(data stored in SCRATCH zone)

EMBL: CP001790

ID   CP001790; SV 1; circular; genomic DNA; STD; PRO; 5063892 BP.
AC   CP001790; ACUM01000000-ACUM01000079;
PR   Project:PRJNA31293;
DT   22-OCT-2009 (Rel. 102, Created)
DT   01-SEP-2017 (Rel. 134, Last updated, Version 6)
DE   Pectobacterium parmentieri WPP163 chromosome, complete genome.
KW   .
OS   Pectobacterium parmentieri WPP163
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Pectobacteriaceae; Pectobacterium.
RN   [1]
RP   1-5063892
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   "Complete sequence of Pectobacterium wasabiae WPP163";
RL   Unpublished.
RN   [2]
RP   1-5063892
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   ;
RL   Submitted (06-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
DR   MD5; 83aeaba453f66f662c18e26afef5c658.
DR   BioSample; SAMN02598479.
DR   EnsemblGenomes-Gn; EBG00001447188.
DR   EnsemblGenomes-Gn; EBG00001447189.
DR   EnsemblGenomes-Gn; EBG00001447190.
DR   EnsemblGenomes-Gn; EBG00001447191.
DR   EnsemblGenomes-Gn; EBG00001447192.
DR   EnsemblGenomes-Gn; EBG00001447193.
DR   EnsemblGenomes-Gn; EBG00001447194.
DR   EnsemblGenomes-Gn; EBG00001447195.
DR   EnsemblGenomes-Gn; EBG00001447196.
DR   EnsemblGenomes-Gn; EBG00001447197.
DR   EnsemblGenomes-Gn; EBG00001447198.
DR   EnsemblGenomes-Gn; EBG00001447199.
DR   EnsemblGenomes-Gn; EBG00001447200.
DR   EnsemblGenomes-Gn; EBG00001447201.
DR   EnsemblGenomes-Gn; EBG00001447202.
DR   EnsemblGenomes-Gn; EBG00001447203.
DR   EnsemblGenomes-Gn; EBG00001447204.
DR   EnsemblGenomes-Gn; EBG00001447205.
DR   EnsemblGenomes-Gn; EBG00001447206.
DR   EnsemblGenomes-Gn; EBG00001447207.
DR   EnsemblGenomes-Gn; EBG00001447208.
DR   EnsemblGenomes-Gn; EBG00001447209.
DR   EnsemblGenomes-Gn; EBG00001447210.
DR   EnsemblGenomes-Gn; EBG00001447211.
DR   EnsemblGenomes-Gn; EBG00001447212.
DR   EnsemblGenomes-Gn; EBG00001447213.
DR   EnsemblGenomes-Gn; EBG00001447214.
DR   EnsemblGenomes-Gn; EBG00001447215.
DR   EnsemblGenomes-Gn; EBG00001447216.
DR   EnsemblGenomes-Gn; EBG00001447217.
DR   EnsemblGenomes-Gn; EBG00001447218.
DR   EnsemblGenomes-Gn; EBG00001447219.
DR   EnsemblGenomes-Gn; EBG00001447220.
DR   EnsemblGenomes-Gn; EBG00001447221.
DR   EnsemblGenomes-Gn; EBG00001447222.
DR   EnsemblGenomes-Gn; EBG00001447223.
DR   EnsemblGenomes-Gn; EBG00001447224.
DR   EnsemblGenomes-Gn; EBG00001447225.
DR   EnsemblGenomes-Gn; EBG00001447226.
DR   EnsemblGenomes-Gn; EBG00001447227.
DR   EnsemblGenomes-Gn; EBG00001447228.
DR   EnsemblGenomes-Gn; EBG00001447229.
DR   EnsemblGenomes-Gn; EBG00001447230.
DR   EnsemblGenomes-Gn; EBG00001447231.
DR   EnsemblGenomes-Gn; EBG00001447232.
DR   EnsemblGenomes-Gn; EBG00001447233.
DR   EnsemblGenomes-Gn; EBG00001447234.
DR   EnsemblGenomes-Gn; EBG00001447235.
DR   EnsemblGenomes-Gn; EBG00001447236.
DR   EnsemblGenomes-Gn; EBG00001447237.
DR   EnsemblGenomes-Gn; EBG00001447238.
DR   EnsemblGenomes-Gn; EBG00001447239.
DR   EnsemblGenomes-Gn; EBG00001447240.
DR   EnsemblGenomes-Gn; EBG00001447241.
DR   EnsemblGenomes-Gn; EBG00001447242.
DR   EnsemblGenomes-Gn; EBG00001447243.
DR   EnsemblGenomes-Gn; EBG00001447244.
DR   EnsemblGenomes-Gn; EBG00001447245.
DR   EnsemblGenomes-Gn; EBG00001447246.
DR   EnsemblGenomes-Gn; EBG00001447247.
DR   EnsemblGenomes-Gn; EBG00001447248.
DR   EnsemblGenomes-Gn; EBG00001447249.
DR   EnsemblGenomes-Gn; EBG00001447250.
DR   EnsemblGenomes-Gn; EBG00001447251.
DR   EnsemblGenomes-Gn; EBG00001447252.
DR   EnsemblGenomes-Gn; EBG00001447253.
DR   EnsemblGenomes-Gn; EBG00001447254.
DR   EnsemblGenomes-Gn; EBG00001447255.
DR   EnsemblGenomes-Gn; EBG00001447256.
DR   EnsemblGenomes-Gn; EBG00001447257.
DR   EnsemblGenomes-Gn; EBG00001447258.
DR   EnsemblGenomes-Gn; EBG00001447259.
DR   EnsemblGenomes-Gn; EBG00001447260.
DR   EnsemblGenomes-Gn; EBG00001447261.
DR   EnsemblGenomes-Gn; EBG00001447262.
DR   EnsemblGenomes-Gn; EBG00001447263.
DR   EnsemblGenomes-Gn; EBG00001447264.
DR   EnsemblGenomes-Gn; EBG00001447265.
DR   EnsemblGenomes-Gn; EBG00001447266.
DR   EnsemblGenomes-Gn; EBG00001447267.
DR   EnsemblGenomes-Gn; EBG00001447268.
DR   EnsemblGenomes-Gn; EBG00001447269.
DR   EnsemblGenomes-Gn; EBG00001447270.
DR   EnsemblGenomes-Gn; EBG00001447271.
DR   EnsemblGenomes-Gn; EBG00001447272.
DR   EnsemblGenomes-Gn; EBG00001447273.
DR   EnsemblGenomes-Gn; EBG00001447274.
DR   EnsemblGenomes-Gn; EBG00001447275.
DR   EnsemblGenomes-Gn; EBG00001447276.
DR   EnsemblGenomes-Gn; EBG00001447277.
DR   EnsemblGenomes-Gn; EBG00001447278.
DR   EnsemblGenomes-Gn; EBG00001447279.
DR   EnsemblGenomes-Gn; EBG00001447280.
DR   EnsemblGenomes-Gn; EBG00001447281.
DR   EnsemblGenomes-Gn; EBG00001447282.
DR   EnsemblGenomes-Gn; EBG00001447283.
DR   EnsemblGenomes-Gn; EBG00001447284.
DR   EnsemblGenomes-Gn; EBG00001447285.
DR   EnsemblGenomes-Gn; EBG00001447286.
DR   EnsemblGenomes-Gn; EBG00001447287.
DR   EnsemblGenomes-Gn; EBG00001447288.
DR   EnsemblGenomes-Gn; EBG00001447289.
DR   EnsemblGenomes-Gn; EBG00001447290.
DR   EnsemblGenomes-Gn; EBG00001447291.
DR   EnsemblGenomes-Gn; EBG00001447292.
DR   EnsemblGenomes-Gn; EBG00001447293.
DR   EnsemblGenomes-Gn; EBG00001447294.
DR   EnsemblGenomes-Gn; EBG00001447295.
DR   EnsemblGenomes-Gn; EBG00001447296.
DR   EnsemblGenomes-Gn; EBG00001447297.
DR   EnsemblGenomes-Gn; EBG00001447298.
DR   EnsemblGenomes-Gn; EBG00001447299.
DR   EnsemblGenomes-Gn; EBG00001447300.
DR   EnsemblGenomes-Gn; EBG00001447301.
DR   EnsemblGenomes-Gn; EBG00001447302.
DR   EnsemblGenomes-Gn; EBG00001447303.
DR   EnsemblGenomes-Gn; EBG00001447304.
DR   EnsemblGenomes-Gn; EBG00001447305.
DR   EnsemblGenomes-Gn; EBG00001447306.
DR   EnsemblGenomes-Gn; EBG00001447307.
DR   EnsemblGenomes-Gn; EBG00001447308.
DR   EnsemblGenomes-Gn; EBG00001447309.
DR   EnsemblGenomes-Gn; EBG00001447310.
DR   EnsemblGenomes-Gn; EBG00001447311.
DR   EnsemblGenomes-Gn; EBG00001447312.
DR   EnsemblGenomes-Gn; EBG00001447313.
DR   EnsemblGenomes-Gn; EBG00001447314.
DR   EnsemblGenomes-Gn; EBG00001447315.
DR   EnsemblGenomes-Gn; EBG00001447316.
DR   EnsemblGenomes-Gn; EBG00001447317.
DR   EnsemblGenomes-Gn; EBG00001447318.
DR   EnsemblGenomes-Gn; EBG00001447319.
DR   EnsemblGenomes-Gn; EBG00001447320.
DR   EnsemblGenomes-Gn; EBG00001447321.
DR   EnsemblGenomes-Gn; EBG00001447322.
DR   EnsemblGenomes-Gn; EBG00001447323.
DR   EnsemblGenomes-Gn; EBG00001447324.
DR   EnsemblGenomes-Gn; EBG00001447325.
DR   EnsemblGenomes-Gn; EBG00001447326.
DR   EnsemblGenomes-Gn; EBG00001447327.
DR   EnsemblGenomes-Gn; EBG00001447328.
DR   EnsemblGenomes-Gn; EBG00001447329.
DR   EnsemblGenomes-Gn; EBG00001447330.
DR   EnsemblGenomes-Gn; EBG00001447331.
DR   EnsemblGenomes-Gn; EBG00001447332.
DR   EnsemblGenomes-Gn; EBG00001447333.
DR   EnsemblGenomes-Gn; EBG00001447334.
DR   EnsemblGenomes-Gn; EBG00001447335.
DR   EnsemblGenomes-Gn; EBG00001447336.
DR   EnsemblGenomes-Gn; EBG00001447337.
DR   EnsemblGenomes-Gn; EBG00001447338.
DR   EnsemblGenomes-Gn; EBG00001447339.
DR   EnsemblGenomes-Gn; EBG00001447340.
DR   EnsemblGenomes-Gn; EBG00001447341.
DR   EnsemblGenomes-Gn; EBG00001447342.
DR   EnsemblGenomes-Gn; EBG00001447343.
DR   EnsemblGenomes-Gn; EBG00001447344.
DR   EnsemblGenomes-Gn; EBG00001447345.
DR   EnsemblGenomes-Gn; EBG00001447346.
DR   EnsemblGenomes-Gn; EBG00001447347.
DR   EnsemblGenomes-Gn; EBG00001447348.
DR   EnsemblGenomes-Gn; EBG00001447349.
DR   EnsemblGenomes-Gn; EBG00001447350.
DR   EnsemblGenomes-Gn; EBG00001447351.
DR   EnsemblGenomes-Gn; EBG00001447352.
DR   EnsemblGenomes-Gn; EBG00001447353.
DR   EnsemblGenomes-Gn; EBG00001447354.
DR   EnsemblGenomes-Gn; EBG00001447355.
DR   EnsemblGenomes-Gn; EBG00001447356.
DR   EnsemblGenomes-Gn; EBG00001447357.
DR   EnsemblGenomes-Gn; EBG00001447358.
DR   EnsemblGenomes-Gn; EBG00001447359.
DR   EnsemblGenomes-Gn; EBG00001447360.
DR   EnsemblGenomes-Gn; EBG00001447361.
DR   EnsemblGenomes-Gn; EBG00001447362.
DR   EnsemblGenomes-Gn; EBG00001447363.
