVATKAWFNTYLNIYAATTVNHLLEASYN
FT                   EHHLKKRLQEQLFLVVEEGNDIVGFANFIYGEELYLSAHYVKPESQHTGYGTALLNEGL
FT                   SRFEDKFEGVYLEVDNKNEEAVAYYKEQGFTILRSYQPEMYGEKLDLALMYKAF"
FT   gene            614301..615596
FT                   /locus_tag="SAAV_0567"
FT   CDS_pept        614301..615596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0567"
FT                   /product="HD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10488"
FT                   /protein_id="ACY10488.1"
FT                   /translation="MTNAYVDLKLVEEKVFKDPIHRYIHVEDQLIWDLIKTKEFQRLRR
FT                   IRQLGTLYLSFHTAEHSRFGHSLGVYEIVRRLIDESFIGHDAWDNKDRPLALCAALLHD
FT                   LGHGPFSHSFEKIFNTDHEAYTQAIITGDTEVNAVLRKVSPEFPREVAEVINKTHHNKL
FT                   VISMISSQIDADRMDYLQRDAYFTGVSYGAFDMERILRLMRPSKDEVLIKESGMHAVEN
FT                   FIMSRYQMYWQIYFHPVSRGGEVLLNNCLKRAKQLYNEGYEFKLHPHDFIPFFEETVTI
FT                   EQYVELDEAVVTYYLEKWTKEDDAILSDLASRFINRDLFKYIPFDGSIITISELQELFE
FT                   AGGINPDYYFVSEAFSDLPYDYDRPGSNRKPIHLLRQDGTIREISNQSLVIHSITGINR
FT                   QDYKLYYPREMVAKIKDKTIREAIENLINELN"
FT   gene            615639..616145
FT                   /locus_tag="SAAV_0568"
FT   CDS_pept        615639..616145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10489"
FT                   /protein_id="ACY10489.1"
FT                   /translation="MSEKKGFNFNIIKNDPLDGHKGTNIGSISLDNIAPVFIDVANKEA
FT                   FIDIGGMHARAKVEKGVKWITDKAAVEGDEAKEYWLCWVTTERNEQGPYYAGLTACYLL
FT                   VNKAIRRGYKSMPEHVNMMDKSMKHHIIIDQIGDENKAILKDFLMNHDEGMWKLSSDAL
FT                   HQAFN"
FT   gene            616644..617654
FT                   /gene="adhP"
FT                   /locus_tag="SAAV_0569"
FT   CDS_pept        616644..617654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="SAAV_0569"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10490"
FT                   /protein_id="ACY10490.1"
FT                   /translation="MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKN
FT                   ADFGDVTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCR
FT                   SVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQ
FT                   WLGVFGIGGLGNLALQYAKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEV
FT                   MKLTDNKGLDATVVTSVAKTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEV
FT                   VGSLVGTRQDLREAFEFAAENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF"
FT   gene            617930..618346
FT                   /locus_tag="SAAV_0570"
FT   CDS_pept        617930..618346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10491"
FT                   /protein_id="ACY10491.1"
FT                   /translation="MDKKVSIQTKQVLKQHNEKEKFEFTTEGTWQQRQSNFIRYVEQIE
FT                   DATVNVTIKVDDDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLEVKTLRILHFV
FT                   SGDGGKLKIHYELYQDNEKMGSYQYEINYKEIGE"
FT   gene            618343..620004
FT                   /gene="argS"
FT                   /locus_tag="SAAV_0571"
FT   CDS_pept        618343..620004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="SAAV_0571"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10492"
FT                   /protein_id="ACY10492.1"
FT                   /translation="MNIIDQVKQTLVEEIAASINKAGLADEIPDIKIEVPKDTKNGDYA
FT                   TNIAMVLTKIAKRNPREIAQAIVDNLDTEKAHVKQIDIAGPGFINFYLDNQYLTAIIPE
FT                   AIEKGDQFGHVNESKGQNVLLEYVSANPTGDLHIGHARNAAVGDALANILTAAGYNVTR
FT                   EYYINDAGNQITNLARSIETRFFEALGDNSYSMPEDGYNGKDIIEIGKDLAEKHPEIKD
FT                   YSEEARLKEFRKLGVEYEMAKLKNDLAEFNTHFDNWFSETSLYEKGEILEVLAKMKELG
FT                   YTYEADGATWLRTTDFKDDKDRVLIKNDGTYTYFLPDIAYHFDKVKRGNDILIDLFGAD
FT                   HHGYINRLKASLETFGVDSNRLEIQIMQMVRLMENGKEVKMSKRTGNAITLREIMDEVG
FT                   VDAARYFLTMRSPDSHFDFDMELAKEQSQDNPVYYAQYAHARICSILKQAKEQGIEVTA
FT                   ANDFTTITNEKAIELLKKVADFEPTIESAAEHRSAHRITNYIQDLAAHFHKFYNAEKVL
FT                   TDDIEKTKAHVAMIEAVRITLKNALAMVGVSAPESM"
FT   gene            620274..620909
FT                   /locus_tag="SAAV_0572"
FT   CDS_pept        620274..620909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0572"
FT                   /product="endonuclease III, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10493"
FT                   /protein_id="ACY10493.1"
FT                   /translation="MLGTDELYKLLYRHMGPQNWWPADNDIELMLGAILVQNTRWRNAE
FT                   IALNQIKEHTHFNPNHILELPIETLQSLIHSSGFYKSKTLTIKTLLTWLARHHFNYQEI
FT                   NERYKGGLRKELLSLKGIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQ
FT                   LKKVVTLPNHFTNQDANEFHALLDVFGKHYFRDKDIKNYDFLEPYFKK"
FT   gene            621221..622048
FT                   /locus_tag="SAAV_0573"
FT   CDS_pept        621221..622048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0573"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10494"
FT                   /protein_id="ACY10494.1"
FT                   /translation="MKDNDKQGSDDNGSSKSPYHRIVSLMPSNTEILYELGLGKYIVGV
FT                   STVDDYPKDVKEGKKQFDALNLNKEELLKAKPDLILAHESQKATANKVLSSLEKQGIKV
FT                   VYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDNIDKVIDSIPAHHKKSKVFIE
FT                   VSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVTKESIIKKNPDILISTEAKTR
FT                   SDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRIDEGLKELRDAIYRK"
FT   gene            622197..623147
FT                   /locus_tag="SAAV_0574"
FT   CDS_pept        622197..623147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0574"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10495"
FT                   /protein_id="ACY10495.1"
FT                   /translation="MTFNKVLLSWIVILIITTSIYLFWQLGDINDVFNQSILINVRLPR
FT                   LLEALLTGMILTVAGLIFQTVLNNALADSFTLGLASGATFGSGLALFLGLTTLWIPVFS
FT                   ITFSLITLITVLVITSVLSQGYPVRILILSGLMIGALFNSLLYFLILLKPRKLNTIANY
FT                   LFGGFGDAEYSNVSIIAITFIIALFGIFIILNQLKLLQLGELKSQSLGLNVQLITYIAL
FT                   CIASMITAINVAYVGIIGFIGMVIPQLIRKWQWKQSLGRQLALNIVIGGQIMVMADFIG
FT                   SHILSPVQIPASIIIALIGIPVLFYMLISQSKRLH"
FT   gene            623202..623921
FT                   /locus_tag="SAAV_0575"
FT   CDS_pept        623202..623921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0575"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10496"
FT                   /protein_id="ACY10496.1"
FT                   /translation="MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLA
FT                   DFKKAFIELDDDEDNDKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYT
FT                   LEKLSQKGFQIGVIANGKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMID
FT                   QLGVLPEQIMYVGDDALNDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLT
FT                   ILPIKNDNKGENYGSIY"
FT   gene            623905..624705
FT                   /locus_tag="SAAV_0576"
FT   CDS_pept        623905..624705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0576"
FT                   /product="alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10497"
FT                   /protein_id="ACY10497.1"
FT                   /translation="MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAQLAK
FT                   SFQVVLIDLRGHGYSDKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGADISV
FT                   RYPEFTSSLMLVNPTSIEGELPEERLFRKYAHIIRNWDPEKQDKFLNKRKYYRPRKMNR
FT                   FLKHVVDTNEISTKEEIQAVKEVFKNADISQTYRNVVVPTKIIAGEFGERTTRLEAKEV
FT                   ADLIQNADFEVYQESSAFPFVEEQERFVEDTASFINKHHDEKHV"
FT   gene            624841..625347
FT                   /locus_tag="SAAV_0577"
FT   CDS_pept        624841..625347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10498"
FT                   /protein_id="ACY10498.1"
FT                   /translation="MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQS
FT                   LENVKIGESIKDVLTKYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHIS
FT                   MMYNDANGPTYQAVKNYVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYR
FT                   IDLEK"
FT   gene            625509..626225
FT                   /locus_tag="SAAV_0578"
FT   CDS_pept        625509..626225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10499"
FT                   /protein_id="ACY10499.1"
FT                   /translation="MRINDKILLENIEDYFNHKGLSPHLIDDIKEKVITDIKNSEKKDQ
FT                   DYIEYKRKSPAQIILMIQRNLFALQMNPVIFFIINFILISYLYDKQYVQFQAITGMSLF
FT                   YCLVIFPMTIVVYLRVSQKNYLRSNKIEMIMGTIIAIISLLLIILQAFNITWGVIPITN
FT                   FGHQFFFFIGIILVIAGIFYKRLEFSGIGLLFCQKTVDAMIHNPQSAQIFSLIIWILLV
FT                   VLVIYFTIRLSSRTRL"
FT   gene            626394..627182
FT                   /locus_tag="SAAV_0579"
FT   CDS_pept        626394..627182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0579"
FT                   /product="alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10500"
FT                   /protein_id="ACY10500.1"
FT                   /translation="MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLAS
FT                   SYKVLTYDLRGHGKSSKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTD
FT                   KYAYRVKSLTTIASKKDDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMK
FT                   WYQKQRIYSIKSEDDSAVAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFK
FT                   LEAHFLNVTKKIFEHSGHAPHIEEPEAFMNYYLNFLKSVS"
FT   gene            complement(627434..627808)
FT                   /gene="sarA"
FT                   /locus_tag="SAAV_0580"
FT   CDS_pept        complement(627434..627808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sarA"
FT                   /locus_tag="SAAV_0580"
FT                   /product="staphylococcal accessory regulator A"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10501"
FT                   /protein_id="ACY10501.1"
FT                   /translation="MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISE
FT                   NKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKI
FT                   ESLLSRVNKRITEANNEIEL"
FT   gene            complement(627956..628075)
FT                   /locus_tag="SAAV_0581"
FT   CDS_pept        complement(627956..628075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10502"
FT                   /protein_id="ACY10502.1"
FT                   /translation="MLIFLTKPNANPEIQSLCLMNNLFYKHFFVYFSFLISYN"
FT   gene            complement(628756..629649)
FT                   /locus_tag="SAAV_0582"
FT   CDS_pept        complement(628756..629649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10503"
FT                   /protein_id="ACY10503.1"
FT                   /translation="MLIPIQTSVNSRLSLYTKSPFYTSFISFSVGTICLIILNIIINPE
FT                   VFTIHFYNNQSFNYTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATVAGQIIMGVIIDT
FT                   FGLFGATIHDFNLIKAIGVLLLIVGIVIMNQFNKNNLLLTDQKYLLFWLLLGFIFGFFP
FT                   PIQTTINSALASHTHSPAFASLVSFTIGSITLLILTAIFNSSLKLKTSHLKFGKLKPIY
FT                   FTGGILGMAFVTANIILMPHMGAALTTLIGMFGQILMGILIDHFGLFGSPKIAMTSRKT
FT                   IGLLCILTGIILLRLF"
FT   gene            complement(629880..630104)
FT                   /locus_tag="SAAV_0583"
FT   CDS_pept        complement(629880..630104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10504"
FT                   /protein_id="ACY10504.1"
FT                   /translation="MTKTLELSFKSSLDKPVKLQLPQLNNVVTEQVARDSMNALVDLNI
FT                   IKSNSGTITKVHSAQIIDKTTTVLFEDKK"
FT   gene            complement(630121..630324)
FT                   /locus_tag="SAAV_0584"
FT   CDS_pept        complement(630121..630324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10505"
FT                   /protein_id="ACY10505.1"
FT                   /translation="MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFS
FT                   KLIERLTGETYNNIELIKSLSI"
FT   gene            630483..631043
FT                   /locus_tag="SAAV_0585"
FT   CDS_pept        630483..631043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0585"
FT                   /product="phage integrase family integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10506"
FT                   /protein_id="ACY10506.1"
FT                   /translation="MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELL
FT                   TITVSQVKRLIEKCTLSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSL
FT                   RTNQVLSRQQAYRIIHQASIEAGIDNVGLTTLRKTFAYHAYQKGIPIPVIQKYLGHQSA
FT                   IETLNFIGLENECEHSIYISLQL"
FT   gene            631062..633464
FT                   /locus_tag="SAAV_0586"
FT   CDS_pept        631062..633464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0586"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10507"
FT                   /protein_id="ACY10507.1"
FT                   /translation="MSLVYLLIAILVIMAMILLMSKRRALAKYAGYIALVAPVISSIYF
FT                   LIQIPSVAKLQYLSTSIPWIKTLDINLDLRLDGLSLMFSLIISLIGIAVFFYATQYLSS
FT                   RKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGA
FT                   IQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQADHIKNHGLFIPMIFMFLLGAFT
FT                   KSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFLLLRFTPLLGLSNMYIYIVTFVG
FT                   LITMLFGSITALKQWDLKGILAYSTISQLGMIMAMVGIGGGYAQHQQDAIASIYVFVLF
FT                   GALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIAALSMAGV
FT                   PFLNGFLSKEMFLDALTQTGQLSQFSLISMIAIVFVGVIASIFTFTYALYMVKEVFWTK
FT                   YDSKVFTKKNIHEPWLFSLPSLILMVLVPVIFFVPNIFGKGIIVPALRGVSGGNHQIDP
FT                   LAPHVSQWHGFNIPLLLTIIIILLGSVLAIKVDWKKVFTGKIRQISVSKGYEMVYRHFE
FT                   KFATKRFKRVMQDRLNQYIIMTLGIFMIIIGYGYIRIGLPKVHQLHVSEFGALEIILAI
FT                   VTVTIGISLIFIRQRLTMVILNGVIGFVVTLFFIAMKAPDLALTQLVVETITTILFIVS
FT                   FSRLPNVPRSNANKKREIIKISVSLLMALIVVSLIFITQQTDGLSSISDFYLKADKLTG
FT                   GKNIVNAILGDFRALDTLFEGLVLIITGLGIYTLLNYQDRRGQDERE"
FT   gene            633451..633876
FT                   /locus_tag="SAAV_0587"
FT   CDS_pept        633451..633876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0587"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10508"
FT                   /protein_id="ACY10508.1"
FT                   /translation="MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFS
FT                   SAFILMFLAFNVEEVLESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILP
FT                   ILGQIHVSTITLFELGILFSVVGVIVTVMLSLSGGRS"
FT   gene            633873..634217
FT                   /locus_tag="SAAV_0588"
FT   CDS_pept        633873..634217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0588"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10509"
FT                   /protein_id="ACY10509.1"
FT                   /translation="MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMS
FT                   MGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEI
FT                   EGLRGEDDAK"
FT   gene            634207..635703
FT                   /locus_tag="SAAV_0589"
FT   CDS_pept        634207..635703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0589"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10510"
FT                   /protein_id="ACY10510.1"
FT                   /translation="MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIIS
FT                   LMLLIYVQRHRPITLDFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHK
FT                   ANRYHLPSFILFLSVGVIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIY
FT                   VVLNIIGSWLFLLGIGLLYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAA
FT                   LVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAI
FT                   TMVIGAIGVIAYKDIKKIAAYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLL
FT                   FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGA
FT                   LQNGNYIGLALMIITSLIAMYSLFRILFYMYFGDKDGEEVNFKKIPLYRKRILSILVVV
FT                   VIAIGIAAPVVLNVTSDATELNTSDQLYQKLVNPHLKGED"
FT   gene            635704..636186
FT                   /locus_tag="SAAV_0590"
FT   CDS_pept        635704..636186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0590"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10511"
FT                   /protein_id="ACY10511.1"
FT                   /translation="MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRF
FT                   FSDDFYVRKIWVAIKFLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWAI
FT                   TFLTILIIITPGSTVIRISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR"
FT   gene            636183..636485
FT                   /locus_tag="SAAV_0591"
FT   CDS_pept        636183..636485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0591"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   F"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10512"
FT                   /protein_id="ACY10512.1"
FT                   /translation="MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTS
FT                   AVVMSIVGVLSVLMGTVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL"
FT   gene            636460..636897
FT                   /locus_tag="SAAV_0592"
FT   CDS_pept        636460..636897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0592"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10513"
FT                   /protein_id="ACY10513.1"
FT                   /translation="MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATK
FT                   SSTLSVLLTLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYR
FT                   KNDAHTHASILLSSNEQNSTEALQLRAKKREEHRKKWYQND"
FT   gene            637237..639279
FT                   /locus_tag="SAAV_0593"
FT   CDS_pept        637237..639279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0593"
FT                   /product="Na+/H+ antiporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10514"
FT                   /protein_id="ACY10514.1"
FT                   /translation="MEIFETILIFIAVVILSSFVHTFIPKVPLAFIQIFLGMLLFITPI
FT                   PVQFNFDSELFMVTMIAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIH
FT                   WIWPDLPIGAAFAIAAILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFK
FT                   IAVGVLVTGAFSLVDAVQLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTII
FT                   QLLTPFVTYLIAELFHASGIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVL
FT                   NGFVFSILGFLVPEVIIKIIKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLA
FT                   ISPFQKMMTKNDDDNPTTEKPPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFT
FT                   YRNDLLFIASGMVIISLVVAQVLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQK
FT                   STFETSFKYGNVIKEYHDKLAFLKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQ
FT                   ITNSVLENYMRYAERTQVYRQASLIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLME
FT                   LNKINKLVHYNVVSRLSKETTKDNTLEIGMVCDGYLMRIENLTPSNFFNSASEDTITKI
FT                   KLNALREQRRILRELIDTDEVSEGTALKLREAINYDEMVIVDSMT"
FT   gene            complement(640173..641102)
FT                   /locus_tag="SAAV_0594"
FT   CDS_pept        complement(640173..641102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0594"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10515"
FT                   /protein_id="ACY10515.1"
FT                   /translation="MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDM
FT                   AKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALE
FT                   QAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDND
FT                   KKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGY
FT                   IWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTD
FT                   SIGKEGTKGDSYYKMMKSNIETVHGSMK"
FT   gene            complement(641099..641935)
FT                   /locus_tag="SAAV_0595"
FT   CDS_pept        complement(641099..641935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0595"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10516"
FT                   /protein_id="ACY10516.1"
FT                   /translation="MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGD
FT                   AMSHAVLPGVALSFLFGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLA
FT                   SGIIIISLINTTTDLYHILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDP
FT                   TFSRMSGLNTTLLHYFVMLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMM
FT                   IIASLISVISSIVGLYYSYIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT"
FT   gene            complement(641929..642672)
FT                   /locus_tag="SAAV_0596"
FT   CDS_pept        complement(641929..642672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0596"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10517"
FT                   /protein_id="ACY10517.1"
FT                   /translation="MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLI
FT                   KSLIGEFNATGTKLLYNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWF
FT                   RRPNKSARDKLKQLLSDLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFV
FT                   GIDFSSEKLIMTKIENLKQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMS
FT                   VTRLNETFMSSTDCSDPSQRSNITC"
FT   gene            642794..643438
FT                   /gene="sirR"
FT                   /locus_tag="SAAV_0597"
FT   CDS_pept        642794..643438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirR"
FT                   /locus_tag="SAAV_0597"
FT                   /product="iron-dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10518"
FT                   /protein_id="ACY10518.1"
FT                   /translation="MLTEEKEDYLKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGR
FT                   LEKAGYVETKPYKGVRLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEH
FT                   RISDLFVERLDSLLNFPETCPHGGVIPRNNEYKEKYITTILNYEPGDIVTIKRVRDKTD
FT                   LLIYLSSKDISIGNEVEIVSKDEMNKVIIIKRNDNVIIVSYENAMNMFAEK"
FT   gene            complement(643518..644270)
FT                   /locus_tag="SAAV_0598"
FT   CDS_pept        complement(643518..644270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10519"
FT                   /protein_id="ACY10519.1"
FT                   /translation="MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVIL
FT                   NYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTI
FT                   GGYLMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYF
FT                   ILKDENIVEIQLLVTMSYQYILSVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHV
FT                   PIFIYSTIWIIFNLYAVNILLKYTHLIN"
FT   gene            644506..645270
FT                   /gene="tagA"
FT                   /locus_tag="SAAV_0599"
FT   CDS_pept        644506..645270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagA"
FT                   /locus_tag="SAAV_0599"
FT                   /product="teichoic acid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10520"
FT                   /protein_id="ACY10520.1"
FT                   /translation="MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQSTNNLFI
FT                   VTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASHRLKQPLAHRIPGIELMDECL
FT                   KIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFAHHHGYIDLEDETVVKRIKLFKP
FT                   DYIFVGMGFPKQEEWIMTHENQFESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYR
FT                   ALIDWKRIGRLKSIPIFMYKIAKAKRKIKKAK"
FT   gene            complement(645331..646125)
FT                   /locus_tag="SAAV_0600"
FT   CDS_pept        complement(645331..646125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0600"
FT                   /product="teichoic acids export protein ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10521"
FT                   /protein_id="ACY10521.1"
FT                   /translation="MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISL
FT                   KAYEGDVIGLVGINGSGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIE
FT                   NIEFKMLCMGFKRKEIKAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPD
FT                   ILVIDEALSVGDQTFAQKCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLK
FT                   DYGELDDVLPKYEAFLNDFKKKSKAEQKEFRNKLDEARFVIK"
FT   gene            646451..647284
FT                   /locus_tag="SAAV_0601"
FT   CDS_pept        646451..647284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0601"
FT                   /product="tagG protein, teichoic acid ABC transporter
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10522"
FT                   /protein_id="ACY10522.1"
FT                   /translation="MKVWFNGMSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVA
FT                   WELINPVMQIMVYWMVFGLGIRSNAPIHGVPFVYWLLVGISMWFFINQGILEGTKAITQ
FT                   KFNQVSKMNFPLSIIPTYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFC
FT                   FFLTASVTLLTSTLGVLVRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNP
FT                   VYFIAESYRAAILYHEWYFMDHWKLMLYNFGIVAIFFAIGAYLHMKYRDQFADFL"
FT   gene            647383..648486
FT                   /gene="tagB"
FT                   /locus_tag="SAAV_0602"
FT   CDS_pept        647383..648486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagB"
FT                   /locus_tag="SAAV_0602"
FT                   /product="teichoic acid biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10523"
FT                   /protein_id="ACY10523.1"
FT                   /translation="MNVLIKKFYHLVVRILSKMITPQVIDKPHIVFMMTFPEDIKPIIK
FT                   TLNNSSYQKTVLTTPKQAPYLSELSDDVDVIEMTNRTLVKQIKALKSAQMIIIDNYYLL
FT                   LGGYNKTSNQHIVQTWHASGALKNFGLTDHQVDVSDKAMVQQYRKVYQATDFYLVGCEQ
FT                   MSQCFKQSLGATEEQMLYFGLPRINKYYTAERATVKAELKDKYGITNKLVLYVPTYRED
FT                   KADNRAIDKAYFEKCLPGYTLINKLHPSIEDSDIDDVSSIDTSTLMLMSDIIISDYSSL
FT                   PIEASLLDIPTIFYVYDEGTYDKVRGLNQFYKAIPDSYKVYTEEDLIMTIQEKEHLLSP
FT                   LFKDWHKYNTDKSLHQLTEYIDKMVTK"
FT   gene            648483..649544
FT                   /gene="tagX"
FT                   /locus_tag="SAAV_0603"
FT   CDS_pept        648483..649544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagX"
FT                   /locus_tag="SAAV_0603"
FT                   /product="teichoic acid biosynthesis protein X"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10524"
FT                   /protein_id="ACY10524.1"
FT                   /translation="MRLTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPM
FT                   IERLQRELKHISLIQLQNASIATCINKGLMDIKMTDPHDSDAFMVINPTSIVLPGKLDR
FT                   LTAAFKNNDNIDMVIGQRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKL
FT                   FSAKFAELQCDETLANTYNHAILVKAMQKATDIHLVSQMIVGDNDIDTHATSNDEDFNR
FT                   YIIEIMKIRQRVMEMLLLPEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDY
FT                   IMSMQHSDYVSQNMFDIINTVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKG
FT                   RKFAHRTKSMLKR"
FT   gene            649607..650005
FT                   /gene="tagD"
FT                   /locus_tag="SAAV_0604"
FT   CDS_pept        649607..650005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /locus_tag="SAAV_0604"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10525"
FT                   /protein_id="ACY10525.1"
FT                   /translation="MKRVITYGTYDLLHYGHIELLRRAREMGDYLIVALSTDEFNQIKH
FT                   KKSYYDYEQRKMMLESIRYVDLVIPEKGWGQKEDDVEKFDVDVFVMGHDWEGEFDFLKD
FT                   KCEVIYLKRTEGISTTKIKQELYGKDAK"
FT   gene            complement(650122..651417)
FT                   /gene="pbp4"
FT                   /locus_tag="SAAV_0605"
FT   CDS_pept        complement(650122..651417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp4"
FT                   /locus_tag="SAAV_0605"
FT                   /product="penicillin-binding protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10526"
FT                   /protein_id="ACY10526.1"
FT                   /translation="MKNLISIIIILCLTLSIMTPYAQATNSDVTPVQAANQYGYAGLSA
FT                   AYEPTSAVNVSQTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTN
FT                   KEYIMSTLPELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMN
FT                   NKAKAIGMKNTHFVNPTGAENSRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKI
FT                   LDFTKQLAPTTHAVTYYTFNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRI
FT                   NQVIMGAGDYKNLGGEKQRNMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLY
FT                   DVLPSDFSKKDYKLVVEDGKVHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEE
FT                   HPLFTIIGGACLVAGLALIVHMIINRLFRKRK"
FT   gene            651838..653565
FT                   /gene="abcA"
FT                   /locus_tag="SAAV_0606"
FT   CDS_pept        651838..653565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcA"
FT                   /locus_tag="SAAV_0606"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10527"
FT                   /protein_id="ACY10527.1"
FT                   /translation="MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRI
FT                   VDKFSVSHINWNLIALFGGIFVINALLSGLGLYLLSKIGEKIIYAIRSVLWEHIIQLKM
FT                   PFFDKNESGQLMSRLTDDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTF
FT                   ITIPIFVLIMIPLGRIMQKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAH
FT                   KNLNEIYKLGLKQAKIAAVVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFY
FT                   VIQLSMPLINLSTLVTDYKKAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEH
FT                   VDFKYDVKKILDDVSFQIPQGQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESV
FT                   YDIPLSKWRRKIGYVMQSNSMMSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQF
FT                   DEGYDTLVGERGLKLSGGQRQRIDIARSFVKNPDILLLDEATANLDSESELKIQEALET
FT                   LMEGRTTIVIAHRLSTIKKAGQIIFLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD"
FT   gene            653922..655151
FT                   /locus_tag="SAAV_0607"
FT   CDS_pept        653922..655151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0607"
FT                   /product="nucleoside permease NupC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10528"
FT                   /protein_id="ACY10528.1"
FT                   /translation="MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWF
FT                   FIYFDWGQKAVRGAANGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLF
FT                   DILMYFNILPKIIGGIGWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEM
FT                   RVLTIAMMSMSSVSGAIVGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDI
FT                   IYSLKNNEVERQPFFSFLGDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGLIAG
FT                   WIGIKGSFGLNQILGVFMYPFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIA
FT                   SYTPHHRAVITTFLISFANFSTIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLL
FT                   TAAFVGLFAW"
FT   gene            655676..656509
FT                   /locus_tag="SAAV_0608"
FT   CDS_pept        655676..656509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10529"
FT                   /protein_id="ACY10529.1"
FT                   /translation="MNKTVKDLILVVLGSFIFAAGVNAFIISGNLGEGGVTGLAIILYY
FT                   AFHISPAITNFLVNAVLIAIGYKFLSKRSMYLTILVTILISIFLSLTESWQVETGNSIV
FT                   NAIFGGVSVGLGIGVIILAGGTTAGTTILARIATKYLDVSTPYALLFFDMIVVAISLTV
FT                   IPLDKVLVTVISLYIGTKVMEYVIEGLNTKKAMTIISTNPDKLAKAIDEQIGRGLTILN
FT                   GHGYYTREEKDVLYVVISKTQVSKAKRLIKQIDKDAFLVIHDVRDVYGNGFLADE"
FT   gene            656791..657588
FT                   /locus_tag="SAAV_0609"
FT   CDS_pept        656791..657588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0609"
FT                   /product="iron compound ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10530"
FT                   /protein_id="ACY10530.1"
FT                   /translation="MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTL
FT                   LKALSRLLAVKEGEVFLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFP
FT                   HQKGFGRLTAEDKKEIDWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFL
FT                   DEPTTYLDICHQLEILELVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATG
FT                   STEDVLTQEILEKVFNIDVVLRKDPKTGKPLLVTYDLCRRAYS"
FT   gene            657624..658628
FT                   /locus_tag="SAAV_0610"
FT   CDS_pept        657624..658628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0610"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10531"
FT                   /protein_id="ACY10531.1"
FT                   /translation="MTNRENPTPLKFLSYIIGLSMILLITLFISTLIGDAKIQASTIIE
FT                   AIFNYNPSNQQQNIINEIRIPRNIAAVIVGMALAVSGAIIQGVTRNGLADPALIGLNSG
FT                   ASFALALTYAVLPNTSFLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVS
FT                   AMLTALSQGIALAFRLNQTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTI
FT                   LNLGESLAKGLGQNVTMIRGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDY
FT                   AKILPLTALLGGILVLVADVIARYLGEAPVGAIISFIGVPYFLYLVKKGGRSI"
FT   gene            658625..659641
FT                   /locus_tag="SAAV_0611"
FT   CDS_pept        658625..659641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0611"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10532"
FT                   /protein_id="ACY10532.1"
FT                   /translation="MISSNNKRRQLIALAVFSILLFLGCTWSITSGEYNIPVERFFKTL
FT                   IGQGDAIDELILLDFRLPRMMITILAGAALSISGAIVQSVTKNPIAEPGILGINAGGGF
FT                   AIALFIAIGKINADNFVYVLPLISILGGITTALIIFIFSFNKNEGVTPASMVLIGVGLQ
FT                   TALYGGSITIMSKFDDKQSDFIAAWFAGNIWGDEWPFVIAFLPWVLIIIPYLLFKSNTL
FT                   NIIHTGDNIARGLGVRLSRERLILFFIAVMLSSAAVAVAGSISFIGLMGPHIAKRIVGP
FT                   RHQLFLPIAILVGACLLVIADTIGKIVLQPGGVPAGIVVAIIGAPYFLYLMYKTKNV"
FT   gene            659878..660843
FT                   /locus_tag="SAAV_0612"
FT   CDS_pept        659878..660843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0612"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10533"
FT                   /protein_id="ACY10533.1"
FT                   /translation="MKKLINKKETFLTDMLEGLLIAHPELDLIANTVIVKKAKKEHGVA
FT                   IVSGGGSGHEPAHAGFVAEGMLDAAVCGEVFTSPTPDKILEAIKAVDTGDGVLLVVKNY
FT                   AGDVMNFEMAQELAEMEGINVQTVIVRDDIAVTNEVQRRGVAGTVFVHKLAGYLAEKGY
FT                   SLTEIKSRVEALLPEIKSIGMAIEPPLVPTTGKYGFDIEDDKMEIGIGIHGEKGIHREE
FT                   VKDIDRIVGTLLDELYKEVTANDVILMVNGMGGTPLSELNIVTKYIQQNLAARTVNVAK
FT                   WFVGDYMTSLDMQGFSITIVPNKPEYLEAFLAPTTSQYFK"
FT   gene            660885..661469
FT                   /locus_tag="SAAV_0613"
FT   CDS_pept        660885..661469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0613"
FT                   /product="DAK2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10534"
FT                   /protein_id="ACY10534.1"
FT                   /translation="MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFS
FT                   SLKDKLDDSSMQSLFKSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQ
FT                   AFAEAVESRGKVTLNEKTMYDVVARAAEKLENGETLTFNDLQQLADNTKDMVATKGRAA
FT                   YFGEESKGYIDPGAQSMVYILNALIGDEDNA"
FT   gene            661462..661878
FT                   /locus_tag="SAAV_0614"
FT   CDS_pept        661462..661878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10535"
FT                   /protein_id="ACY10535.1"
FT                   /translation="MPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSF
FT                   DIIQEVLTKLEDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLS
FT                   IGGSIDDALAEIKQSFQLKFTNNEKCKPFSNETL"
FT   gene            661940..662437
FT                   /locus_tag="SAAV_0615"
FT   CDS_pept        661940..662437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10536"
FT                   /protein_id="ACY10536.1"
FT                   /translation="MQHLIKKHVLNGEFDLVRQLMSETDFMEFEEAYISSAHEVESMMF
FT                   YTCILDMIKYEESSEMHDLAFLLLVYPLSEYEGALDSAYYHADASIKLTDGKEVKSLLQ
FT                   MLLLHAIPTPVISDKKAFDIAKQILKLDPNNNVARNVLKDTAKRMDNVVVDINELHQRN
FT                   AR"
FT   gene            662894..663961
FT                   /locus_tag="SAAV_0616"
FT   CDS_pept        662894..663961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10537"
FT                   /protein_id="ACY10537.1"
FT                   /translation="MMMNKEATKIGFAYVGIVVGAGFSTGQEVMQFFTKYGLWAYLGVI
FT                   ISGFILAFIGRQVAKIGTAFEATNHESTLQYVFGEKFSKVFDYILIFFLFGIAVTMIAG
FT                   AGATFEESYNIPTWLGALIMTLAIYITLLLDFNKIVRALGIVTPFLIVLVVLIAGVYLF
FT                   KGHVSLAEVNQVVPEASIWKGIWFGTIYGGLAFSVGFSTIVAIGGDTEKRTVSGAGAMY
FT                   GGIIYTVLLALINFALQSEYPTIKNASIPTLTLANNIHPLIATVLSVIMLAVMYNTILG
FT                   LMYSFAARFTEPYSKNYHIFIIIMMVAGYLLSFVGFAELINKLYTIMGYVGLFIVVAVI
FT                   IKYFKRKNADKKHIA"
FT   gene            664112..665155
FT                   /locus_tag="SAAV_0617"
FT   CDS_pept        664112..665155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0617"
FT                   /product="lipase/esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10538"
FT                   /protein_id="ACY10538.1"
FT                   /translation="MNKDNKWTMITALFITVISVLLAFHLKQHYDQITNENHANKDKIN
FT                   IKNKNVRIYQNLTYNRVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPL
FT                   LAKIAEQGYIVVNVNYALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSA
FT                   GAQLASQFTAIQTNDRLREAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFM
FT                   KSYTGEEDWEKSFKNISQMSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVP
FT                   VDTLFYDGTHHLHHQYQFHLNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQMENPSNE
FT                   LPLNPLN"
FT   gene            665484..665912
FT                   /locus_tag="SAAV_0618"
FT   CDS_pept        665484..665912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10539"
FT                   /protein_id="ACY10539.1"
FT                   /translation="MTRSALKPFKNKRVMVTGRIQRVLFKNYLDRHSTFKPNVRILLKD
FT                   VFVSGVSIDHLWLYETNKYYALAMELIHQRVKFSANVVPYYKINRNNNLFVQDYGIKRK
FT                   GRLITEEAYNQNNQYQDKIYEKLPDIDFRLEDFYSKEN"
FT   gene            complement(666121..666627)
FT                   /locus_tag="SAAV_0619"
FT   CDS_pept        complement(666121..666627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0619"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10540"
FT                   /protein_id="ACY10540.1"
FT                   /translation="MAHIIRRVSIKDVENFISMLAKIYDESPYMFYTPGEYDPSVTSAS
FT                   KQLEEYITSPHKVIFVAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQA
FT                   LLDAIMAWCLNNQIHRIEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMM
FT                   AKILN"
FT   gene            666740..667663
FT                   /locus_tag="SAAV_0620"
FT   CDS_pept        666740..667663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10541"
FT                   /protein_id="ACY10541.1"
FT                   /translation="MKPKVLLAGGTGYIGKYLSEVIENDAELFTISKYPDNKKTDDVEM
FT                   TWIQCDIFHYEQVVAAMNQIDIAVFFIDPTKNSAKITQSSARDLTLIAADNFGRAAAIN
FT                   QVKKVIYIPGSRYDNETIERLGAYGTPVETTNLVFKRSLVNVELQVSKYDDVRSTMKVV
FT                   LPKGWTLKNVVNHFIAWMGYTKGTFVKTEKSHDQFKIYIKNKVRPLAVFKIEETADGII
FT                   TLILLSGSLVKKYTVNQGKLEFRLIKESAVVYIHLYDYIPRLFWPIYYFIQAPMQKMMI
FT                   HGFEVDCRIKDFQSRLKSGENMKYTK"
FT   gene            667679..668353
FT                   /locus_tag="SAAV_0621"
FT   CDS_pept        667679..668353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0621"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10542"
FT                   /protein_id="ACY10542.1"
FT                   /translation="MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNP
FT                   EIVILDVQLPKYDGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYT
FT                   NVLIAKLQAIYRRVYEFTAEEKRTLTWQDAVVDLSKDSIQKGDDTIFLSKTEMIILEIL
FT                   ITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMA
FT                   HE"
FT   gene            668346..669386
FT                   /locus_tag="SAAV_0622"
FT   CDS_pept        668346..669386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0622"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10543"
FT                   /protein_id="ACY10543.1"
FT                   /translation="MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFY
FT                   IVSLNLSLTMIFLILTYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQIS
FT                   AHKEKVVEQQLQLNMHEQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINS
FT                   MLDTQLYITRLESQRKDMYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYT
FT                   DTKWCRMIIRQILSNALKYSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERG
FT                   FTSTANRNETTSSGMGLYLVNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSE
FT                   VTNLSF"
FT   gene            669530..670291
FT                   /locus_tag="SAAV_0623"
FT   CDS_pept        669530..670291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0623"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10544"
FT                   /protein_id="ACY10544.1"
FT                   /translation="MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSG
FT                   KTTLLNVLSSIDYISQGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKE
FT                   NIMLPLTVQKLDKEHMLNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPS
FT                   IIFADEPTGALDSKSTQDLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIF
FT                   TELYQGDDDKHTFFKEIIRVQSVLGGVNYDL"
FT   gene            670281..672170
FT                   /locus_tag="SAAV_0624"
FT   CDS_pept        670281..672170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0624"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10545"
FT                   /protein_id="ACY10545.1"
FT                   /translation="MTFNEIIFKNFRQNLSHYAIYLFSLITSVVLYFSFVALKYAHKLN
FT                   MTESYPIIKEGSQVGSYFLFFIIIAFLLYANVLFIKRRSYELALYQTLGLSKFNIIYIL
FT                   MLEQLLIFIITAILGIIIGIFGSKLLLMIVFTLLGIKEKVPIIFSLRAVFETLMLIGVA
FT                   YFLTSAQNFILVFKQSISQMSKNNQVKETNHNKITFEEVVLGILGIVLITTGYYLSLNI
FT                   VQYYDSIGILMFILLSTVIGAYLFFKSSVSLVFKMVKKFRKGVISVNDVMFSSSIMNRI
FT                   KKNAFSLTVMAIISAITVSVLCFAAISRASLSSEIKYTAPHDVTIKDQQKANQLASELN
FT                   NQKIPHFYNYKEVIHTKLYKDNLFDVKAKEPYNVTITSDKYIPNTDLKRGQADLFVAEG
FT                   SIKDLVKHKKHGKAIIGTKKHHVNIKLRKDINKIYFMTDVDLGGPTFVLNDKDYQEIRK
FT                   HTKAKHIVSQFGFDLKHKKDALALEKVKNKVDKSIKTRSEAISSISSLTGILLFVTSFL
FT                   GITFLIAVCCIIYIKQIDETEDELENYSILRKLGFTQKDMARGLKFKIMFNFGLPLVIA
FT                   LSHAYFTSLAYMKLMGTTNQIPVFIVMGLYICMYAVFAVTAYNHSKRTIRHSI"
FT   gene            672895..673512
FT                   /locus_tag="SAAV_0625"
FT   CDS_pept        672895..673512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10546"
FT                   /protein_id="ACY10546.1"
FT                   /translation="MFSKKKDKFMVQLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNI
FT                   KTYESHGDELVHQVITDLNQTFITPIEREDILSLCDAIDDVLDAIEETAAMFEMYSIEY
FT                   TDEYMAEFVDNIQKAVAEMKLAVGLLVDKKLSHMRIHSINIKEFETNCDGILRQSIKHI
FT                   FNSETDPITLIKIKDIYESMEEIADKCQIVANNFETIIMKNS"
FT   gene            673528..674535
FT                   /locus_tag="SAAV_0626"
FT   CDS_pept        673528..674535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0626"
FT                   /product="phosphate transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10547"
FT                   /protein_id="ACY10547.1"
FT                   /translation="MSYIIIVTIAVVIFSLIFDFINGFHDTANAVATAVSTRALTPKTA
FT                   ILMAAVMNFIGALTFTGVAGTITKDIVDPFKLENGLVVVLAAILAAIIWNLATWFYGIP
FT                   SSSSHALIGSIAGAAIASEGSFGVLHYQGFTKIIIVLIVSPIIAFCVGFLMYSIFKVIF
FT                   KNANLTRANRNFRFFQIFTAALQSFSHGTNDAQKSMGIITLALIVANVQNDGSVEPQLW
FT                   VKFACATAMGLGTAIGGWKIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLST
FT                   THVVSSSILGVGASNRAKGVKWSTAQRMIITWVITLPISALLAGLLFYILNLFF"
FT   gene            complement(675123..675920)
FT                   /locus_tag="SAAV_0627"
FT   CDS_pept        complement(675123..675920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0627"
FT                   /product="LysM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10548"
FT                   /protein_id="ACY10548.1"
FT                   /translation="MKKLAFAITATSGAAAFLTHHDAQASTQHTVQSGESLWSIAQKYN
FT                   TSVESIKQNNQLDNNLVFPGQVISVGGSDAQNTSNTSPQAGSASSHTVQAGESLNIIAS
FT                   RYGVSVDQLMAANNLRGYLIMPNQTLQIPNGGSGGTTPTATTGSNGNASSFNHQNLYTA
FT                   GQCTWYVFDRRAQAGSPISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHV
FT                   AYVERVNGDGSILISEMNYTYGPYNMNYRTIPASEVSSYAFIH"
FT   gene            676281..676925
FT                   /locus_tag="SAAV_0628"
FT   CDS_pept        676281..676925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10549"
FT                   /protein_id="ACY10549.1"
FT                   /translation="MSQNTNHSYYHQNQHAQSISKVWLYFMYYWIIFGIGCYLGQFLPL
FT                   SWRQPLSFGLLIIILATLVFERARRFGLIISHIYAVVIGLLSYATFTTYLQNLGPDIFY
FT                   KNIALAIFAFIAFGIIGYFFVGDASSIGKYLFVTLITLIIASLIGIFLQNPIFYTIITV
FT                   VSLLLFLLYTLYDFNRLKRGDYSPREMGFNLFINLLNIIKDILYLANMFRR"
FT   gene            677622..679772
FT                   /locus_tag="SAAV_0629"
FT   CDS_pept        677622..679772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0629"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10550"
FT                   /protein_id="ACY10550.1"
FT                   /translation="MAKSCLHILTNNEYATTRCQDGIVLFWPIDGEIELQKFRKSKIIE
FT                   DDIYIINHLDVFSIKNNKKTIMLYLSSDWFAELGFTFFNYHYTAKLIKSSYNLKCLLLK
FT                   LTYRYLDNQPLNDADIRKLQDIIKIIAKEASMDKKIAQNQYRYAYYGDLRDELEYIYQN
FT                   VNQRLTLKSVADKLFVSKSNLSSQFHLLMGMGFKKYIDTLKIGKSIEILLTTDSTISNI
FT                   SEHLGFSSSSTYSKMFKSYMDITPNEYRNLSKYNKCLMLKPEPLVGKMVQEVKEIILNY
FT                   IEHYKNHLTDVIHIDEDKFETPKLFQTVIQINTYTEMKLVFLEGIFKTLLNKNSQVVFF
FT                   IMPSILKSKNTMSEEEKFTIIKTIIESDLKIAFNINDIETTYFVEEAFMSVFRQISPNE
FT                   LSNHNNYEVHFVFDLSLMEIRTIYRMILKLHNIMLNVKLGLNITCLFEKPSVFKSLVSQ
FT                   IKRLKFDSLIIDNANLSSPYLMGESDELLLKNILHFKNLKQVINELDIEQEKLIFLNVE
FT                   NHKLLNNKERDLSNSAPLIYKTLSALYHNFDGFGLNIFDNHHTFNAMHLYDKNGFKTTL
FT                   GLILEKFIEYVSKPKYENSYYSIFDIENYYCLVIYDWRVIESETIMSNFEDSQVYINFK
FT                   NNVLNDKYLIVIETLDENSGNINHLISKELRDKYEWNPSLLSKIDNYLKPAIEIKEHNF
FT                   SDNSLNINVTFNALYIIKIGKK"
FT   gene            679852..680277
FT                   /gene="sarX"
FT                   /locus_tag="SAAV_0630"
FT   CDS_pept        679852..680277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sarX"
FT                   /locus_tag="SAAV_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10551"
FT                   /protein_id="ACY10551.1"
FT                   /translation="MAKKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYI
FT                   DKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERL
FT                   SKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI"
FT   gene            680467..681183
FT                   /locus_tag="SAAV_0631"
FT   CDS_pept        680467..681183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10552"
FT                   /protein_id="ACY10552.1"
FT                   /translation="MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQ
FT                   ALRLVLERAKTYSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVN
FT                   RTASDVRAAFGKNGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVID
FT                   DNGLTIVYAEPDQFAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDAL
FT                   EDLEDVQNVFHNVDLK"
FT   gene            681183..681656
FT                   /locus_tag="SAAV_0632"
FT   CDS_pept        681183..681656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10553"
FT                   /protein_id="ACY10553.1"
FT                   /translation="MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLL
FT                   TDDNISHFHRIDADEVWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGT
FT                   IFASSIEISNTYSLVGCMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK"
FT   gene            681748..681864
FT                   /locus_tag="SAAV_0633"
FT   CDS_pept        681748..681864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10554"
FT                   /protein_id="ACY10554.1"
FT                   /translation="MLQLFLMKIALNDFENDKSVLFIFLKNHFYEEMCVLSN"
FT   gene            682009..682653
FT                   /locus_tag="SAAV_0634"
FT   CDS_pept        682009..682653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0634"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10555"
FT                   /protein_id="ACY10555.1"
FT                   /translation="MKVKYIDKRHWRRLIDREYTEVKVNNNRFKGIIGLVTMKKVRDPL
FT                   EVTVVGQNIIVADDNYKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNAR
FT                   TVDLCLDVLALPSGEYELVDEDDLMFALESEQITKKQFHEAYMIAHQIMAELENDFKGF
FT                   QKKIMYCFNKINAKAQKNHQKPQNKTNIEKSKQIKPKQYNQTKNHQQQKKN"
FT   gene            682769..683635
FT                   /locus_tag="SAAV_0635"
FT   CDS_pept        682769..683635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0635"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10556"
FT                   /protein_id="ACY10556.1"
FT                   /translation="MKIEDYRLLITLDETKTLRKAAEILYISQPAVTQRLKAIENAFGV
FT                   DIFIRTKKQLITTTEGTMIIEHARDMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQT
FT                   LLPEVLSLYNAQFPNVEIQVQVGSTEQIKANHRDYHVMITRGNKVMNLANTHLFNDDHY
FT                   FIFPKNRRDDVTKLPFIEFQADPIYINQIKQWYNDNLEQDYHATITVDQVATCKEMLIS
FT                   GVGVTILPEIMMKNISKEQFEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMAS
FT                   FVEQPKA"
FT   gene            683767..684987
FT                   /locus_tag="SAAV_0636"
FT   CDS_pept        683767..684987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0636"
FT                   /product="sugar efflux transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10557"
FT                   /protein_id="ACY10557.1"
FT                   /translation="MDMFAALLQIKNYKLFVANMFLLGMGIAVTVPYLVLFATKDLGMT
FT                   TNQYGLLLASAAISQFTVNSIIARFSDTHHFNRKIIIILALLMGALGFSIYFFVDTIWL
FT                   FILLYAIFQGLFAPAMPQLYASARESINVSSSKDRAQFANTVLRSMFSLGFLFGPFIGA
FT                   QLIGLKGYAGLFGGTISIILFTLVLQVFFYKDLNIKHPISTQQHVEKIAPNMFKDKTLL
FT                   LPFIAFILLHIGQWMYTMNMPLFVTDYLKENEQHVGYLASLCAGLEVPFMIILGVLSSR
FT                   LHTRTLLIYGAIFGGLFYFSIGVFKNFYMMLAGQVFLAIFLAVLLGIGISYFQDILPDF
FT                   PGYASTLFSNAMVIGQLGGNLLGGAMSHWVGLENVFFVSAASIMLGMILIFFTKNQKIT
FT                   KEDMIST"
FT   gene            684984..685472
FT                   /locus_tag="SAAV_0637"
FT   CDS_pept        684984..685472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10558"
FT                   /protein_id="ACY10558.1"
FT                   /translation="MTIILWLLIIAAFMLAFVGLIKPIIPSVLVLWVGFLIYQFGFHNQ
FT                   HLSWVFYVSMALLTILILCADFLANKYFVNRFGGSKFGEYAALIGVVIGCFVLPPFGII
FT                   IIPFILVFIVELIQGYSFERAVKVSIGSIVAFLTSSIAQAIIMFIMIVWFFIDALLIN"
FT   gene            complement(685571..686260)
FT                   /locus_tag="SAAV_0638"
FT   CDS_pept        complement(685571..686260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10559"
FT                   /protein_id="ACY10559.1"
FT                   /translation="MKSTAQLTKENNVKSLRLSNTDREIFENYMTYMRSDFRVNPHDTE
FT                   LIINRILKQLLSAEQHGLLALDFFNHDPKAHAIKELKAMPNETFKNIFKYIYQHIVLLI
FT                   GIVSFLKGFLGFFMEKNGSNLYFVSFPFSVVVGFFIVFLFIWFSFKTIQLQCFNNSNWI
FT                   WIFTYLAIILLIVGFFYVFFIPQSLLAFGPYIQVSNWVFIIFSFIVMPIGLRIERNISK
FT                   KHSHTFL"
FT   gene            686387..686830
FT                   /locus_tag="SAAV_0639"
FT   CDS_pept        686387..686830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0639"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10560"
FT                   /protein_id="ACY10560.1"
FT                   /translation="MRTLNKDEHNYIKQIANIHETLLSQAESNYKCTKLSIALRYEMIC
FT                   SRLEHTNDKIYIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALE
FT                   KWAKTMNAKRISSTIHKNNLPMISLNKDLGYQVSHVKMYKDID"
FT   gene            686897..687292
FT                   /locus_tag="SAAV_0640"
FT   CDS_pept        686897..687292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10561"
FT                   /protein_id="ACY10561.1"
FT                   /translation="MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKK
FT                   EKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQ
FT                   TKSSDKDNHKKPTSTDKDQKANDKHQS"
FT   gene            687430..687729
FT                   /locus_tag="SAAV_0641"
FT   CDS_pept        687430..687729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10562"
FT                   /protein_id="ACY10562.1"
FT                   /translation="MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHL
FT                   PNFESDTDTFVATYRLNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK"
FT   gene            687809..688351
FT                   /locus_tag="SAAV_0642"
FT   CDS_pept        687809..688351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0642"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10563"
FT                   /protein_id="ACY10563.1"
FT                   /translation="MIYCETERLILRDWHEDDLLPFQKMNANYDVRKYFPSLLSYRRSE
FT                   LDMRTMDAVIKDYGIGLFAVEDKESHQWIGFIGLNYIPETSDYPFKELPLYEIGWRLLP
FT                   EFWGKGLATEGAKATLKLAEEHQIYDVYSFTAEANKASQRVMEKIGMTVYDHFELPNLS
FT                   KYHLLKRQVRYYINLRK"
FT   gene            complement(688447..689013)
FT                   /locus_tag="SAAV_0643"
FT   CDS_pept        complement(688447..689013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10564"
FT                   /protein_id="ACY10564.1"
FT                   /translation="MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGI
FT                   MGAIQDGVLNHGGKAIGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMA
FT                   PGGAGSLEEFFEMYSWAQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALA
FT                   PLCDTKESLIESILNFKPLGTRSYD"
FT   gene            complement(689015..689473)
FT                   /locus_tag="SAAV_0644"
FT   CDS_pept        complement(689015..689473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0644"
FT                   /product="UPF0178 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10565"
FT                   /protein_id="ACY10565.1"
FT                   /translation="MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPH
FT                   VSTLYVDDGPDAVDYKIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQ
FT                   QLLDKRYMNAQIRKQGGRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD"
FT   gene            complement(689476..690159)
FT                   /locus_tag="SAAV_0645"
FT   CDS_pept        complement(689476..690159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10566"
FT                   /protein_id="ACY10566.1"
FT                   /translation="MDKKKVIKFMINVLPIVLVPLIVERKRIKQHPDVQKVTDATSKVA
FT                   SKTSAAISNTASDVKEYVGDKKQDFENKRELKKFAREHDPAYIEKKGEKLAKQNRKDAD
FT                   KMNKILQKNIEKRHKEEQKAREKNEIQRIKDMKKSQKYEEKAGLTPNKLDEKTEKKGDK
FT                   LAEKNRKEIAKMNKKLQKNIEKRHKEEQKRQQEADKARIKSFKKYKDYVAKSASQQNKE
FT                   NNTEA"
FT   gene            complement(690331..691206)
FT                   /gene="uppP"
FT                   /locus_tag="SAAV_0646"
FT   CDS_pept        complement(690331..691206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="SAAV_0646"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10567"
FT                   /protein_id="ACY10567.1"
FT                   /translation="MFIIELIKGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEFLG
FT                   SQSAFTFKIVIQLGSVFAAAWVFRERFLEILHIGKHKHVEGENDQQRRSKPRRLNLLHV
FT                   LVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSVKVKNPQTVDQIN
FT                   YFQAFVIGISQAVAMWPGFSRSGSTISTGVLMKLNHKAASDFTFIMAVPIMLAASGLSL
FT                   LKHYQDIQIADIPFYILGFLAAFTVGLIAIKTFLHLINKIKLIPFAIYRIVLVIFIAIL
FT                   YFGFGIGKGI"
FT   gene            691425..693056
FT                   /locus_tag="SAAV_0647"
FT   CDS_pept        691425..693056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0647"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10568"
FT                   /protein_id="ACY10568.1"
FT                   /translation="MKKLTTILFQYKIFPVLMFLVSTGLGILVITQNILIADFLAKIIR
FT                   HQFQGLWIVLFILLGVLLLRATVQFLNQWLGDTLAFKVKHMLRQRVIYKNNGHPIGEQM
FT                   TILTENIDGLAPFYKSYLPQVFKSMMVPLIIIIAMFFIHFNTALIMLITAPFIPLFYII
FT                   FGLKTRDESKDQMTYLNQFSQRFLNIAKGLVTLKLFNRTEQTEKHIYDDSTQFRTLTMR
FT                   ILRSAFLSGLMLEFISMLGIGLVALEATLSLVVFHNIDFKTAAIAIILAPEFYNAIKDL
FT                   GQAFHTGKQSEGASDVVFEFLEQPNYNNEFLLKYEENQKPFIQLTDISFRYDDSDRLVL
FT                   NDLNLEIFKGDQIALVGPSGAGKSTLTHLIAGVYQPTIGTISTNQRDLNIGILSQQPYI
FT                   FSASIKENITMFKDIENNTIEEVLDEVGLLDKVQSFTKGINTIIGEGGEMLSGGQMRRI
FT                   ELCRLLVMKPDLVIFDEPATGLDIQTEHMIQNVLFQHFKDTTMIVIAHRDNTIRHLQRR
FT                   LYIENGRLIADDRNISVNITENGDDL"
FT   gene            693053..694726
FT                   /locus_tag="SAAV_0648"
FT   CDS_pept        693053..694726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0648"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10569"
FT                   /protein_id="ACY10569.1"
FT                   /translation="MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGA
FT                   PLYALMILVVTVKLFGFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRK
FT                   LSSSDLISRMISRVEALQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLF
FT                   TLLIVPWLSSKKARTLKKHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLN
FT                   HFDKLQLKEQRFLTIYDFILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMILTL
FT                   FEQAVPMTNVAYYKADTDQALHDINEVISVPSTNGKKRLNDKYDATNIYEVKDASFKYW
FT                   NQQTYVLSDINFNVNRGEKIAIVGPSGSGKSTLLQIMAGLYQLDSGSVRFENMDMFEID
FT                   DKDKFESLNVLLQSQQLFDGTIRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHT
FT                   LSGGEIQRLAITRMLLKDTASTWILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLT
FT                   LLSRFETIIVMINGKIVEKGNYQQLLANQGALWNMIQYNA"
FT   gene            complement(694853..695296)
FT                   /gene="norR"
FT                   /locus_tag="SAAV_0649"
FT   CDS_pept        complement(694853..695296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norR"
FT                   /locus_tag="SAAV_0649"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10570"
FT                   /protein_id="ACY10570.1"
FT                   /translation="MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLT
FT                   ILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSET
FT                   IRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK"
FT   gene            695523..696449
FT                   /locus_tag="SAAV_0650"
FT   CDS_pept        695523..696449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0650"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10571"
FT                   /protein_id="ACY10571.1"
FT                   /translation="MKNNKDEKIRISIINGFLGSGKTTLLTHYISELLKNDEKIKIIMN
FT                   EFGTFDIDSNSISNEIEVHSLINGCVCCDLKQELVYELKAIALKGDVNHVIIEATGIAH
FT                   PLELLVACQDPQIVNFFEKPIIYGVLDATRFLERHQYTENTVSLMEDQLKLSDMIIINK
FT                   IDLITDDSLEKIDKQLGMICASIPTYKTTYGKVSLEELDLTVKDREISSHHHHHHGIKS
FT                   MTYTFTGPIDRQLFYQFIMKLPESVLRLKGYVSFRNQPNAIYEFQYAYGLPDYGIIGMQ
FT                   LPLTIVIIGETLDTNHIRNQLDMLQFT"
FT   gene            696552..697460
FT                   /locus_tag="SAAV_0651"
FT   CDS_pept        696552..697460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0651"
FT                   /product="aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10572"
FT                   /protein_id="ACY10572.1"
FT                   /translation="MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGIT
FT                   TMDHADIYGDYQCESLFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSK
FT                   HIVKSVEQSLINLNVDYLDSLLIHRPSPLMDPEQVADALTKLVKQGKLKSFGVSNFNHS
FT                   QYQLLNQYIMKERLHISINQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFD
FT                   KEDIKAQRIMKVVQSIADKYGVSDTAVMIAWLVKIPHSIMPILGTSQLKRIDQAIEGLQ
FT                   LNLDDQSWFDIYTAIIGQDIP"
FT   gene            697495..697782
FT                   /locus_tag="SAAV_0652"
FT   CDS_pept        697495..697782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10573"
FT                   /protein_id="ACY10573.1"
FT                   /translation="MTNEDKRFEQLRFERKFIVIPYLIYAVIVLLLNIFYSDLKITMTL
FT                   FGLFFAYNVVILFIAFIKHYKRTLLLSLILTVLSGAAFFGIIYVYGINHF"
FT   gene            698065..699618
FT                   /locus_tag="SAAV_0653"
FT   CDS_pept        698065..699618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0653"
FT                   /product="anion transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10574"
FT                   /protein_id="ACY10574.1"
FT                   /translation="MSEEKHVVEHEQQKKEKTKKQYKPFWIVMSFIILIVVLLLPAPSS
FT                   LPIMAKAVLAILAFAVIMWVTEAVSYPVSATLIIGLMILLLGFSPVQNLGEKLGNPKSG
FT                   SAILAGSDLLGTNHALSLAFSGYATSAVALVAAALFLAAAMQETNLHKRLALLVLSIVG
FT                   NKTRNIVIGAIIVSIVLAFFVPSATARAGAVVPILLGMIAAFKVSKDSKLASLLIITSV
FT                   QAVSIWNIGIKTAAAQNIVAINFINHQLGFDVSWGEWFLYAAPWSIVMSVALYFIMIKV
FT                   MPPEINTIEGGKDLIKEELHKLGPVSPREWRLIVISMLLLLFWSTEKVLHPIDSASITI
FT                   IALGVMLMPKIGVMTWKHVENKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLG
FT                   LKHLPIIATIALITLFNILIHLGFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQ
FT                   FVISFGFLLPVSAPQNMLAYGTGTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGLL
FT                   "
FT   gene            699704..701077
FT                   /locus_tag="SAAV_0654"
FT   CDS_pept        699704..701077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0654"
FT                   /product="deoxyribodipyrimidine photolyase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10575"
FT                   /protein_id="ACY10575.1"
FT                   /translation="MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSAS
FT                   DLKAQFYRGTLQRFYQSLHAEKLTPYVMSYDDIISFCKENNISEVVIAGDIMSYHLEEY
FT                   DILHQRSLFNEARIAVTLIRGNHYFKASKTMNQQGEPYKVFTSFYRKWRPYLRHRDVYH
FT                   YDLKSFEDFVIASPDDLVFDDIAFGSSQVIEQNKWQHFLDQDIQNYESGRDYLPEVLTS
FT                   QLSVALAYGLLDIIEIFNDLLARYDEDEANHEAFIRELIFREFYYVLMTQYPETSYQAF
FT                   KPKYRQIKWSQNEANFNAWCEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLF
FT                   IDWTWGEKFFRKHLIDYDAASNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYI
FT                   KTYLPIFNQIDAKYLHDTQRNESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD"
FT   gene            complement(701513..702133)
FT                   /locus_tag="SAAV_0655"
FT   CDS_pept        complement(701513..702133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10576"
FT                   /protein_id="ACY10576.1"
FT                   /translation="MMQSRYIARIYFLILFIVSLFETKIFQFMTLNLFLAYIPFELSLL
FT                   LRLFKPNKKYEWPLFIIYSFIFVLLLPNTFYMVTDLIHLNQFQFNFYAGLNLSEWKYFT
FT                   YLLLGVFLAVYVMILIYFEILTLTSHRWLNRLIVVVLMFLNGFGIYIGRFLRLHSVYFF
FT                   NEPLHVLNHILESLTLKTAMFVCFMVVMQAAILLFGKGVRLNK"
FT   gene            complement(702316..702738)
FT                   /locus_tag="SAAV_0656"
FT   CDS_pept        complement(702316..702738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10577"
FT                   /protein_id="ACY10577.1"
FT                   /translation="MKLQKSNHTILLVLEKGEDIVECITTFADDQDLTFTSVSGIGACD
FT                   DVVLKFFNLTTKQYEEKHITEPLELTSLLGNISRLDNGHFAHLHATFGTQSYETFSGHL
FT                   AKAIVSATAEIILTVTDLDIQRSFKDAVGLNLLDPQ"
FT   gene            702947..704113
FT                   /gene="norA"
FT                   /locus_tag="SAAV_0657"
FT   CDS_pept        702947..704113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norA"
FT                   /locus_tag="SAAV_0657"
FT                   /product="multi drug resistance protein NorA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10578"
FT                   /protein_id="ACY10578.1"
FT                   /translation="MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVA
FT                   AFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMS
FT                   AGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAG
FT                   ALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFE
FT                   TLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVV
FT                   VLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGN
FT                   FIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM"
FT   gene            704406..704858
FT                   /locus_tag="SAAV_0658"
FT   CDS_pept        704406..704858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10579"
FT                   /protein_id="ACY10579.1"
FT                   /translation="MTVKNLFLGFVAVILTVCLIGLLILATNEDALAKVHKTINTLNAI
FT                   NVSTEDTYKKKMDILNIHTAKASEVNENVEKQNHFKHRVNANKSNSFNEQECQVIADRY
FT                   ADKHINDNYGLERISKTNHGYNYVYSNDNSTSKQHVSISNQGIITK"
FT   gene            705032..705514
FT                   /locus_tag="SAAV_0659"
FT   CDS_pept        705032..705514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0659"
FT                   /product="ebsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10580"
FT                   /protein_id="ACY10580.1"
FT                   /translation="MAKNKKTNAMRMLDRAKIKYEVHSFEVPEEHLSGAEVAELIQANV
FT                   KTVFKTLVLENTKHEHFVFVIPVSETLDMKKAAALVGEKKLQLMPLDNLKNVTGYIRGG
FT                   CSPVGMKTLFPTVVDKSCENYSHISVSGGLRTMQITIAVEDLITITKGKIGAVIHE"
FT   gene            705764..706528
FT                   /locus_tag="SAAV_0660"
FT   CDS_pept        705764..706528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0660"
FT                   /product="DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10581"
FT                   /protein_id="ACY10581.1"
FT                   /translation="MMIITEKRHELILEELSHKDFLTLQELIDRTGCSASTIRRDLSKL
FT                   QQLGKLQRVHGGAMLKENRMIEANLTEKLATNLDEKKMIAKIAANQINDNECLFIDAGS
FT                   STLELIKYIQAKDIIVVTNGLTHVEALLKKGIKTIMLGGQVKENTLATIGSSAMEILRR
FT                   YCFDKAFIGMNGLDIELGLTTPDEQEALVKQTAMSLANQSFVLIDHSKFNKVYFARVPL
FT                   LESTTIITSEKALNQESLKEYQQKYHFIGGTL"
FT   gene            706525..707445
FT                   /gene="fruK"
FT                   /locus_tag="SAAV_0661"
FT   CDS_pept        706525..707445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="SAAV_0661"
FT                   /product="1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10582"
FT                   /protein_id="ACY10582.1"
FT                   /translation="MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRV
FT                   LKTLDVESTALGFAGGFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAP
FT                   GPHITSTQFEQLLQQIKNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAE
FT                   KELAESVLPFHPLFIKPNKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDG
FT                   AIYIDKEISIKAVNPQGKVVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAF
FT                   DEDLATRDAIEKIKSQVTISVLDGE"
FT   gene            707451..709409
FT                   /locus_tag="SAAV_0662"
FT   CDS_pept        707451..709409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0662"
FT                   /product="fructose specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10583"
FT                   /protein_id="ACY10583.1"
FT                   /translation="MRVTELLTKDTIAMDLMANDKNGVIDELVNQLDKAGKLSDVASFK
FT                   EAIHNRESQSTTGIGEGIAIPHAKVAAVKSPAIAFGKSKEGVDYQSLDMQPAHLFFMIA
FT                   APEGGAQTHLDALAKLSGILMDENVREKLLHASSPEEVLAIIDEADDEVTKEEEAEAEA
FT                   QQVATAEQSSKQSNEPYVLAVTACPTGIAHTYMARDALKKQADKMGIKIKVETNGSSGI
FT                   KNHLTEQDIENATGIIVAADVHVETDRFDGKNVVEVPVADGIKRPEELINKALDTSRKP
FT                   FVARDGQRKGNSNDSQEKLSPGKAFYKHLMNGVSNMLPLVISGGILMAIVFLFGANSFN
FT                   PKSSEYNAFAEQLWNIGSKSAFALIIPILSGFIARSIADKPGFASGLVGGMLAISGGSG
FT                   FIGGIIAGFLAGYLTQGVKAMTRKLPQALEGLKPTLIYPLLTVTATGLLMIYVFNPPAS
FT                   WLNHLLLDGLNNLSGSNIVLLGLVIGAMMAIDMGGPFNKAAYVFATGALIEGNAAPITA
FT                   AMIGGMIPPLAIATAMLIFRRKFTKEQRGSIIPNYVMGMSFITEGAIPFAAADPLRVIP
FT                   SMMIGSGIGGAIALGLGSRITAPHGGIIVIVGTDGAHLLQTLIALLVGTLVSALIYGLI
FT                   KPKLTETEIEASKSMDE"
FT   gene            709717..710898
FT                   /gene="nagA"
FT                   /locus_tag="SAAV_0663"
FT   CDS_pept        709717..710898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="SAAV_0663"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10584"
FT                   /protein_id="ACY10584.1"
FT                   /translation="MSELIIYNGKVYTEDGKIDNGYIHVKDGQIVAIGEGDDKAAIDND
FT                   TTNKIQVIDAKGHHVLPGFIDIHIHGGYGQDAMDGSYDGLKYLSENLLSEGTTSYLATT
FT                   MTQSTDKIDKALTNIAKYEAEQDVHNAAEIVGIHLEGPFISENKVGAQHPQYVVRPFID
FT                   KIKHFQETANRLIKIMTFAPEVEGAKEALETYKDDIIFSIGHTVATYEEAVEAVERGAK
FT                   HVTHLYNAATPFQHREPGVFGAAWLNDALHTEMIVDGTHSHPASVAIAYRMKGNERFYL
FT                   ITDAMRAKGMPEGEYDLGGQKVTVQSQQARLANGALAGSILKMNHGLRNLISFTGDTLD
FT                   HLWRVTSLNQAIALGIDDRKGSIKVNKDADLVILDDDMNVKSTIKQGKVHTFS"
FT   gene            711119..712468
FT                   /locus_tag="SAAV_0664"
FT   CDS_pept        711119..712468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0664"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10585"
FT                   /protein_id="ACY10585.1"
FT                   /translation="METSTIISLIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGN
FT                   KPAKIVKKMIANLDYYLSACQLGITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTT
FT                   ISFAVSFIIVTYLHVVLGELAPKSIAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSA
FT                   RVIIRMFGVNPDAQTDAMSEEEIKIIINNSYNGGEINQTELAYMQNIFSFDERHAKDIM
FT                   VPRTQMITLNEPFNVDELLETIKEHQFTRYPITDDGDKDHIKGFINVKEFLTEYASGKT
FT                   IKIANYIHELPMISETTRISDALIRMQREHVHMSLIIDEYGGTAGILTMEDILEEIVGE
FT                   IRDEFDDDEVNDIVKIDNKTFQVNGRVLLDDLTEEFGIEFDDSEDIDTIGGWLQSRNTN
FT                   LQKDDYVDTTYDRWVVSEIDNHQIIWVILNYEFNEARPTIGQSDEDEKSE"
FT   gene            712690..713529
FT                   /locus_tag="SAAV_0665"
FT   CDS_pept        712690..713529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0665"
FT                   /product="aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10586"
FT                   /protein_id="ACY10586.1"
FT                   /translation="MLNEIQILNNGYPMPSVGLGVYKISDEDMTKVVNAAIDAGYRAFD
FT                   TAYFYDNEASLGRALKDNGVDREDLFITTKLWNDYQGYEKTFEYFNKSIENLQTDYLDL
FT                   FLIHWPCEADGLFLETYKAMEELYEQGKVKAIGVCNFNVHHLEKLMAQSSIKPMVNQIE
FT                   VHPYFNQQELQEFCDRHDIKVTAWMPLMRNRGLLDNPVIVKIAEKYHKTPAQVVLRWHL
FT                   AHNRIIIPKSQTPKRIQENIDILDFNLELTEVAEIDALDRNARQGKNPDDVKIGDLK"
FT   gene            713661..714644
FT                   /locus_tag="SAAV_0666"
FT   CDS_pept        713661..714644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0666"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10587"
FT                   /protein_id="ACY10587.1"
FT                   /translation="MKIRVVIPCFNEGEVITQTHQQLTEILSQDSSVKGYDYNMLFIDD
FT                   GSTDTTIDEMQHLATIDRHVSFISFSRNFGKEAAMIAGYQHSTEFDAVIMIDCDLQHPP
FT                   EYIPKMVEGFMEGYDQVIAKRDRSGENFSRKTLSHLYYKLVNCFVEEVQFDDGVGDFRL
FT                   LSQRAVKSIASLEEYNRFSKGLFEWIGYNTKVFTYQNVERQKGESKWSFKKLFNYGIDG
FT                   LISFNSKPLRMMIYLGLFIFSISVLYIIYLFINIMISGVNIPGYFSTIAAILLLGGIQL
FT                   ISIGVVGEYIGRIYYEVKVRPKYIIQATNLSSIENDEKDTHKVYSK"
FT   gene            complement(714716..715771)
FT                   /gene="saeS"
FT                   /locus_tag="SAAV_0667"
FT   CDS_pept        complement(714716..715771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="saeS"
FT                   /locus_tag="SAAV_0667"
FT                   /product="sensor histidine kinase SaeS"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10588"
FT                   /protein_id="ACY10588.1"
FT                   /translation="MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTT
FT                   IITSCLTLLICSIFINPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNK
FT                   MASEITQQMNQIKSEQQEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESY
FT                   DILIKQANRLSTLFDDMTHIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLE
FT                   VNFCSEIDAFYQYRTPLERILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEG
FT                   IGIIPELQERIFERTFRVENSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTM
FT                   TVTLHKLDITS"
FT   gene            complement(715771..716457)
FT                   /gene="saeR"
FT                   /locus_tag="SAAV_0668"
FT   CDS_pept        complement(715771..716457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="saeR"
FT                   /locus_tag="SAAV_0668"
FT                   /product="DNA-binding response regulator SaeR"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10589"
FT                   /protein_id="ACY10589.1"
FT                   /translation="MTHLLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDI
FT                   DIMVLDIMMPEVNGYDIVKEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPFS
FT                   PRELVLRINNLLTRMKKYHHQPVEQLSFDELTLINLSKVVTVNGHEVPMRIKEFELLWY
FT                   LASRENEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEKESFTTYTITTVWGLGY
FT                   KFERSR"
FT   gene            complement(716432..716905)
FT                   /locus_tag="SAAV_0669"
FT   CDS_pept        complement(716432..716905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10590"
FT                   /protein_id="ACY10590.1"
FT                   /translation="MNKLLLLVTFIIRVGSGIVMLMQGYEKLTGGFTLKGLVPVIANNT
FT                   DSPEWYKWFFANIVAHTTSLFDIVVPLGEIAIGLGLIFGVFAYAASFFGAFVMINYILA
FT                   DMIFTYPLQLTFFILLLMSHSLLKQISLKEIINYFRGRKNRGEKIDDPLTDRG"
FT   gene            complement(717248..717688)
FT                   /locus_tag="SAAV_0670"
FT   CDS_pept        complement(717248..717688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10591"
FT                   /protein_id="ACY10591.1"
FT                   /translation="MNTKYFLAVGAVASVLTLGACGNSNSQDQGNKTEQKTKSEDSNVK
FT                   TDKTKHLTGTFSSKNGETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEI
FT                   AMVDYDKEKQTFDLKNVDLSKYDEVTIYCKKAHVIFGGAKLK"
FT   gene            complement(717968..718552)
FT                   /locus_tag="SAAV_0671"
FT   CDS_pept        complement(717968..718552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10592"
FT                   /protein_id="ACY10592.1"
FT                   /translation="MILYILINIAIVVLITGFNLYRHQMQHLSLSAMLLSITINAFINT
FT                   FIIDKYNFITLCTITMFIIWTILQFYIDKKLKPVYITDQKFIAIILTIVVSLTQRVTDF
FT                   SSTQSIYMSIPFLAPAIFIIGGIMLFISTFNSLDETAENNNKIKKLMIKGLIIINISFI
FT                   VMMVLTPYWYLYLIVYLIFLLFLLWQKVYKF"
FT   gene            complement(718651..719364)
FT                   /locus_tag="SAAV_0672"
FT   CDS_pept        complement(718651..719364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0672"
FT                   /product="radical activating enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10593"
FT                   /protein_id="ACY10593.1"
FT                   /translation="MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFT
FT                   WDGSAKGDIKLMTAEEIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFS
FT                   ALETQGSKFQPWMTQIDDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDK
FT                   DYDFAKMIHHRYPDIPFYLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYV
FT                   LPQLHTLLWSNKKGV"
FT   gene            complement(719368..719787)
FT                   /locus_tag="SAAV_0673"
FT   CDS_pept        complement(719368..719787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0673"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10594"
FT                   /protein_id="ACY10594.1"
FT                   /translation="MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTY
FT                   FVNLTIVGDKLDDTGFLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQI
FT                   VKENLASLEHQPKCIQVFVRETPTSYVVFRPKEQV"
FT   gene            complement(719789..720457)
FT                   /locus_tag="SAAV_0674"
FT   CDS_pept        complement(719789..720457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0674"
FT                   /product="exsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10595"
FT                   /protein_id="ACY10595.1"
FT                   /translation="MESVLNNEKAIVVFSGGQDSTTCLFYAKKHFKEVELVTFNYGQRH
FT                   DTEIEVAKQIAQDQGMKHHVLDMSLLSQLTPNALTQHDMEITNNEDGIPNTFVPARNLL
FT                   FLSFAGALAYQIGAKHIITGVCETDFSGYPDCRDSFIKSMNVTLSLAMDKDFVIHTPLM
FT                   WLNKAETWKLSDELEVLDYIRTKTLTCYNGIIGDGCGECPACHLRQRGLNQYLESKGAL
FT                   "
FT   gene            720808..721401
FT                   /gene="pabA"
FT                   /locus_tag="SAAV_0675"
FT   CDS_pept        720808..721401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="SAAV_0675"
FT                   /product="para-aminobenzoate synthase, glutamine
FT                   amidotransferase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10596"
FT                   /protein_id="ACY10596.1"
FT                   /translation="MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKP
FT                   KAIVISPGPGNPDDYPILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGH
FT                   TTQLRHTNEGIFQGLPQNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPV
FT                   FGVQYHPESILSEYGYRQVELFLSKVGDYCENRI"
FT   gene            721385..722536
FT                   /locus_tag="SAAV_0676"
FT   CDS_pept        721385..722536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0676"
FT                   /product="putative para-aminobenzoate synthase component"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10597"
FT                   /protein_id="ACY10597.1"
FT                   /translation="MRIEYNYRYYLTENEYKQYHIQLKGFIKKYVATKLADVGEVIHFA
FT                   QAQQRQGRYVSLYLSYEAAKYFNHVMCTHSLAKDDIYAVAYSFEKAESINSTYEHQTSY
FT                   VSKHHFSFVESSEVMMTNIKRVQQAIVEGETYQVNYTARLTDNIYYPISTLYERLTQFS
FT                   NGNYTALLQTDEIQVASISPELFFQKGQFNNVDNVIISKPMKGTMPRGKTEAEDQQYYK
FT                   TLQTSSKDRAENVMIVDLLRNDIGRISQSGSIKVYKLFFIEAYKTVFQMTSMVSGTLKT
FT                   NTDLTQILTSLFPCGSITGAPKLNTMKYIKQFESSPRGIYCGAIGLLLPTEDDKMIFNI
FT                   PIRTIEYKYGQAIYGVGAGITIDSKPKDEVNEFYAKTKILEML"
FT   gene            722536..723144
FT                   /locus_tag="SAAV_0677"
FT   CDS_pept        722536..723144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0677"
FT                   /product="putative anthranilate/para-aminobenzoate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10598"
FT                   /protein_id="ACY10598.1"
FT                   /translation="MQLFETMKIDNGHIPRLTYHTNRIKCSSERLNFKFDEHAWRNELN
FT                   DVTTKYHSGQYRLKIVLNAESKFETIVSPLPEKSSFTAKFQVLPKVVNPTFIKNKTTER
FT                   KHLAHNHETDLILLTSEDGKVLEFDIGNIVIEEDGKWYTPSYKDDFLKGCMRDYLIDSD
FT                   KLVEKDFNKNELIYKYHNNEIRLFLINSLREVADVHLCL"
FT   gene            723504..724214
FT                   /locus_tag="SAAV_0678"
FT   CDS_pept        723504..724214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10599"
FT                   /protein_id="ACY10599.1"
FT                   /translation="MKIYSQGDQAIVVAIEKEVSKSLTEDLLTLRSYLIEQNYPFIIEI
FT                   VPSESDMMIVYDARDMIKHHNIQSPFLYMKALIESIHLNIKHDFNQQDLIEIPIVYGSK
FT                   YGPDIESLLKHYKIKLETFIELHSKTQYFVSMMGYSPGFPYLTGLNKKLYINHTSKQKK
FT                   FIPAGSVVLEGKKCGIVTTDTINDWLVIGYTPLSLFNPKESDFARLKLGDNIKFRPINE
FT                   NELDVGAFKDVNHN"
FT   gene            724198..725202
FT                   /locus_tag="SAAV_0679"
FT   CDS_pept        724198..725202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10600"
FT                   /protein_id="ACY10600.1"
FT                   /translation="MSIIIEKSGLFSSFQDFGRRGYEHDGVIPCGALDTLAHEIANRLV
FT                   ANDKNEATLEMTNKMATIRFTEPTLIALAGGNVKAYTEHMTISPYKLYLLDKGDVLKFR
FT                   ETSYTSRVYLAVGGGFELDAWLGSNSTDFNVKIGGFKGRTLQDGDEIKLKRDYTARHHK
FT                   LFENLAHTKQTDWGIDGYALSFNYMSDVFHVVKNKGTEDFKEDAIQRFVKHDYKVTSKA
FT                   NRMGMMLEGEKIKAFYEDMPPYQTVKKGTIQIKRDGTPIILLNDHYTLGSYPQIGTIAS
FT                   YHLTKLAQKPQGSRLKFQFIDILTAEKNLVKYSNWLNQLFHGIEYRMQLEMMK"
FT   gene            725676..727616
FT                   /locus_tag="SAAV_0680"
FT   CDS_pept        725676..727616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0680"
FT                   /product="sulfatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10601"
FT                   /protein_id="ACY10601.1"
FT                   /translation="MSSQKKKISLFAFFLLTVITITLKTYFSYYVDFSLGVKGLVQNLI
FT                   LLMNPYSLVALVLSVFLFFKGKKAFWFMFIGGFLLTFLLYANVVYFRFFSDFLTFSTLN
FT                   QVGNVESMGGAVSASFKWYDFVYFIDTLVYLFILIFKTKWLDTKAFSKKFVPVVMAASV
FT                   ALFFLNLAFAETDRPELLTRTFDHKYLVKYLGPYNFTVYDGVKTIENNQQKALASEDDL
FT                   TKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNKLSSG
FT                   KEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQKQG
FT                   YKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSANYQ
FT                   AKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIND
FT                   LKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG
FT                   GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVN
FT                   GKIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYK
FT                   YETGPKANSKK"
FT   gene            727892..729769
FT                   /locus_tag="SAAV_0681"
FT   CDS_pept        727892..729769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0681"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10602"
FT                   /protein_id="ACY10602.1"
FT                   /translation="MEAYKIEHLNKSYADKTIFDNLDLSISEGEKIGLVGINGTGKSTL
FT                   LKVIGGIDDDFTANVMHPNQYRIRYSSQKQDLNEDMTVFDAVLSSDTTTLRIIKQYEQA
FT                   VQAYADDQSDKLFKRMIDAQDAMDQHDAWDYNAEIKTILSKLGIHDTTKYIKELSGGQQ
FT                   KRVVLAKTLIEQPDLLLLDEPTNHLDFESISWLINYVKQYPHTVLFVTHDRYFLNEVST
FT                   RIIELNRGKLASYPGNYESYIEMRAEREVTLQKQQQKQRALYKEELAWMRAGAKARTTK
FT                   QQARINRFNDLENEVNQQYKDDKGELNLAYSRLGKQVFELEDLSKAINDKVLFEHLTEI
FT                   IQKGERIGVVGPNGAGKTTLLNILSGEDQQFEGKLKTGQTVKVAYFKQTDETLDRDIRM
FT                   IDYLREESEVAKEKDGTSVSITQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHQ
FT                   PNVLLLDEPTNDLDTETLTILEDYIHTFGGTVITVSHDRYFLNKVAQSYWFIHDGQMEK
FT                   IIGTFEDYESYKKSLDKNKSTLKQQSKSYTTVRKKNGLSYKEKLEYEQLMKRIEQAEVR
FT                   MEEIDVLMIEASADYGKIKELNEEKEQLEIQYDLDITRWSELEEIKEQQ"
FT   gene            729781..731562
FT                   /gene="recQ1"
FT                   /locus_tag="SAAV_0682"
FT   CDS_pept        729781..731562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ1"
FT                   /locus_tag="SAAV_0682"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10603"
FT                   /protein_id="ACY10603.1"
FT                   /translation="MMQQTLSHYFGYETFRPGQEEIISKVLDHRNVLGVLPTGGGKSIC
FT                   YQVPGLLLGGTTIVISPLISLMKDQVDQLKAMGIQAAFLNSSLTQKEQQRIEKALSNGE
FT                   IQFLYVAPERFENRYFLNMLQRIKIHLVAFDEAHCISKWGHDFRPSYQNVISKVFTLPQ
FT                   DFTIIALTATATVEVQQDIREKLNIAQTDQIKTSTKRRNLIFKVNPTYQRQKFILDYIK
FT                   THDEDAGIIYCSTRKQVEELQEALESQKIESVIYHAGLSNKEREEAQNDFLFDRVKVVV
FT                   ATNAFGMGIDKSNVRFVIHYNMPGDLESYYQEAGRAGRDGLKSECILLFSERDINLHEY
FT                   FITVSQADDDYKDKMGEKLTKMIQYTKTKKCLEATIVHYFEPNEKLEECEQCSNCVQQD
FT                   KSYNMTQEAKMIISCIARMKQQESYSVIIQVLRGESTDYIKYKGYDQISTHGLMKGYTT
FT                   SELSHLIDELRFKGFLNENDEILMCDTSIKKLLSNEVEVFTTPFKQKATEKVFINTVEG
FT                   VDRVLFSQLVEVRKKLSDKLTIAPVSIFSDYTLEEFAKRKPASKQDMINIDGVGSYKLK
FT                   HYCPAFLETIQNYKAKV"
FT   gene            731784..732761
FT                   /locus_tag="SAAV_0683"
FT   CDS_pept        731784..732761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0683"
FT                   /product="osmoprotectant ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10604"
FT                   /protein_id="ACY10604.1"
FT                   /translation="MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLK
FT                   MINRLIHLSEGYIYFKDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKK
FT                   WKEKDIDKRVDELLDMVGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPF
FT                   SALDPISREKLQDDLIELQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEG
FT                   FKNNPQSEFVKQFMGSHLEDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIE
FT                   VLYQHLSESERVIVMQEDSVGQYVIDRKDIFKYLSQKKEVAQHD"
FT   gene            732754..734268
FT                   /locus_tag="SAAV_0684"
FT   CDS_pept        732754..734268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0684"
FT                   /product="osmoprotectant ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10605"
FT                   /protein_id="ACY10605.1"
FT                   /translation="MTNFFDILSERKGQLFSTMIEHIQISFIALLIATAIAVPLGILLT
FT                   KTKTISEIVMNIAAILQTIPSLALLGLMIPLFGIGRVPAIIALVVYALLPILRNTYTGI
FT                   KEVDPSLIEAAKGIGMKPFRRLTKVELPIAMPVIMAGVRTAMVLIIGTATLAALIGAGG
FT                   LGDLILLGIDRNNASLILLGAIPAALLAIIFDLILRFMAKLSYKKLLMTLGVIVMIIIL
FT                   AIAIPMFAQKGDKITLAGKLGSEPSIITNMYKILIEEETKNTVEVKDGMGKTAFLFNAL
FT                   KSDDIDGYLEFTGTVLGELTKEPLKSKEEKKVYEQAKQSLEKKYQMTMLKPMKYNNTYA
FT                   LAVKRDFAKQHNIRTIGDLNKVKDQLKPGFTLEFNDRPDGYKAVQKAYNLNLDNIRTME
FT                   PKLRYQAINKGNINLIDAYSTDAELKQYDMVVLKDDKHVFPPYQGAPLFKESFLKKHPE
FT                   IKKPLNKLENKISDEDMQMMNYKVTVKNEDPYTVAKDYLKAKGLIK"
FT   gene            734508..735566
FT                   /gene="hisC"
FT                   /locus_tag="SAAV_0685"
FT   CDS_pept        734508..735566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="SAAV_0685"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10606"
FT                   /protein_id="ACY10606.1"
FT                   /translation="MKEQLNQLSAYQPGLSPRALKEKYGIEGDLYKLASNENLYGPSPK
FT                   VKEAISAHLDELYYYPETGSPTLKAAISKHLNVDQSRILFGAGLDEVILMISRAVLTPG