DR   EnsemblGenomes-Gn; EBG00001447364.
DR   EnsemblGenomes-Gn; EBG00001447365.
DR   EnsemblGenomes-Gn; EBG00001447366.
DR   EnsemblGenomes-Gn; EBG00001447367.
DR   EnsemblGenomes-Gn; EBG00001447368.
DR   EnsemblGenomes-Gn; EBG00001447369.
DR   EnsemblGenomes-Gn; EBG00001447370.
DR   EnsemblGenomes-Gn; EBG00001447371.
DR   EnsemblGenomes-Gn; EBG00001447372.
DR   EnsemblGenomes-Gn; EBG00001447373.
DR   EnsemblGenomes-Gn; EBG00001447374.
DR   EnsemblGenomes-Gn; EBG00001447375.
DR   EnsemblGenomes-Gn; EBG00001447376.
DR   EnsemblGenomes-Gn; EBG00001447377.
DR   EnsemblGenomes-Gn; EBG00001447378.
DR   EnsemblGenomes-Gn; EBG00001447379.
DR   EnsemblGenomes-Gn; EBG00001447380.
DR   EnsemblGenomes-Gn; EBG00001447381.
DR   EnsemblGenomes-Gn; EBG00001447382.
DR   EnsemblGenomes-Gn; EBG00001447383.
DR   EnsemblGenomes-Gn; EBG00001447384.
DR   EnsemblGenomes-Gn; EBG00001447385.
DR   EnsemblGenomes-Gn; EBG00001447386.
DR   EnsemblGenomes-Gn; EBG00001447387.
DR   EnsemblGenomes-Gn; EBG00001447388.
DR   EnsemblGenomes-Gn; Pecwa_R0001.
DR   EnsemblGenomes-Gn; Pecwa_R0002.
DR   EnsemblGenomes-Gn; Pecwa_R0003.
DR   EnsemblGenomes-Gn; Pecwa_R0004.
DR   EnsemblGenomes-Gn; Pecwa_R0005.
DR   EnsemblGenomes-Gn; Pecwa_R0006.
DR   EnsemblGenomes-Gn; Pecwa_R0007.
DR   EnsemblGenomes-Gn; Pecwa_R0008.
DR   EnsemblGenomes-Gn; Pecwa_R0009.
DR   EnsemblGenomes-Gn; Pecwa_R0010.
DR   EnsemblGenomes-Gn; Pecwa_R0011.
DR   EnsemblGenomes-Gn; Pecwa_R0012.
DR   EnsemblGenomes-Gn; Pecwa_R0013.
DR   EnsemblGenomes-Gn; Pecwa_R0014.
DR   EnsemblGenomes-Gn; Pecwa_R0015.
DR   EnsemblGenomes-Gn; Pecwa_R0016.
DR   EnsemblGenomes-Gn; Pecwa_R0017.
DR   EnsemblGenomes-Gn; Pecwa_R0018.
DR   EnsemblGenomes-Gn; Pecwa_R0019.
DR   EnsemblGenomes-Gn; Pecwa_R0020.
DR   EnsemblGenomes-Gn; Pecwa_R0021.
DR   EnsemblGenomes-Gn; Pecwa_R0022.
DR   EnsemblGenomes-Gn; Pecwa_R0023.
DR   EnsemblGenomes-Gn; Pecwa_R0024.
DR   EnsemblGenomes-Gn; Pecwa_R0025.
DR   EnsemblGenomes-Gn; Pecwa_R0026.
DR   EnsemblGenomes-Gn; Pecwa_R0027.
DR   EnsemblGenomes-Gn; Pecwa_R0028.
DR   EnsemblGenomes-Gn; Pecwa_R0029.
DR   EnsemblGenomes-Gn; Pecwa_R0030.
DR   EnsemblGenomes-Gn; Pecwa_R0031.
DR   EnsemblGenomes-Gn; Pecwa_R0032.
DR   EnsemblGenomes-Gn; Pecwa_R0033.
DR   EnsemblGenomes-Gn; Pecwa_R0034.
DR   EnsemblGenomes-Gn; Pecwa_R0035.
DR   EnsemblGenomes-Gn; Pecwa_R0036.
DR   EnsemblGenomes-Gn; Pecwa_R0037.
DR   EnsemblGenomes-Gn; Pecwa_R0038.
DR   EnsemblGenomes-Gn; Pecwa_R0039.
DR   EnsemblGenomes-Gn; Pecwa_R0040.
DR   EnsemblGenomes-Gn; Pecwa_R0041.
DR   EnsemblGenomes-Gn; Pecwa_R0042.
DR   EnsemblGenomes-Gn; Pecwa_R0043.
DR   EnsemblGenomes-Gn; Pecwa_R0044.
DR   EnsemblGenomes-Gn; Pecwa_R0045.
DR   EnsemblGenomes-Gn; Pecwa_R0046.
DR   EnsemblGenomes-Gn; Pecwa_R0047.
DR   EnsemblGenomes-Gn; Pecwa_R0048.
DR   EnsemblGenomes-Gn; Pecwa_R0049.
DR   EnsemblGenomes-Gn; Pecwa_R0050.
DR   EnsemblGenomes-Gn; Pecwa_R0051.
DR   EnsemblGenomes-Gn; Pecwa_R0052.
DR   EnsemblGenomes-Gn; Pecwa_R0053.
DR   EnsemblGenomes-Gn; Pecwa_R0054.
DR   EnsemblGenomes-Gn; Pecwa_R0055.
DR   EnsemblGenomes-Gn; Pecwa_R0056.
DR   EnsemblGenomes-Gn; Pecwa_R0057.
DR   EnsemblGenomes-Gn; Pecwa_R0058.
DR   EnsemblGenomes-Gn; Pecwa_R0059.
DR   EnsemblGenomes-Gn; Pecwa_R0060.
DR   EnsemblGenomes-Gn; Pecwa_R0061.
DR   EnsemblGenomes-Gn; Pecwa_R0062.
DR   EnsemblGenomes-Gn; Pecwa_R0063.
DR   EnsemblGenomes-Gn; Pecwa_R0064.
DR   EnsemblGenomes-Gn; Pecwa_R0065.
DR   EnsemblGenomes-Gn; Pecwa_R0066.
DR   EnsemblGenomes-Gn; Pecwa_R0067.
DR   EnsemblGenomes-Gn; Pecwa_R0068.
DR   EnsemblGenomes-Gn; Pecwa_R0069.
DR   EnsemblGenomes-Gn; Pecwa_R0070.
DR   EnsemblGenomes-Gn; Pecwa_R0071.
DR   EnsemblGenomes-Gn; Pecwa_R0072.
DR   EnsemblGenomes-Gn; Pecwa_R0073.
DR   EnsemblGenomes-Gn; Pecwa_R0074.
DR   EnsemblGenomes-Gn; Pecwa_R0075.
DR   EnsemblGenomes-Gn; Pecwa_R0076.
DR   EnsemblGenomes-Gn; Pecwa_R0077.
DR   EnsemblGenomes-Gn; Pecwa_R0078.
DR   EnsemblGenomes-Gn; Pecwa_R0079.
DR   EnsemblGenomes-Gn; Pecwa_R0080.
DR   EnsemblGenomes-Gn; Pecwa_R0081.
DR   EnsemblGenomes-Gn; Pecwa_R0082.
DR   EnsemblGenomes-Gn; Pecwa_R0083.
DR   EnsemblGenomes-Gn; Pecwa_R0084.
DR   EnsemblGenomes-Gn; Pecwa_R0085.
DR   EnsemblGenomes-Gn; Pecwa_R0086.
DR   EnsemblGenomes-Gn; Pecwa_R0087.
DR   EnsemblGenomes-Gn; Pecwa_R0088.
DR   EnsemblGenomes-Gn; Pecwa_R0089.
DR   EnsemblGenomes-Gn; Pecwa_R0090.
DR   EnsemblGenomes-Gn; Pecwa_R0091.
DR   EnsemblGenomes-Gn; Pecwa_R0092.
DR   EnsemblGenomes-Gn; Pecwa_R0093.
DR   EnsemblGenomes-Gn; Pecwa_R0094.
DR   EnsemblGenomes-Gn; Pecwa_R0095.
DR   EnsemblGenomes-Gn; Pecwa_R0096.
DR   EnsemblGenomes-Gn; Pecwa_R0097.
DR   EnsemblGenomes-Gn; Pecwa_R0098.
DR   EnsemblGenomes-Gn; Pecwa_R0099.
DR   EnsemblGenomes-Gn; Pecwa_R0100.
DR   EnsemblGenomes-Gn; Pecwa_R0101.
DR   EnsemblGenomes-Tr; EBT00001600839.
DR   EnsemblGenomes-Tr; EBT00001600841.
DR   EnsemblGenomes-Tr; EBT00001600844.
DR   EnsemblGenomes-Tr; EBT00001600846.
DR   EnsemblGenomes-Tr; EBT00001600848.
DR   EnsemblGenomes-Tr; EBT00001600850.
DR   EnsemblGenomes-Tr; EBT00001600851.
DR   EnsemblGenomes-Tr; EBT00001600853.
DR   EnsemblGenomes-Tr; EBT00001600855.
DR   EnsemblGenomes-Tr; EBT00001600857.
DR   EnsemblGenomes-Tr; EBT00001600858.
DR   EnsemblGenomes-Tr; EBT00001600860.
DR   EnsemblGenomes-Tr; EBT00001600863.
DR   EnsemblGenomes-Tr; EBT00001600865.
DR   EnsemblGenomes-Tr; EBT00001600867.
DR   EnsemblGenomes-Tr; EBT00001600869.
DR   EnsemblGenomes-Tr; EBT00001600871.
DR   EnsemblGenomes-Tr; EBT00001600873.
DR   EnsemblGenomes-Tr; EBT00001600875.
DR   EnsemblGenomes-Tr; EBT00001600878.
DR   EnsemblGenomes-Tr; EBT00001600880.
DR   EnsemblGenomes-Tr; EBT00001600881.
DR   EnsemblGenomes-Tr; EBT00001600883.
DR   EnsemblGenomes-Tr; EBT00001600885.
DR   EnsemblGenomes-Tr; EBT00001600887.
DR   EnsemblGenomes-Tr; EBT00001600889.
DR   EnsemblGenomes-Tr; EBT00001600891.
DR   EnsemblGenomes-Tr; EBT00001600892.
DR   EnsemblGenomes-Tr; EBT00001600894.
DR   EnsemblGenomes-Tr; EBT00001600896.
DR   EnsemblGenomes-Tr; EBT00001600898.
DR   EnsemblGenomes-Tr; EBT00001600900.
DR   EnsemblGenomes-Tr; EBT00001600902.
DR   EnsemblGenomes-Tr; EBT00001600904.
DR   EnsemblGenomes-Tr; EBT00001600907.
DR   EnsemblGenomes-Tr; EBT00001600909.
DR   EnsemblGenomes-Tr; EBT00001600911.
DR   EnsemblGenomes-Tr; EBT00001600912.
DR   EnsemblGenomes-Tr; EBT00001600914.
DR   EnsemblGenomes-Tr; EBT00001600916.
DR   EnsemblGenomes-Tr; EBT00001600918.
DR   EnsemblGenomes-Tr; EBT00001600919.
DR   EnsemblGenomes-Tr; EBT00001600922.
DR   EnsemblGenomes-Tr; EBT00001600924.
DR   EnsemblGenomes-Tr; EBT00001600926.
DR   EnsemblGenomes-Tr; EBT00001600928.
DR   EnsemblGenomes-Tr; EBT00001600931.
DR   EnsemblGenomes-Tr; EBT00001600932.
DR   EnsemblGenomes-Tr; EBT00001600934.
DR   EnsemblGenomes-Tr; EBT00001600936.
DR   EnsemblGenomes-Tr; EBT00001600938.
DR   EnsemblGenomes-Tr; EBT00001600939.
DR   EnsemblGenomes-Tr; EBT00001600941.
DR   EnsemblGenomes-Tr; EBT00001600943.
DR   EnsemblGenomes-Tr; EBT00001600945.
DR   EnsemblGenomes-Tr; EBT00001600947.