FT                   DTIVTSEATFGQYYHNAIVESANVIQVPLKDGGFDLEGILKEVNEDTSLVWLCNPNNPT
FT                   GTYFNHESLDSFLSQVPPHVPVIIDEAYFEFVTAEDYPDTLALQQKYDNAFLLRTFSKA
FT                   YGLAGLRVGYVVASEHAIEKWNIIRPPFNVTRISEYAAVAALEDQQYLKEVTHKNSVER
FT                   ERFYQLPQSEYFLPSQTNFIFVKTKRVNELYEALLNVGCITRPFPTGVRITIGFKEQND
FT                   KMLEVLSNFKYE"
FT   gene            735905..736447
FT                   /locus_tag="SAAV_0686"
FT   CDS_pept        735905..736447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10607"
FT                   /protein_id="ACY10607.1"
FT                   /translation="MTRKSIAIDMDEVLADTLGEIIDAVNFRADLGIKMEALNGQKLKH
FT                   VIPEHDGLITEVLREPGFFRHLKVMPHAQEVVKKLTEHYDVYIATAAMDVPTSFSDKYE
FT                   WLLEFFPFLDPQHFVFCGRKNIVKADYLIDDNPRQLEIFTGTPIMFTAVHNINDDRFER
FT                   VNSWKDVEQYFLDNIEK"
FT   gene            complement(737326..738243)
FT                   /locus_tag="SAAV_0687"
FT   CDS_pept        complement(737326..738243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10608"
FT                   /protein_id="ACY10608.1"
FT                   /translation="MENKYTHGVLFYHEHSGLKNINQGIGEVTTALSSICKHLSIQLSE
FT                   NEGDIIKYCQEIKTKNYAKDVDILFILGGDGTVNELINGVMSHDLQLPIGILPGGTFND
FT                   FTKTLNIAPNHKQASEQMISAQVGTYDVIKINNQYALNFVGLGLIVQNAENVQDGSKDI
FT                   FGKLSYIGSTVKTLLNPTQFNYQLSIDDKTYSGETTMILTANGPFIGGSRIPLTDLSPQ
FT                   DGELNTFIFNEQSFSILNDIFKKRDSMNWNEITQGIEHIPGKKISLTTDPAMKVDIDGE
FT                   ISLETPIDIEVIPNAIQLLTVNDL"
FT   gene            complement(738513..740018)
FT                   /locus_tag="SAAV_0688"
FT   CDS_pept        complement(738513..740018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0688"
FT                   /product="proton-dependent oligopeptide transporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10609"
FT                   /protein_id="ACY10609.1"
FT                   /translation="MTQQNSHGNQIQDIPQTGFFGHPRGLGVLFFVEFWERFSYYGMRA
FT                   LLIFYMYFAVTDNGLGIDKTTAMSIMSVYGSLIYMTSIPGGWIADRITGTRGATLLGAV
FT                   FIIIGHICLSLPFALIGLFTSMFFIIIGSGLMKPNISNIVGRLYPENDRRMDAGFVIFY
FT                   MSVNMGALLSPIILQHFVNVKNFHGGFLIAAVGMALGLVWYVLFNRKNLGSVGMKPTNP
FT                   LTPAEKKKYGLIIGSVVLAIVLIIVIGALTNSLSFNLVSNTVLVLGIALPIIYFTLIIR
FT                   SKDVTDTERSRVKAFIPLFILGMVFWAIQEQGSNVLNIYGIEHSDMKLNLFGWKTNFGE
FT                   AIFQSINPLFILLLAPIISLLWQKLGTKQPSLPVKFAIGTFLAGASYILIGIVGYASGS
FT                   SNFSVNWVILSYIICVIGELCLSPTGNSAAVKLAPKAFNAQMMSIWYLTNASAQAINGT
FT                   LVKLIEPLGQTNYFIFLGVVAIIVTTIVLAFSPLIIKAMKGIR"
FT   gene            complement(740361..740861)
FT                   /locus_tag="SAAV_0689"
FT   CDS_pept        complement(740361..740861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0689"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10610"
FT                   /protein_id="ACY10610.1"
FT                   /translation="MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYF
FT                   VKFNCPEFTSLCPITGQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNI
FT                   IMNNLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKI
FT                   DNR"
FT   gene            complement(740881..741747)
FT                   /locus_tag="SAAV_0690"
FT   CDS_pept        complement(740881..741747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0690"
FT                   /product="integral membrane domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10611"
FT                   /protein_id="ACY10611.1"
FT                   /translation="MNPKVKGIIAILISAIGFSFMSVFFRLAGDLPVFQKSLARNLVAM
FT                   FIPLFFLYKYHQPMFGRLSSQPLLITRSTLGLIGVLLNIYAIDHMVLSDADSLMKLNPF
FT                   WTILLSIVFLHEKVRKYQITAMIIAILGMLLIVKPEFSSSMIPSLAGLFSGIFAASAYT
FT                   CVRALSSREAPYTIVFYFSLFSVIVLIPFTAYTYEPMSQMQILYLLGAGLAAAVGQIGV
FT                   TLAYSFAAAKDISIFTYASIIFTAILGFVLFGESPDFYATLGYVVIIGASYYMFEKARR
FT                   DAKIIKK"
FT   gene            742141..742398
FT                   /locus_tag="SAAV_0691"
FT   CDS_pept        742141..742398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0691"
FT                   /product="ribonucleoside-diphosphate reductase 2,
FT                   NrdH-redoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10612"
FT                   /protein_id="ACY10612.1"
FT                   /translation="MYNETHNIVLVKRKRHNILCFVCKCFIYEEITFKSNLTQKFNSYY
FT                   QLIVIFLENVLSKWKISNDVNTTYSDFYTFNPYKLLFSQI"
FT   gene            742548..742946
FT                   /gene="nrdI"
FT                   /locus_tag="SAAV_0692"
FT   CDS_pept        742548..742946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="SAAV_0692"
FT                   /product="ribonucleotide reductase stimulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10613"
FT                   /protein_id="ACY10613.1"
FT                   /translation="MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTG
FT                   TIGFGEVPEPVQSFLEVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELH
FT                   GKNKDVIEFKNKVGNFNENHGREKVQSY"
FT   gene            742909..745014
FT                   /gene="nrdE"
FT                   /locus_tag="SAAV_0693"
FT   CDS_pept        742909..745014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="SAAV_0693"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10614"
FT                   /protein_id="ACY10614.1"
FT                   /translation="MKTMEEKKYNHIELNNEVTKRREDGFFSLEKDQEALVAYLEEVKD
FT                   KTILFDTEIERLRYLVDNDFYFNVFDIYSEADLIEITDYAKSISFNFASYMSASKFFKD
FT                   YALKTNDKSQYLEDYNQHVAIVALYLANGNKAQAKQFISAMVEQRYQPATPTFLNAGRA
FT                   RRGELVSCFLLEVDDSLNSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGIAK
FT                   GVLPIAKSLEGGFSYADQLGQRPGAGAVYLNIFHYDVEEFLDTKKVNADEDLRLSTIST
FT                   GLIVPSKFFDLAKEGKDFYMFAPHTVKEEYGVTLDDIDLEKYYDDMVANPNVEKKKKNA
FT                   REMLNLIAQTQLQSGYPYLMFKDNANRVHPNSNIGQIKMSNLCTEIFQLQETSIINDYG
FT                   IEDEIKRDISCNLGSLNIVNVMESGKFRDSVHSGMDALTVVSDVANIQNAPGVRKANSE
FT                   LHSVGLGVMNLHGYLAKNKIGYESEEAKDFANIFFMMMNFYSIERSMEIAKERGIKYQD
FT                   FEKSDYANGKYFEFYTTQEFEPQFEKVRELFDGMAIPTSEDWKKLQQDVEQYGLYHAYR
FT                   LAIAPTQSISYVQNATSSVMPIVDQIERRTYGNAETFYPMPFLSPQTMWYYKSAFNTDQ
FT                   MKLIDLIATIQTHIDQGISTILYVNSEISTRELARLYVYAHYKGLKSLYYTRNKLLSVE
FT                   ECTSCSI"
FT   gene            745132..746103
FT                   /gene="nrdF"
FT                   /locus_tag="SAAV_0694"
FT   CDS_pept        745132..746103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="SAAV_0694"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10615"
FT                   /protein_id="ACY10615.1"
FT                   /translation="MIAVNWNTQEDMTNMFWRQNISQMWVETEFKVSKDIASWKTLSEA
FT                   EQDTFKKALAGLTGLDTHQADDGMPLVMLHTTDLRKKAVYSFMAMMEQIHAKSYSHIFT
FT                   TLLPSSETNYLLDEWVLEEPHLKYKSDKIVANYHKLWGKEASIYDQYMARVTSVFLETF
FT                   LFFSGFYYPLYLAGQGKMTTSGEIIRKILLDESIHGVFTGLDAQHLRNELSESEKQKAD
FT                   QEMYKLLNDLYLNEESYTKMLYDDLGITEDVLNYVKYNGNKALSNLGFEPYFEEREFNP
FT                   IIENALDTTTKNHDFFSVKGDGYVLALNVEALQDDDFVFDNK"
FT   gene            746478..747449
FT                   /locus_tag="SAAV_0695"
FT   CDS_pept        746478..747449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0695"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10616"
FT                   /protein_id="ACY10616.1"
FT                   /translation="MKYLLKGNILLLLLILLTIISLFIGVSELSIKDLLHLTESQRNIL
FT                   FSSRIPRTMSILIAGSSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALLFFPTG
FT                   HILLKLVFAVICSICGTFLFVKIIDFIKVKDVIFVPLLGIMMGGIVASFTTFISLRTNA
FT                   VQSIGNWLNGNFAIITSGRYEILYLSIPLLALTYLFANHFTIVGMGKDFTNNLGLSYEK
FT                   LINIALFITATITALVVVTVGTLPFLGLVIPNIISIYRGDHLKNAIPHTMMLGAIFVLF
FT                   SDIVGRIVVYPYEINIGLTIGVFGTIIFLILLMKGRKNYAQQ"
FT   gene            747436..748392
FT                   /locus_tag="SAAV_0696"
FT   CDS_pept        747436..748392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0696"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10617"
FT                   /protein_id="ACY10617.1"
FT                   /translation="MRNNNKKIMLLIAVTLLISMLYLFVGIDFEIFEYQFSSRLRKFIL
FT                   IILVGAAIATSVVIFQAITNNRLLTPSIMGLDAVYLFIKVLPVFLFGIQSVWVTNVYLN
FT                   FILTLITMVLFALILFQGIFKIGHFSIYFILLIGVLLGTFFRSITGFIQLIMDPESFLA
FT                   IQSSMFANFNASNSNLVTFSAVLLVILLVITILLLPYLDVLLLGRAEAINLGISYEKLT
FT                   RILLVIVSVLVSVSTALVGPITFLGLLTVNLAHELMKTYEHKYILIATICLSWISLFSA
FT                   QWVVENVFEATTEMSILIDLIGGSYFIYLLVRRRNAQ"
FT   gene            748389..749150
FT                   /locus_tag="SAAV_0697"
FT   CDS_pept        748389..749150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0697"
FT                   /product="iron compound ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10618"
FT                   /protein_id="ACY10618.1"
FT                   /translation="MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLS
FT                   AICRLIRFDNGEVKIDGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYS
FT                   KGRLTKEDHDIVNDALDLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPL
FT                   NNLDMKHAVQIMQTLKMLAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDN
FT                   VIQSSVLSDLYDMNIQIEHIRNQRICLYFKD"
FT   gene            749269..750297
FT                   /locus_tag="SAAV_0698"
FT   CDS_pept        749269..750297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0698"
FT                   /product="transferrin receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10619"
FT                   /protein_id="ACY10619.1"
FT                   /translation="MKKTVLYLVLAVMFLLAACGNNSDKEQSKSETKGSKDTVKIENNY
FT                   KMRGEKKDGSDAKKVKETVEVPKNPKNAVVLDYGALDVMKEMGLSDKVKALPKGEGGKS
FT                   LPNFLESFKDDKYTNVGNLKEVNFDKIAATKPEVIFISGRTANQKNLDEFKKAAPKAKI
FT                   VYVGADEKNLIGSMKQNTENIGKIYDKEDKAKELNKDLDNKIASMKDKTKNFNKTVMYL
FT                   LVNEGELSTFGPKGRFGGLVYDTLGFNAVDKKVSNSNHGQNVSNEYVNKENPDVILAMD
FT                   RGQAISGKSTAKQALNNPVLKNVKAIKEDKVYNLDPKLWYFAAGSTTTTIKQIEELDKV
FT                   VK"
FT   gene            complement(750614..750928)
FT                   /locus_tag="SAAV_0699"
FT   CDS_pept        complement(750614..750928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10620"
FT                   /protein_id="ACY10620.1"
FT                   /translation="MPKVYGSLIDTETRCRHYFTEEDIIAIKFKCCNKYYPCYKCHNEF
FT                   EKHAIKRWSEPSFNEKAILCGVCKHELTINEYMMVERCPNCQSRFNNRCKYHFHIYFEI
FT                   "
FT   gene            complement(750946..751869)
FT                   /gene="murB"
FT                   /locus_tag="SAAV_0700"
FT   CDS_pept        complement(750946..751869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="SAAV_0700"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10621"
FT                   /protein_id="ACY10621.1"
FT                   /translation="MINKDIYQALQQLIPNEKIKVDEPLKRYTYTKTGGNADFYITPTK
FT                   NEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIDVSDDAIIAGSG
FT                   AAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSL
FT                   IKLTTKELELDYRNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYP
FT                   SCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYV
FT                   QKTVKEKFGIELNREVRIIGEHPKES"
FT   gene            complement(751996..752514)
FT                   /locus_tag="SAAV_0701"
FT   CDS_pept        complement(751996..752514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10622"
FT                   /protein_id="ACY10622.1"
FT                   /translation="MYSNVQPFINSDLTNCFQSQYTEIESLLFNLLDSPVKYTKHIGGT
FT                   HHFKYSTEPILDILVGVENLHDITSLDEKRLNYVGFYRLHHKYTKKVMMAKFNNFHELK
FT                   QQVRLHIIQMNTQTFESYLALDYLLSTNDDIALQFNTKKHQILQHSLTIRQYEMQKQQY
FT                   FEKLCKKYL"
FT   gene            752634..753512
FT                   /locus_tag="SAAV_0702"
FT   CDS_pept        752634..753512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10623"
FT                   /protein_id="ACY10623.1"
FT                   /translation="MKKIVIIAVLAILFVVISACGNKEKEAQHQFTKQFKDVEQKQKEL
FT                   QHVMDNIHLKEIDHLSKTDTTDKNSKEFKALQEDVKNHLIPKFEAYYKSAKNLPDDTMK
FT                   VKKLKKEYMTLANEKKDAIYQLKKFIGLCNQSIKYNEDILDYTKQFEKNRYKVESEIKL
FT                   ADNKSEATNLTTKLEHNNKALRDTAKKNLDDSKENEVKGAIKNHIMPMIEKQITDINQT
FT                   NISDKHVNNARKNAIEMYYSLQNYYNTRIETIKVSEKLSKVDVDKLPKKGIDITHGDKA
FT                   FEKKLEKLEEK"
FT   gene            753666..753986
FT                   /locus_tag="SAAV_0703"
FT   CDS_pept        753666..753986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10624"
FT                   /protein_id="ACY10624.1"
FT                   /translation="MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLY
FT                   ERDMDGYYLIVQQERDLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQA
FT                   EE"
FT   gene            754410..755534
FT                   /locus_tag="SAAV_0704"
FT   CDS_pept        754410..755534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0704"
FT                   /product="glycerate kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10625"
FT                   /protein_id="ACY10625.1"
FT                   /translation="MKVLVAMDEFHGIISSYQANRYVEEAVASQIETADVVQVPLFNGR
FT                   HELLDSVFLWQSGQKYRIPVHDADMNEVEGVYGQTDTGMTVIEGNLFLKGKKPIVERTS
FT                   YGLGEMIKHALDNDAKHVVISLGGIDSFDAGAGMLQALGAQFYDDEGRVVDMRQGAGVI
FT                   KYIRRMDMSNLHPKMETARIQVMSDFSSRLYGKQSEIMQTYDAHQLHHNQAAEIDNLIW
FT                   YFSELFKSELKIAIGPVERGGAGGGIAAVLNGLYQAEILTSHALVDQLTHLENLVEQAD
FT                   LIIFGEGLNENDQLLETTTLRIAELCHKHQKVAIAICATAEKFDLFESQGVTAMFNTFI
FT                   DMPETYTDFKMGLQIRHYTVQSLKLLKTHFNVEV"
FT   gene            complement(755721..756947)
FT                   /gene="pepT"
FT                   /locus_tag="SAAV_0705"
FT   CDS_pept        complement(755721..756947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="SAAV_0705"
FT                   /product="peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10626"
FT                   /protein_id="ACY10626.1"
FT                   /translation="MKNQLIDRLTRYTTIDTQSDQKSTTTPSTEKQWDLLHLLEKELQQ
FT                   LGLPTDLDENGYLFATLESNIDADVPTVGFLAHVDTSPDFNASNVKPQIIENYDGKPYK
FT                   LGNTKRVLDPKVFPELNSLVGHTLMVTDGTSLLGADDKAGIVEIMEAICYLQEHPEIKH
FT                   GTIRIGFTPDEEIGRGPHKFDVDRFNADFAYTMDGSQYGELQYESFNAAEAVITCHGVN
FT                   VHPGSAKNAMVNAIRLGEQFDSLLPDSEVPERTEGYEGFYHLMNFEGTVEKATLQYIIR
FT                   DHDKKQFELRKKRILEIRDDINAHFENYPVKVDISDQYFNMAEKILPLPHIIDIPKRVF
FT                   AKLDIPANTEPIRGGTDGSQLSFMGLPTPNIFTGCGNFHGPYEYASIDVMEKAVQVIIG
FT                   IVEDIAENH"
FT   gene            complement(756961..757455)
FT                   /locus_tag="SAAV_0706"
FT   CDS_pept        complement(756961..757455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10627"
FT                   /protein_id="ACY10627.1"
FT                   /translation="MLFYLFHFTISFISTVLFSIIFNAPKRLLVACGFVGAIAWTIYQL
FT                   TVDLEFGKVGASFLGSLILGLMSHTMSRRYKRPVIIFIVPGIIPLVPGGAAYQATRFLV
FT                   SNDYTSAVNTFLEVTLISGAIAFGILVSEILYYLYTRIKQLYGKIKGKTYKKSYNMNNR
FT                   V"
FT   gene            complement(757473..758234)
FT                   /locus_tag="SAAV_0707"
FT   CDS_pept        complement(757473..758234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10628"
FT                   /protein_id="ACY10628.1"
FT                   /translation="MPDSITIIDENKVIDVVLIAGRILLESGAETYRVEDTMNRIAHSY
FT                   GLHNTYSFVSSTAIIFSLNDRTSTRLIRVQERTTDLEKIALTNSLSRKISNKELTIDEA
FT                   KSEFIHLQHASLQYSFLTNFFAAAIACGFFLFMFGGVASDCWIAVIAGGSAFLTFSFVQ
FT                   RYIQIKFFSEFVAAAVVISIAATFTKLGIATNQDIITIASVMPLVPGILITNAIRDLLA
FT                   GELLAGMSRGVEAALTAFAIGAGVAIVLLII"
FT   gene            complement(758430..759500)
FT                   /locus_tag="SAAV_0708"
FT   CDS_pept        complement(758430..759500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0708"
FT                   /product="GGDEF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10629"
FT                   /protein_id="ACY10629.1"
FT                   /translation="MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVS
FT                   LLLSVYPIPYREDYLIHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVT
FT                   LIVIAAVTSAIGPFLKQNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLII
FT                   TLASAITFVDIWHFFSLVNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIAL
FT                   LLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLD
FT                   QSVKLAENIRSGVEKSSFHLPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVA
FT                   KNQGRNKVMFNPIINL"
FT   gene            759818..760873
FT                   /locus_tag="SAAV_0709"
FT   CDS_pept        759818..760873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0709"
FT                   /product="glycosyl transferase, group 4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10630"
FT                   /protein_id="ACY10630.1"
FT                   /translation="MVTLLLVAVTMIVSLTITPIVIAISKRLNLVDKPNFRKVHTKPIS
FT                   VMGGTVILFSFLIGIWIGHPIETEIKPLIIGAIIMYVLGLVDDIYDLKPYIKLAGQIAA
FT                   ALVVAFYGVTIDFISLPMGTTIHFGFLSIPITVIWIVAITNAINLIDGLDGLASGVSAI
FT                   GLITIGFIAILQANIFITMICCVLLGSLIGFLFYNFHPAKIFLGDSGALMIGFIIGFLS
FT                   LLGFKNITIIALFFPIVILAVPFIDTLFAMIRRVKKGQHIMQADKSHLHHKLLALGYTH
FT                   RQTVLLIYSISILFSLSSIILYVSPPLGVVLMFVLIIFSIELIVEFTGLIDNNYRPILN
FT                   LISRKSSHKED"
FT   gene            complement(761038..761679)
FT                   /locus_tag="SAAV_0710"
FT   CDS_pept        complement(761038..761679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10631"
FT                   /protein_id="ACY10631.1"
FT                   /translation="MTQNIITVKKEHIIENVISKSRFIAHIKPVQNEDEAKAFIAAIKK
FT                   EHKDATHNCSAYTIGPEMNIQKANDDGEPTGTAGVPMLDILKKLDVHNACVVVTRYFGG
FT                   IKLGGGGLIRAYSGAVRDVIYDVGRVELREAVPCIVTLNYDQTGKFEYELASTHFMLRN
FT                   QTYTDKVSYYIDVVKSDYEAFINFLNQMTAGNFDLTEETPKQLPFDIPTE"
FT   gene            761823..762689
FT                   /locus_tag="SAAV_0711"
FT   CDS_pept        761823..762689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0711"
FT                   /product="degV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10632"
FT                   /protein_id="ACY10632.1"
FT                   /translation="MKIAVMTDSTSYLSQDLIDKYNIQIAPLSVTFDDGKNFTESNEIA
FT                   IEEFYNKMASSQTIPTTSQPAIGEWITKYEMLRDQGYTDIIVICLSSGISGSYQSSYQA
FT                   GEMVEGVNVHAFDSKLAAMIEGCYVLRAIEMVEEGYEPQQIIDDLTNMREHTGAYLIVD
FT                   DLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVRTKKRAIQTLEKKVLDIV
FT                   KDFEEVTLFVINGDHFEDGQALYKKLQEDCPSGYQVAYSEFGPVVAAHLGSGGLGLGYV
FT                   GRKIRLT"
FT   gene            763197..764135
FT                   /locus_tag="SAAV_0712"
FT   CDS_pept        763197..764135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0712"
FT                   /product="comf operon protein 1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10633"
FT                   /protein_id="ACY10633.1"
FT                   /translation="MLYAVTGAGKTEMMFQGIQYARRQGDNIAIVSPRVDVVVEISKRI
FT                   KDAFLNEDIDILHQQSSQQFEGHFVVCTVHQLYRFKQHFDTIFIDEVDAFPLSMDKSLQ
FT                   QALKSSSKVEHATIYMTATPPKQLLSEIPHENIIKLPARFHKKSLPVPKYRYFKLNNNK
FT                   IQKMLYRILQDQINNQRYTLVFFNNIETMIKTFSVYKQKITKLTYVHSEDVFRFEKVEQ
FT                   LRNGHFDVIFTTTILERGFTMANLDVVVIDAHQYTQEALIQIAGRVGRKLECPAGKVLF
FT                   FHEGVSMNMIQAKKEIQRMNKLALKRGWIDE"
FT   gene            764128..764802
FT                   /locus_tag="SAAV_0713"
FT   CDS_pept        764128..764802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10634"
FT                   /protein_id="ACY10634.1"
FT                   /translation="MNNCLSCGAKLYENITIYNLFKKPNRLCDRCKENWDNIKLDIKAR
FT                   RCSRCLKHLNQDEAYCLDCKFLSAHFNLMEQLYCQFQYDGLMKEMIHQYKFLKDYYLCE
FT                   LLAHLIEIPQTSYDYIVPIPSSPAHDLSRTFNPVEAVLKAKGIRFDKILKMSNRPKQSH
FT                   LTKKERLADENPFIIDTELDLNGKEILLVDDIYTTGLTIHRAGCKLYAKNIRKFKVFAF
FT                   AR"
FT   gene            764863..765435
FT                   /locus_tag="SAAV_0714"
FT   CDS_pept        764863..765435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0714"
FT                   /product="ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10635"
FT                   /protein_id="ACY10635.1"
FT                   /translation="MIRFEIHGDNLTITDAIRNYIEEKIGKLERYFNDVPNAVAHVKVK
FT                   TYSNSATKIEVTIPLKNVTLRAEERNDDLYAGIDLINNKLERQVRKYKTRINRKSRDRG
FT                   DQEVFVAELQEMQETQVDNDAYDDNEIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVF
FT                   TDRETDGTSIVYRRKDGKYGLIQTSEQ"
FT   gene            765849..768380
FT                   /gene="secA"
FT                   /locus_tag="SAAV_0715"
FT   CDS_pept        765849..768380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SAAV_0715"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10636"
FT                   /protein_id="ACY10636.1"
FT                   /translation="MGFLSKILDGNNKEIKQLGKLADKVIALEEKTAILTDEEIRNKTK
FT                   QFQTELADIDNVKKQNDYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIA
FT                   EMRTGEGKTLTATMPTYLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLTVGLNLN
FT                   SKTTEEKREAYAQDITYSTNNELGFDYLRDNMVNYSEDRVMRPLHFAIIDEVDSILIDE
FT                   ARTPLIISGEAEKSTSLYTQANVFAKMLKQDEDYKYDEKTKAVHLTEQGADKAERMFKV
FT                   ENLYDVQNVDVISHINTALRAHVTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLH
FT                   QAIEAKEGVQIQNESKTMASITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIP
FT                   TNKPVQRNDKSDLIYISQKGKFDAVVEDVVEKHKAGQPVLLGTVAVETSEYISNLLKKR
FT                   GIRHDVLNAKNHEREAEIVAGAGQKGAVTIATNMAGRGTDIKLGEGVEELGGLAVIGTE
FT                   RHESRRIDDQLRGRSGRQGDKGDSRFYLSLQDELMIRFGSERLQKMMSRLGLDDSTPIE
FT                   SKMVSRAVESAQKRVEGNNFDARKRILEYDEVLRKQREIIYNERNSIIDEEDSSQVVDA
FT                   MLRSTLQRSINYYINTADDEPEYQPFIDYINDIFLQEGDITEDDIKGKDAEDIFEVVWA
FT                   KIEAAYQSQKDILEEQMNEFERMILLRSIDSHWTDHIDTMDQLRQGIHLRSYAQQNPLR
FT                   DYQNEGHELFDIMMQNIEEDTCKFILKSVVQVEDNIEREKTTEFGEAKHVSAEDGKEKV
FT                   KPKPIVKGDQVGRNDDCPCGSGKKFKNCHGK"
FT   gene            768422..768526
FT                   /locus_tag="SAAV_0716"
FT   CDS_pept        768422..768526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10637"
FT                   /protein_id="ACY10637.1"
FT                   /translation="MLWEESFYFTSVKYFKKCEEVVKRCYVLSFKKSV"
FT   gene            768810..769805
FT                   /gene="prfB"
FT                   /locus_tag="SAAV_0717"
FT   CDS_pept        768810..769805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="SAAV_0717"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10638"
FT                   /protein_id="ACY10638.1"
FT                   /translation="MMAEPNFWDNQTKAQDIIDKNNALKAIVNGYKTLQAEVDDMDATW
FT                   DLLQEEFDEEMKEDLEQEVINFKAKVDEYELQLLLDGPHDANNAILELHPGAGGTESQD
FT                   WANMLFRMYQRYCEKKGFKVETVDYLPGDEAGIKSVTLLIKGHNAYGYLKAEKGVHRLV
FT                   RISPFDSSGRRHTSFASCDVIPDFNNDEIEIEINPDDITVDTFRASGAGGQHINKTESA
FT                   IRITHHPSGIVVNNQNERSQIKNREAAMKMLKSKLYQLKLEEQAREMAEIRGEQKEIGW
FT                   GSQIRSYVFHPYSMVKDHRTNEETGKVDAVMDGDIGPFIESYLRQTMSHD"
FT   gene            770214..771053
FT                   /locus_tag="SAAV_0718"
FT   CDS_pept        770214..771053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0718"
FT                   /product="LysM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10639"
FT                   /protein_id="ACY10639.1"
FT                   /translation="MKKTLTVTVSSVLAFLALNNAAHAQQHGTQVKTPVQHNYVSNVQA
FT                   QTQSPTTYTVVAGDSLYKIALEHHLTLNQLYSYNPGVTPLIFPGDVISLVPQNKVKQTK
FT                   AVKSPVRKASQAKKVVKQPVQQASKKVVVKQAPKQAVAKTVNVAYKPAQVQKSVPTVPV
FT                   AHNYNKSVANRGNLYAYGNCTYYAFDRRAQLGRSIGSLWGNANNWNYAAKVAGFKVDKT
FT                   LEVGAIFQTAAGPYGHVGVVESVNPNGTITVSEMNYAGFNVKSSRTILNPGKYNYIH"
FT   gene            771227..771877
FT                   /locus_tag="SAAV_0719"
FT   CDS_pept        771227..771877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0719"
FT                   /product="HD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10640"
FT                   /protein_id="ACY10640.1"
FT                   /translation="MGVHQYFKRLSDMERLIRLPGKFKYFEHNVAAHSFKVTKIAQYLA
FT                   TVEEYHGRKINWKSLYEKALNHDFAEVFTGDIKTPVKYASSELKKLFSQVEEEMVETFI
FT                   EEEIPLQYRDVYKQRLQEGKDDSLEGQILSVADKIDLLYETFGEIQKRNPEELFFEIYE
FT                   MSLETIIQFDHLASVQDFINNIIPEMLTENFIPRTELRETTMNILNKRKEENE"
FT   gene            771874..772110
FT                   /locus_tag="SAAV_0720"
FT   CDS_pept        771874..772110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10641"
FT                   /protein_id="ACY10641.1"
FT                   /translation="MIWYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYF
FT                   HNEWIIFIDVVSLLAGYLIIDQLEFHKHQDEDR"
FT   gene            772379..774364
FT                   /gene="uvrB"
FT                   /locus_tag="SAAV_0721"
FT   CDS_pept        772379..774364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="SAAV_0721"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10642"
FT                   /protein_id="ACY10642.1"
FT                   /translation="MVEHYPFKIHSDFEPQGDQPQAIKEIVDGIKAGKRHQTLLGATGT
FT                   GKTFTMSNVIKEVGKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYYDYYQPEAYV
FT                   PSTDTFIEKDASINDEIDQLRHSATSALFERDDVIIIASVSCIYGLGNPEEYKDLVVSV
FT                   RVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRVRGDVVEIFPASKEELCIRVEFFGDE
FT                   IDRIREVNYLTGEVLKEREHFAIFPASHFVTREEKLKVAIERIEKELEERLKELRDENK
FT                   LLEAQRLEQRTNYDLEMMREMGFCSGIENYSVHLTLRPLGSTPYTLLDYFGDDWLVMID
FT                   ESHVTLPQVRGMYNGDRARKQVLVDHGFRLPSALDNRPLKFEEFEEKTKQLVYVSATPG
FT                   PYEIEHTDKMVEQIIRPTGLLDPKIEVRPTENQIDDLLSEIQTRVERNERVLVTTLTKK
FT                   MSEDLTTYMKEAGIKVNYLHSEIKTLERIEIIRDLRMGTYDVIVGINLLREGIDIPEVS
FT                   LVVILDADKEGFLRSNRSLIQTIGRAARNDKGEVIMYADKMTDSMKYAIDETQRRREIQ
FT                   MKHNEKHGITPKTINKKIHDLISATVENDENNDKAQTVIPKKMTKKERQKTIDNIEKEM
FT                   KQAAKDLDFEKATELRDMLFELKAEG"
FT   gene            774372..777218
FT                   /gene="uvrA"
FT                   /locus_tag="SAAV_0722"
FT   CDS_pept        774372..777218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SAAV_0722"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10643"
FT                   /protein_id="ACY10643.1"
FT                   /translation="MKEPSIVVKGARAHNLKDIDIELPKNKLIVMTGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSAYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVT
FT                   EIYDYIRLLYARVGKPYCPNHNIEIESQTVQQMVDRIMELEARTKIQLLAPVIAHRKGS
FT                   HEKLIEDIGKKGYVRLRIDGEIVDVNDVPTLDKNKNHTIEVVVDRLVVKDGIETRLADS
FT                   IETALELSEGQLTVDVIDGEDLKFSESHACPICGFSIGELEPRMFSFNSPFGACPTCDG
FT                   LGQKLTVDVDLVVPDKDKTLNEGAIEPWIPTSSDFYPTLLKRVCEVYKINMDKPFKKLT
FT                   ERQRDILLYGSGDKEIEFTFTQRQGGTRKRTMVFEGVVPNISRRFHESPSEYTREMMSK
FT                   YMTELPCETCHGKRLSREALSVYVGGLNIGEVVEYSISQALNYYKNIDLSEQDQAIANQ
FT                   ILKEIISRLTFLNNVGLEYLTLNRASGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSI
FT                   GLHQRDNDRLINTLKEMRDLGNTLIVVEHDDDTMRAADYLVDIGPGAGEHGGQIVSSGT
FT                   PQKVMKDKKSLTGQYLSGKKRIDVPEYRRPASDRKISIRGARSNNLKGIDVDIPLSIMT
FT                   VVTGVSGSGKSSLVNEVLYKSLAQKINKSKVKPGLYDKIEGIDQLDKIIDIDQSPIGRT
FT                   PRSNPATYTGVFDDIRDVFAQTNEAKIRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHF
FT                   LPDVYVPCEVCDGKRYNRETLEVTYKGKNIADILEMTVEEATQFFENIPKIKRKLQTLV
FT                   DVGLGYVTLGQQATTLSGGEAQRVKLASELHKRSTGKSIYILDEPTTGLHVDDISRLLK
FT                   VLNRLVENGDTVVIIEHNLDVIKTADYIIDLGPEGGSGGGTIVATGTPEDIAQTKSSYT
FT                   GKYLKEVLERDKQNTEDK"
FT   gene            777882..778814
FT                   /gene="hprK"
FT                   /locus_tag="SAAV_0723"
FT   CDS_pept        777882..778814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="SAAV_0723"
FT                   /product="HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10644"
FT                   /protein_id="ACY10644.1"
FT                   /translation="MLTTEKLVETLKLDLIAGEEGLSKPIKNADISRPGLEMAGYFSHY
FT                   ASDRIQLLGTTELSFYNLLPDKDRAGRMRKLCRPETPAIIVTRGLQPPEELVEAAKELN
FT                   TPLIVAKDATTSLMSRLTTFLEHALAKTTSLHGVLVDVYGVGVLITGDSGIGKSETALE
FT                   LVKRGHRLVADDNVEIRQINKDELIGKPPKLIEHLLEIRGLGIINVMTLFGAGSILTEK
FT                   RIRLNINLENWNKQKLYDRVGLNEETLSILDTEITKKTIPVRPGRNVAVIIEVAAMNYR
FT                   LNIMGINTAEEFSERLNEEIIKNSHKSEE"
FT   gene            778820..779659
FT                   /gene="lgt"
FT                   /locus_tag="SAAV_0724"
FT   CDS_pept        778820..779659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="SAAV_0724"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10645"
FT                   /protein_id="ACY10645.1"
FT                   /translation="MGIVFNYIDPVAFNLGPLSVRWYGIIIAVGILLGYFVAQRALVKA
FT                   GLHKDTLVDIIFYSALFGFIAARIYFVIFQWPYYAENPSEIIKIWHGGIAIHGGLIGGF
FT                   IAGVIVCKVKNLNPFQIGDIVAPSIILAQGIGRWGNFMNHEAHGGPVSRAFLEQLHLPN
FT                   FIIENMYINGQYYHPTFLYESIWDVAGFIILVNIRKHLKLGETFFLYLTWYSIGRFFIE
FT                   GLRTDSLMLTSNIRVAQLVSILLILISISLIVYRRIKYNPPLYSKVGALPWPTKKVK"
FT   gene            779667..780152
FT                   /locus_tag="SAAV_0725"
FT   CDS_pept        779667..780152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0725"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10646"
FT                   /protein_id="ACY10646.1"
FT                   /translation="MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVL
FT                   KRHIYKQLLNINIGNQSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRY
FT                   GPVTIGSNTLIGANATILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR"
FT   gene            780160..781599
FT                   /locus_tag="SAAV_0726"
FT   CDS_pept        780160..781599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0726"
FT                   /product="TPR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10647"
FT                   /protein_id="ACY10647.1"
FT                   /translation="MAQKNNNVIPMTFDDAFYRKMAKQKFKQREYKRAAEYFEKVLELS
FT                   PDDLEIQIDYAQCLVQLGIAKKAEHLFYDNIIYNRHLEDSFYELSQLNIEVNEPNKAFL
FT                   FGINYVIVSDDQDYRDELDQMFDVKYQSEEQIELEAQLFVVQILFQYLFSQGRLKDAKN
FT                   YVLHQPQEVQDHRVVRNLLAMCYLYLGEYDTAKALYEALLQEDSTDIYALCHYTLLLYN
FT                   TKENEQYQKYLKILNKVVPMNDDESFKLGIVLSYLKQYRASQQLLYPLYKKGKFLSIQM
FT                   YNALAYNYYYLGEEDESHYYWDKLKQISKVEIGHAPWVIENSKEVFDQHILPLLQSDDS
FT                   HYRLYGIFLLDQLNGKEIVMTESIWQVLENLNNYEKLYLTYLVQGLTLNKLDFIHRGLL
FT                   TLYQNELFVSENDLMVAWINQGELIIAEKVDLTDVEPYIGAFIYLYFKNQPRNVTKKQI
FT                   TTWLGITQYKLNKMIEFLLSI"
FT   gene            781666..782601
FT                   /gene="trxB"
FT                   /locus_tag="SAAV_0727"
FT   CDS_pept        781666..782601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="SAAV_0727"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10648"
FT                   /protein_id="ACY10648.1"
FT                   /translation="MTEIDFDIAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMAN
FT                   TEEVENFPGFEMITGPDLSTKMFEHAKKFGAVYQYGDIKSVEDKGEYKVINFGNKELTA
FT                   KAVIIATGAEYKKIGVPGEQELGGRGVSYCAVCDGAFFKNKRLFVIGGGDSAVEEGTFL
FT                   TKFADKVTIVHRRDELRAQRILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLTSTK
FT                   DGSEETHEADGVFIYIGMKPLTAPFKDLGITNDVGYIVTKDDMTTSVPGIFAAGDVRDK
FT                   GLRQIVTATGDGSIAAQSAAEYIEHLNDQA"
FT   gene            complement(782948..783115)
FT                   /locus_tag="SAAV_0728"
FT   CDS_pept        complement(782948..783115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10649"
FT                   /protein_id="ACY10649.1"
FT                   /translation="MDFQFLQTMQVGVWAPTQRISKRNSTGNASWGVGPNTEAYDKSAY
FT                   DNVQVGVVQR"
FT   gene            783370..784281
FT                   /locus_tag="SAAV_0729"
FT   CDS_pept        783370..784281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10650"
FT                   /protein_id="ACY10650.1"
FT                   /translation="MDNNEKEKSKSELLVVTGLSGAGKSLVIQCLENMGYFCVDNLPPV
FT                   LLPKFVELMEQGNPSLRKVAIAIDLRGKELFNSLVAVVDKVKSESDVIIDVMFLEASTE
FT                   KLISRYKETRRAHPLMEQGKRSLINAINDEREHLSQIRSIANFVIDTTKLSPKELKERI
FT                   RRYYEDEEFETFTINVTSFGFKHGIQMDADLVFDVRFLPNPYYVVDLRPLTGLDKDVYN
FT                   YVMKWKETEIFFEKLTDLLDFMIPGYKKEGKSQLVIAIGCTGGQHRSVALAERLGNYLN
FT                   EVFEYNVYVHHRDAHIESGEKK"
FT   gene            784278..785273
FT                   /locus_tag="SAAV_0730"
FT   CDS_pept        784278..785273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10651"
FT                   /protein_id="ACY10651.1"
FT                   /translation="MRQIKVVLIGGGTGLSVMARGLREFPIDITAIVTVADNGGSTGKI
FT                   RDEMDIPAPGDIRNVIAALSDSESVLSQLFQYRFEENQISGHSLGNLLIAGMTNITNDF
FT                   GHAIKALSKILNIKGRVIPSTNTSVQLNAVMEDGEIVFGETNIPKKHKKIDRVFLEPND
FT                   VQPMEEAIDALREADLIVLGPGSLYTSVISNLCVNGISDALIHSDAPKLYVSNVMTQPG
FT                   ETDGYSVKDHIDAIHRQAGQPFIDYVICSTQTFNAQVLKKYEEKHSKPVEVNKAELEKE
FT                   SINVKTSSNLVEISENHLVRHNTKVLSTMIYDIALELISTIPFVPSDKRK"
FT   gene            785384..786328
FT                   /locus_tag="SAAV_0731"
FT   CDS_pept        785384..786328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10652"
FT                   /protein_id="ACY10652.1"
FT                   /translation="MSFASEMKNELTRIDVDEMNAKAELSALIRMNGALSLSNQQFVIN
FT                   VQTENATTARRIYSLIKRVFNVEVEILVRKKMKLKKNNIYICRTKMKAKEILDELGILK
FT                   DGIFTHEIDHSMIQDDEMRRSYLRGAFLAGGSVNNPETSSYHLEIFSQNESHAEGLTKL
FT                   MNSYELNAKHLERKKGSITYLKEAEKISDFLSLIGGYQALLKFEDVRIVRDMRNSVNRL
FT                   VNCETANLNKTVSAAMKQVESIKLIDKEIGIENLPDRLREIARIRVEHQEISLKELGEM
FT                   VSTGPISKSGVNHRLRKLNDLADKIRNGEQIEL"
FT   gene            complement(786631..786705)
FT                   /locus_tag="SAAV_0732"
FT   tRNA            complement(786631..786705)
FT                   /locus_tag="SAAV_0732"
FT                   /product="tRNA-Arg"
FT   gene            786892..787479
FT                   /gene="clpP"
FT                   /locus_tag="SAAV_0733"
FT   CDS_pept        786892..787479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SAAV_0733"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10653"
FT                   /protein_id="ACY10653.1"
FT                   /translation="MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIV
FT                   SQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLL
FT                   AAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIE
FT                   KIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK"
FT   gene            complement(787722..788624)
FT                   /locus_tag="SAAV_0734"
FT   CDS_pept        complement(787722..788624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10654"
FT                   /protein_id="ACY10654.1"
FT                   /translation="MKQYLITGGTGMVGSQLVNEIKKSDSHITILTRHDQISNDKKISY
FT                   VNWAKSGWEHKVPQNIDVVINLAGATLNKRWTPEYKQTLMLSRIQSTQALYELFKSRNK
FT                   APKVLFNASATGYYPPDLFMSYTEVYKTLPFDFLSDIVYQWERFAQQFEQLGTRVVIGR
FT                   FGMILSNEGGALQTMKLPYKYYIGGKLGSGQQWYSWIHINDLIQAILFLINNESASGPF
FT                   NLTAPIPERQNLFGYTLARAMHKPHETWAPSLAMRLILGQMSTVVLDTQKVLPNKIQAL
FT                   GFQFKYSNLKMALEDLIKE"
FT   gene            789327..789956
FT                   /locus_tag="SAAV_0735"
FT   CDS_pept        789327..789956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10655"
FT                   /protein_id="ACY10655.1"
FT                   /translation="MSNQNYDYNKNEDGSKKKMSTTAKVVSIATVLLLLGGLVFAIFAY
FT                   VDHSNKAKERMLNEQKQEQKEKRQKENAEKERKKKQQEEKEQNELDSQANQYQQLPQQN
FT                   QYQYVPPQQQAPTKQRPAKEENDDKASKDESKDKDDNASQDKSDDNQKKTDDNKQPAQP
FT                   KPQPQQPTPKPNNNQQNNQSNQQAKPQAPQQNSQSTTNKQNNANDK"
FT   gene            complement(790196..790336)
FT                   /locus_tag="SAAV_0736"
FT   CDS_pept        complement(790196..790336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10656"
FT                   /protein_id="ACY10656.1"
FT                   /translation="MGWGPNTEAGGKSAYNNVQVGGAPTQKLTESQLTIMCKLAGPQHR
FT                   S"
FT   gene            790769..791782
FT                   /gene="gapR"
FT                   /locus_tag="SAAV_0737"
FT   CDS_pept        790769..791782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapR"
FT                   /locus_tag="SAAV_0737"
FT                   /product="glycolytic operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10657"
FT                   /protein_id="ACY10657.1"
FT                   /translation="MKDLLQAQQKLIPDLIDKMYKRFSILTTISKNQPVGRRSLSEHMD
FT                   MTERVLRSETDMLKKQDLIKVKPTGMEITAEGEQLISQLKGYFDIYADDNRLSEGIKNK
FT                   FQIKEVHVVPGDADNSQSVKTELGRQAGQLLEGILQEDAIVAVTGGSTMACVSEAIHLL
FT                   PYNVFFVPARGGLGENVVFQANTIAASMAQQAGGYYTTMYVPDNVSETTYNTLLLEPSV
FT                   INTLDKIKQANVILHGIGDALKMAHRRQSPEKVIEQLQHHQAVGEAFGYYFDTQGQIVH
FT                   KVKTIGLQLEDLESKDFIFAVAGGKSKGEAIKAYLTIAPKNTVLITDEAAAKIILE"
FT   gene            791835..792845
FT                   /gene="gapA1"
FT                   /locus_tag="SAAV_0738"
FT   CDS_pept        791835..792845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA1"
FT                   /locus_tag="SAAV_0738"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10658"
FT                   /protein_id="ACY10658.1"
FT                   /translation="MAVKVAINGFGRIGRLAFRRIQEVEGLEVVAVNDLTDDDMLAHLL
FT                   KYDTMQGRFTGEVEVVDGGFRVNGKEVKSFSEPDASKLPWKDLNIDVVLECTGFYTDKD
FT                   KAQAHIEAGAKKVLISAPATGDLKTIVFNTNHQELDGSETVVSGASCTTNSLAPVAKVL
FT                   NDDFGLVEGLMTTIHAYTGDQNTQDAPHRKGDKRRARAAAENIIPNSTGAAKAIGKVIP
FT                   EIDGKLDGGAQRVPVATGSLTELTVVLEKQDVTVEQVNEAMKNASNESFGYTEDEIVSS
FT                   DVVGMTYGSLFDATQTRVMSVGDRQLVKVAAWYDNEMSYTAQLVRTLAYLPELSK"
FT   gene            792984..794174
FT                   /gene="pgk"
FT                   /locus_tag="SAAV_0739"
FT   CDS_pept        792984..794174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SAAV_0739"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10659"
FT                   /protein_id="ACY10659.1"
FT                   /translation="MAKKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQ
FT                   YIIEQGGKIVLFSHLGKVKEESDKAKLTLRPVVEDLSKKLDKEVVFVPETRGEKLEAAI
FT                   KDLKEGDVLLVENTRYEDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVG
FT                   ISTHLETAAGFLMDKEIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVNIADKIII
FT                   GGGMAYTFLKAQGKEIGISLLEEDKIDFAKDLLEKHGDKIVLPVDTKVAKEFSNDAKIT
FT                   VVPSDSIPADQEGMDIGPNTVKLFADELEGAHTVVWNGPMGVFEFSNFAQGTIGVCKAI
FT                   ANLKDAITIIGGGDSAAAAISLGFENDFTHISTGGGASLEYLEGKELPGIKAINNK"
FT   gene            794296..795057
FT                   /gene="tpiA"
FT                   /locus_tag="SAAV_0740"
FT   CDS_pept        794296..795057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="SAAV_0740"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10660"
FT                   /protein_id="ACY10660.1"
FT                   /translation="MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQ
FT                   LDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELF
FT                   HETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEDQLKS
FT                   VVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIK
FT                   EYMAQTDIDGALVGGASLKVEDFVQLLEGAK"
FT   gene            795060..796577
FT                   /gene="pgm"
FT                   /locus_tag="SAAV_0741"
FT   CDS_pept        795060..796577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="SAAV_0741"
FT                   /product="phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10661"
FT                   /protein_id="ACY10661.1"
FT                   /translation="MTKKPTALIILDGFANRESEHGNAVKLANKPNFDRYYNKYPTTQI
FT                   EASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHV
FT                   NSHDSALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKY
FT                   IEETEAKFNELGIGQFASVSGRYYAMDRDKRWEREEKAYNAIRNFDAPTYATAKEGVEA
FT                   SYNEGLTDEFVVPFIVENQNDGVNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQV
FT                   KDLFYATFTKYNDNIDAAIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSG
FT                   GRNEEFKGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELNKGDLDLIILNFANPDMV
FT                   GHSGMLEPTIKAIEAVDECLGEVVDKILDMDGYAIITADHGNSDQVLTDDDQPMTTHTT
FT                   NPVPVIVTKEGVTLRETGRLGDLAPTLLDLLNVEQPEDMTGESLIKH"
FT   gene            796707..798011
FT                   /gene="eno"
FT                   /locus_tag="SAAV_0742"
FT   CDS_pept        796707..798011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="SAAV_0742"
FT                   /product="phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10662"
FT                   /protein_id="ACY10662.1"
FT                   /translation="MPIITDVYAREVLDSRGNPTVEVEVLTESGAFGRALVPSGASTGE
FT                   HEAVELRDGDKSRYLGKGVTKAVENVNEIIAPEIIEGEFSVLDQVSIDKMMIALDGTPN
FT                   KGKLGANAILGVSIAVARAAADLLGQPLYKYLGGFNGKQLPVPMMNIVNGGSHSDAPIA
FT                   FQEFMILPVGATTFKESLRWGTEIFHNLKSILSKRGLETAVGDEGGFAPKFEGTEDAVE
FT                   TIIQAIEAAGYKPGEEVFLGFDCASSEFYENGVYDYSKFEGEHGAKRTAAEQVDYLEQL
FT                   VDKYPIITIEDGMDENDWDGWKQLTERIGDRVQLVGDDLFVTNTEILAKGIENGIGNSI
FT                   LIKVNQIGTLTETFDAIEMAQKAGYTAVVSHRSGETEDTTIADIAVATNAGQIKTGSLS
FT                   RTDRIAKYNQLLRIEDELFETAKYDGIKSFYNLDK"
FT   gene            798350..798808
FT                   /locus_tag="SAAV_0743"
FT   CDS_pept        798350..798808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10663"
FT                   /protein_id="ACY10663.1"
FT                   /translation="MADRTNKEIKTGRFIATASIVFSILLIIHYFVSLDNATAKALLNL
FT                   TNQNTSDKAIDYILNSFRFTGIMYILAYLAGFITFWNRHTYVWWFMFAVYVSNSLFTLI
FT                   NLSITIQAIKAAHGAYLTLPILIVIIGSVALAIYMLVVSIKRKSTFNR"
FT   gene            798875..799108
FT                   /gene="secG"
FT                   /locus_tag="SAAV_0744"
FT   CDS_pept        798875..799108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="SAAV_0744"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10664"
FT                   /protein_id="ACY10664.1"
FT                   /translation="MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQ
FT                   KQRGVDLFLNRLIIILSILFFVLMICISYLGM"
FT   gene            799224..799964
FT                   /gene="est"
FT                   /locus_tag="SAAV_0745"
FT   CDS_pept        799224..799964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="est"
FT                   /locus_tag="SAAV_0745"
FT                   /product="carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10665"
FT                   /protein_id="ACY10665.1"
FT                   /translation="MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTS
FT                   YAPQYEGHAAPPEEILKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSL
FT                   NRDVKGIVTMCAPMGGKTEGAIYEGFLEYARNFKKYEGKNQETIDNEMDHFKPTETLKE
FT                   LSEALDTIKDQVDEVFDPILVIQVENDNMIDPQSANYIYDHVDSDDKDIKWYSQSGHVI
FT                   TIDKEKEQVFEDIYQFLESLDWSE"
FT   gene            799998..802370
FT                   /locus_tag="SAAV_0746"
FT   CDS_pept        799998..802370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0746"
FT                   /product="VacB/RNase II family exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10666"
FT                   /protein_id="ACY10666.1"
FT                   /translation="MNLKQSIEEIINQPEYEPMSVSDFQDALGLSSADSFRDLIKVLVE
FT                   LEQSGLIERTKTDRYQKKHSSKGHSKLIKGTLSQNKKGFAFLRPEDEDMEDIFIPPTKI
FT                   NRALDGDTVIVEIHQSKGEHKGKIEGEVKSIEKHSVTQVVGTYSEARHFGFVIPDDKRI
FT                   MQDIFIPKGQSLGAVDGHKVLVQITKYADGSDNPEGHISAILGHKNDPGVDILSIIYQH
FT                   GIEIEFPDEVLQEAEAVPDHIENTEIKGRHDLRDELTITIDGADAKDLDDAISVKKLAN
FT                   GNTQLTVSIADVSYYVTEDSALDKEAYDRATSVYLVDRVIPMIPHRLSNGICSLNPHVD
FT                   RLTLSCRMEIDASGRVVKHEIFDSVIHSDYRMTYDAVNQIITEKDPNIREQYKEITPML
FT                   DLAQDLSNRLIQMRKRRGEIDFDISEAKVLVNEVGIPTDVQLRQRGEGERLIESFMLIA
FT                   NETVAEHFSKLNVPFIYRVHEQPKSDRLRQFFDFITNFGIMIKGTGEDIHPTTLQKVQE
FT                   EVEGRPEQMVISTMMLRSMQQAHYDDVNLGHFGLSAEYYTHFTSPIRRYPDLTVHRLIR
FT                   KYLIEKSMDNKEVKRWEDKLPELAEHTSKRERRAIEAERDTDELKKAEYMIQHIGDEFE
FT                   GIVSSVANFGMFIELPNTIEGMVHIANMTDDYYRFEERQMALIGERQAKVFRIGDTVKV
FT                   KVTHVDVDERLIDFQIVGMPLPKNDRSQRPARGKTIQAKTRGKSLDKSKSDDKGRKKKG
FT                   KQRKGKNQRNNDKSGNSKHKPFYKDKSVKKKARRKKK"
FT   gene            802392..802856
FT                   /gene="smpB"
FT                   /locus_tag="SAAV_0747"
FT   CDS_pept        802392..802856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="SAAV_0747"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10667"
FT                   /protein_id="ACY10667.1"
FT                   /translation="MAKKKSPGTLAENRKARHDYNIEDTIEAGIVLQGTEIKSIRRGSA
FT                   NLKDSYAQVKNGEMYLNNMHIAPYEEGNRFNHDPLRSRKLLLHKREIFKLGEQTREIGY
FT                   SIVPLKLYLKHGHCKVLLGVARGKKKYDKRQALKEKAVKRDVARDMKARY"
FT   gene            802947..803307
FT                   /locus_tag="SAAV_0749"
FT   tmRNA           802947..803307
FT                   /locus_tag="SAAV_0749"
FT                   /product="tmRNA"
FT   gene            803630..803911
FT                   /locus_tag="SAAV_0750"
FT   CDS_pept        803630..803911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10668"
FT                   /protein_id="ACY10668.1"
FT                   /translation="MATEKELFIFVTSLSGCSYKEMSRVLIFSLESICLLTQSAIVDET
FT                   EIKEVVVKKCISQHTIVAIFIVLDDKLFLEFLVFIICNYTTSFTNINV"
FT   gene            complement(804178..804501)
FT                   /locus_tag="SAAV_0751"
FT   CDS_pept        complement(804178..804501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10669"
FT                   /protein_id="ACY10669.1"
FT                   /translation="MNNEELEMRLLLMKQSIEQLQEELAPNLKTRDLVLLRYMYSYKEI
FT                   NMLDSYLFQLATNKEQITKKQFKTKLENIREVPEIPIRQVNDILEGYKNSELYVELINS
FT                   ILK"
FT   gene            complement(804517..804663)
FT                   /locus_tag="SAAV_0752"
FT   CDS_pept        complement(804517..804663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0752"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10670"
FT                   /protein_id="ACY10670.1"
FT                   /translation="MNNALKQEEATWGNVQGQVSQALMGTGIKDSTARSIGFWVSQVGQ
FT                   ALI"
FT   gene            complement(804855..805583)
FT                   /locus_tag="SAAV_0753"
FT   CDS_pept        complement(804855..805583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10671"
FT                   /protein_id="ACY10671.1"
FT                   /translation="MKKVMGILLASTLILGACGHHQDSAKKESASHKKKENDNEELNEE
FT                   LKEFKSKKNMDIKIKGDTIVSDKFEAKIKEPFIINEKDEKKKYIAFKMEITAKKDDKDL
FT                   NPSSISHDYINITQDDKNTVNKLRDGYLLSDKKYKDWTEHNQDQIKKGKTAQAMFIYEL
FT                   RGDGNINLNVHKYSEDKTVDSKSFKFSKLKTEDFSHRAETREEVEKKEKEFEEEYKKEQ
FT                   EREKEKEKQKDDDHSSLDEV"
FT   gene            806021..806173
FT                   /locus_tag="SAAV_0754"
FT   CDS_pept        806021..806173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10672"
FT                   /protein_id="ACY10672.1"
FT                   /translation="MVKKLLKAIKQNFLYEQSNITFKMIVFGYKRLSKMLFQFEINHIN
FT                   FLWEG"
FT   gene            806226..806702
FT                   /locus_tag="SAAV_0755"
FT   CDS_pept        806226..806702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10673"
FT                   /protein_id="ACY10673.1"
FT                   /translation="MALFYFVSVSVQLYQMKISFLPALGFNQILLEREKDQLNIMNSAT
FT                   EEHHHKDYIKLYNLGGGAAKKIAIEVLLGNDKVIQKKYVNILPSKEGYMLPINKNVYEE
FT                   LERTIENNGYEADLNVRMTYYHNVSRKQQEVILKGQIDRFNTYNNKEIYDLQFI"
FT   gene            806841..807371
FT                   /locus_tag="SAAV_0756"
FT   CDS_pept        806841..807371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0756"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10674"
FT                   /protein_id="ACY10674.1"
FT                   /translation="MQIRQIHQHDFAQVDQLIRTAFENSEHGYGNESELVDQIRLSDTY
FT                   DNNLEIVAVLQNEVVGHGLLSEVYLDNGAQREIGLVLAPVSVDIHHQNKGIGKRLIQAL
FT                   EREAILKGYNFISVLGWPTYYANLGYQRASMYDIYPPYDGIPDEAFLIKELKVNSLAGK
FT                   TGTINYTSAFEKI"
FT   gene            807640..810585
FT                   /gene="clfA"
FT                   /locus_tag="SAAV_0757"
FT   CDS_pept        807640..810585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clfA"
FT                   /locus_tag="SAAV_0757"
FT                   /product="clumping factor A"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10675"
FT                   /protein_id="ACY10675.1"
FT                   /translation="MKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASENSVTQS
FT                   DSASNESKSNDSSSVSAAPKTDDTNVSDTKTSSNTNNGETSVAQNPAQQETTQSSSTNA
FT                   TTEETPVTGEATTTTTNQANTPATTQSSNTNAEELVNQTSNETTSNDTNTVSSVNSPQN
FT                   STNAENVSTTQDTSTEATPSNNESAPQNTDASNKDVVSQAVNPSTPRMRAFSLAAVAAD
FT                   APAAGTDITNQLTDVKVTIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKEL
FT                   NLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDNKENVTANITMPAYIDPE
FT                   NVTKTGNVTLTTGIGTNTASKTVLIDYEKYGQFHNLSIKGTIDQIDKTNNTYRQTIYVN
FT                   PSGDNVVLPALTGNLIPNTKSNALIDAKNTDIKVYRVDNANDLSESYYVNPSDFEDVTN
FT                   QVRISFPNANQYKVEFPTDDDQITTPYIVVVNGHIDPASTGDLALRSTFYGYDSNFIWR
FT                   SMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPEDSDSDPGSDSGSDSNSDSG
FT                   SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSAS
FT                   DSDSASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSASDSDSASDSESDSDSDSDSDSDSDSDSESDSDSDSDSDSESDSDSDSDSDS
FT                   DSASDSDSGSDSDSSSDSDSDSTSDTGSDNDSDSDSNSDSESGSNNNVVPPNSPKNGTN
FT                   ASNKNEAKDSKEPLPDTGSEDEANTSLIWGLLASLGSLLLFRRKKENKDKK"
FT   gene            810806..812308
FT                   /locus_tag="SAAV_0758"
FT   CDS_pept        810806..812308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0758"
FT                   /product="putative secreted von Willebrand factor-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10676"
FT                   /protein_id="ACY10676.1"
FT                   /translation="MKNKLLVLSLGALCVSQIWESNHASAVVSGEKNPYVSKALELKDK
FT                   SNKSNSYENYRDSLESLISSLSFADYEKYEEPEYEKAVKKYQQKFMAEDDALKKFLNEE
FT                   KKIKNADISRKSNDLLGLTHERYSYIFDTLKKNKQEFLKDIEEIQLKNSDLKDFNNTEQ
FT                   HNADVEINNLENKVLMVGYTFYNTNKDEVEELYSELDLIVGEVQDKSDKKRAVNQRMLN
FT                   RKKEDLEFIIDKFFKKIQQERPESIPALTSEKNHNQTMALKLKADTEAAKNDVSKRSKR
FT                   SLNTQNNKSTTQEISEEQKAEYQRKSEALKERFINRQKSKNESVVSLIDDEDDNENDRQ
FT                   LVVSAPSKKPTTPTTYTETTTQVPMPTVERQTQQQIVYKTPKPLAGLNGESHDFTTTHQ
FT                   SPTTSNHTHNNVVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKL
FT                   VDNYKDTHSYKDRLNAQQKVNTLSEGHQKRFNKQINKVYNGK"
FT   gene            812661..813683
FT                   /gene="empbp"
FT                   /locus_tag="SAAV_0759"
FT   CDS_pept        812661..813683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="empbp"
FT                   /locus_tag="SAAV_0759"
FT                   /product="secretory extracellular matrix and plasma binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10677"
FT                   /protein_id="ACY10677.1"
FT                   /translation="MKKKLLVLTMSTLFATQLINSNHAKASVTESVDKKFVVPESGINK
FT                   IIPAYDEFKNSPKVNVSNLTDNKNFVVSEDKLNKIVDSSAASKIVDKNFAVPESKLGNI
FT                   VPEYKEINNRVNVATNNPASQQVDKHFVAKGPEVNRFITQNKVNHHFITTQTHYKKVIT
FT                   SYKSTHVHKHVNHAKDSINKHFIVKPSESPRYTHPSQSLIIKHHFAVPGYHAHKFVTPG
FT                   HASIKINHFCVVPQINSFKVIPPYGHNSHRMHVPSFQNNTTATHQNAKVNKAYDYKYFY
FT                   SYKVVKGVKKYFSFSQSNGYKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
FT                   "
FT   gene            814018..814539
FT                   /locus_tag="SAAV_0760"
FT   CDS_pept        814018..814539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10678"
FT                   /protein_id="ACY10678.1"
FT                   /translation="MKRKVLVLTMGVICATQLWHSNHANALVTESVETNFVVKDSDNKN
FT                   ILQTHTEITTEEKFSIVEKSQLNKLKALCNDNYIEYDLHTNQTGIKKGWLYGYSEIDSS
FT                   HFTDRDKRVIRRDHVKEAQSLINDYKDTQSYEDLAKATAKVSTLSQSHQNYLNKQIDKV
FT                   NNKIEKTEKR"
FT   gene            814880..815566
FT                   /gene="nuc"
FT                   /locus_tag="SAAV_0761"
FT   CDS_pept        814880..815566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuc"
FT                   /locus_tag="SAAV_0761"
FT                   /product="thermonuclease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10679"
FT                   /protein_id="ACY10679.1"
FT                   /translation="MTEYLLSAGICMAIVSILLIGMAISNVSKGQYAKRFFFFATSCLV
FT                   LTLVVVSSLSSSANASQTDNGVNRSGSEDPTVYSATSTKKLHKEPATLIKAIDGDTVKL
FT                   MYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENANKIEVEFDKGQRTDK
FT                   YGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSED
FT                   NADSGQ"
FT   gene            815923..816123
FT                   /locus_tag="SAAV_0762"
FT   CDS_pept        815923..816123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0762"
FT                   /product="CSD family cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10680"
FT                   /protein_id="ACY10680.1"
FT                   /translation="MNNGTVKWFNAEKGFGFIEREDGSDVFVHFSAIAEDGYKSLEEGQ
FT                   KVEFDIVEGDRGEQAANVVKM"
FT   gene            complement(816615..816833)
FT                   /locus_tag="SAAV_0763"
FT   CDS_pept        complement(816615..816833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10681"
FT                   /protein_id="ACY10681.1"
FT                   /translation="MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENG
FT                   NISNIDHSLLVSVDPKALEISIFDAVN"
FT   gene            complement(816895..817179)
FT                   /locus_tag="SAAV_0764"
FT   CDS_pept        complement(816895..817179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10682"
FT                   /protein_id="ACY10682.1"
FT                   /translation="MNELTKEQKYTIAKFYKLYIERSNNGETETVANFFGDAKDARENY
FT                   FCDRDYQDFLTNCQILIQNKYLTGEILDDNIYNISILNKTFIEFEQNFG"
FT   gene            complement(817267..817836)
FT                   /locus_tag="SAAV_0765"
FT   CDS_pept        complement(817267..817836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0765"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10683"
FT                   /protein_id="ACY10683.1"
FT                   /translation="MNYIKRTIILLILFVVVSPINSPKTIADNKYSEIQDDKFQLQPGD
FT                   IIVTKGPVMWGFFGHCSIAIDDKTILQIEGPGDKPTTQSFESFKYNYASGKNDWMKVYR
FT                   CSYPGAGKKAAEWVKKNYENTNHRYLVTLNLNSKKFTYCTKIIYQAYKFGVSEKSVKSY
FT                   GLHIISPYAIKDNFIDPYKLRLVKAY"
FT   gene            complement(818024..818212)
FT                   /locus_tag="SAAV_0766"
FT   CDS_pept        complement(818024..818212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0766"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10684"
FT                   /protein_id="ACY10684.1"
FT                   /translation="MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVIL
FT                   YIFGFAILIYTFIFGVL"
FT   gene            complement(818241..818501)
FT                   /locus_tag="SAAV_0767"
FT   CDS_pept        complement(818241..818501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10685"
FT                   /protein_id="ACY10685.1"
FT                   /translation="MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGV
FT                   ILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPIFYSFIG"
FT   gene            complement(818806..818910)
FT                   /locus_tag="SAAV_0768"
FT   CDS_pept        complement(818806..818910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0768"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10686"
FT                   /protein_id="ACY10686.1"
FT                   /translation="MFGQYTKWCVIILKTHDEIVKRHKTCPLHLLSAI"
FT   gene            818842..819045
FT                   /locus_tag="SAAV_0769"
FT   CDS_pept        818842..819045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0769"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10687"
FT                   /protein_id="ACY10687.1"
FT                   /translation="MTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVM
FT                   SNYTDHQLIETTNRAISLYMAN"
FT   gene            complement(819042..819278)
FT                   /locus_tag="SAAV_0770"
FT   CDS_pept        complement(819042..819278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10688"
FT                   /protein_id="ACY10688.1"
FT                   /translation="MDHHNQCNYVNPQNVSLDWECFIISKSEMLLDGVPNELINTWLDK
FT                   DIITPFSIRNDEINFKTKDIWDALIHHNWYYSN"
FT   gene            819503..820084