DR   EnsemblGenomes-Tr; EBT00001600949.
DR   EnsemblGenomes-Tr; EBT00001600951.
DR   EnsemblGenomes-Tr; EBT00001600953.
DR   EnsemblGenomes-Tr; EBT00001600954.
DR   EnsemblGenomes-Tr; EBT00001600956.
DR   EnsemblGenomes-Tr; EBT00001600958.
DR   EnsemblGenomes-Tr; EBT00001600960.
DR   EnsemblGenomes-Tr; EBT00001600963.
DR   EnsemblGenomes-Tr; EBT00001600964.
DR   EnsemblGenomes-Tr; EBT00001600966.
DR   EnsemblGenomes-Tr; EBT00001600968.
DR   EnsemblGenomes-Tr; EBT00001600970.
DR   EnsemblGenomes-Tr; EBT00001600972.
DR   EnsemblGenomes-Tr; EBT00001600973.
DR   EnsemblGenomes-Tr; EBT00001600975.
DR   EnsemblGenomes-Tr; EBT00001600977.
DR   EnsemblGenomes-Tr; EBT00001600979.
DR   EnsemblGenomes-Tr; EBT00001600981.
DR   EnsemblGenomes-Tr; EBT00001600983.
DR   EnsemblGenomes-Tr; EBT00001600985.
DR   EnsemblGenomes-Tr; EBT00001600987.
DR   EnsemblGenomes-Tr; EBT00001600989.
DR   EnsemblGenomes-Tr; EBT00001600991.
DR   EnsemblGenomes-Tr; EBT00001600992.
DR   EnsemblGenomes-Tr; EBT00001600994.
DR   EnsemblGenomes-Tr; EBT00001600997.
DR   EnsemblGenomes-Tr; EBT00001600999.
DR   EnsemblGenomes-Tr; EBT00001601000.
DR   EnsemblGenomes-Tr; EBT00001601002.
DR   EnsemblGenomes-Tr; EBT00001601004.
DR   EnsemblGenomes-Tr; EBT00001601006.
DR   EnsemblGenomes-Tr; EBT00001601008.
DR   EnsemblGenomes-Tr; EBT00001601011.
DR   EnsemblGenomes-Tr; EBT00001601012.
DR   EnsemblGenomes-Tr; EBT00001601014.
DR   EnsemblGenomes-Tr; EBT00001601015.
DR   EnsemblGenomes-Tr; EBT00001601016.
DR   EnsemblGenomes-Tr; EBT00001601017.
DR   EnsemblGenomes-Tr; EBT00001601018.
DR   EnsemblGenomes-Tr; EBT00001601019.
DR   EnsemblGenomes-Tr; EBT00001601020.
DR   EnsemblGenomes-Tr; EBT00001601021.
DR   EnsemblGenomes-Tr; EBT00001601022.
DR   EnsemblGenomes-Tr; EBT00001601023.
DR   EnsemblGenomes-Tr; EBT00001601024.
DR   EnsemblGenomes-Tr; EBT00001601025.
DR   EnsemblGenomes-Tr; EBT00001601026.
DR   EnsemblGenomes-Tr; EBT00001601027.
DR   EnsemblGenomes-Tr; EBT00001601028.
DR   EnsemblGenomes-Tr; EBT00001601029.
DR   EnsemblGenomes-Tr; EBT00001601030.
DR   EnsemblGenomes-Tr; EBT00001601031.
DR   EnsemblGenomes-Tr; EBT00001601032.
DR   EnsemblGenomes-Tr; EBT00001601033.
DR   EnsemblGenomes-Tr; EBT00001601034.
DR   EnsemblGenomes-Tr; EBT00001601035.
DR   EnsemblGenomes-Tr; EBT00001601036.
DR   EnsemblGenomes-Tr; EBT00001601037.
DR   EnsemblGenomes-Tr; EBT00001601038.
DR   EnsemblGenomes-Tr; EBT00001601039.
DR   EnsemblGenomes-Tr; EBT00001601040.
DR   EnsemblGenomes-Tr; EBT00001601041.
DR   EnsemblGenomes-Tr; EBT00001601042.
DR   EnsemblGenomes-Tr; EBT00001601043.
DR   EnsemblGenomes-Tr; EBT00001601044.
DR   EnsemblGenomes-Tr; EBT00001601045.
DR   EnsemblGenomes-Tr; EBT00001601046.
DR   EnsemblGenomes-Tr; EBT00001601047.
DR   EnsemblGenomes-Tr; EBT00001601048.
DR   EnsemblGenomes-Tr; EBT00001601049.
DR   EnsemblGenomes-Tr; EBT00001601050.
DR   EnsemblGenomes-Tr; EBT00001601051.
DR   EnsemblGenomes-Tr; EBT00001601052.
DR   EnsemblGenomes-Tr; EBT00001601053.
DR   EnsemblGenomes-Tr; EBT00001601054.
DR   EnsemblGenomes-Tr; EBT00001601055.
DR   EnsemblGenomes-Tr; EBT00001601056.
DR   EnsemblGenomes-Tr; EBT00001601057.
DR   EnsemblGenomes-Tr; EBT00001601058.
DR   EnsemblGenomes-Tr; EBT00001601059.
DR   EnsemblGenomes-Tr; EBT00001601060.
DR   EnsemblGenomes-Tr; EBT00001601061.
DR   EnsemblGenomes-Tr; EBT00001601062.
DR   EnsemblGenomes-Tr; EBT00001601063.
DR   EnsemblGenomes-Tr; EBT00001601064.
DR   EnsemblGenomes-Tr; EBT00001601065.
DR   EnsemblGenomes-Tr; EBT00001601066.
DR   EnsemblGenomes-Tr; EBT00001601067.
DR   EnsemblGenomes-Tr; EBT00001601068.
DR   EnsemblGenomes-Tr; EBT00001601069.
DR   EnsemblGenomes-Tr; EBT00001601070.
DR   EnsemblGenomes-Tr; EBT00001601071.
DR   EnsemblGenomes-Tr; EBT00001601072.
DR   EnsemblGenomes-Tr; EBT00001601073.
DR   EnsemblGenomes-Tr; EBT00001601074.
DR   EnsemblGenomes-Tr; EBT00001601075.
DR   EnsemblGenomes-Tr; EBT00001601076.
DR   EnsemblGenomes-Tr; EBT00001601077.
DR   EnsemblGenomes-Tr; EBT00001601078.
DR   EnsemblGenomes-Tr; EBT00001601079.
DR   EnsemblGenomes-Tr; EBT00001601080.
DR   EnsemblGenomes-Tr; EBT00001601081.
DR   EnsemblGenomes-Tr; EBT00001601082.
DR   EnsemblGenomes-Tr; EBT00001601083.
DR   EnsemblGenomes-Tr; EBT00001601084.
DR   EnsemblGenomes-Tr; EBT00001601085.
DR   EnsemblGenomes-Tr; EBT00001601086.
DR   EnsemblGenomes-Tr; EBT00001601087.
DR   EnsemblGenomes-Tr; EBT00001601088.
DR   EnsemblGenomes-Tr; EBT00001601089.
DR   EnsemblGenomes-Tr; EBT00001601090.
DR   EnsemblGenomes-Tr; EBT00001601091.
DR   EnsemblGenomes-Tr; EBT00001601092.
DR   EnsemblGenomes-Tr; EBT00001601093.
DR   EnsemblGenomes-Tr; EBT00001601094.
DR   EnsemblGenomes-Tr; EBT00001601095.
DR   EnsemblGenomes-Tr; EBT00001601096.
DR   EnsemblGenomes-Tr; EBT00001601097.
DR   EnsemblGenomes-Tr; EBT00001601098.
DR   EnsemblGenomes-Tr; EBT00001601099.
DR   EnsemblGenomes-Tr; EBT00001601100.
DR   EnsemblGenomes-Tr; EBT00001601101.
DR   EnsemblGenomes-Tr; EBT00001601102.
DR   EnsemblGenomes-Tr; EBT00001601103.
DR   EnsemblGenomes-Tr; EBT00001601104.
DR   EnsemblGenomes-Tr; EBT00001601105.
DR   EnsemblGenomes-Tr; EBT00001601106.
DR   EnsemblGenomes-Tr; EBT00001601107.
DR   EnsemblGenomes-Tr; EBT00001601108.
DR   EnsemblGenomes-Tr; EBT00001601109.
DR   EnsemblGenomes-Tr; EBT00001601110.
DR   EnsemblGenomes-Tr; EBT00001601111.
DR   EnsemblGenomes-Tr; EBT00001601112.
DR   EnsemblGenomes-Tr; EBT00001601113.
DR   EnsemblGenomes-Tr; EBT00001601114.
DR   EnsemblGenomes-Tr; EBT00001601115.
DR   EnsemblGenomes-Tr; EBT00001601116.
DR   EnsemblGenomes-Tr; EBT00001601117.
DR   EnsemblGenomes-Tr; EBT00001601118.
DR   EnsemblGenomes-Tr; EBT00001601119.
DR   EnsemblGenomes-Tr; EBT00001601120.
DR   EnsemblGenomes-Tr; EBT00001601121.
DR   EnsemblGenomes-Tr; EBT00001601122.
DR   EnsemblGenomes-Tr; EBT00001601123.
DR   EnsemblGenomes-Tr; EBT00001601124.
DR   EnsemblGenomes-Tr; Pecwa_R0001-1.
DR   EnsemblGenomes-Tr; Pecwa_R0002-1.
DR   EnsemblGenomes-Tr; Pecwa_R0003-1.
DR   EnsemblGenomes-Tr; Pecwa_R0004-1.
DR   EnsemblGenomes-Tr; Pecwa_R0005-1.
DR   EnsemblGenomes-Tr; Pecwa_R0006-1.
DR   EnsemblGenomes-Tr; Pecwa_R0007-1.
DR   EnsemblGenomes-Tr; Pecwa_R0008-1.
DR   EnsemblGenomes-Tr; Pecwa_R0009-1.
DR   EnsemblGenomes-Tr; Pecwa_R0010-1.
DR   EnsemblGenomes-Tr; Pecwa_R0011-1.
DR   EnsemblGenomes-Tr; Pecwa_R0012-1.
DR   EnsemblGenomes-Tr; Pecwa_R0013-1.
DR   EnsemblGenomes-Tr; Pecwa_R0014-1.
DR   EnsemblGenomes-Tr; Pecwa_R0015-1.
DR   EnsemblGenomes-Tr; Pecwa_R0016-1.
DR   EnsemblGenomes-Tr; Pecwa_R0017-1.
DR   EnsemblGenomes-Tr; Pecwa_R0018-1.
DR   EnsemblGenomes-Tr; Pecwa_R0019-1.
DR   EnsemblGenomes-Tr; Pecwa_R0020-1.
DR   EnsemblGenomes-Tr; Pecwa_R0021-1.
DR   EnsemblGenomes-Tr; Pecwa_R0022-1.
DR   EnsemblGenomes-Tr; Pecwa_R0023-1.
DR   EnsemblGenomes-Tr; Pecwa_R0024-1.
DR   EnsemblGenomes-Tr; Pecwa_R0025-1.
DR   EnsemblGenomes-Tr; Pecwa_R0026-1.
DR   EnsemblGenomes-Tr; Pecwa_R0027-1.
DR   EnsemblGenomes-Tr; Pecwa_R0028-1.
DR   EnsemblGenomes-Tr; Pecwa_R0029-1.
DR   EnsemblGenomes-Tr; Pecwa_R0030-1.
DR   EnsemblGenomes-Tr; Pecwa_R0031-1.
DR   EnsemblGenomes-Tr; Pecwa_R0032-1.
DR   EnsemblGenomes-Tr; Pecwa_R0033-1.
DR   EnsemblGenomes-Tr; Pecwa_R0034-1.
DR   EnsemblGenomes-Tr; Pecwa_R0035-1.
DR   EnsemblGenomes-Tr; Pecwa_R0036-1.
DR   EnsemblGenomes-Tr; Pecwa_R0037-1.
DR   EnsemblGenomes-Tr; Pecwa_R0038-1.
DR   EnsemblGenomes-Tr; Pecwa_R0039-1.
DR   EnsemblGenomes-Tr; Pecwa_R0040-1.
DR   EnsemblGenomes-Tr; Pecwa_R0041-1.
DR   EnsemblGenomes-Tr; Pecwa_R0042-1.
DR   EnsemblGenomes-Tr; Pecwa_R0043-1.
DR   EnsemblGenomes-Tr; Pecwa_R0044-1.
DR   EnsemblGenomes-Tr; Pecwa_R0045-1.
DR   EnsemblGenomes-Tr; Pecwa_R0046-1.
DR   EnsemblGenomes-Tr; Pecwa_R0047-1.
DR   EnsemblGenomes-Tr; Pecwa_R0048-1.
DR   EnsemblGenomes-Tr; Pecwa_R0049-1.
DR   EnsemblGenomes-Tr; Pecwa_R0050-1.
DR   EnsemblGenomes-Tr; Pecwa_R0051-1.
DR   EnsemblGenomes-Tr; Pecwa_R0052-1.
DR   EnsemblGenomes-Tr; Pecwa_R0053-1.
DR   EnsemblGenomes-Tr; Pecwa_R0054-1.
DR   EnsemblGenomes-Tr; Pecwa_R0055-1.
DR   EnsemblGenomes-Tr; Pecwa_R0056-1.
DR   EnsemblGenomes-Tr; Pecwa_R0057-1.
DR   EnsemblGenomes-Tr; Pecwa_R0058-1.
DR   EnsemblGenomes-Tr; Pecwa_R0059-1.
DR   EnsemblGenomes-Tr; Pecwa_R0060-1.
DR   EnsemblGenomes-Tr; Pecwa_R0061-1.
DR   EnsemblGenomes-Tr; Pecwa_R0062-1.
DR   EnsemblGenomes-Tr; Pecwa_R0063-1.
DR   EnsemblGenomes-Tr; Pecwa_R0064-1.
DR   EnsemblGenomes-Tr; Pecwa_R0065-1.
DR   EnsemblGenomes-Tr; Pecwa_R0066-1.
DR   EnsemblGenomes-Tr; Pecwa_R0067-1.
DR   EnsemblGenomes-Tr; Pecwa_R0068-1.
DR   EnsemblGenomes-Tr; Pecwa_R0069-1.
DR   EnsemblGenomes-Tr; Pecwa_R0070-1.
DR   EnsemblGenomes-Tr; Pecwa_R0071-1.
DR   EnsemblGenomes-Tr; Pecwa_R0072-1.
DR   EnsemblGenomes-Tr; Pecwa_R0073-1.
DR   EnsemblGenomes-Tr; Pecwa_R0074-1.
DR   EnsemblGenomes-Tr; Pecwa_R0075-1.
DR   EnsemblGenomes-Tr; Pecwa_R0076-1.
DR   EnsemblGenomes-Tr; Pecwa_R0077-1.
DR   EnsemblGenomes-Tr; Pecwa_R0078-1.
DR   EnsemblGenomes-Tr; Pecwa_R0079-1.
DR   EnsemblGenomes-Tr; Pecwa_R0080-1.
DR   EnsemblGenomes-Tr; Pecwa_R0081-1.
DR   EnsemblGenomes-Tr; Pecwa_R0082-1.
DR   EnsemblGenomes-Tr; Pecwa_R0083-1.
DR   EnsemblGenomes-Tr; Pecwa_R0084-1.
DR   EnsemblGenomes-Tr; Pecwa_R0085-1.
DR   EnsemblGenomes-Tr; Pecwa_R0086-1.
DR   EnsemblGenomes-Tr; Pecwa_R0087-1.
DR   EnsemblGenomes-Tr; Pecwa_R0088-1.
DR   EnsemblGenomes-Tr; Pecwa_R0089-1.
DR   EnsemblGenomes-Tr; Pecwa_R0090-1.
DR   EnsemblGenomes-Tr; Pecwa_R0091-1.
DR   EnsemblGenomes-Tr; Pecwa_R0092-1.
DR   EnsemblGenomes-Tr; Pecwa_R0093-1.
DR   EnsemblGenomes-Tr; Pecwa_R0094-1.
DR   EnsemblGenomes-Tr; Pecwa_R0095-1.
DR   EnsemblGenomes-Tr; Pecwa_R0096-1.
DR   EnsemblGenomes-Tr; Pecwa_R0097-1.
DR   EnsemblGenomes-Tr; Pecwa_R0098-1.
DR   EnsemblGenomes-Tr; Pecwa_R0099-1.
DR   EnsemblGenomes-Tr; Pecwa_R0100-1.
DR   EnsemblGenomes-Tr; Pecwa_R0101-1.
DR   EuropePMC; PMC3678301; 23781227.
DR   EuropePMC; PMC3816273; 24204365.
DR   EuropePMC; PMC4471427; 26150828.
DR   EuropePMC; PMC4888284; 27257541.
DR   EuropePMC; PMC6286560; 30526490.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP001790.
DR   SILVA-SSU; CP001790.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085666
CC   Source DNA and bacteria available from Nicole T. Perna
CC   (ntperna@wisc.edu)
CC   Contacts: Nicole T. Perna (ntperna@wisc.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Pectobacterium wasabiae WPP163
CC   GOLD Stamp ID         :: Gi03812
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Soft rot
CC   Habitat               :: Host
CC   Phenotypes            :: Pathogen
CC   ##Metadata-END##
FH   Key             Location/Qualifiers
FT   source          1..5063892
FT                   /organism="Pectobacterium parmentieri WPP163"
FT                   /strain="WPP163"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:561231"
FT   gene            53..1450
FT                   /locus_tag="Pecwa_0001"
FT   CDS_pept        53..1450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: eca:ECA4441 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85870"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACX85870.1"
FT                   LIRTLSS"
FT   gene            1455..2555
FT                   /locus_tag="Pecwa_0002"
FT   CDS_pept        1455..2555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4440 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85871"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACX85871.1"
FT   gene            2603..3688
FT                   /locus_tag="Pecwa_0003"
FT   CDS_pept        2603..3688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: pct:PC1_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85872"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACX85872.1"
FT   gene            3707..6124
FT                   /locus_tag="Pecwa_0004"
FT   CDS_pept        3707..6124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85873"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACX85873.1"
FT   gene            complement(6241..7431)
FT                   /locus_tag="Pecwa_0005"
FT   CDS_pept        complement(6241..7431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0005"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pct:PC1_0005 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85874"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX85874.1"
FT   gene            complement(7658..9661)
FT                   /locus_tag="Pecwa_0006"
FT   CDS_pept        complement(7658..9661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0006"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: chemotaxis sensory transducer; KEGG: pct:PC1_0007
FT                   methyl-accepting chemotaxis sensory transducer with cache
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85875"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX85875.1"
FT   gene            complement(9975..10988)
FT                   /locus_tag="Pecwa_0007"
FT   CDS_pept        complement(9975..10988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0007"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: eca:ECA4436 LacI family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85876"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACX85876.1"
FT   gene            11202..11507
FT                   /locus_tag="Pecwa_0008"
FT   CDS_pept        11202..11507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0008"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: pct:PC1_0009
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85877"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACX85877.1"
FT   gene            11524..12837
FT                   /locus_tag="Pecwa_0009"
FT   CDS_pept        11524..12837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0009"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /note="KEGG: eca:ECA4434 PTS system, IIBC component;
FT                   TIGRFAM: PTS system, lactose/cellobiose family IIC subunit;
FT                   PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85878"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ACX85878.1"
FT   gene            12827..13159
FT                   /locus_tag="Pecwa_0010"
FT   CDS_pept        12827..13159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0010"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG: eca:ECA4433
FT                   pts system, cellobiose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85879"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ACX85879.1"
FT                   QHVNLK"
FT   gene            13175..14617
FT                   /locus_tag="Pecwa_0011"
FT   CDS_pept        13175..14617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0011"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   eca:ECA4432 6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85880"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACX85880.1"
FT   gene            14773..15588
FT                   /locus_tag="Pecwa_0012"
FT   CDS_pept        14773..15588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0012"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: pct:PC1_0013 Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85881"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACX85881.1"
FT   gene            15973..16866
FT                   /locus_tag="Pecwa_0013"
FT   CDS_pept        15973..16866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0013"
FT                   /product="lipoprotein"
FT                   /note="KEGG: pmr:PMI1798 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85882"
FT                   /inference="similar to AA sequence:KEGG:PMI1798"
FT                   /protein_id="ACX85882.1"
FT                   FIRHSGYLQTYGVWGK"
FT   gene            complement(17108..18004)
FT                   /locus_tag="Pecwa_0014"
FT   CDS_pept        complement(17108..18004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0014"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA4427 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85883"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACX85883.1"
FT                   HITQVMKEKLAASLDLK"
FT   gene            18147..19697
FT                   /locus_tag="Pecwa_0015"
FT   CDS_pept        18147..19697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0015"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA4426 putative extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85884"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACX85884.1"
FT   gene            19766..20650
FT                   /locus_tag="Pecwa_0016"
FT   CDS_pept        19766..20650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0016"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   eca:ECA4425 putative dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85885"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ACX85885.1"
FT                   KEITDVLVSVGAL"
FT   gene            20754..21707
FT                   /locus_tag="Pecwa_0017"
FT   CDS_pept        20754..21707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0017"
FT                   /product="Ribosylpyrimidine nucleosidase"
FT                   /EC_number=""
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: pct:PC1_0017 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85886"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX85886.1"
FT   gene            21712..22680
FT                   /locus_tag="Pecwa_0018"
FT   CDS_pept        21712..22680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0018"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: pct:PC1_0018 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85887"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACX85887.1"
FT   gene            22680..23657
FT                   /locus_tag="Pecwa_0019"
FT   CDS_pept        22680..23657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0019
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85888"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX85888.1"
FT   gene            23654..24562
FT                   /locus_tag="Pecwa_0020"
FT   CDS_pept        23654..24562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4421 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85889"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX85889.1"
FT   gene            24602..26407
FT                   /locus_tag="Pecwa_0021"
FT   CDS_pept        24602..26407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0021"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: pct:PC1_0021 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85890"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX85890.1"
FT   gene            26772..27470
FT                   /locus_tag="Pecwa_0022"
FT   CDS_pept        26772..27470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0022"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: eca:ECA4419
FT                   galactonate operon transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85891"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACX85891.1"
FT                   SSTKRLKDIT"
FT   gene            27467..28363
FT                   /locus_tag="Pecwa_0023"
FT   CDS_pept        27467..28363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0023"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number=""
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   eca:ECA4418 2-dehydro-3-deoxygalactonokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85892"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX85892.1"
FT                   DRAFQAGIRSIVNELEY"
FT   gene            28347..28964
FT                   /locus_tag="Pecwa_0024"
FT   CDS_pept        28347..28964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0024"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="PFAM: KDPG and KHG aldolase; thiamine monophosphate
FT                   synthase; KEGG: eca:ECA4417
FT                   2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85893"
FT                   /inference="protein motif:PFAM:PF01081"
FT                   /protein_id="ACX85893.1"
FT   gene            28961..30109
FT                   /locus_tag="Pecwa_0025"
FT   CDS_pept        28961..30109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0025"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: eca:ECA4416 galactonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85894"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACX85894.1"
FT   gene            30193..30309
FT                   /locus_tag="Pecwa_0026"
FT   CDS_pept        30193..30309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85895"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX85895.1"
FT   gene            30654..31943
FT                   /locus_tag="Pecwa_0027"
FT   CDS_pept        30654..31943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0027"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: d-galactonate transporter; phosphoglycerate
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   KEGG: eca:ECA4415 putative D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85896"
FT                   /inference="protein motif:TFAM:TIGR00893"
FT                   /protein_id="ACX85896.1"
FT   gene            complement(32052..32309)
FT                   /locus_tag="Pecwa_0028"
FT   CDS_pept        complement(32052..32309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0028"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   eca:ECA4414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85897"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ACX85897.1"
FT   gene            complement(32482..33282)
FT                   /locus_tag="Pecwa_0029"
FT   CDS_pept        complement(32482..33282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0029"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4413 aliphatic sulfonates transport
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85898"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX85898.1"
FT   gene            complement(33279..34073)
FT                   /locus_tag="Pecwa_0030"
FT   CDS_pept        complement(33279..34073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0030"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4412 putative
FT                   aliphatic sulfonates transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85899"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX85899.1"
FT   gene            complement(34084..35226)
FT                   /locus_tag="Pecwa_0031"
FT   CDS_pept        complement(34084..35226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0031"
FT                   /product="alkanesulfonate monooxygenase, FMNH(2)-dependent"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0025 alkanesulfonate monooxygenase;
FT                   TIGRFAM: alkanesulfonate monooxygenase, FMNH(2)-dependent;
FT                   PFAM: Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85900"
FT                   /inference="protein motif:TFAM:TIGR03565"
FT                   /protein_id="ACX85900.1"
FT   gene            complement(35285..36307)
FT                   /locus_tag="Pecwa_0032"
FT   CDS_pept        complement(35285..36307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0032"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA4410 alkanesulfonate transporter substrate-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85901"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ACX85901.1"
FT                   "
FT   gene            36706..37029
FT                   /locus_tag="Pecwa_0033"
FT   CDS_pept        36706..37029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0033"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: pct:PC1_0028
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85902"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACX85902.1"
FT                   QPL"
FT   gene            37026..38342
FT                   /locus_tag="Pecwa_0034"
FT   CDS_pept        37026..38342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0034"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /note="KEGG: eca:ECA4408 PTS system EIIC component;
FT                   TIGRFAM: PTS system, lactose/cellobiose family IIC subunit;
FT                   PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85903"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ACX85903.1"
FT   gene            38368..39765
FT                   /locus_tag="Pecwa_0035"
FT   CDS_pept        38368..39765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0035"
FT                   /product="Beta-glucosidase"
FT                   /EC_number=""
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   eca:ECA4407 putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85904"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX85904.1"
FT                   VAAENGF"
FT   gene            complement(40035..40292)
FT                   /locus_tag="Pecwa_0036"