FT                   /locus_tag="SAAV_0771"
FT   CDS_pept        819503..820084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0771"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10689"
FT                   /protein_id="ACY10689.1"
FT                   /translation="MAKTLYLMRHGQTLFNFKGLIQGFGDSPLTELGIAQAQKARSYYE
FT                   TKGINFDLYASSTQERASDTLENVAPNQSYQRFKGLKEWHFGIFEGESVYLFDNLYKPE
FT                   DLFGDRIVPFKGEARQQVEERIVKTLHDIMSQTKNNALVVSHGTIMGVFLRYCLKLDEA
FT                   LKHNIGNCNILKFEYDNGTFKFVELIDPNL"
FT   gene            complement(820157..820774)
FT                   /locus_tag="SAAV_0772"
FT   CDS_pept        complement(820157..820774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0772"
FT                   /product="LysE/YggA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10690"
FT                   /protein_id="ACY10690.1"
FT                   /translation="MVTAIIHGFILAIGLILPLGAQNVFIFNQGANQPKYRYVLPAIIT
FT                   AGLSDSLLIIIAVVGVSIIIMSLPVLQAIIYIVGLIFLMYMAWTIWHDKPSTDGEAQII
FT                   SPMKQVSFALSVSLLNPHAILDTIGVIGSSAALYSGSNKIAFTIACISVSWLWFFLLAI
FT                   LGKMVGSIDKTGKLLTIINKISSIIIIIVALMILQKLIQLLF"
FT   gene            complement(820929..821423)
FT                   /locus_tag="SAAV_0773"
FT   CDS_pept        complement(820929..821423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0773"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10691"
FT                   /protein_id="ACY10691.1"
FT                   /translation="MIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDIL
FT                   NQGSPKCIVFGCYENETLIATAALEQIRYVGKEHKSLIKYNFVTNNDKSINSELINFII
FT                   NYARQNNYESLLTSIVSNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLIN
FT                   K"
FT   gene            complement(821822..822244)
FT                   /locus_tag="SAAV_0774"
FT   CDS_pept        complement(821822..822244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0774"
FT                   /product="OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10692"
FT                   /protein_id="ACY10692.1"
FT                   /translation="MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADGKATNPEQ
FT                   LFAAGYASCFNGAFDLILKQNKVRDAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNVI
FT                   SQEEAEKYLQMAHEFCPYSKATQGNINVDLNVNVVD"
FT   gene            822392..823108
FT                   /gene="aroD"
FT                   /locus_tag="SAAV_0775"
FT   CDS_pept        822392..823108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="SAAV_0775"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10693"
FT                   /protein_id="ACY10693.1"
FT                   /translation="MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVT
FT                   VDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIE
FT                   WQADIDIEKHQRIIKHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAV
FT                   MPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQA
FT                   PGQIDVTDLKAQVTLY"
FT   gene            823191..823730
FT                   /locus_tag="SAAV_0776"
FT   CDS_pept        823191..823730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0776"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10694"
FT                   /protein_id="ACY10694.1"
FT                   /translation="MELQQAIANRRSVKKFKRDMHIDDALLYQAIEKAADAPNHGMREP
FT                   WRVVHVPKDRLGDMSKDISKFAFPNELDKQQCHYDAVTKLGGMLLLILKTDPRQRQNDE
FT                   NYFAFGAYAQNLMLLLYEAGIGTCWKSPLYIYDPKVRKTLGIKKDEVLAGFLYLTDLEE
FT                   DMPKAPRKNRNLITLY"
FT   gene            complement(823881..824201)
FT                   /locus_tag="SAAV_0777"
FT   CDS_pept        complement(823881..824201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0777"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10695"
FT                   /protein_id="ACY10695.1"
FT                   /translation="MQAIKSNESFKSIINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQ
FT                   YNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAET
FT                   FK"
FT   gene            824345..824701
FT                   /locus_tag="SAAV_0778"
FT   CDS_pept        824345..824701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10696"
FT                   /protein_id="ACY10696.1"
FT                   /translation="MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTI
FT                   IANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKIT
FT                   LGFKEDQYKETWLA"
FT   gene            825303..825416
FT                   /locus_tag="SAAV_0779"
FT   CDS_pept        825303..825416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0779"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10697"
FT                   /protein_id="ACY10697.1"
FT                   /translation="MKENLLGTIIWSIATFYYSRMMKIMNLAILKIKIGGS"
FT   gene            825418..826296
FT                   /locus_tag="SAAV_0780"
FT   CDS_pept        825418..826296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10698"
FT                   /protein_id="ACY10698.1"
FT                   /translation="MLNIQDVSHLSKKEQKAYNRFVESVENGNLPVLPCIEMDLKEMQE
FT                   ETLSQSKIGGMPFLKSFKDIPLDENNVPMVLLAQINLNDLPEQQELFPVNEGILQFWIS
FT                   SEDQMYGMSENLKGNNINSRLVYIKEPITDLSLENIQVHLKSLDADNEDIPFSGAFSIE
FT                   FRLSKQTITCTDYKYDEDVLALWNKVNPSFALKSMFGGYDELMEPVCNTFTAKEPFNQL
FT                   GGYPYFDQIDPRTNDQELKMYDRVLLQIDSTRDDNSSIIWGDLGIANILVKSTDLEAMK
FT                   FDDYMYSWDCS"
FT   gene            827090..827476
FT                   /locus_tag="SAAV_0781"
FT   CDS_pept        827090..827476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0781"
FT                   /product="TOPRIM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10699"
FT                   /protein_id="ACY10699.1"
FT                   /translation="MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMI
FT                   ESLYDKQVFVLADSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKH
FT                   GFTCKKETPLLPNINNERLVLVNE"
FT   gene            827469..827765
FT                   /locus_tag="SAAV_0782"
FT   CDS_pept        827469..827765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10700"
FT                   /protein_id="ACY10700.1"
FT                   /translation="MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEIL
FT                   QLPLLKIDLNFYPQFCKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK"
FT   misc_feature    827823..827926
FT                   /product="SAM riboswitch (S box leader)"
FT                   /note="SAAV_0983"
FT   gene            828015..829040
FT                   /locus_tag="SAAV_0784"
FT   CDS_pept        828015..829040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0784"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10701"
FT                   /protein_id="ACY10701.1"
FT                   /translation="MIELKEVVKEYRTKNKEVLAVDHVNLSIRAGSIYGVIGFSGAGKS
FT                   TLIRMFNHLEAPTSGEVIIDGDHIGQLSKNGLRAKRQKVSMIFQHFNLLWSRTVLKNIM
FT                   FPLEIAGVPRRRAKQKALELVELVGLKGREKAYPSELSGGQKQRVGIARALANDPTVLL
FT                   CDEATSALDPQTTDEILDLLLKIREQQNLTIVLITHEMHVIRRICDEVAVMESGKVIEH
FT                   GPVTQVFENPQHTVTKRFVKEDLNDDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVS
FT                   SLSTAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRH
FT                   G"
FT   gene            829033..829728
FT                   /locus_tag="SAAV_0785"
FT   CDS_pept        829033..829728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0785"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10702"
FT                   /protein_id="ACY10702.1"
FT                   /translation="MGKSFSEIINEMITMPNIQWPEVWTAIVETLYMTVVSTIFAFILG
FT                   LILGVLLFLSAKGKSIGARLFYSIVSFIVNLFRAIPFIILILLLIPFTSLILGTISGPT
FT                   GALPALIIGAAPFYARLVEIAFKEIDKGVIEAAWSMGANTWIVIRKVLLPEAMPALVSG
FT                   ITVTAIALVGSTAVAGVIGAGGLGNLAYLTGFTRNQNDVILVSTVFILIIVFIIQFIGD
FT                   WLTNKLDKR"
FT   gene            829746..830567
FT                   /locus_tag="SAAV_0786"
FT   CDS_pept        829746..830567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0786"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10703"
FT                   /protein_id="ACY10703.1"
FT                   /translation="MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEI
FT                   LEKAKPLLEKKGYDLDIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVS
FT                   AGDVHLEPMAVYSKKYKSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIE
FT                   DAKFSDITENKKDIKFNNKQSAEFSPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVE
FT                   SAKDNPYANLIAVKEGHQDDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK"
FT   gene            complement(830711..831931)
FT                   /locus_tag="SAAV_0787"
FT   CDS_pept        complement(830711..831931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0787"
FT                   /product="pathogenicity island protein, integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10704"
FT                   /protein_id="ACY10704.1"
FT                   /translation="MWYEKFTNKHGETKYRYYEKYKDPLTNKWRRVSVVLNKNGKQSQK
FT                   EAQRLLNERIEAKLNDNTPTTLKSLTFHVACDEWFQNYIKTSGSKRTTIKTKLSKLNTL
FT                   KKFVDEDILINKITLSYAQQVFDELDSKGYVYQVNKDALSIFKNVFEYTRRIYKLQDLE
FT                   FLKDITLNKRIKSYDEVKAKRNKYLELNEIQSIIKDINMKAQKMHSGIHKRFYLFVALM
FT                   TEFQALNGMRIGEMLAIKNEVIDFDNKSLNINGTIHWFHDESGGFGVKDTTKTESSYRT
FT                   IGLSSRSCEILKKAILENKKDSKWNDGYLNRNFVFTNHKGNPMQTERFNKILRKSAKDV
FT                   GIEKEISSHILRHSHISLLSQQGVSLKAIMDRVGHSDHRTTLSIYSHVTEQMDKDMMNK
FT                   LEQVKLG"
FT   gene            complement(831945..833333)
FT                   /locus_tag="SAAV_0788"
FT   CDS_pept        complement(831945..833333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0788"
FT                   /product="SAP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10705"
FT                   /protein_id="ACY10705.1"
FT                   /translation="MKKIFYCFLLIFSILMLFGGINEVTQNKLTFIDIFMFAIFISLIV
FT                   FSIVKLFKHNHLDYKSNKSNTNHKNISNSKTTQFNTVQSNDHIRKNNITHDIETNNTKK
FT                   VKQVKSITNNKTNTLNKDQVKLNENVQENNQDLVIDVKDDNNNNYHYDLNANDILILHL
FT                   NKNREVGKEVKNHFYLLENQINVDEILNKLINLDYLDIKSNFDVSLFYLKVPELKEILR
FT                   EYKLKLSGNKPELIERIKTNIDENAIKLPQVYVPTSKGNKIIGETEYILHFYNSPIISL
FT                   GSAHKMAKEVLNIDDKIEYIYFYLLQQNQKSNNSDHRTANIINSLVLYYKKTNKDKDVI
FT                   RKYTNYATYLSVTQGIHSAAFLYSSEENIIDRLFIYFNYHLEYYENMLFIDNVSRRLFK
FT                   NLFYEDIKSFEDTDKNFCDEICELLFAQIYNNRNITLNNLPTINYVLEKIKKENEIRMT
FT                   KYDF"
FT   gene            complement(833360..833932)
FT                   /locus_tag="SAAV_0789"
FT   CDS_pept        complement(833360..833932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0789"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10706"
FT                   /protein_id="ACY10706.1"
FT                   /translation="MQQNSLEDFSNILKNFRKAEDLTLDTLSKYLGVSDVYVSKLENGK
FT                   RFPSKNILFWYVLFMDQSQMHDDIEKLLTIFSENKKISYEQLRTEYDEFVKKFREKQKK
FT                   HSSKIQRKEIKLTMNEFNQYQIEEIDEPYFDLKWLLNQSEYKLFYSGIDNKNSLGFNEV
FT                   LSESDKKMLSEIVNSVIQRIYNDENQK"
FT   gene            834104..834325
FT                   /locus_tag="SAAV_0790"
FT   CDS_pept        834104..834325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10707"
FT                   /protein_id="ACY10707.1"
FT                   /translation="MIAKVNYLKRLIAFEGLSLKDFASEIEVNSNFLNSIVNGKRTTSP
FT                   KTANKIAKRLNVDIKDIFIFIEEKEEVK"
FT   gene            834326..834598
FT                   /locus_tag="SAAV_0791"
FT   CDS_pept        834326..834598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0791"
FT                   /product="pathogenicity island protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10708"
FT                   /protein_id="ACY10708.1"
FT                   /translation="MARTKLKDIPTKENTISEPKQVVVKPLFAKPNALASIFGISYSST
FT                   NRILKEWEKDPKGVDDLYYSLSSTMTVISIPRFEEYMKKRHKKWM"
FT   gene            834610..834756
FT                   /locus_tag="SAAV_0792"
FT   CDS_pept        834610..834756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0792"
FT                   /product="pathogenicity island protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10709"
FT                   /protein_id="ACY10709.1"
FT                   /translation="MKMYLTYICLVSLLTILLLAISNMYVAFSVYGMMVTYGFNLTGGL
FT                   ENE"
FT   gene            834749..834961
FT                   /locus_tag="SAAV_0793"
FT   CDS_pept        834749..834961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0793"
FT                   /product="pathogenicity island protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10710"
FT                   /protein_id="ACY10710.1"
FT                   /translation="MNNEQKEVIKDIYSSLESVVNNESTEYIHKIKDGKKEWTETVNRE
FT                   QHLQAIIEWTLQQIENNFEFEEENE"
FT   gene            834963..835322
FT                   /locus_tag="SAAV_0794"
FT   CDS_pept        834963..835322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0794"
FT                   /product="pathogenicity island protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10711"
FT                   /protein_id="ACY10711.1"
FT                   /translation="MNKLTKQEYKNIENKLNYDHMVNGKKRTNKINKLLQREHDRDASI
FT                   IKSEYPRLSDGEISEVIVDYRTYKELVIATETFVDFPINYEDSNVCQFITKEDIEDLKS
FT                   AIEEMTSFIENLEEL"
FT   gene            835323..835640
FT                   /locus_tag="SAAV_0795"
FT   CDS_pept        835323..835640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0795"
FT                   /product="pathogenicity island protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10712"
FT                   /protein_id="ACY10712.1"
FT                   /translation="MNWEIRILMGDIGIVKEKLEDVATAHTWFVDERFTKRSLKTKEEV
FT                   VNYGLTYNEHRIHNEQVTELMLTYLKELDGLMNKFHEIEKASSENFGEESDDAQKLKIT
FT                   E"
FT   gene            835704..836573
FT                   /locus_tag="SAAV_0796"
FT   CDS_pept        835704..836573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0796"
FT                   /product="pathogenicity island protein ORF15"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10713"
FT                   /protein_id="ACY10713.1"
FT                   /translation="MNEIKLEYDTHVSVVHYESLDSRSFKSFSKPKWSKLVNKLSVPIE
FT                   ANYKYARGVAVYGDIKNGANDHGEIIKKHRNDNNVIYRDVIVLDYDEINDLKQLHDAIS
FT                   SVLSNVAWFWHTSFSHTTETPRIRLYIPLNERISADDYRKYSKVLANKIGHKVDEGSYQ
FT                   PSRCFALPVIQKGHIFIKRVNDCPIIDVDMLEQWSKELEQSNASPNVIGYTRRDSAYWR
FT                   ELSFGTTEGNRNNALASLVGHLLRCRVNDYIVYSYALLWGQFACKPPMKEQEINATFQS
FT                   ILNKHYNN"
FT   gene            836587..838296
FT                   /locus_tag="SAAV_0797"
FT   CDS_pept        836587..838296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0797"
FT                   /product="pathogenicity island protein ORF 14/13"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10714"
FT                   /protein_id="ACY10714.1"
FT                   /translation="METGKSDVLDKIEKINKKDSALQEIIPKGYEIEHHQCGVALYQLI
FT                   PSKKEGEPDKKVFITSTIPQITERFEDIESNEVSFNMLFYDNKTPVNIAVSAEEISDSR
FT                   QLLKLVNKKLDVTSSTSTKLVDYINVSKRYNPPLNVKVATRLGHVKGYFIYPYQEVMKD
FT                   SNVKLFSNDKGFQKLIDSFRSKGTLQGYSKKVFAQIKDLPMVMVMLYASLGSVLLREFG
FT                   LQPFIVEISGSTSTGKTFTLNLVSSVWGTSDLITTWSSTQNSIESMASFLNSFPMFKDD
FT                   TRNTHPKFVTSATYNFSSGESKSRSNINLTLNAKKEWRNILISTGESSIANMADEKAGV
FT                   SARVVTLQDPPYPDNFDFTTLDKSFRENYGTLGLAFIKQYESKKDVYKKAFESYQRYFN
FT                   QKGSNEIMQRLGRAFALLQVTGEVLNDIDGFEHDHFKIIEQAYDSMVKNNKTIDKPKQL
FT                   LEELLQYLDANRNNIAGDGYSSVKNGDIKAIYKRDYLCILGETVKEKLTHELQTITGQW
FT                   DKKGYLIKGEKDRLQKQVKHQTVKYRGFAIRREVLEELGFDFSNSYNPNSDY"
FT   gene            838626..839006
FT                   /locus_tag="SAAV_0798"
FT   CDS_pept        838626..839006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0798"
FT                   /product="pathogenicity island protein ORF12"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10715"
FT                   /protein_id="ACY10715.1"
FT                   /translation="MDKEQLKKYIYDYVKEYKEIPIYQLEDLFKELNHDYIGRTSITHD
FT                   KDENIVFWSGWNKITMFALIELIKSEQLDLVYRGSFVMRYLLDGRVPNLPLAICYPEDG
FT                   QQTDVPSWVPMVLRINKEEKTK"
FT   gene            839003..839644
FT                   /locus_tag="SAAV_0799"
FT   CDS_pept        839003..839644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0799"
FT                   /product="pathogenicity island protein ORF11"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10716"
FT                   /protein_id="ACY10716.1"
FT                   /translation="MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMA
FT                   YVMMNSKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMM
FT                   ASHLFEDEYFMYGLQTYAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLA
FT                   TGINEPAPELVEGLRLVTEFVQDENATQEDYKALECKLNNLKASYYSLSK"
FT   gene            839991..840332
FT                   /locus_tag="SAAV_0800"
FT   CDS_pept        839991..840332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0800"
FT                   /product="pathogenicity island protein ORF10"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10717"
FT                   /protein_id="ACY10717.1"
FT                   /translation="MQSIAEKETYHLPTEHLQVFNVIKNTSNKYITKTKILNQLGYEYN
FT                   SSNERWLRRVINSLVYDYGYPIGCSYKPSERGYYIITTEQEKLQAMRSIKKLADGSMKR
FT                   YEALKRIEV"
FT   gene            840344..840922
FT                   /locus_tag="SAAV_0801"
FT   CDS_pept        840344..840922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0801"
FT                   /product="pathogenicity island protein ORF9"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10718"
FT                   /protein_id="ACY10718.1"
FT                   /translation="MKTESYFKEYNQFVIDQHKAIQELEQKCNALESKIKIDKSTYKQL
FT                   IMDGQDDKADNLYQATDADEKKLKALNKRLETKKSVSKEVKYQKTIELLKHQSELSSLY
FT                   ESEKQSALGKLKKVVDAYNEIIDEIEDINDRYEDEHQQYASIYSQEQLYDDKEAREALN
FT                   GYFRENIFTSYINGNDLPYEHNNKLFLKC"
FT   gene            840940..841158
FT                   /locus_tag="SAAV_0802"
FT   CDS_pept        840940..841158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0802"
FT                   /product="pathogenicity island protein ORF8"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10719"
FT                   /protein_id="ACY10719.1"
FT                   /translation="MEIKYELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISSE
FT                   LQQSEQSKQKQYGTKLQNLAKQNRIIK"
FT   gene            841209..841736
FT                   /locus_tag="SAAV_0803"
FT   CDS_pept        841209..841736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0803"
FT                   /product="pathogenicity island protein ORF7"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10720"
FT                   /protein_id="ACY10720.1"
FT                   /translation="MKLLKTKHCLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQIE
FT                   SMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKARLQNYKNRSISNMVLLKTVLNH
FT                   YTEKEQKQVVKYMRSNGRYKPYSVIERLQVELYQASIKQRSERQKQRNTAIENSKIARV
FT                   NAYHQSSYVKVV"
FT   gene            841739..842080
FT                   /locus_tag="SAAV_0804"
FT   CDS_pept        841739..842080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0804"
FT                   /product="pathogenicity island protein ORF6"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10721"
FT                   /protein_id="ACY10721.1"
FT                   /translation="MDKKQIRGFVCDYHKRTRSDVLIDDDINTDEFFSIGDEDSNEWAT
FT                   DDNVDDYIIKNHLEIIVGGLATDKEFYIFHSLIQGRSYKDISKVLECSEQSVRLWYETL
FT                   LDKIVEVIE"
FT   gene            842077..842646
FT                   /locus_tag="SAAV_0805"
FT   CDS_pept        842077..842646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0805"
FT                   /product="pathogenicity island protein ORF5; phage
FT                   terminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10722"
FT                   /protein_id="ACY10722.1"
FT                   /translation="MSELTAKQARFVNEYIRTLNVTQSAIKAGYSANSAHVTGCRLLKK
FT                   PHIKQYIQEQKDKIIDENVLTAKELLHVLTNAAVGDETETKEVVVKRGEYKENPQSGKV
FT                   QLVYNEHVELIEVPIKPSDRLKARDMLGKYHKLFTDKHDINGNVPIFINIGEWDGDDDK
FT                   LDKTVKEVSNANPNHPVIVDDIPLED"
FT   gene            complement(842721..843080)
FT                   /locus_tag="SAAV_0806"
FT   CDS_pept        complement(842721..843080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10723"
FT                   /protein_id="ACY10723.1"
FT                   /translation="MLNTIITSIFLFIFFLPFFCIGFFIITLIRDLTRNFNNINVTYNT
FT                   FTYYETGKTILELRYFIWERRKRKYFIDLIERSEIIHLAGNKEIVRGMYYVDASPLKGN
FT                   NKKSFLRKCIQIFEK"
FT   gene            complement(843197..843586)
FT                   /locus_tag="SAAV_0807"
FT   CDS_pept        complement(843197..843586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10724"
FT                   /protein_id="ACY10724.1"
FT                   /translation="MDLFKDISDVSNEIGEGIHDATDAIKKEAEKDAKIAMEKARLFAL
FT                   KHELKSEIQSMISDEKEDIENCFSSLDEIESILKDQSSKLEGAFEGKTSDAIAFNLATE
FT                   QSKLMDLTESYDDCKKSCKTYDGWF"
FT   gene            complement(843588..844796)
FT                   /locus_tag="SAAV_0808"
FT   CDS_pept        complement(843588..844796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0808"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10725"
FT                   /protein_id="ACY10725.1"
FT                   /translation="MSIIQNNDITNHRLSEKVYTIKSNQKYVNIKTNNGMQTFKVQSSR
FT                   IDKVNGFQAMAVSPKDSKGNIDNETVYFVYAGTDKYEPADISTDIYLGTNDIKIETNPD
FT                   KILNAAIYRDTSLKEINPSTVGNNKWLEMVNKNNAKEADQFNEAYLWTQSVLNNGNYKH
FT                   AYGTGHSLGGTIAQVMTVLCNFDKTKTFSAPNGYNILPDNVKENLDLSKYNQTITDYAH
FT                   PNDKIGIATLGSSILGTEILADDSELSKLFFNPISGHGIGTFEFSGGSVKIKVDGKKAD
FT                   QMAREMEDKLHNIDKAIKALEKYMENTKKQAKQIESKYVNKLLSGSHEFISPSDIENYV
FT                   EELSKSGHYDFFDEALFEDTIGELKYTKQRLSQFSEKIIDATKKFEDRDKEISEIYHWF
FT                   EGV"
FT   gene            844889..845215
FT                   /locus_tag="SAAV_0809"
FT   CDS_pept        844889..845215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0809"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10726"
FT                   /protein_id="ACY10726.1"
FT                   /translation="MKHDEKEKFYNEQKERITLYLKYNIKNFKSVEFTSIESDPMGGYA
FT                   INGYINNNKDLSFTASTYADQNNQFEADYSSTSGFQEMMPENPKSVSEIKKEQSNKKDK
FT                   KKDD"
FT   gene            845390..845881
FT                   /locus_tag="SAAV_0810"
FT   CDS_pept        845390..845881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10727"
FT                   /protein_id="ACY10727.1"
FT                   /translation="MYDELKNKPELRKSITHITLSITVLTTIAVIIRLFTKNPPESWVS
FT                   ALNIAGTISIVYYMGVFNSKFKYLKWLAISKKFSYKMFLVFIAIIFFAFPFVLLFVHNL
FT                   SEYIFHTENVLVNYISRIFIIIIMNFTFILMHAMSFTMIILLLMAVLSRRIIKKDKSNT
FT                   "
FT   gene            846481..846675
FT                   /locus_tag="SAAV_0811"
FT   CDS_pept        846481..846675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10728"
FT                   /protein_id="ACY10728.1"
FT                   /translation="MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVE
FT                   NAKEKATDFIDKVKGNKGE"
FT   gene            complement(846909..847760)
FT                   /locus_tag="SAAV_0812"
FT   CDS_pept        complement(846909..847760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0812"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10729"
FT                   /protein_id="ACY10729.1"
FT                   /translation="MQQFKWINILKGFAMGTSDLVPGVSGGTIALLLGIYNQFIASISG
FT                   IFSRRFWPSFTFLIPIIIGMLLAMGSLSNLFNYLLSQHHIPTMFFFGGLIIGIVPYLLK
FT                   ISNYKTSFTTKHYMMVIAGIAILIVITLMNNGDKHAGETLTLSTGLIIKYFIAGMCASS
FT                   AMLLPGISGSFMLLVFGVYGTVMLAISEVVKLNFTGLPILLAVGFGVLAGFIISSKIIQ
FT                   YFLTHHKLMTFALIIGFVVGSLFAVFPGLPTNIVMWFVSLVVFIIGFIVSLTLGRITAE
FT                   NE"
FT   gene            848088..848849
FT                   /locus_tag="SAAV_0813"
FT   CDS_pept        848088..848849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0813"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10730"
FT                   /protein_id="ACY10730.1"
FT                   /translation="MASTLEIKDLHVSIEDKEILKGVNLTINTDEIHAIMGPNGTGKST
FT                   LSSAIMGHPSYEVTKGEVLLDGVNILELEVDERAKAGLFLAMQYPSEITGVTNADFMRS
FT                   AINAKREEGQEINLMQFIKKLDKNMDFLDIDKDMAQRYLNEGFSGGEKKRNEILQLMML
FT                   EPKFAILDEIDSGLDIDALKVVSKGINQMRGENFGALMITHYQRLLNYITPDKVHVMYA
FT                   GKVVKSGGPELAKRLEEEGYEWVKEEFGSAE"
FT   gene            848947..850254
FT                   /gene="sufD"
FT                   /locus_tag="SAAV_0814"
FT   CDS_pept        848947..850254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="SAAV_0814"
FT                   /product="FeS assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10731"
FT                   /protein_id="ACY10731.1"
FT                   /translation="MTTDILNISEEQLVDYSKAHNEPSWMTELRKKALKLTETLEMPKP
FT                   DKTKLRKWDFDSFKQHDVKGDVYQSLSQLPESVREIIDVDHSKNLVIQHNNTIAYTQVD
FT                   DNASKDGVIVEGLADALMNHSDLVQKHFMKDAVTVDEHRITALHTALVNGGVFVYVPKN
FT                   VVVEHPVQYVVLHDDKNASFYNHVIIVTEESAEVTYVENYLSNASGEGNQLNIISEVIA
FT                   GANSNITYGSVDYMDKGFTGHIIRRGITEADASINWALGLMNEGSQIIDNTTNLFGDRS
FT                   TSSLKSVVVGTGEQKINLTSKIVQYGKETDGYILKHGVMKEHASSVFNGIGYIKHGGTK
FT                   SIANQESRVLMLSEHARGDANPILLIDEDDVQAGHAASVGRVDPDQLYYLMSRGISQRE
FT                   AERLVIHGFLDPVVRELPIEDVKRQLREVIERKVSK"
FT   gene            850369..851610
FT                   /locus_tag="SAAV_0815"
FT   CDS_pept        850369..851610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0815"
FT                   /product="SufS subfamily cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10732"
FT                   /protein_id="ACY10732.1"
FT                   /translation="MAEHSFDVNEVIKDFPILDQKFNGKRLAYLDSTATSQTPMQVLNV
FT                   LEDYYKRYNSNVHRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFTRGTTASINLV
FT                   AHSYGDANVEEGDEIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQT
FT                   INDKTKIVAIAHISNVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQEMNADF
FT                   YSFSGHKMLGPTGIGVLFGKRELLQKMEPIEFGGDMIDFVSKYDATWADLPTKFEAGTP
FT                   LIAQAIGLAEAIRYLERIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVIT
FT                   FNLQDVHPHDVATAVDTEGVAVRAGHHCAQPLMKWLNVSSTARASFYIYNTKEDIDQLI
FT                   NALKQTKEFFSYEF"
FT   gene            851600..852064
FT                   /locus_tag="SAAV_0816"
FT   CDS_pept        851600..852064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0816"
FT                   /product="NifU domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10733"
FT                   /protein_id="ACY10733.1"
FT                   /translation="MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRI
FT                   RLTFDIEDGIIKDAKFEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDY
FT                   VITEEMGDIEALQGVSQFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE"
FT   gene            852215..853612
FT                   /gene="sufB"
FT                   /locus_tag="SAAV_0817"
FT   CDS_pept        852215..853612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="SAAV_0817"
FT                   /product="FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10734"
FT                   /protein_id="ACY10734.1"
FT                   /translation="MAKKAPDVGDYKYGFHDDDVSIFRSERGLTENIVREISNMKNEPE
FT                   WMLDFRLKSLKLFYKMPMPQWGGDLSELNFDDITYYVKPSEQAERSWDEVPEEIKRTFD
FT                   KLGIPEAEQKYLAGVSAQYESEVVYHNMEKELEEKGIIFKDTDSALQENEELFKKYFAS
FT                   VVPAADNKFAALNSAVWSGGSFIYVPKNIKLDTPLQAYFRINSENMGQFERTLIIADEG
FT                   ASVHYVEGCTAPVYTTSSLHSAVVEIIVHKDAHVRYTTIQNWANNVYNLVTKRTFVYEN
FT                   GNMEWVDGNLGSKLTMKYPNCVLLGEGAKGSTLSIAFAGKGQVQDAGAKMIHKAPNTSS
FT                   TIVSKSISKNGGKVIYRGIVHFGRKAKGARSNIECDTLILDNESTSDTIPYNEVFNDQI
FT                   SLEHEAKVSKVSEEQLFYLMSRGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKF
FT                   EMEGSIG"
FT   gene            complement(853680..854729)
FT                   /locus_tag="SAAV_0818"
FT   CDS_pept        complement(853680..854729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0818"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10735"
FT                   /protein_id="ACY10735.1"