FT   CDS_pept        complement(40035..40292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0036"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   eca:ECA4406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85905"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ACX85905.1"
FT   gene            40529..41815
FT                   /locus_tag="Pecwa_0037"
FT   CDS_pept        40529..41815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85906"
FT                   /inference="similar to AA sequence:KEGG:ECA4405"
FT                   /protein_id="ACX85906.1"
FT   gene            complement(41862..42236)
FT                   /locus_tag="Pecwa_0038"
FT   CDS_pept        complement(41862..42236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0038"
FT                   /product="protein of unknown function DUF1375"
FT                   /note="PFAM: protein of unknown function DUF1375; KEGG:
FT                   eca:ECA4404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85907"
FT                   /inference="protein motif:PFAM:PF07119"
FT                   /protein_id="ACX85907.1"
FT   gene            42625..43038
FT                   /locus_tag="Pecwa_0039"
FT   CDS_pept        42625..43038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0039"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: pct:PC1_0034
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85908"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACX85908.1"
FT   gene            43181..43633
FT                   /locus_tag="Pecwa_0040"
FT   CDS_pept        43181..43633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0040"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: eca:ECA4402
FT                   heat shock chaperone IbpB"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85909"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACX85909.1"
FT   gene            complement(43747..44361)
FT                   /locus_tag="Pecwa_0041"
FT   CDS_pept        complement(43747..44361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85910"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX85910.1"
FT   gene            44599..46257
FT                   /locus_tag="Pecwa_0042"
FT   CDS_pept        44599..46257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0042"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; TrkA-C domain protein; KEGG:
FT                   eca:ECA4401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85911"
FT                   /inference="protein motif:TFAM:TIGR01625"
FT                   /protein_id="ACX85911.1"
FT   gene            46783..48195
FT                   /locus_tag="Pecwa_0043"
FT   CDS_pept        46783..48195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0043"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: eca:ECA4400 putative
FT                   sodium:sulfate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85912"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ACX85912.1"
FT                   VGSMWWKLLGFW"
FT   gene            48388..50016
FT                   /locus_tag="Pecwa_0044"
FT   CDS_pept        48388..50016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0044"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: pct:PC1_0038 signal transduction histidine
FT                   kinase regulating citrate/malate metabolism; TIGRFAM: PAS
FT                   sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold domain protein; PAS fold-4 domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85913"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACX85913.1"
FT   gene            50009..50731
FT                   /locus_tag="Pecwa_0045"
FT   CDS_pept        50009..50731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0045"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: eca:ECA4398 DNA-binding
FT                   transcriptional activator DcuR"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85914"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX85914.1"
FT                   YLYRLLPEKQDSLRQYCE"
FT   gene            50849..51742
FT                   /pseudo
FT                   /locus_tag="Pecwa_0046"
FT   gene            51729..52007
FT                   /locus_tag="Pecwa_0047"
FT   CDS_pept        51729..52007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85915"
FT                   /inference="similar to AA sequence:KEGG:ECA4396"
FT                   /protein_id="ACX85915.1"
FT   gene            complement(52146..53489)
FT                   /locus_tag="Pecwa_0048"
FT   CDS_pept        complement(52146..53489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0048"
FT                   /product="Citrate carrier protein"
FT                   /note="PFAM: Citrate carrier protein; KEGG: eca:ECA4395
FT                   Na(+)-malate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85916"
FT                   /inference="protein motif:PFAM:PF03390"
FT                   /protein_id="ACX85916.1"
FT   gene            55087..56694
FT                   /locus_tag="Pecwa_0049"
FT   CDS_pept        55087..56694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0049"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA4394 periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85917"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACX85917.1"
FT                   GYVVQPRGVHSFNNVTLD"
FT   gene            56929..57948
FT                   /locus_tag="Pecwa_0050"
FT   CDS_pept        56929..57948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0050"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0045
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85918"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX85918.1"
FT   gene            57961..58863
FT                   /locus_tag="Pecwa_0051"
FT   CDS_pept        57961..58863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0051"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4392 dipeptide
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85919"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX85919.1"
FT   gene            58877..59857
FT                   /locus_tag="Pecwa_0052"
FT   CDS_pept        58877..59857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0052"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: eca:ECA4391 dipeptide transporter ATP-binding
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85920"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACX85920.1"
FT   gene            59854..60864
FT                   /locus_tag="Pecwa_0053"
FT   CDS_pept        59854..60864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0053"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: eca:ECA4390 dipeptide transporter ATP-binding
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85921"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACX85921.1"
FT   gene            complement(60930..61535)
FT                   /locus_tag="Pecwa_0054"
FT   CDS_pept        complement(60930..61535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_03902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85922"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX85922.1"
FT   gene            complement(61721..62158)
FT                   /locus_tag="Pecwa_0055"
FT   CDS_pept        complement(61721..62158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85923"
FT                   /inference="similar to AA sequence:KEGG:PC1_0050"
FT                   /protein_id="ACX85923.1"
FT   gene            complement(62305..62796)
FT                   /locus_tag="Pecwa_0056"
FT   CDS_pept        complement(62305..62796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85924"
FT                   /inference="similar to AA sequence:KEGG:PSEEN0864"
FT                   /protein_id="ACX85924.1"
FT                   "
FT   gene            complement(62790..63497)
FT                   /locus_tag="Pecwa_0057"
FT   CDS_pept        complement(62790..63497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85925"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX85925.1"
FT                   KDIFYDIEKDTTW"
FT   gene            complement(63668..63937)
FT                   /locus_tag="Pecwa_0058"
FT   CDS_pept        complement(63668..63937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85926"
FT                   /inference="similar to AA sequence:KEGG:PSEEN2319"
FT                   /protein_id="ACX85926.1"
FT   gene            complement(64055..64594)
FT                   /locus_tag="Pecwa_0059"
FT   CDS_pept        complement(64055..64594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85927"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX85927.1"
FT                   GFTYCYEANIYKKINR"
FT   gene            complement(64650..65021)
FT                   /locus_tag="Pecwa_0060"
FT   CDS_pept        complement(64650..65021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85928"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX85928.1"
FT   gene            complement(65245..65763)
FT                   /locus_tag="Pecwa_0061"
FT   CDS_pept        complement(65245..65763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0061"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   eca:ECA4275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85929"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACX85929.1"
FT                   DDWRAPVEA"
FT   gene            complement(66115..67368)
FT                   /locus_tag="Pecwa_0062"
FT   CDS_pept        complement(66115..67368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0062"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eca:ECA4386 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85930"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACX85930.1"
FT                   RGIAILAEEVEKAISVGS"
FT   gene            67761..68969
FT                   /locus_tag="Pecwa_0063"
FT   CDS_pept        67761..68969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85931"
FT                   /inference="similar to AA sequence:KEGG:ECA4385"
FT                   /protein_id="ACX85931.1"
FT                   AVE"
FT   gene            complement(69077..70522)
FT                   /locus_tag="Pecwa_0064"
FT   CDS_pept        complement(69077..70522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0064"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: eca:ECA4383 altronate
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85932"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACX85932.1"
FT   gene            complement(70536..71558)
FT                   /locus_tag="Pecwa_0065"
FT   CDS_pept        complement(70536..71558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0065"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   pct:PC1_0059 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85933"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX85933.1"
FT                   "
FT   gene            71699..72613
FT                   /locus_tag="Pecwa_0066"
FT   CDS_pept        71699..72613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0066"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; KEGG: eca:ECA4381
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85934"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACX85934.1"
FT   gene            72827..74176
FT                   /locus_tag="Pecwa_0067"
FT   CDS_pept        72827..74176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0067"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4380 sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85935"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX85935.1"
FT   gene            74443..76236
FT                   /locus_tag="Pecwa_0068"
FT   CDS_pept        74443..76236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0068"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4379 gamma-glutamyltranspeptidase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85936"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ACX85936.1"
FT   gene            complement(76340..77365)
FT                   /locus_tag="Pecwa_0069"
FT   CDS_pept        complement(76340..77365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_3939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85937"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX85937.1"
FT                   K"
FT   gene            complement(77712..81191)
FT                   /locus_tag="Pecwa_0070"
FT   CDS_pept        complement(77712..81191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0070"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: cellulose synthase operon C domain protein;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide repeat; KEGG:
FT                   pct:PC1_0073 cellulose synthase operon C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85938"
FT                   /inference="protein motif:PFAM:PF05420"
FT                   /protein_id="ACX85938.1"
FT   gene            complement(81173..82288)
FT                   /locus_tag="Pecwa_0071"
FT   CDS_pept        complement(81173..82288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0071"
FT                   /product="Cellulase"
FT                   /EC_number=""
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   eca:ECA4373 endo-1,4-D-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85939"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX85939.1"
FT   gene            complement(82295..84652)
FT                   /locus_tag="Pecwa_0072"
FT   CDS_pept        complement(82295..84652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0072"
FT                   /product="Cellulose synthase BcsB"
FT                   /note="PFAM: Cellulose synthase BcsB; KEGG: eca:ECA4372
FT                   cellulose synthase regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85940"
FT                   /inference="protein motif:PFAM:PF03170"
FT                   /protein_id="ACX85940.1"
FT   gene            complement(84727..87426)
FT                   /locus_tag="Pecwa_0073"
FT   CDS_pept        complement(84727..87426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0073"
FT                   /product="cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /note="TIGRFAM: cellulose synthase catalytic subunit
FT                   (UDP-forming); PFAM: glycosyl transferase family 2; type IV
FT                   pilus assembly PilZ; KEGG: pct:PC1_0076 cellulose synthase
FT                   catalytic subunit (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85941"
FT                   /inference="protein motif:TFAM:TIGR03030"
FT                   /protein_id="ACX85941.1"
FT   gene            complement(87423..88160)
FT                   /locus_tag="Pecwa_0074"
FT   CDS_pept        complement(87423..88160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0074"
FT                   /product="cellulose synthase operon protein YhjQ"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjQ;
FT                   PFAM: YhjQ family protein; KEGG: eca:ECA4369 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85942"
FT                   /inference="protein motif:TFAM:TIGR03371"
FT                   /protein_id="ACX85942.1"
FT   gene            complement(88163..88372)
FT                   /locus_tag="Pecwa_0075"
FT   CDS_pept        complement(88163..88372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85943"
FT                   /inference="similar to AA sequence:KEGG:PC1_0078"
FT                   /protein_id="ACX85943.1"
FT   gene            89087..90661
FT                   /locus_tag="Pecwa_0076"
FT   CDS_pept        89087..90661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0076"
FT                   /product="cellulose biosynthesis protein BcsE"
FT                   /note="TIGRFAM: cellulose biosynthesis protein BcsE; KEGG:
FT                   pct:PC1_0079 cellulose biosynthesis protein BcsE"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85944"
FT                   /inference="protein motif:TFAM:TIGR03369"
FT                   /protein_id="ACX85944.1"
FT                   RVPGESS"
FT   gene            90658..90864
FT                   /locus_tag="Pecwa_0077"
FT   CDS_pept        90658..90864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0077"
FT                   /product="celllulose biosynthesis operon protein BcsF/YhjT"
FT                   /note="TIGRFAM: celllulose biosynthesis operon protein
FT                   BcsF/YhjT; KEGG: eca:ECA4365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85945"
FT                   /inference="protein motif:TFAM:TIGR03493"
FT                   /protein_id="ACX85945.1"
FT   gene            90866..92524
FT                   /locus_tag="Pecwa_0078"
FT   CDS_pept        90866..92524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0078"
FT                   /product="cellulose synthase operon protein YhjU"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjU;
FT                   KEGG: pct:PC1_0081 cellulose synthase operon protein YhjU"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85946"
FT                   /inference="protein motif:TFAM:TIGR03368"
FT                   /protein_id="ACX85946.1"
FT   gene            92959..94140
FT                   /locus_tag="Pecwa_0079"
FT   CDS_pept        92959..94140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0079"
FT                   /product="diguanylate cyclase"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein; KEGG: eca:ECA4363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85947"
FT                   /inference="protein motif:PFAM:PF00672"
FT                   /protein_id="ACX85947.1"
FT   gene            94459..95751
FT                   /locus_tag="Pecwa_0080"
FT   CDS_pept        94459..95751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0080"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   eca:ECA4362 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85948"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACX85948.1"
FT   gene            96108..97610
FT                   /locus_tag="Pecwa_0081"
FT   CDS_pept        96108..97610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0081"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   pct:PC1_0084 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85949"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACX85949.1"
FT   gene            complement(97678..98610)
FT                   /locus_tag="Pecwa_0082"
FT   CDS_pept        complement(97678..98610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0082"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: pct:PC1_0086 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85950"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACX85950.1"
FT   gene            complement(98777..99793)
FT                   /locus_tag="Pecwa_0083"
FT   CDS_pept        complement(98777..99793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0083"
FT                   /product="ribonuclease"
FT                   /note="TIGRFAM: ribonuclease; PFAM: ribonuclease BN; KEGG:
FT                   pct:PC1_0087 ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85951"
FT                   /inference="protein motif:TFAM:TIGR00766"
FT                   /protein_id="ACX85951.1"
FT   gene            99923..101125
FT                   /locus_tag="Pecwa_0084"
FT   CDS_pept        99923..101125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0084"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4358 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85952"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX85952.1"
FT                   E"
FT   gene            complement(101161..101727)
FT                   /locus_tag="Pecwa_0085"
FT   CDS_pept        complement(101161..101727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85953"
FT                   /inference="similar to AA sequence:KEGG:PC1_0089"
FT                   /protein_id="ACX85953.1"
FT   gene            complement(101914..102591)
FT                   /locus_tag="Pecwa_0086"
FT   CDS_pept        complement(101914..102591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: pct:PC1_0091
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85954"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ACX85954.1"
FT                   SHH"
FT   gene            102808..103053
FT                   /locus_tag="Pecwa_0087"
FT   CDS_pept        102808..103053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0087"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: eca:ECA4353 sulfur
FT                   transfer protein SirA"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85955"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACX85955.1"
FT   gene            complement(103113..105467)
FT                   /locus_tag="Pecwa_0088"
FT   CDS_pept        complement(103113..105467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0088"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: eca:ECA4352
FT                   zinc/cadmium/mercury/lead-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85956"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACX85956.1"
FT   gene            complement(105562..106191)
FT                   /locus_tag="Pecwa_0089"
FT   CDS_pept        complement(105562..106191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0089"
FT                   /product="YhhN family protein"
FT                   /note="PFAM: YhhN family protein; KEGG: pct:PC1_0094 YhhN
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85957"
FT                   /inference="protein motif:PFAM:PF07947"
FT                   /protein_id="ACX85957.1"
FT   gene            106373..106693
FT                   /locus_tag="Pecwa_0090"
FT   CDS_pept        106373..106693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0090"
FT                   /product="Domain of unknown function DUF1820"
FT                   /note="PFAM: Domain of unknown function DUF1820; KEGG:
FT                   eca:ECA4350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85958"
FT                   /inference="protein motif:PFAM:PF08850"
FT                   /protein_id="ACX85958.1"
FT                   KS"
FT   gene            complement(106776..107054)
FT                   /locus_tag="Pecwa_0091"
FT   CDS_pept        complement(106776..107054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0091"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="PFAM: protein of unknown function DUF1145; KEGG:
FT                   pct:PC1_0097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85959"
FT                   /inference="protein motif:PFAM:PF06611"
FT                   /protein_id="ACX85959.1"
FT   gene            complement(107081..107656)
FT                   /locus_tag="Pecwa_0092"
FT   CDS_pept        complement(107081..107656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0092"
FT                   /product="methyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4347 16S rRNA
FT                   m(2)G966-methyltransferase; TIGRFAM: methyltransferase;
FT                   PFAM: Protein of unknown function methylase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85960"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACX85960.1"
FT   gene            107995..109410
FT                   /locus_tag="Pecwa_0093"
FT   CDS_pept        107995..109410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0093"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: eca:ECA4346 cell division protein FtsY;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85961"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ACX85961.1"
FT                   ADDFIEALFARED"
FT   gene            109416..110087
FT                   /locus_tag="Pecwa_0094"
FT   CDS_pept        109416..110087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0094"
FT                   /product="Type II (General) Secretory Pathway (IISP) Family
FT                   protein"
FT                   /note="KEGG: pct:PC1_0100 type II (general) secretory
FT                   pathway (IISP) family protein; TIGRFAM: Type II (General)
FT                   Secretory Pathway (IISP) Family protein; cell division
FT                   ATP-binding protein FtsE; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85962"
FT                   /inference="protein motif:TFAM:TIGR00960"
FT                   /protein_id="ACX85962.1"
FT                   E"
FT   gene            110077..111045
FT                   /locus_tag="Pecwa_0095"
FT   CDS_pept        110077..111045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0095"
FT                   /product="protein insertion ABC transporter, inner membrane
FT                   subunit FtsX"
FT                   /note="TIGRFAM: protein insertion ABC transporter, inner
FT                   membrane subunit FtsX; PFAM: protein of unknown function
FT                   DUF214; KEGG: pct:PC1_0101 protein insertion ABC
FT                   transporter, inner membrane subunit FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85963"
FT                   /inference="protein motif:TFAM:TIGR00439"
FT                   /protein_id="ACX85963.1"
FT   gene            111367..112224
FT                   /locus_tag="Pecwa_0096"
FT   CDS_pept        111367..112224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0096"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: pct:PC1_0102 RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85964"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ACX85964.1"
FT                   AIEA"
FT   gene            complement(112313..112759)
FT                   /locus_tag="Pecwa_0097"
FT   CDS_pept        complement(112313..112759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0097"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA4342 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85965"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX85965.1"
FT   gene            113165..114277
FT                   /locus_tag="Pecwa_0098"
FT   CDS_pept        113165..114277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0098"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   eca:ECA4341 leucine-specific binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85966"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACX85966.1"
FT   gene            114435..115361
FT                   /locus_tag="Pecwa_0099"
FT   CDS_pept        114435..115361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0099"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: eca:ECA4340
FT                   branched-chain amino acid transporter permease subunit
FT                   LivH"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85967"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACX85967.1"
FT   gene            115358..116632
FT                   /locus_tag="Pecwa_0100"
FT   CDS_pept        115358..116632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0100"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pct:PC1_0106 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85968"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACX85968.1"
FT   gene            116629..117399
FT                   /locus_tag="Pecwa_0101"
FT   CDS_pept        116629..117399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0101"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pct:PC1_0107 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85969"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX85969.1"
FT   gene            117405..118106
FT                   /locus_tag="Pecwa_0102"
FT   CDS_pept        117405..118106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0102"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4337 leucine/isoleucine/valine transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85970"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX85970.1"
FT                   NEAVRSAYLGG"
FT   gene            118171..119361
FT                   /locus_tag="Pecwa_0103"
FT   CDS_pept        118171..119361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0103"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eca:ECA4336 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85971"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACX85971.1"
FT   gene            complement(119460..121106)
FT                   /locus_tag="Pecwa_0104"
FT   CDS_pept        complement(119460..121106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0104"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: pct:PC1_0110 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85972"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX85972.1"
FT   gene            complement(121703..123373)
FT                   /locus_tag="Pecwa_0105"
FT   CDS_pept        complement(121703..123373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0105"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: pct:PC1_0111 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85973"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX85973.1"
FT   gene            complement(124119..125789)
FT                   /locus_tag="Pecwa_0106"
FT   CDS_pept        complement(124119..125789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0106"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: eca:ECA4333 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85974"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX85974.1"
FT   gene            complement(126058..127737)
FT                   /locus_tag="Pecwa_0107"
FT   CDS_pept        complement(126058..127737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0107"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: pct:PC1_0113
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85975"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX85975.1"
FT   gene            complement(128037..129395)
FT                   /locus_tag="Pecwa_0108"
FT   CDS_pept        complement(128037..129395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0108"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: eca:ECA4331 inner
FT                   membrane permease YgbN"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85976"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACX85976.1"
FT   gene            complement(129586..130368)
FT                   /locus_tag="Pecwa_0109"
FT   CDS_pept        complement(129586..130368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0109"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number=""
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: pct:PC1_0115 hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85977"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX85977.1"
FT   gene            complement(130387..131043)
FT                   /locus_tag="Pecwa_0110"
FT   CDS_pept        complement(130387..131043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0110"
FT                   /product="L-fuculose-phosphate aldolase"
FT                   /EC_number=""
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pct:PC1_0116 L-fuculose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85978"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX85978.1"
FT   gene            complement(131040..132314)
FT                   /locus_tag="Pecwa_0111"
FT   CDS_pept        complement(131040..132314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0111"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   pct:PC1_0117 type III effector Hrp-dependent outers"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85979"
FT                   /inference="protein motif:PFAM:PF07005"
FT                   /protein_id="ACX85979.1"
FT   gene            complement(132311..133225)
FT                   /locus_tag="Pecwa_0112"
FT   CDS_pept        complement(132311..133225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0112"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number=""
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: pct:PC1_0118 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85980"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX85980.1"
FT   gene            133548..134309
FT                   /locus_tag="Pecwa_0113"
FT   CDS_pept        133548..134309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0113"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   eca:ECA4325 DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85981"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACX85981.1"
FT   gene            134523..134801
FT                   /locus_tag="Pecwa_0114"
FT   CDS_pept        134523..134801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0114"
FT                   /product="Protein of unknown function DUF1778"
FT                   /note="PFAM: Protein of unknown function DUF1778; KEGG:
FT                   pct:PC1_0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85982"
FT                   /inference="protein motif:PFAM:PF08681"
FT                   /protein_id="ACX85982.1"
FT   gene            complement(134877..135170)
FT                   /locus_tag="Pecwa_0115"
FT   CDS_pept        complement(134877..135170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0115"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   pct:PC1_0123 plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85983"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACX85983.1"
FT   gene            complement(135163..135405)
FT                   /locus_tag="Pecwa_0116"
FT   CDS_pept        complement(135163..135405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0116"
FT                   /product="putative addiction module antidote protein,
FT                   CopG/Arc/MetJ family"
FT                   /note="TIGRFAM: addiction module antidote protein, CC2985
FT                   family; PFAM: protein of unknown function UPF0156; KEGG:
FT                   pct:PC1_0124 putative addiction module antidote protein,
FT                   CopG/Arc/MetJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85984"
FT                   /inference="protein motif:TFAM:TIGR02606"
FT                   /protein_id="ACX85984.1"
FT   gene            135602..136936
FT                   /locus_tag="Pecwa_0117"
FT   CDS_pept        135602..136936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0117"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pct:PC1_0125 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85985"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACX85985.1"
FT   gene            137009..137896
FT                   /locus_tag="Pecwa_0118"
FT   CDS_pept        137009..137896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4321
FT                   glycerol-3-phosphate transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85986"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX85986.1"
FT                   VIQFRFVERKVNYQ"
FT   gene            137923..138768
FT                   /locus_tag="Pecwa_0119"
FT   CDS_pept        137923..138768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0119"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0127
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85987"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX85987.1"