FT                   /translation="MPVYKDESTNKWYFSIRYKDVYGNNKRKMQRGFSTKREAKSAEAI
FT                   FLNDVNEGYSDSKTFDYIFHHYLENSDLRPKTKRRKQNEYHKHFKAKFGHIKMNKITQN
FT                   QCQEFRKYLIENVASTNSARTIWSGFKVVINYAKKYFGLRTDPTISIKPIPRVKPKPKF
FT                   MMREEFEERIKDIEEQDYRELFTLMFYTGLRIGEAMALVWTDYNKYKKEISINKTMDIS
FT                   NRTIYPRPKTDSSEDIVPLPKFINTMLTERHQREKELNKYFDERSYFIFGGMAPKHYSH
FT                   VQKKFQKAFPHYNIHALRHSYASYLANNGVDIFVLQSLMRHAQITETMGTYSHLYTQKK
FT                   HDAIAIFDK"
FT   gene            complement(854790..855758)
FT                   /locus_tag="SAAV_0819"
FT   CDS_pept        complement(854790..855758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0819"
FT                   /product="DNA adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10736"
FT                   /protein_id="ACY10736.1"
FT                   /translation="MTNHNTKLIQSLYNQFDFYEIPVNRFINSDAQKRSNATNEVLILN
FT                   YKPTKRQLKEFERAKFYKQLKPTSFVLKEYVKWEKLQENVREYELQLNDLNVLMASDEF
FT                   EFKEKFERLYSQRAESFDILPLFISSRNKQIEYWSSDGEAKKYGFDKKETVFDFLVESG
FT                   LRENLFMNNRYKNVLDYILGLEVGLSSNDKKNYTGTWMMNQIANLLKENDITFRKEVPY
FT                   KEIIDANRIKDKTFDFVFNKDDVTYCLEVNFFNTSGSKINSEAERFIELNKELQNYEDI
FT                   EFIWVTDGIGLKKNQTSINKAMKSIGNLYNLTTFDEFLKEL"
FT   gene            complement(855889..856452)
FT                   /locus_tag="SAAV_0820"
FT   CDS_pept        complement(855889..856452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0820"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10737"
FT                   /protein_id="ACY10737.1"
FT                   /translation="MMSEYKLSPIVKWAGGKTQLLDAINALIPNDFAIYHEPFLGGGAT
FT                   LLSNQPKNAIINDLNYELMTTYNVIKHDITPLIKELKDMIKQHNTNNAKDFYMTVREQE
FT                   ILNLNDIEIAARFLYLNKTGFNGLYRVNSQGKFNVPFNKKDMIKNSTVFSETNLRNLNK
FT                   YFNENNIIILNEDFNEALKKVKRK"
FT   gene            complement(856541..856870)
FT                   /locus_tag="SAAV_0821"
FT   CDS_pept        complement(856541..856870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0821"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10738"
FT                   /protein_id="ACY10738.1"
FT                   /translation="MNLKEVDINIEEWEMVEIPFYTEEELTYRLNNNLPLTKSEFEEQE
FT                   SKKMSTYKEIENLHINTGGKELTQEQIEEAKSFIDSQGFKDMIREAKESRQRVMESKIT
FT                   ERTKM"
FT   gene            complement(856882..857598)
FT                   /locus_tag="SAAV_0822"
FT   CDS_pept        complement(856882..857598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0822"
FT                   /product="putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10739"
FT                   /protein_id="ACY10739.1"
FT                   /translation="MNSFKDRLKQIMSERKISQSELSRRTGIGRNSISDYLNGKYEAKQ
FT                   DKVFELAKALNVNEAWLMGFDISKNRKIENNDITTVYNQLTPPRQNNVLKYANSQLDEQ
FT                   NSKGDNVVDINSYKQDKVEVDVNGCVSAGVGESLHEEAIFKTYVKAPVPPHDLALKVNG
FT                   NSMEPMFKDGEIIFVEKTHNIKNGQIGIFIIEGEAYLKKVFVEDNRLTLVSLNKKYRDL
FT                   HFYRNESVRLVGKVIL"
FT   gene            857762..858004
FT                   /locus_tag="SAAV_0823"
FT   CDS_pept        857762..858004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0823"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10740"
FT                   /protein_id="ACY10740.1"
FT                   /translation="MIYNFDYSLLYERMAEYRYSQSSLANAIPISRTSINHKLQGKNLF
FT                   TQWEIKRICELLEIPPTKVGRYFFEQNVQKTVQMS"
FT   gene            858017..858460
FT                   /locus_tag="SAAV_0824"
FT   CDS_pept        858017..858460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0824"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10741"
FT                   /protein_id="ACY10741.1"
FT                   /translation="MEQITLTKEELKEIIAKEVREAINGKKPISSGSIFNKVRIDSDDL
FT                   EEINKKLDFAKHLSLGRMRKLNHPIPLKKYQHGFESIHQKAYVQDVHDHIRKLTLSIFG
FT                   VTLNSDLSESEYNLAAKFYRDIKNYYLYIYEKRVSELTIDDFE"
FT   gene            858475..858618
FT                   /locus_tag="SAAV_0825"
FT   CDS_pept        858475..858618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0825"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10742"
FT                   /protein_id="ACY10742.1"
FT                   /translation="MLQKFRIAKEKSKLKLNLLKHANSNLETRNNPELLRAVAELLKEI
FT                   NR"
FT   gene            complement(858628..859230)
FT                   /locus_tag="SAAV_0826"
FT   CDS_pept        complement(858628..859230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0826"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10743"
FT                   /protein_id="ACY10743.1"
FT                   /translation="MDNINLTQRQLDLIKKNQAILSKLPIETYAKVVNTMNDLRINQSK
FT                   LSDWASYMHRVTKNHPMFKTNLFSEKILDEFISSNSFPEDEVRKVSTHLRNSFVDTVDV
FT                   PVLGKTVDSAHPIDDVNTEKYNSVFNESLNHIFISPSAKFIKKVSVGSAIGVTSPVMVR
FT                   TILDQYVNYFMFFNVIATLLTLYVIANYLYDENSNDD"
FT   gene            859860..860612
FT                   /locus_tag="SAAV_0827"
FT   CDS_pept        859860..860612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0827"
FT                   /product="phage anti repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10744"
FT                   /protein_id="ACY10744.1"
FT                   /translation="MQALQTKSNIGEMFNIQEKENGEIAISGRELHQALEVKTPYKKWF
FT                   ERMSDYGFEENIDYVVTDIFVHNPLGGRQNQIDHALTLDTAKEIAMIQRSEPGKRARQY
FT                   FIQVEKAWNSPEMIMQRALKIANNTINQLETKIERDKPKIVFADAVATTKTSILVGELA
FT                   KIIKQNGINIGQRRLFEWLRQNGFLIKRKGVDYNMPTQYSMERELFEIKETSITHSDGH
FT                   TSISKTPKVTGKGQQYFVNKFLGEKQTS"
FT   gene            860653..860943
FT                   /locus_tag="SAAV_0828"
FT   CDS_pept        860653..860943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0828"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10745"
FT                   /protein_id="ACY10745.1"
FT                   /translation="MEINVCGVKYKIVQLEDVDNNPSCLGLCIYKDSLIQLKRGLSFER
FT                   KKQILIHELLHAMMYESGYEEHDEELVNNLSIVINQVISQNDIKATLNELE"
FT   gene            complement(860955..861125)
FT                   /locus_tag="SAAV_0829"
FT   CDS_pept        complement(860955..861125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0829"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10746"
FT                   /protein_id="ACY10746.1"
FT                   /translation="MATNPPKDGRRKGAVKNRSQVKNPKTGRYVKRNSETGRFMDVKSD
FT                   SKPFKGVRKER"
FT   gene            861196..861417
FT                   /locus_tag="SAAV_0830"
FT   CDS_pept        861196..861417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0830"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10747"
FT                   /protein_id="ACY10747.1"
FT                   /translation="MIKNSLQAKELAVILSVSKSKAGQIIRELNKELEDEGYIAIRGRV
FT                   PVQLARKKFPYHDLSDERIMEELKKENE"
FT   gene            861665..861925
FT                   /locus_tag="SAAV_0831"
FT   CDS_pept        861665..861925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0831"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0831"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10748"
FT                   /protein_id="ACY10748.1"
FT                   /translation="MYYEIGDVCQKVINVDGFDFKLAVKKKDHSILVNILDLEDKFIDG
FT                   INITNENDLYTALDILNQSIYEWIEENADDYDRLINLVMKW"
FT   gene            861933..862169
FT                   /locus_tag="SAAV_0832"
FT   CDS_pept        861933..862169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0832"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10749"
FT                   /protein_id="ACY10749.1"
FT                   /translation="MKPHKFKRMAIDLIERVQSTSYQVDYKYNVIWVWHYSDDYLGKVA
FT                   SINMHNNVDDDNTILARYEKAKKMLAGEVLSDG"
FT   gene            862162..862641
FT                   /locus_tag="SAAV_0833"
FT   CDS_pept        862162..862641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0833"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10750"
FT                   /protein_id="ACY10750.1"
FT                   /translation="MANLYELSEAFKELSNQDELDQTLLKDTLDSIQAEMNVKVDNIVN
FT                   WRRETLGDIDVIDKEIKRLQNLKKQKQNLTDRLRDYLKEMLETQEVDSYRTATNHIFKR
FT                   KNGASKNIIDEKLIPKDYWLSQAPKLNSKQLIDDLKAGKDIPGVELKVTESLVIK"
FT   gene            862641..863279
FT                   /locus_tag="SAAV_0834"
FT   CDS_pept        862641..863279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0834"
FT                   /product="putative phage single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10751"
FT                   /protein_id="ACY10751.1"
FT                   /translation="MNKSETVVEINKAMVAFRKEVKQPLKDKNNPFFKSKYVPLENVVE
FT                   AIDEAATPHGLSYTQWALNDVDGRVGVATMLMHESGEYIEYDPVFMNAEKNTPQGAGSL
FT                   ISYLKRYSLSAIFGITSDQDDDGNEASGKNNNPKQQTRTQWASSETIGILKKEVISFTK
FT                   LIKGTDKEAPQNIVEQKFDINNYKLTEKQAAEAIQKIRNNAKTITGGKR"
FT   gene            863279..863704
FT                   /gene="ssb1"
FT                   /locus_tag="SAAV_0835"
FT   CDS_pept        863279..863704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb1"
FT                   /locus_tag="SAAV_0835"
FT                   /product="single-stranded DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10752"
FT                   /protein_id="ACY10752.1"
FT                   /translation="MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGERE
FT                   ADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRNYENKDGQRVFVTEVVADSVQFLE
FT                   PKNNNQQQKNNYQQQRQTQTGNNPFDNTEEDFSDLPF"
FT   gene            864389..864508
FT                   /locus_tag="SAAV_0836"
FT   CDS_pept        864389..864508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0836"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10753"
FT                   /protein_id="ACY10753.1"
FT                   /translation="MNKILIRFAINYIKYQQKQLREKEARIKYLEGFLKGKGY"
FT   gene            complement(864502..865152)
FT                   /locus_tag="SAAV_0837"
FT   CDS_pept        complement(864502..865152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0837"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10754"
FT                   /protein_id="ACY10754.1"
FT                   /translation="MKKCFIACPIGTDDSKVRRNSDFLLQSIIKPALESDFEIQRSDLI
FT                   SSTNKITDEIIGGLTNSELVIVDLSTHNPNVFYELGYRHALERPTITMINKDENIPFDV
FT                   SAYRTIYYSELYADVVNAKDQLKETIKTFTDNDFNFENPVNKYNNIDNEYGVLNRHLLD
FT                   IKSDLSELKEFLPSVTKQDPDIPADSMVRMMELAVQYPDQFERLMELQNKNSQ"
FT   gene            865207..865977
FT                   /locus_tag="SAAV_0838"
FT   CDS_pept        865207..865977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0838"
FT                   /product="putative phage replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10755"
FT                   /protein_id="ACY10755.1"
FT                   /translation="MATFRTIKESGDFVTVHKSFVFDSNLSAKAKGILLYFLSRPDNWQ
FT                   IYTSEVVKHMNDGQKSINSGVQELMDNKYVHRIQKRAENGVFKGFEYLVYEKPTEMPFS
FT                   ENGLSANGFSENGKTENRKGRTTNNNSTNNDLTNNNNTNNEGSILSGNPTVSSIPYKEI
FT                   IEYLNKKAGKHFKHNTAKTKDFIKARWNQDFRLEDFKKVIDIKTAEWLNTDSDKYLRPE
FT                   TLFGNKFEGYLNQKIQPTGTDQLERMKYDESYWD"
FT   gene            865987..866760
FT                   /locus_tag="SAAV_0839"
FT   CDS_pept        865987..866760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0839"
FT                   /product="DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10756"
FT                   /protein_id="ACY10756.1"
FT                   /translation="MKPLFDEKINKSLKKYQPIEVILRQNCDKCGHQYDLYKFENGYEY
FT                   KDGCECEIQRLAYEEYKRNKQKKLDYIFNQSNVNPSLRDATVNNYKPQNEKQVQAKQTA
FT                   IEYVQGFSTKEPKSLILQGSYGTGKSHLAYAIAKAVKAKGHTVAFMHIPMLMDRIKATY
FT                   NKNAVETTDELVRLLSDIDLLVLDDMGVENTEHTLNKLFSIVDNRVGKNNIFTTNFSDK
FT                   ELNQNMNWQRINSRMKHNARKVRVIGDDFRERDTW"
FT   gene            866754..866912
FT                   /locus_tag="SAAV_0840"
FT   CDS_pept        866754..866912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0840"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10757"
FT                   /protein_id="ACY10757.1"
FT                   /translation="MVTKEFLKTKLECSDMYAQKLIDEAQGDENKLYDLFIQKLTERHT
FT                   RPAIVEY"
FT   gene            867156..867473
FT                   /locus_tag="SAAV_0841"
FT   CDS_pept        867156..867473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0841"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10758"
FT                   /protein_id="ACY10758.1"
FT                   /translation="MEIEIKFNETFEAPMGSPRPRFRNTGRFVQTYMPTSYTKHKAYIQ
FT                   KQMPKLKLEHALKIELDFYFPLLKSWSKKKKSEMVGQYKVTKPDIDNLIKTVLDACNGH
FT                   V"
FT   gene            867563..867748
FT                   /locus_tag="SAAV_0842"
FT   CDS_pept        867563..867748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0842"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10759"
FT                   /protein_id="ACY10759.1"
FT                   /translation="MQQQAYINATIDIRIPTEVEYQYFDDVDKEKETLADYLYNNPDEI
FT                   LEYDNLKIRNVNIEVE"
FT   gene            867749..868108
FT                   /locus_tag="SAAV_0843"
FT   CDS_pept        867749..868108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0843"
FT                   /product="PVL ORF-50 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10760"
FT                   /protein_id="ACY10760.1"
FT                   /translation="MSVVKINGKPYKFTEHENELIKKNGLTPGMVAKRVRGGWKLLEAL
FT                   HAPYGMRLAEYKEIVLSRIMQRESKEREIARQRRKEAELRRKKPHLFNVPQVHPRDPYW
FT                   FDTTYNQMFKKWQEA"
FT   gene            868369..868620
FT                   /locus_tag="SAAV_0844"
FT   CDS_pept        868369..868620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0844"
FT                   /product="conserved hypothetical phage prtotein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10761"
FT                   /protein_id="ACY10761.1"
FT                   /translation="MMNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILE
FT                   GLHNAMQDALKEDIELDEAVGIMTGQVVYEYEEEQEND"
FT   gene            868613..869146
FT                   /locus_tag="SAAV_0845"
FT   CDS_pept        868613..869146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0845"
FT                   /product="putative dUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10762"
FT                   /protein_id="ACY10762.1"
FT                   /translation="MTNTLQVRLLSETARMPERNHKTDAGYDIFSAETVLLEPQEKAVI
FT                   KTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDNETLESEDM
FT                   SNFGRSPAGIDGKYARLPVTDKILCMNGSYVINKGDKLAQLVIVPIWTPELKQVEEFES
FT                   VSERGAKGFGSSGV"
FT   gene            869183..869428
FT                   /locus_tag="SAAV_0846"
FT   CDS_pept        869183..869428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0846"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10763"
FT                   /protein_id="ACY10763.1"
FT                   /translation="MSDMLEIFLIGFGVYLFYRIAIIFLKSKKTIHTNIYEMLMLATIF
FT                   MISTFAYKHQKTHILIAFLVMFFMSKLKQVQGSYEE"
FT   gene            869425..869631
FT                   /locus_tag="SAAV_0847"
FT   CDS_pept        869425..869631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0847"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0847"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10764"
FT                   /protein_id="ACY10764.1"
FT                   /translation="MTQYLVTTFKDSTGLPHEHITVARDNQTFTVVEAENKEEAKEKYE
FT                   AQVKRDAIIKLGQLFENIRECGK"
FT   gene            869628..870014
FT                   /locus_tag="SAAV_0848"
FT   CDS_pept        869628..870014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0848"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0848"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10765"
FT                   /protein_id="ACY10765.1"
FT                   /translation="MIKKLKNMDWFDIFIAGILRLFGVIALMLVVISPIYTVASYQNKE
FT                   VHQGTITDKYNKRQDKEDKFYIVLDNKQVIENSDLLFKKKFDSADIQARLKVGDKVEVK
FT                   TIGYRIHFLNLYPVLYEVKKVDKK"
FT   gene            870319..870969
FT                   /locus_tag="SAAV_0849"
FT   CDS_pept        870319..870969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0849"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0849"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10766"
FT                   /protein_id="ACY10766.1"
FT                   /translation="MNEQIIGSIYTLAGGVVLYSVKEIFRYFTDSNLQRKKINLEQIYP
FT                   IYLDCFKKAKKMIGAYIIPTEQHEFLDFFDIEVFNNLDKQSKKAYENVIGFRQMINLSN
FT                   RVKAMEDFKMSFNNEFSTNQIFFNPSFVMETIAIINEYQKDISYLKNIINKMNENRAYN
FT                   HIDSFITSEYRRKINDYNLYLDKFEEQFSQKFKINRTSIKERIIINLNKRRFK"
FT   gene            870966..871169
FT                   /locus_tag="SAAV_0850"
FT   CDS_pept        870966..871169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0850"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10767"
FT                   /protein_id="ACY10767.1"
FT                   /translation="MMWITMTIVFAILLLVCISINSDRAREIQALRYMNDYLLDEVVKT
FT                   KGYNGLEEYRIELKRMNNDIKK"
FT   gene            871192..871662
FT                   /locus_tag="SAAV_0851"
FT   CDS_pept        871192..871662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0851"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0851"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10768"
FT                   /protein_id="ACY10768.1"
FT                   /translation="MYNRKEIREMIDNYKWMKNIIDSKVYDNESTSIAQYGYQSAMPKA
FT                   KGTTSNKVLVKVINKNKALRKYDYLINKIAFIDEYEEYITNEKDYHILQMLKQRESHNR
FT                   IMSILDIGRDNFYSRVKDIVNILYNLQQKTDTSYTSDSSDTSYKSYKSYTSD"
FT   gene            871777..872229
FT                   /locus_tag="SAAV_0852"
FT   CDS_pept        871777..872229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0852"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10769"
FT                   /protein_id="ACY10769.1"
FT                   /translation="MEISKYQEIATRTHNDELNLNESITCYGLGLTQSTGNVTDLIKQH
FT                   MFCNVPIDKGIMINELSEALWNIANLTNVLGINLDEIAGHSVNTILMNKPNQTINLDNG
FT                   IKQGDKVLFQGSKYLVDGSIGNLLLISNDKDDRQVTVQDVKKVDKE"
FT   gene            872236..872589
FT                   /locus_tag="SAAV_0853"
FT   CDS_pept        872236..872589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0853"
FT                   /product="putative phage endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10770"
FT                   /protein_id="ACY10770.1"
FT                   /translation="MSIMKRCGHPTCNVLINHNESYCDKHKQYANENYNDLRRRNDPEY
FT                   LRFYKSKTWQNMRRIVLLEHDFICVSCGNQATMVDHIVPTKIDWARRLDKSNLQPLCDA
FT                   CHNQKTKEDLKKY"
FT   gene            872717..873187
FT                   /locus_tag="SAAV_0854"
FT   CDS_pept        872717..873187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0854"
FT                   /product="putative phage terminase, small subunit, P27
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0854"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10771"
FT                   /protein_id="ACY10771.1"
FT                   /translation="MAGRPKKLLSNSNKNYTKEEIIEKERQEAQLNKFSKIDTEPPHFL
FT                   DEIAKQEYLRILPHMQELPISNLDKAQLAQYCSFYSDFVKASLILEQESLMLEDDRGNQ
FT                   KVNPAFNIKEKAGIRMQQTANTLGLTIDSRLRIMVPEEKENDDPYMKFASDD"
FT   gene            873187..874881
FT                   /locus_tag="SAAV_0855"
FT   CDS_pept        873187..874881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0855"
FT                   /product="putative phage terminase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0855"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10772"
FT                   /protein_id="ACY10772.1"
FT                   /translation="MIDYVTQYAKKVVSGEILASQKNIQVCKRHLSFIENPPIGCHWDN
FT                   RLSNKAIEFVEMLPDPKTNEPMPLMEFQKFIVGSLYGWRRGQYRMFTKAYISMARKQGK
FT                   SLIVSGMSVNELLFGQYPKFNRQIYVASSTYKQAQTIFKMASQQVNLMRSKSKFIREKT
FT                   DVRKTDIEDILSSSVFAPLSNNPDAVDGKDPTVAILDELASMPDDEMYSRFKTGMTLQK
FT                   NPLTLLVSTAGDNLNSQMYQEYKYIKRILNEEVRADNYFVYCAEMDSQEEVQDETKWIK
FT                   AMPLLESKEHRKTILQNIKSDIQDELEKGTSYHKILIKNFNLWQAQREDSLLDIEDWEQ
FT                   ATTNMPNINGKDVYIGVDLSRLDDLTSVGFIFPNDNKKVFLHSHSFIGLRTNLEQKAKR
FT                   DKINYDLVIERGEADVTRSDSGMIDYKQVIDFIMDFITTHDLNVKAVCYDPWNAQSFIT
FT                   TIESMALDWPLIEVGQSFKALSQSIKEFRMWVADKRIQHNDNTLLTTSVNNAVLIRDGE
FT                   DNVKINKKMNRQKIDPIISIITAFTEARMHEFQENWAEIYESEEFGF"
FT   gene            874895..875095
FT                   /locus_tag="SAAV_0856"
FT   CDS_pept        874895..875095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0856"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0856"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10773"
FT                   /protein_id="ACY10773.1"
FT                   /translation="MDLNKINVFFNLLVANLVSILFLLGLFVINISVYKTFGQNMGLLC
FT                   TGITLIVISLILNHESNQERR"
FT   gene            875161..876351
FT                   /locus_tag="SAAV_0857"
FT   CDS_pept        875161..876351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0857"
FT                   /product="phage portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0857"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10774"
FT                   /protein_id="ACY10774.1"
FT                   /translation="MMVQTLPGFQGTKLREYKDVEAIKHSDIFTAVMMIASDLARMPIR
FT                   LTVNGQIDYSDRVINLLNTRPNPMYNGYIFKLVVFASALLTSHGYVEITRDKIGKPMNL
FT                   TFRKTSEIELKSDARGRLYYFHQRIDSKGNIIERNVKFEDMLDIKFYSLDGINGLSLLD
FT                   TLSRTIESDNNGKDFLNNFLRNGTHAGGILKMKGVLDNKKARERAREEFHKTFSGTKQA
FT                   GKVVVLDESMTFDQLEVDTEVLKLIRENKSSTREIAGVFGIPLHKFGIETANMSITDAN
FT                   LDYLSTLKPYITCVCAELNFKFNDEYVNREFKFDTTEIRVVDEKTQAEIDKINIDSGKM
FT                   NIDEIRQRDGLAPIPGGNGSIHRVDLNHVNIELVDEYQMNKSRATDKKLKGGEENE"
FT   gene            876344..876928
FT                   /locus_tag="SAAV_0858"
FT   CDS_pept        876344..876928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0858"
FT                   /product="phage prohead protease, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0858"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10775"
FT                   /protein_id="ACY10775.1"
FT                   /translation="MSKETRVGNIIEVRSNDNNEMVIEGYALKFDTWSENLGGFKETIS
FT                   RRALENTDLSDVRCLVDHIPSQIIGRTKSGTLELETDDVGLKYRCKLPNTTFARDLYEN
FT                   MRVGNINQCSFGFMLDDKGDEVRFDEQENIYKRTLTAIRELTDVSVVTYPAYKDTDVKP
FT                   ALRSIETVKKEQRKKELEIRLKKHSILNNIW"
FT   gene            877016..878263
FT                   /locus_tag="SAAV_0859"
FT   CDS_pept        877016..878263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0859"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0859"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10776"
FT                   /protein_id="ACY10776.1"
FT                   /translation="MKTKEKLQSEISDIKRQIDLKVKYATRALNNDELEKAEKLEQEIT
FT                   DLRSQIQEKQEELDKLKEKDGTSENNPQTVELNEARTYRNQANINDLGISIQNTKVTSQ
FT                   EVRDFTEYLETRNDIQGGSLKTDSGFVVIPEEIVTDILKLKEVEFNLDKYVTVKRVTNG
FT                   SGKYPVVRQSEVAALEKVEELEENPELAVKPFFQLAYDINTHRGYFRISREAIEDAKVN
FT                   VLQELKLWMARTIAATRNKAIIDVITKGSTGSTSSGFEKEGKKLEVKKAKSLDDIKDAI
FT                   NLNVKPNYEHNVAIVSQTMFAKLDKMKDKLGNYLIQPDVKEKTQQRLLGAKIEILPDEV
FT                   LGQKGNNTLIIGNLKDAIVLFDRSQYQASWTDYMHFGECLMIAVRQDCRILDYKSAIVI
FT                   EYDDSERGEGDLGLEA"
FT   gene            878299..878457
FT                   /locus_tag="SAAV_0860"
FT   CDS_pept        878299..878457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0860"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10777"
FT                   /protein_id="ACY10777.1"
FT                   /translation="MAMYEVKKSYTDLEKGQYLKSGKRVEMTVKRAEYVNKKLKEHGVI
FT                   LERVKEE"
FT   gene            878466..878798
FT                   /locus_tag="SAAV_0861"
FT   CDS_pept        878466..878798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0861"
FT                   /product="putative DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10778"
FT                   /protein_id="ACY10778.1"
FT                   /translation="MQLTAEELKLLKKHCKIDHNSEDDLLGIYYSWAFHEIASAVTDEP
FT                   SKYIDWFKSHPLFARAIYPLASYYFENRIAYLDRDLSLAPHMVLSTVHKLRGSFEQFLE
FT                   SENDEI"
FT   gene            879120..879497
FT                   /locus_tag="SAAV_0862"
FT   CDS_pept        879120..879497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0862"
FT                   /product="HK97 gp10 family phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0862"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10779"
FT                   /protein_id="ACY10779.1"
FT                   /translation="MGARIESNNIEQGLKNAVLKMNLNSNVIVKAGAMSLVPLLKSNTP
FT                   FANTKKHARDHIAVSNVKTDRHTSEKIVTIGYAKGVSHRIHATEFGTMYQKPQLFITKT
FT                   EKQGKNKVLKTMLDTAKRLQK"
FT   gene            879494..879874
FT                   /locus_tag="SAAV_0863"
FT   CDS_pept        879494..879874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0863"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0863"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10780"
FT                   /protein_id="ACY10780.1"
FT                   /translation="MINVTKIIRNAIIANNITDEVNVFNYTIDDHFHEKTDKPIIRIYP
FT                   LPFNPDTYADDNEISREYHYQIDVWWSQDEPNEQAEKIVELLKVINFQCYYREPLYESD
FT                   VMSFRHIIRAKGSILSMKLEEN"
FT   gene            879875..880828
FT                   /locus_tag="SAAV_0864"
FT   CDS_pept        879875..880828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0864"
FT                   /product="putative phage major tail protein, Phi13 family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0864"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10781"
FT                   /protein_id="ACY10781.1"
FT                   /translation="MIEKLKQAPRFLKLNLQHFADTGVSGIAIGVSNFYYAPILKDTEN
FT                   EWETGAGTRIRFLKEIEVDRPQDTEEDYGDDMVAATAVSNGKLSVKTTFVTVPADDKAF
FT                   LNGAKKGVGGYKYGAKDIPPDVAIVFERRNHDESSEWVGLFKGKFTRSSIKGQTKQDKV
FT                   EFQNDDVEGNFIDRLFDESSHVTGYDKKGSTTGRDYVFMETFGKTYDEFMSSRGEQNME
FT                   PVEKEMKKTEKVEVTSVNVTDEQVTVKVDATKQLSATTEPSGQKVTYAVTEGQTYASVT
FT                   STGLVKGLAEGNATVTATAGKQTDTVQITVQSNLEM"
FT   gene            880893..881339
FT                   /locus_tag="SAAV_0865"
FT   CDS_pept        880893..881339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0865"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0865"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10782"
FT                   /protein_id="ACY10782.1"
FT                   /translation="MERTSIELITGFTKTGKPQYQKYLAKPIITLFETIQGSKLGLKLN
FT                   KAFKGADFKDLTEEEFNNLSVTEQEEYKNKQEEYENNMAVQMEVLEEVLDFIVEAFDNQ
FT                   FTSIELQKGLPNGQEGIEKIGQLIGRITGGEPSDTKKFVTENQK"
FT   gene            881399..881521
FT                   /locus_tag="SAAV_0866"
FT   CDS_pept        881399..881521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0866"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0866"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10783"
FT                   /protein_id="ACY10783.1"
FT                   /translation="MIENGMDAEKVANMPIHFFLDIVESKIETKRTAKSFKDIF"
FT   gene            881577..886226
FT                   /locus_tag="SAAV_0867"
FT   CDS_pept        881577..886226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0867"
FT                   /product="phage tail tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0867"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10784"
FT                   /protein_id="ACY10784.1"
FT                   /translation="MPNPIGNMVIKVDLDGSGFNRGVTGLNRQMKMVSRELSANLSQFS
FT                   RYDNSLEKSKIKVEGLSKKQKVQAQITKELKDSYDKLSKETGENSAKTQAAAAKYNEAY
FT                   AKLNQYERELNQATQELKDMQREQKALNTAMGKLGTNFNNFGPKLQEIGNSMKNVGRNM
FT                   TMYVTAPVVAGFAVAAKKGIEFDDSMRKVKATSGATGEEFEALKKKAREMGATTKFSAS
FT                   DSAEALNYMALAGWDSKQMMEGLSGVMDLAAASGEELGAVSDIVTDGLTAFGLKAKDSG
FT                   HFADVLAQTSSKANTDVRGLGEAFKYVAPVAGALGYTIEDTSIAIGLMSNAGIKGEKAG
FT                   TALRTMFTNLSSPTRAMGNEMERLGISITDSNGKMIPMRKLLDQLREKFKHLSKDQQAS
FT                   SAATIFGKEAMSGALAIINASDEDYQKLTKSIDSSTGASKRMADTMESGLGGKLRTLRS
FT                   QLEELALTIYDRIEPALKIIVSAFSKVVTWVTKLPTSIQLAVVGFGLFAAVLGPLVFMF
FT                   GLFISVMGNAMTVLGPLLINVNKAGSIFAFLRTKIASLVKLFPILGVSISSLTLPITLI
FT                   VGALVGIGIAFYQAYKRSETFRNIVNQAISGVANAFKAAKLALQGFFDLFKGDSKGAVT
FT                   LEKIFPPETVAGIQNVVNTIRTTFFKVVDAIVGFAKEIGAQLASFWKENGSEITQALQN
FT                   IAGFIKATFEFIFNFIIKPIMFAIWQVMQFIWPAVKALIVSTWENIKGVIQGAINIILG
FT                   IIKVFSSLFTGNWRGVWDGIVMILKGTVQLIWNLIQLWFVGKILGVVRYFGGLLKGLIA
FT                   GIWDVIKSIFSKSLSAIWNATKSIFGFLFNSVKSIFTNMKNWLSSTWNNIKSNTVDKAH