FT                   "
FT   gene            138967..140040
FT                   /locus_tag="Pecwa_0120"
FT   CDS_pept        138967..140040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0120"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: eca:ECA4319
FT                   glycerol-3-phosphate transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85988"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX85988.1"
FT                   PTSSWHLFDSQSGLRME"
FT   gene            140040..140789
FT                   /locus_tag="Pecwa_0121"
FT   CDS_pept        140040..140789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0121"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: eca:ECA4318 cytoplasmic glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85989"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACX85989.1"
FT   gene            140983..141939
FT                   /locus_tag="Pecwa_0122"
FT   CDS_pept        140983..141939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0122"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: eca:ECA4317
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85990"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACX85990.1"
FT   gene            complement(141953..142249)
FT                   /locus_tag="Pecwa_0123"
FT   CDS_pept        complement(141953..142249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85991"
FT                   /inference="similar to AA sequence:KEGG:ECA4316"
FT                   /protein_id="ACX85991.1"
FT   gene            142580..143044
FT                   /locus_tag="Pecwa_0124"
FT   CDS_pept        142580..143044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0124"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   pct:PC1_0132 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85992"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACX85992.1"
FT   gene            complement(143076..143885)
FT                   /locus_tag="Pecwa_0125"
FT   CDS_pept        complement(143076..143885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85993"
FT                   /inference="similar to AA sequence:KEGG:PC1_0133"
FT                   /protein_id="ACX85993.1"
FT   gene            complement(143855..146029)
FT                   /locus_tag="Pecwa_0126"
FT   CDS_pept        complement(143855..146029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85994"
FT                   /inference="similar to AA sequence:KEGG:PC1_0134"
FT                   /protein_id="ACX85994.1"
FT   gene            complement(146194..147564)
FT                   /locus_tag="Pecwa_0127"
FT   CDS_pept        complement(146194..147564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0127"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   pct:PC1_0135 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85995"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX85995.1"
FT   gene            complement(147561..148259)
FT                   /locus_tag="Pecwa_0128"
FT   CDS_pept        complement(147561..148259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0128"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: eca:ECA4311 DNA-binding transcriptional
FT                   regulator CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85996"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX85996.1"
FT                   GRGYLMVSAA"
FT   gene            148413..148937
FT                   /locus_tag="Pecwa_0129"
FT   CDS_pept        148413..148937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0129"
FT                   /product="putative stress resistance protein"
FT                   /note="KEGG: eca:ECA4310 putative stress resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85997"
FT                   /inference="similar to AA sequence:KEGG:ECA4310"
FT                   /protein_id="ACX85997.1"
FT                   TTNHTETDSPE"
FT   gene            149143..149298
FT                   /pseudo
FT                   /locus_tag="Pecwa_0130"
FT   gene            149600..153349
FT                   /locus_tag="Pecwa_0131"
FT   CDS_pept        149600..153349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmr:PMI0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85998"
FT                   /inference="similar to AA sequence:KEGG:PMI0561"
FT                   /protein_id="ACX85998.1"
FT   gene            153419..154528
FT                   /locus_tag="Pecwa_0132"
FT   CDS_pept        153419..154528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0132"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; KEGG: pmr:PMI0560 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACX85999"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ACX85999.1"
FT   gene            154710..157271
FT                   /locus_tag="Pecwa_0133"
FT   CDS_pept        154710..157271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmr:PMI0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86000"
FT                   /inference="similar to AA sequence:KEGG:PMI0559"
FT                   /protein_id="ACX86000.1"
FT   gene            157271..158410
FT                   /locus_tag="Pecwa_0134"
FT   CDS_pept        157271..158410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0134"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor type A; KEGG: pmr:PMI0558 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86001"
FT                   /inference="protein motif:PFAM:PF05762"
FT                   /protein_id="ACX86001.1"
FT   gene            158407..160479
FT                   /locus_tag="Pecwa_0135"
FT   CDS_pept        158407..160479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0135"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   pmr:PMI0557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86002"
FT                   /inference="protein motif:PFAM:PF04434"
FT                   /protein_id="ACX86002.1"
FT   gene            160773..161960
FT                   /locus_tag="Pecwa_0136"
FT   CDS_pept        160773..161960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0136"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4309 sugar efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86003"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX86003.1"
FT   gene            162004..162906
FT                   /locus_tag="Pecwa_0137"
FT   CDS_pept        162004..162906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0137"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   pct:PC1_0139 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86004"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACX86004.1"
FT   gene            163114..164076
FT                   /locus_tag="Pecwa_0138"
FT   CDS_pept        163114..164076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0138"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0140 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86005"
FT                   /inference="protein motif:TFAM:TIGR02482"
FT                   /protein_id="ACX86005.1"
FT   gene            complement(164394..165236)
FT                   /locus_tag="Pecwa_0139"
FT   CDS_pept        complement(164394..165236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0139"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   net:Neut_2192 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86006"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACX86006.1"
FT   gene            complement(165245..165535)
FT                   /locus_tag="Pecwa_0140"
FT   CDS_pept        complement(165245..165535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0140"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   har:HEAR2248 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86007"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACX86007.1"
FT   gene            complement(165664..165949)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0141"
FT   gene            165950..167574
FT                   /pseudo
FT                   /locus_tag="Pecwa_0142"
FT   gene            167799..168095
FT                   /locus_tag="Pecwa_0143"
FT   CDS_pept        167799..168095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pay:PAU_00937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86008"
FT                   /inference="similar to AA sequence:KEGG:PAU_00937"
FT                   /protein_id="ACX86008.1"
FT   gene            complement(168150..168435)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0144"
FT   gene            168463..169548
FT                   /locus_tag="Pecwa_0145"
FT   CDS_pept        168463..169548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0145"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: eca:ECA2869 putative rhs
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86009"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACX86009.1"
FT   gene            169798..170493
FT                   /locus_tag="Pecwa_0146"
FT   CDS_pept        169798..170493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86010"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86010.1"
FT                   ERIYSYLPD"
FT   gene            170598..171018
FT                   /pseudo
FT                   /locus_tag="Pecwa_0147"
FT   gene            171009..171410
FT                   /pseudo
FT                   /locus_tag="Pecwa_0148"
FT   gene            171414..171944
FT                   /locus_tag="Pecwa_0149"
FT   CDS_pept        171414..171944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86011"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_3204"
FT                   /protein_id="ACX86011.1"
FT                   NNFPPDNIIFEKF"
FT   gene            complement(172000..172294)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0150"
FT   gene            172451..172687
FT                   /locus_tag="Pecwa_0151"
FT   CDS_pept        172451..172687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86012"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86012.1"
FT   gene            172899..173330
FT                   /locus_tag="Pecwa_0152"
FT   CDS_pept        172899..173330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efe:EFER_2927 putative global regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86013"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86013.1"
FT   gene            complement(173398..173692)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0153"
FT   gene            173781..174203
FT                   /pseudo
FT                   /locus_tag="Pecwa_0154"
FT   gene            174215..174658
FT                   /locus_tag="Pecwa_0155"
FT   CDS_pept        174215..174658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmn:NMCC_0593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86014"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86014.1"
FT   gene            complement(174721..175026)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0156"
FT   gene            175264..175713
FT                   /locus_tag="Pecwa_0157"
FT   CDS_pept        175264..175713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_1261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86015"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86015.1"
FT   gene            complement(175779..176058)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0158"
FT   gene            176191..176508
FT                   /locus_tag="Pecwa_0159"
FT   CDS_pept        176191..176508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dze:Dd1591_2561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86016"
FT                   /inference="similar to AA sequence:KEGG:Dd1591_2561"
FT                   /protein_id="ACX86016.1"
FT                   G"
FT   gene            176516..176941
FT                   /locus_tag="Pecwa_0160"
FT   CDS_pept        176516..176941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dze:Dd1591_2562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86017"
FT                   /inference="similar to AA sequence:KEGG:Dd1591_2562"
FT                   /protein_id="ACX86017.1"
FT   gene            177010..177203
FT                   /pseudo
FT                   /locus_tag="Pecwa_0161"
FT   gene            177514..177876
FT                   /locus_tag="Pecwa_0162"
FT   CDS_pept        177514..177876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eum:ECUMN_0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86018"
FT                   /inference="similar to AA sequence:KEGG:ECUMN_0782"
FT                   /protein_id="ACX86018.1"
FT                   SLDMDEESQDIYNLRT"
FT   gene            complement(177933..178286)
FT                   /locus_tag="Pecwa_0163"
FT   CDS_pept        complement(177933..178286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_03894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86019"
FT                   /inference="similar to AA sequence:KEGG:ESA_03894"
FT                   /protein_id="ACX86019.1"
FT                   YYMENDDFLDFDK"
FT   gene            complement(178780..179364)
FT                   /locus_tag="Pecwa_0164"
FT   CDS_pept        complement(178780..179364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86020"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86020.1"
FT   gene            complement(179449..179715)
FT                   /locus_tag="Pecwa_0165"
FT   CDS_pept        complement(179449..179715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86021"
FT                   /inference="similar to AA sequence:KEGG:ECA3411"
FT                   /protein_id="ACX86021.1"
FT   gene            complement(179753..180087)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0166"
FT   gene            180291..181175
FT                   /locus_tag="Pecwa_0167"
FT   CDS_pept        180291..181175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0167"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /note="TIGRFAM: N-carbamoylputrescine amidase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: eca:ECA4274 putative
FT                   carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86022"
FT                   /inference="protein motif:TFAM:TIGR03381"
FT                   /protein_id="ACX86022.1"
FT                   YGTIASSDGKTRR"
FT   gene            181179..182282
FT                   /locus_tag="Pecwa_0168"
FT   CDS_pept        181179..182282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0168"
FT                   /product="agmatine deiminase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4273 agmatine deiminase; TIGRFAM:
FT                   agmatine deiminase; PFAM: Porphyromonas-type
FT                   peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86023"
FT                   /inference="protein motif:TFAM:TIGR03380"
FT                   /protein_id="ACX86023.1"
FT   gene            complement(182421..183188)
FT                   /locus_tag="Pecwa_0169"
FT   CDS_pept        complement(182421..183188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0169"
FT                   /product="triosephosphate isomerase"
FT                   /note="TIGRFAM: triosephosphate isomerase; PFAM:
FT                   triosephosphate isomerase; KEGG: pct:PC1_0154
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86024"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ACX86024.1"
FT   gene            complement(183327..183926)
FT                   /locus_tag="Pecwa_0170"
FT   CDS_pept        complement(183327..183926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0170"
FT                   /product="protein of unknown function DUF1454"
FT                   /note="PFAM: protein of unknown function DUF1454; KEGG:
FT                   pct:PC1_0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86025"
FT                   /inference="protein motif:PFAM:PF07305"
FT                   /protein_id="ACX86025.1"
FT   gene            184183..184605
FT                   /locus_tag="Pecwa_0171"
FT   CDS_pept        184183..184605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0171"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805; KEGG:
FT                   eca:ECA4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86026"
FT                   /inference="protein motif:PFAM:PF05656"
FT                   /protein_id="ACX86026.1"
FT   gene            complement(184624..185370)
FT                   /locus_tag="Pecwa_0172"
FT   CDS_pept        complement(184624..185370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0172"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   eca:ECA4269 ferredoxin-NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86027"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACX86027.1"
FT   gene            complement(185676..186686)
FT                   /locus_tag="Pecwa_0173"
FT   CDS_pept        complement(185676..186686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0173"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0158 fructose-1,6-bisphosphatase,
FT                   class II; TIGRFAM: fructose-1,6-bisphosphatase, class II;
FT                   PFAM: GlpX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86028"
FT                   /inference="protein motif:TFAM:TIGR00330"
FT                   /protein_id="ACX86028.1"
FT   gene            complement(186812..188323)
FT                   /locus_tag="Pecwa_0174"
FT   CDS_pept        complement(186812..188323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0174"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; KEGG: eca:ECA4267 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86029"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACX86029.1"