FT                   SLFTGVRSKFTNLWNATKDIFTKLRNWMSNIWNSIKDNTVGIAGRLWDRVRNIFGSMRD
FT                   GLKSIIGKIKDHIGGMVDAVKRGLNKLIEGLNWVGGKLGMDKIPKLHTGTEHTHTTTRL
FT                   VKNGKIARDTFATVGDKGRGNGPNGFRNEMIEFPNGKRVLTPNTDTTAYLPKGSKVYNG
FT                   AQTYSMLNGTLPRFSIGTMWKDIKSGASSAFNWTKDQIGKGTKWLGDKVGDVMDFIDNP
FT                   GKLLNYVLQAFGVDFSSLTKGMGIAGDITKAAWSKIKKSAIKWLEDAFAESGDGGVLDM
FT                   NKLRYLYGHTAAYTRETGRPFHEGLDFDYIFEPVPSTINGRAQVMPFHNGGYGKWVKIV
FT                   KGALEVIYAHLSKYKVKTGQQVRVGQTVGISGNTGFSTGPHLHYEMRWNGRHRDPLPWL
FT                   RKNNGGGKSTPGGNGAANARRAIKAAQNILGGRYKASWITNEMMRVASRESNYTANAVN
FT                   NWDSNARAGIPSRGMFQMIDPSFRAYAKSGYNNPLNPTHQAISAMRYIVGKWVPRTGSW
FT                   RAAFKRAGDYAYATGGKVYNGLYHLGEEGYPEWIIPTDPSRANEAHKLLALAANDIDNR
FT                   SKNKRPNNLPNPSISNSDTNYIHTLENKLDAVINCLVSLVESNQVIADKDYEPVINKYV
FT                   FEDEVNNSIDKRERHESTRVRFRRGGTII"
FT   gene            886226..887716
FT                   /locus_tag="SAAV_0868"
FT   CDS_pept        886226..887716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0868"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0868"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10785"
FT                   /protein_id="ACY10785.1"
FT                   /translation="MQDTIQIDNKTIEWLVVQRGFEIPSFNFVTEKESVKGRTGSIAKA
FT                   RYLNDIEFELPLIIRNEVLAPGGQKTHDDILEELVEFFDIDNLKPKKLKFKSQNWYWFA
FT                   YFDGPLKLPKNPRGSVKFTIKVVLTDPYKYSVTGNKNTAISDQVSVVNSGTADTPLIVE
FT                   ARAIKPSSYFMITKNDEDYFMVGDDEVTKEVKDYMPPVYHSEFRDFKGWTKMITEDIPS
FT                   NDLGGKVGGDFVISNLGEGYKATNFPDAKGWVGAGTKRGLPKAMTDFQITYKCIVEQKG
FT                   KGAGRTAQHIYDSDGKLLASIGYENKYHDRKIGHIVVTLYNQKGDPKKIYDYQNKPIMY
FT                   NLDRIVVYMRLRRVGNKFSIKTWKFDHIKDPDRRKPIDMDEKEWIDGGKFYQRPASIIA
FT                   IYSAKYNGYKWMEMNGLGSFNTEILPKPKGARDVIIQKGDLVKIDMQAKSVVINEEPML
FT                   SEKSFGSNYFNVDSGYSELIIQPENVFDTTVKWQDRYL"
FT   gene            887732..891514
FT                   /locus_tag="SAAV_0869"
FT   CDS_pept        887732..891514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0869"
FT                   /product="phage minor structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0869"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10786"
FT                   /protein_id="ACY10786.1"
FT                   /translation="MIHVLDFNDKIIDFLSTDDPSLVRAIHKRNVNDNSEMLELLISSE
FT                   RAEKFRERHRVIIRDSNKQWREFIINWVQDTMDGYTEIECIASYLADITTAKPYAPGKF
FT                   EKKITSEALKDVLSDTGWEVSEQTEYDGLRTTSWTSYQTRYEVLKQLCTTYKMVLDFYI
FT                   ELSSNTVKGRYVVLKKKNSLFKGKEIEYGKDLVGLTRKIDMSEIKTALIAVGPENDKGK
FT                   RLELVVTDDEAQSQFNLPTRYIWGIYEPQSDDQNMNETRLRSLAKTELNKRKSAVMSYE
FT                   ITSTDLEVTYPHEIISIGDTVRVKHRDFNPPLYVEAEVIAEEYNIISENSTYTFGQPKE
FT                   FKESELREEFNKRLNIIHQKLNDNISNINTIVKDVVDSELEYFERKIHKSDTPPENPVN
FT                   DMLWYDTSNPDVAVLRRYWNGRWIEETPNDVEKLGGITREKALFSELNNIFINLSIQHA
FT                   SLLSEATELLNSEYLVDNDLKADLQASLDAVIDVYNQIKNNLESMTPETATIGRLVDTK
FT                   TLFLEYRKKLQDVYTDVEDVKIAISDRFKLLQSQYTDEKYKEALEIIATKFGLTVNEDL
FT                   QLVGEPNVVKSAIEAARESTKEQLRDYVKTSDYKTDKDGIVERLDTAEAERTTLKGEIK
FT                   DKVTLNEYRNGLEEQKQYTDDQLSDLSNNPEIKASIEQANQEAQEALKSYIDAQDDLKE
FT                   KESQAYADGKISEEEQRAIQDAQAKLEEAKQNAELKARNAEKKANAYTDNKVKESTDAQ
FT                   RKTLTRYGSQIIQNGKEIKLRTTKEEFNASKRTLSRVLADITVNAMKGIYLRYDENGAI
FT                   TSHTIDKDGVKISGDKVDITANREFNVVANNINNKVGKNDIVNSLNLSNEGLDINVNRI
FT                   GIKGGNANRYVQVQNDFIELGGIVQRTWKGKRSTDDIFTRLKDGHLRFRNNTAGGSLYM
FT                   SHFGISTYIDGEGEDGGSSGTIQWWDKTYSDSGMNGITINSYGGVVALTSDYNRIIIDS
FT                   YASANIESREAPIYLSPNTKNKPGLNRFAFTLSNADSAYETDGYIMFGSDENYKYGAGL
FT                   RFSKRSNKGLVQVVNGDYATGGDTTIESGMGKFNIVKRRDGNSYVSIQSYDLLAVGSDN
FT                   AGDRVASNSIYKRTYSAPANLHITSAGTIGRATSAKKYKISIENQYINEDDQFSHSKEI
FT                   LKLPIRTWFDKYESEIMAKELESGKKLSDDTFKLSRHTGLIAEEVEELGFNEFVIYDDN
FT                   GEIEGIAYDRLWVHLIPIIKNQQSKIEKLEELINE"
FT   gene            891507..891659
FT                   /locus_tag="SAAV_0870"
FT   CDS_pept        891507..891659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0870"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0870"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10787"
FT                   /protein_id="ACY10787.1"
FT                   /translation="MNDSNQGLQANPQYTIHYLSQEITRLTQENAMLKAYIQEQNEKSK
FT                   SAEEE"
FT   gene            891705..891992
FT                   /locus_tag="SAAV_0871"
FT   CDS_pept        891705..891992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0871"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0871"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10788"
FT                   /protein_id="ACY10788.1"
FT                   /translation="MANEIIKKTERFILVQIDKEGTERVLYQDFVGSFTTSDSASYAQD
FT                   FKSEENAKKIAETLNLLYQLTGNQNSVKVVKEVVDRTDLSSDKSVDSEIM"
FT   gene            892048..892422
FT                   /locus_tag="SAAV_0872"
FT   CDS_pept        892048..892422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0872"
FT                   /product="conserved hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0872"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10789"
FT                   /protein_id="ACY10789.1"
FT                   /translation="MDDIQKIKKELSELVERVDDVEILANETADHVLELREEHKQHHNE
FT                   LRESHKELKDKQDKVVDENLEQTKILNRIEERYQTQVDVAQKNEEKTLAQNKWLVGAIW
FT                   ALVTIVMIAVITASITALLP"
FT   gene            892952..893227
FT                   /locus_tag="SAAV_0873"
FT   CDS_pept        892952..893227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0873"
FT                   /product="holin, SPP1 family"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0873"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10790"
FT                   /protein_id="ACY10790.1"
FT                   /translation="MDIGTIVRTILLIVAWINQFLAIKHISPIPVDEVFISTVVTGIVS
FT                   IWTWWKNNNFTHASKKGQQKIYEVKAGIQSTGGAPKVNGDDNNAVG"
FT   gene            893214..894626
FT                   /locus_tag="SAAV_0874"
FT   CDS_pept        893214..894626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0874"
FT                   /product="phage amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0874"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10791"
FT                   /protein_id="ACY10791.1"
FT                   /translation="MPSVRTYSQAISYLKSLEGKAWNPDNAFGCQCFDTANQYWLYLFN
FT                   HRLKGVGAADIPTWNDFTNEATVYENTVSFQALPGDVVIFNRNYGGGYGHVGIVISATL
FT                   DSITILEQNWLGGAYWNPPEVTTRRTHGYDFPMWFIRPFYAKETTANKLRSAVTPVKQD
FT                   KLSKGKKIMLVAGHGIGAYSNDPGAVANGENERDFNRKNIIPRVKKYLESVGNTVLLYG
FT                   GNSMNQDLYQDTLYGQRVGNYKDYGMYWIKNEVKPDAIIEFHLDSASPQASGGHVIISD
FT                   RFPADDIDKALSSALDKTVGKIRGVTPRGDLLNANVSADLNLNYRLIELGFITSTKDLN
FT                   YIKNNLDSFTKRIAEAINGRQIDAPSSKPSADKITWNWKGVFYPNPEKAIRVRKTAGLT
FT                   GTVVEEDSWLYTKDDWVKFDQVIKKDGYWWIRFKYQREGSSTNNFYCAVCRITDKEQKI
FT                   KNEKYWGTIEWA"
FT   gene            complement(894686..895243)
FT                   /locus_tag="SAAV_0875"
FT   CDS_pept        complement(894686..895243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0875"
FT                   /product="Ear-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0875"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10792"
FT                   /protein_id="ACY10792.1"
FT                   /translation="MNKKLLTKTLIASALVLTTVGSGFHSSSNYNGINNVAKASEITDS
FT                   ELWKNVRDALKDANIIDKTDKETIKVKYKLKNGGESEISGTANLDNLSNTNNSTVSPDS
FT                   VNRVDITRVNPNGNTIEANDAWKKLVDKLKEKHIVKVGDKVTIHSKDPSDEKVYGKVGD
FT                   QDSNVKNRLISPKDITHITIER"
FT   gene            895618..895770
FT                   /locus_tag="SAAV_0876"
FT   CDS_pept        895618..895770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0876"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0876"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10793"
FT                   /protein_id="ACY10793.1"
FT                   /translation="MCKEVKSLMLDIIKTLLEHQVLAVLIIPEVLKQLREWHLGYLDRK
FT                   PNNKD"
FT   gene            895841..895951
FT                   /locus_tag="SAAV_0877"
FT   CDS_pept        895841..895951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0877"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0877"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10794"
FT                   /protein_id="ACY10794.1"
FT                   /translation="MTEQMYLILFLLSLPLLLFIGRKTHFYCLDKKNGRR"
FT   gene            895938..896138
FT                   /locus_tag="SAAV_0878"
FT   CDS_pept        895938..896138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0878"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0878"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10795"
FT                   /protein_id="ACY10795.1"
FT                   /translation="MDVDNMSDYKLKIIELIKSDITGYQIHKQTGVAQYVISQLRQGKR
FT                   EVDNLTLNTTEKLYSYARQVL"
FT   gene            complement(896968..897282)
FT                   /locus_tag="SAAV_0879"
FT   CDS_pept        complement(896968..897282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0879"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0879"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10796"
FT                   /protein_id="ACY10796.1"
FT                   /translation="MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLL
FT                   AIFSLVIHSAIFLITISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF
FT                   "
FT   gene            897647..898687
FT                   /locus_tag="SAAV_0880"
FT   CDS_pept        897647..898687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0880"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0880"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10797"
FT                   /protein_id="ACY10797.1"
FT                   /translation="MIIAIIILIFISFFFSGSETALTAANKTKFKTEADKGDKKAKGIV
FT                   KLLEKPSEFITTILIGNNVANILLPTLVTIMALRWGISVGIASAVLTVVIILISEVIPK
FT                   SVAATFPDKITRLVYPIINICVIVFRPITLLLNKLTDSINRSLSKGQPQEHQFSKEEFK
FT                   TMLAIAGHEGALNEIETSRLEGVINFENLKVKDVDTTPRINVTAFASNATYEEVYETVM
FT                   NKPYTRYPVYEGDIDNIIGVFHSKYLLAWSNKKEDQITNYSAKPLFVNEHNKAEWVLRK
FT                   MTISRKHLAIVLDEFGGTEAIVSHEDLIEELLGMEIEDEMDKKEKEKLSQQQIQFQQRK
FT                   NRNVSI"
FT   gene            898701..899768
FT                   /locus_tag="SAAV_0881"
FT   CDS_pept        898701..899768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0881"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10798"
FT                   /protein_id="ACY10798.1"
FT                   /translation="MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGA
FT                   GYFNTQQLEDEIDYVRQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEP
FT                   VVKIIEEQQFKCHIDTIIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIA
FT                   NEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDG
FT                   RGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETDTVVTKAFSGKLARGIN
FT                   NRFIEEMSQYEGDIPDYPIQNELTSSIRKAAANIGDKELTHMWSGQSPRLATTHPANTI
FT                   MSNIINQINQIMQYK"
FT   gene            900153..901001
FT                   /locus_tag="SAAV_0882"
FT   CDS_pept        900153..901001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0882"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0882"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10799"
FT                   /protein_id="ACY10799.1"
FT                   /translation="MINIGLTGWGDHYSLYEDLERQTDKLKTYAGHFPVVELDATYYAI
FT                   QPERNILKWIKETPDTFEFVVKIHQALTLHADYKTFADTRQELFDQFKNMLEPLHTQKK
FT                   LAMVLVQFPPWFDCNAQNIKYILYVRQQLQAFPMCVEFRHQSWFSDAFKEQTLAFLTEH
FT                   QIIHAVVDEPQVKDGSVPLVNRITNEIAFVRYHGRNHYGWTKKDMSDQEWRDVRYLYDY
FT                   NEQELIDLAQKAQILAQKAKKVYVIFNNNSGGHAANNAKTYQRLLNIEYEGLAPQQLKL
FT                   F"
FT   gene            901014..901841
FT                   /locus_tag="SAAV_0883"
FT   CDS_pept        901014..901841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0883"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0883"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10800"
FT                   /protein_id="ACY10800.1"
FT                   /translation="MLLTITLLVLIGGLSAIIGSIVGIGGGIIIVPTMVYLGVEHGLLH
FT                   NITTQVAIGTSSVILIVTGLSSSLGYLKTKQVDIKNGSIFLFGLLPGSLLGSFISRYLT
FT                   FESFNLYFGIFLIFVAILLMVRNKIKPFKIFDKPKYEKTYVDAKGKTYHYSVPPLFAFI
FT                   TTFLIGILTGLFGIGGGALMTPLMLIVFRFPPHVAVGTSMMMIFFSSVMSSIGHIAQGH
FT                   VAWGYAIILIISSYFGAKIGVKVNQSIKSDTVVTLLRTVMLLMGIYLIIRALI"
FT   gene            901868..903187
FT                   /locus_tag="SAAV_0884"
FT   CDS_pept        901868..903187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0884"
FT                   /product="5'-nucleotidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0884"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10801"
FT                   /protein_id="ACY10801.1"
FT                   /translation="MRLTIYHTNDIHSHLHEYERIKVYMAEQRPRLNHPSLYVDLGDHV
FT                   DLSAPITEATLGKKNVALLNEAKCDVATIGNNEGMTISHEALNHLYDEAKFIVTCSNVI
FT                   DESGHLPNNIVSSYIKDMDGVKILFVAATAPFTPFYRALDWIVTDPLESIKEEIKHQRG
FT                   KFDVIIVLSHCGIFFDETLCQELPEIDVIFGSHTHHYFEHGEINNGVLMAAAGKYGNYL
FT                   GEVNLTFEAHKVVHKTAKIIPLETLPEVETSFEEEGKTLMSNSVIQHPVVLKRSMNHIT
FT                   EAAYLLAQSVCEYTHAQCAIINAGLLVKDIVKDEVTEYDIHQMLPHPINMVRVRLSGVK
FT                   LKEIITKSNKQEYMYEHAQGLGFRGNIFGGYILYNLGYIHSTGRYYLNGEEIEDDKEYV
FT                   LGTIDMYTFGRYFPTLKELPKEYLMPEFLRDIFKEKLLEY"
FT   gene            903271..904188
FT                   /gene="lipA"
FT                   /locus_tag="SAAV_0885"
FT   CDS_pept        903271..904188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="SAAV_0885"
FT                   /product="lipoyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0885"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10802"
FT                   /protein_id="ACY10802.1"
FT                   /translation="MATKNEEILRKPDWLKIKLNTNENYTGLKKMMREKNLNTVCEEAK
FT                   CPNIHECWGARRTATFMILGAVCTRACRFCAVKTGLPNELDLNEPERVAESVELMNLKH
FT                   VVITAVARDDLRDAGSNVYAETVRKVRERNPFTTIEILPSDMGGDYDALETLMASRPDI
FT                   LNHNIETVRRLTPRVRARATYDRTLEFLRRSKELQPDIPTKSSIMVGLGETIEEIYETM
FT                   DDLRANDVDILTIGQYLQPSRKHLKVQKYYTPLEFGKLRKVAMDKGFKHCQAGPLVRSS
FT                   YHADEQVNEAAKEKQRQGEAQLNS"
FT   gene            904318..904701
FT                   /locus_tag="SAAV_0886"
FT   CDS_pept        904318..904701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0886"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0886"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10803"
FT                   /protein_id="ACY10803.1"
FT                   /translation="MIKVDQHYFELIENYRECFNEEQFIARYSDILDKYDYIVGDYGYD
FT                   QLRLKGFYKDSNKKAEMSKRFSNIQDYIFEYCNFGCPYFVLRHLSKQEVKKLIEEVHPS
FT                   DVIDDDNKLQDVKIKPTIQDTEH"
FT   gene            complement(904780..905037)
FT                   /locus_tag="SAAV_0887"
FT   CDS_pept        complement(904780..905037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0887"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0887"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10804"
FT                   /protein_id="ACY10804.1"
FT                   /translation="MYLYDDNEESQVQFVGFVGEHSRYDLMLVHTNRHYGKTLVLNMQT
FT                   NKFGIIGTDDLKEEGYIAHILGVNAEEGDEITEYLNEVIH"
FT   gene            905144..905578
FT                   /locus_tag="SAAV_0888"
FT   CDS_pept        905144..905578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0888"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0888"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10805"
FT                   /protein_id="ACY10805.1"
FT                   /translation="MYFVDKDKLTQKLAYLQALTDDYHESKHNHYAFERIAQMLIESSV
FT                   DIGNMIIDAFILRDPGNYKDVIDILELENVITKETQQEINKTVDIRKQFTYDYTALDIK
FT                   VIMPMFDDALPYYKQFITEVTIFLHQENVPVTAFGKGENQ"
FT   gene            905578..906357
FT                   /locus_tag="SAAV_0889"
FT   CDS_pept        905578..906357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0889"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0889"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10806"
FT                   /protein_id="ACY10806.1"
FT                   /translation="MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNN
FT                   STKTPEQVTEKLREMHIDAKPEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEA
FT                   GLVIKNDEHVDYVVIGLDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNG
FT                   AITSVVSVSTGVSPQFIGKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMD
FT                   TIHVQTGVSTLEDVQNKNVPPTYSFKDLNEAIAELEK"
FT   gene            906465..907349
FT                   /locus_tag="SAAV_0890"
FT   CDS_pept        906465..907349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0890"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0890"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10807"
FT                   /protein_id="ACY10807.1"
FT                   /translation="MWQKSLVPMPKDQFVTALRDADACFITLSEQIDAEILAQSPNLKV
FT                   IANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIVEAEKYVEAD
FT                   AWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRHKDAEADFN
FT                   ATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQIVDETALI
FT                   DALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQLCINNIE
FT                   AVMTNQVPHTPVN"
FT   gene            907606..907713
FT                   /locus_tag="SAAV_0891"
FT   CDS_pept        907606..907713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0891"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0891"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10808"
FT                   /protein_id="ACY10808.1"
FT                   /translation="MTTNYYVESIKLKLNFIMNIDIMNCKKQILKRILY"
FT   gene            907761..907913
FT                   /locus_tag="SAAV_0892"
FT   CDS_pept        907761..907913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0892"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10809"
FT                   /protein_id="ACY10809.1"
FT                   /translation="MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNF
FT                   IYNEF"
FT   gene            907929..909386
FT                   /gene="dltA"
FT                   /locus_tag="SAAV_0893"
FT   CDS_pept        907929..909386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="SAAV_0893"
FT                   /product="D-alanine--poly(phosphoribitol) ligase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0893"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10810"
FT                   /protein_id="ACY10810.1"
FT                   /translation="MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQ
FT                   GSKKPMILFGHMSPYMIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTD
FT                   ESFESLEGEVFTIEDIKTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQ
FT                   FTEWMLELNKSGNKQQWLNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEM
FT                   LTATPINIWVSTPSFMEMCLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVSRFPSAT
FT                   IYNTYGPTEATVAVTSIQITQEILDQYPTLPVGVERLGARLSTTDDGELVIEGQSVSLG
FT                   YLKNDQKTAEVFNFDDGIRTYHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQ
FT                   LRQSEFVKEAIVVPVYKNDKVIHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPR
FT                   KFEWMEQLPLTSNGKIDRKKIAEVING"
FT   gene            909383..910597
FT                   /gene="dltB"
FT                   /locus_tag="SAAV_0894"
FT   CDS_pept        909383..910597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="SAAV_0894"
FT                   /product="DltB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0894"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10811"
FT                   /protein_id="ACY10811.1"
FT                   /translation="MIPYGDFTFFLIALIALLPVIILGFLGKRSYIYNGVVTAFMIVLI
FT                   FSSDKHNLFDQKYLSVQLISFIIYVVWQVLLIMFYYHSKPKNNSFSKFVTVMVLSILPL
FT                   ALVKVLQSTWLGGHQIHFHESKLIEFVGFLGISYVTFKSVQLIMEIRDGSIKEIKVWKL
FT                   IQFISFFPTISSGPIDRYKRFVKDDKKVPTGNEYRELVLKAIHMIMLGFLYKYIVAYFI
FT                   NTYAIMPLQLDLHGFVNLWLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIKTPPNFDKPF
FT                   KAKNIKDFWNRWHMTLSFWFRDCIYMRSLFYMSRKKLLKSQFAMSNVAFLINFFIMGIW
FT                   HGIEVYYIVYGLYHAALFIGYGYYERWRKKHPPRWQNGFTTALSIVITFHFVTFGFLIF
FT                   SGKLI"
FT   gene            910615..910851
FT                   /gene="dltC"
FT                   /locus_tag="SAAV_0895"
FT   CDS_pept        910615..910851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="SAAV_0895"
FT                   /product="D-alanine--poly(phosphoribitol) ligase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0895"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10812"
FT                   /protein_id="ACY10812.1"
FT                   /translation="MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLE
FT                   IQNKLDIEVSIMDFDRDEWATPNKIVEALEELR"
FT   gene            910848..912023
FT                   /gene="dltD"
FT                   /locus_tag="SAAV_0896"
FT   CDS_pept        910848..912023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /locus_tag="SAAV_0896"
FT                   /product="DltD protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0896"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10813"
FT                   /protein_id="ACY10813.1"
FT                   /translation="MKLKPFLPILISGAVFIVFLLLPASWFTGLVNEKTVEDNRTSLTD
FT                   QVLKGTLIQDKLYESNKYYPIYGSSELGKDDPFNPAIALNKHNANKKAFLLGAGGSTDL
FT                   INAVELASQYDKLKGKKLTFIISPQWFTNHGLTNQNFDARMSQTQINQMFQQKNMSTEL
FT                   KRRYAQRLLQFPHVHNKEYLKSYAKNPKETKDSYIYGFKENQLIKIEAIKSLFAMDKSP
FT                   LEHVKPATKPDASWDEMKQKAVEIGKADTTSNKFGIRDQYWKLIQESKRKVRRDYEFNV
FT                   NSPEFQDLELLVKTMRAAGADVQYVSIPSNGVWYDHIGIDKERRQAVYKKIHSTVVDNG
FT                   GKIYDMTDKDYEKYVISDAVHIGWKGWVYMDEQIAKHMKGEPQPEVDKPKN"
FT   gene            complement(912286..912528)
FT                   /locus_tag="SAAV_0897"
FT   CDS_pept        complement(912286..912528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0897"
FT                   /product="NifU domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0897"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10814"
FT                   /protein_id="ACY10814.1"
FT                   /translation="MPTEDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLH
FT                   GACGTCPSSTITLKAGIERALHEEVPGVIEVEQVF"
FT   gene            912629..912952
FT                   /locus_tag="SAAV_0898"
FT   CDS_pept        912629..912952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0898"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0898"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10815"
FT                   /protein_id="ACY10815.1"
FT                   /translation="MEHVSVVVYGADVICASCVNAPTSKDIYDWLQPLLKRKYPNISFK
FT                   YTYIDITKDNDNLTDHDLQFIERIEQDELFYPLITMNDEYVADGYIQTKQITRFIDQKL
FT                   VNE"
FT   gene            complement(913011..914075)
FT                   /locus_tag="SAAV_0899"
FT   CDS_pept        complement(913011..914075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0899"
FT                   /product="putative NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0899"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10816"
FT                   /protein_id="ACY10816.1"
FT                   /translation="MKNLVLLGGGYGNMRIMSRILTTSLPQDYTVTLVDRMPFHGLKPE
FT                   FYALAAGTKSDKDVRMKFPNHPQVNTVYGEINDIDLDAQIVSVGNSKIDYDELIIGLGC
FT                   EDKYHNVPGAEEYTHSIQTLSKARDTFHSISELPEGAKVGIVGAGLSGIELASELRESR
FT                   SDLEIYLYDRGPRILRNFPEKLSKYVAKWFAKNNVTVVPNSNINKVEPGKIYNCDEPKD
FT                   IDLVVWTAGIQPVEVVRNLPIDINSNGRVIVNQYHQVPTYRNVYVVGDCADLPHAPSAQ
FT                   LAEVQGDQIADVLKKQWLNEPLPDKMPELKVQGIVGSLGDKQGFAYIMDRTVTGRLASI
FT                   LKSGVLWLYKYHNG"
FT   gene            914392..914628
FT                   /locus_tag="SAAV_0900"
FT   CDS_pept        914392..914628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0900"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10817"
FT                   /protein_id="ACY10817.1"
FT                   /translation="MNPIVEFCLSNMAKGGDYVFNQLENDPDVDVLEYGCLTHCGICSA
FT                   GLYALVNGDIVEGDSPEELLQNIYAHIKETWIF"
FT   gene            914641..915000
FT                   /locus_tag="SAAV_0901"
FT   CDS_pept        914641..915000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0901"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10818"
FT                   /protein_id="ACY10818.1"
FT                   /translation="MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMG
FT                   AEEAPGENDEVLEYFGLKVLVDKEDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCG
FT                   ISFRTAKVAGNPENC"
FT   gene            915454..916662
FT                   /locus_tag="SAAV_0902"
FT   CDS_pept        915454..916662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0902"
FT                   /product="NADH dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0902"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10819"
FT                   /protein_id="ACY10819.1"
FT                   /translation="MAQDRKKVLVLGAGYAGLQTVTKLQKAISTEEAEITLINKNEYHY
FT                   EATWLHEASAGTLNYEDVLYPVESVLKKDKVNFVQAEVTKIDRDAKKVETNQGIYDFDI
FT                   LVVALGFVSETFGIEGMKDHAFQIENVITARELSRHIEDKFANYAASKEKDDNDLSILV
FT                   GGAGFTGVEFLGELTDRIPELCSKYGVDQNKVKITCVEAAPKMLPMFSEELVNHAVSYL
FT                   EDRGVEFKIATPIVACNEKGFVVEVDGEKQQLNAGTSVWAAGVRGSKLMEESFEGVKRG
FT                   RIVTKQDLTINGYDNIFVIGDCSAFIPAGEERPLPTTAQIAMQQGESVAKNIKRILNGE
FT                   STEEFEYVDRGTVCSLGSHDGVGMVFGKPIAGKKAAFMKKVIDTRAVFKIGGIGLAFKK
FT                   GKF"
FT   gene            916793..918268
FT                   /locus_tag="SAAV_0903"
FT   CDS_pept        916793..918268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0903"
FT                   /product="cytosol aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0903"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10820"
FT                   /protein_id="ACY10820.1"
FT                   /translation="MNFKLNNTLSNEINTLIIGIPEHLNQLERISFNHIDITESLERLK
FT                   HQHIIGSKVGKIYTTAFDVQDQTYRLITVGLGNLKARSYQDMLKIWGHLFQYIKSEHIE
FT                   DTYLLMDSFISKYDQLSDVLMACGIQSERATYEFDHYKSSKKAPFKTNLNLISESLIEL
FT                   DFIHEGISIGQSINLARDFSNMPPNVLTPQTFAEDIVNHFKNTKVKVDVKDYDTLVSEG
FT                   FGLLQAVGKGSKHKPRLVTITYNGKDKDVAPIALVGKGITYDSGGYSIKTKNGMATMKF
FT                   DMCGAANVVGIIEAASRLQLPVNIVGVLACAENMINEASMKPDDVFTALSGETVEVMNT
FT                   DAEGRLVLADAVYYANQYQPSVIMDFATLTGAAIVALGDDKAAAFESNSKVILNDILQI
FT                   SSKVDEMVFELPITATERASINHSDIADLVNHTNGQGKALFAASFVTHFSGQTPHIHFD
FT                   IAGPATTNKASYNGPKGPTGFMIPTIVQWLKQQ"
FT   gene            918679..919995
FT                   /locus_tag="SAAV_0904"
FT   CDS_pept        918679..919995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0904"
FT                   /product="Na+/H+ antiporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0904"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10821"
FT                   /protein_id="ACY10821.1"
FT                   /translation="MINAVVIAVILMIVLCLCRLNVVISLFISALVGGLISGMSIEKVI
FT                   NVFGKNIVDGAEVALSYALLGGFAALISYSGITDYLVGKIINAIHAENSRWSRVKVKVT
FT                   IIIALLAMSIMSQNLIPVHIAFIPIVIPPLLSLFNDLKIDRRLIGLIIGFGLCFPYVLL
FT                   PYGFGQIFQQIIQSGFAKANHPIEFNMIWKAMLIPSMGYIVGLLIGLYVYRKPREYETR
FT                   KISDSDNVTELKPYILIVTIVAILATFLVQTFTDSMIFGALAGVLVFFISRAYNWYELD
FT                   AKFVEGIKIMAYIGVVILTANGFAGVMNATGDIDELVKTLTSITGDNKLFSIIMMYVIG
FT                   LIVTLGIGSSFATIPIIASLFIPFGASIGLDTMALIALIGTASALGDSGSPASDSTLGP
FT                   TAGLNVDGQHDHIRDTCVPNFLFYNIPLMIFGTIAAMVL"
FT   gene            920014..920388
FT                   /locus_tag="SAAV_0905"
FT   CDS_pept        920014..920388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAAV_0905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAAV_0905"
FT                   /db_xref="EnsemblGenomes-Tr:ACY10822"
FT                   /protein_id="ACY10822.1"
FT                   /translation="MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIAL
FT                   GETACSLGSANLIDTTKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIK
FT                   NDKEQLITVMRGTVAIKPLK"
FT   gene            complement(920444..921598)
FT                   /locus_tag="SAAV_0906"
FT   CDS_pept        com