FT   gene            complement(188377..189216)
FT                   /locus_tag="Pecwa_0175"
FT   CDS_pept        complement(188377..189216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0175"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: pct:PC1_0160 MIP family channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86030"
FT                   /inference="protein motif:TFAM:TIGR00861"
FT                   /protein_id="ACX86030.1"
FT   gene            189766..190005
FT                   /locus_tag="Pecwa_0176"
FT   CDS_pept        189766..190005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0176"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   eca:ECA4265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86031"
FT                   /inference="protein motif:PFAM:PF06005"
FT                   /protein_id="ACX86031.1"
FT   gene            complement(190113..190598)
FT                   /locus_tag="Pecwa_0177"
FT   CDS_pept        complement(190113..190598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0177"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: pct:PC1_0163
FT                   regulator of ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86032"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ACX86032.1"
FT   gene            complement(190718..191635)
FT                   /locus_tag="Pecwa_0178"
FT   CDS_pept        complement(190718..191635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0178"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   eca:ECA4263 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86033"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ACX86033.1"
FT   gene            complement(191781..193112)
FT                   /locus_tag="Pecwa_0179"
FT   CDS_pept        complement(191781..193112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0179"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: eca:ECA4262 ATP-dependent protease ATP-binding
FT                   subunit HslU; TIGRFAM: heat shock protein HslVU, ATPase
FT                   subunit HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86034"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACX86034.1"
FT   gene            complement(193122..193652)
FT                   /locus_tag="Pecwa_0180"
FT   CDS_pept        complement(193122..193652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0180"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   pct:PC1_0166 20S proteasome A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86035"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACX86035.1"
FT                   NQFHTIEELASKA"
FT   gene            complement(193736..194509)
FT                   /locus_tag="Pecwa_0181"
FT   CDS_pept        complement(193736..194509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0181"
FT                   /product="cell division protein FtsN"
FT                   /note="TIGRFAM: cell division protein FtsN; PFAM:
FT                   Sporulation domain protein; KEGG: eca:ECA4260 cell division
FT                   protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86036"
FT                   /inference="protein motif:TFAM:TIGR02223"
FT                   /protein_id="ACX86036.1"
FT   gene            complement(194700..195743)
FT                   /locus_tag="Pecwa_0182"
FT   CDS_pept        complement(194700..195743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0182"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: eca:ECA4259 DNA-binding
FT                   transcriptional regulator CytR"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86037"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACX86037.1"
FT                   NYARNRL"
FT   gene            complement(196014..198212)
FT                   /locus_tag="Pecwa_0183"
FT   CDS_pept        complement(196014..198212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0183"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: eca:ECA4258 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86038"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ACX86038.1"
FT   gene            198504..198719
FT                   /locus_tag="Pecwa_0184"
FT   CDS_pept        198504..198719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0184"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: eca:ECA4257 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86039"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACX86039.1"
FT   gene            complement(198791..199804)
FT                   /locus_tag="Pecwa_0185"
FT   CDS_pept        complement(198791..199804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0185"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pct:PC1_0173 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86040"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACX86040.1"
FT   gene            complement(199801..200763)
FT                   /locus_tag="Pecwa_0186"
FT   CDS_pept        complement(199801..200763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0186"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   pct:PC1_0174 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86041"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACX86041.1"
FT   gene            complement(200773..201570)
FT                   /locus_tag="Pecwa_0187"
FT   CDS_pept        complement(200773..201570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0187"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4254 putative iron(III) ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86042"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86042.1"
FT   gene            complement(201787..202104)
FT                   /locus_tag="Pecwa_0188"
FT   CDS_pept        complement(201787..202104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0188"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG: pct:PC1_0176
FT                   methionine repressor, MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86043"
FT                   /inference="protein motif:PFAM:PF01340"
FT                   /protein_id="ACX86043.1"
FT                   Y"
FT   gene            202174..203451
FT                   /locus_tag="Pecwa_0189"
FT   CDS_pept        202174..203451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0189"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4252 cystathionine gamma-synthase;
FT                   TIGRFAM: O-succinylhomoserine (thiol)-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86044"
FT                   /inference="protein motif:TFAM:TIGR02080"
FT                   /protein_id="ACX86044.1"
FT   gene            203454..205889
FT                   /locus_tag="Pecwa_0190"
FT   CDS_pept        203454..205889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0190"
FT                   /product="aspartate kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4251 bifunctional aspartate kinase
FT                   II/homoserine dehydrogenase II; TIGRFAM: aspartate kinase;
FT                   PFAM: homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding; aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86045"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACX86045.1"
FT   gene            206237..207133
FT                   /locus_tag="Pecwa_0191"
FT   CDS_pept        206237..207133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0191"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4244 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86046"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACX86046.1"
FT                   LSYAICHTLGVRPEVAC"
FT   gene            207250..207432
FT                   /locus_tag="Pecwa_0192"
FT   CDS_pept        207250..207432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86047"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86047.1"
FT                   WPACRIPQTPSRLFV"
FT   gene            207623..208531
FT                   /locus_tag="Pecwa_0193"
FT   CDS_pept        207623..208531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0193"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pct:PC1_0187 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86048"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACX86048.1"
FT   gene            complement(208523..209929)
FT                   /locus_tag="Pecwa_0194"
FT   CDS_pept        complement(208523..209929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0194"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; HI0933 family
FT                   protein; KEGG: pct:PC1_0188 pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86049"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACX86049.1"
FT                   AALNGLNRLF"
FT   gene            210129..210770
FT                   /locus_tag="Pecwa_0195"
FT   CDS_pept        210129..210770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0195"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pct:PC1_0189
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86050"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACX86050.1"
FT   gene            210794..211180
FT                   /locus_tag="Pecwa_0196"
FT   CDS_pept        210794..211180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0196"
FT                   /product="protein of unknown function DUF1422"
FT                   /note="PFAM: protein of unknown function DUF1422; KEGG:
FT                   eca:ECA4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86051"
FT                   /inference="protein motif:PFAM:PF07226"
FT                   /protein_id="ACX86051.1"
FT   gene            complement(211222..212325)
FT                   /locus_tag="Pecwa_0197"
FT   CDS_pept        complement(211222..212325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0197"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA4239 tRNA
FT                   (uracil-5-)-methyltransferase; TIGRFAM: tRNA
FT                   (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86052"
FT                   /inference="protein motif:TFAM:TIGR02143"
FT                   /protein_id="ACX86052.1"
FT   misc_binding    212457..212806
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 77.22"
FT   gene            212872..214767
FT                   /locus_tag="Pecwa_0198"
FT   CDS_pept        212872..214767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0198"
FT                   /product="TonB-dependent vitamin B12 receptor"
FT                   /note="TIGRFAM: TonB-dependent vitamin B12 receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: pct:PC1_0192 TonB-dependent vitamin B12 receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86053"
FT                   /inference="protein motif:TFAM:TIGR01779"
FT                   /protein_id="ACX86053.1"
FT   gene            214712..215569
FT                   /locus_tag="Pecwa_0199"
FT   CDS_pept        214712..215569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0199"
FT                   /product="glutamate racemase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0193 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86054"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACX86054.1"
FT                   KLPL"
FT   gene            215956..217486
FT                   /locus_tag="Pecwa_R0001"
FT   rRNA            215956..217486
FT                   /locus_tag="Pecwa_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            217633..217708
FT                   /locus_tag="Pecwa_R0002"
FT                   /note="tRNA-Glu1"
FT   tRNA            217633..217708
FT                   /locus_tag="Pecwa_R0002"
FT                   /product="tRNA-Glu"
FT   gene            217945..220851
FT                   /locus_tag="Pecwa_R0003"
FT   rRNA            217945..220851
FT                   /locus_tag="Pecwa_R0003"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            220993..221107
FT                   /locus_tag="Pecwa_R0004"
FT   rRNA            220993..221107
FT                   /locus_tag="Pecwa_R0004"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            221429..222466
FT                   /locus_tag="Pecwa_0200"
FT   CDS_pept        221429..222466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0200"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0213
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86055"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACX86055.1"
FT                   IEVLS"
FT   gene            222463..223422
FT                   /locus_tag="Pecwa_0201"
FT   CDS_pept        222463..223422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0201"
FT                   /product="bifunctional BirA, biotin operon
FT                   repressor/biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0214 biotin--protein ligase; TIGRFAM:
FT                   biotin/acetyl-CoA-carboxylase ligase; biotin operon
FT                   repressor; PFAM: biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix type 11 domain protein; biotin protein
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86056"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACX86056.1"
FT   gene            complement(223451..224401)
FT                   /locus_tag="Pecwa_0202"
FT   CDS_pept        complement(223451..224401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0202"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; KEGG: pct:PC1_0196
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86057"
FT                   /inference="protein motif:TFAM:TIGR00554"
FT                   /protein_id="ACX86057.1"
FT   gene            225051..225126
FT                   /locus_tag="Pecwa_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            225051..225126
FT                   /locus_tag="Pecwa_R0005"
FT                   /product="tRNA-Thr"
FT   gene            225142..225226
FT                   /locus_tag="Pecwa_R0006"
FT                   /note="tRNA-Tyr1"
FT   tRNA            225142..225226
FT                   /locus_tag="Pecwa_R0006"
FT                   /product="tRNA-Tyr"
FT   gene            225356..225430
FT                   /locus_tag="Pecwa_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            225356..225430
FT                   /locus_tag="Pecwa_R0007"
FT                   /product="tRNA-Gly"
FT   gene            225437..225512
FT                   /locus_tag="Pecwa_R0008"
FT                   /note="tRNA-Thr2"
FT   tRNA            225437..225512
FT                   /locus_tag="Pecwa_R0008"
FT                   /product="tRNA-Thr"
FT   gene            225620..226804
FT                   /locus_tag="Pecwa_0203"
FT   CDS_pept        225620..226804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0203"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: pct:PC1_3827
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86058"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACX86058.1"
FT   gene            227042..227425
FT                   /locus_tag="Pecwa_0204"
FT   CDS_pept        227042..227425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0204"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: pct:PC1_0199
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86059"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ACX86059.1"
FT   gene            227427..227972
FT                   /locus_tag="Pecwa_0205"
FT   CDS_pept        227427..227972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0205"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: pct:PC1_0200 NusG antitermination factor;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: NGN domain protein; KOW domain protein; SMART:
FT                   NGN domain protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86060"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ACX86060.1"
FT                   IFGRATPVELDFAQVEKG"
FT   gene            228135..228563
FT                   /locus_tag="Pecwa_0206"
FT   CDS_pept        228135..228563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0206"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: eca:ECA0219 50S ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86061"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ACX86061.1"
FT   gene            228567..229271
FT                   /locus_tag="Pecwa_0207"
FT   CDS_pept        228567..229271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0207"
FT                   /product="ribosomal protein L1"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: eca:ECA0220 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86062"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ACX86062.1"
FT                   AIDQSGLNAVAN"
FT   gene            229589..230086
FT                   /locus_tag="Pecwa_0208"
FT   CDS_pept        229589..230086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0208"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: pct:PC1_0203
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86063"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACX86063.1"
FT                   AA"
FT   gene            230153..230518
FT                   /locus_tag="Pecwa_0209"
FT   CDS_pept        230153..230518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0209"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: pct:PC1_0204 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86064"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ACX86064.1"
FT                   EALKKSLEEAGAEVEVK"
FT   gene            230846..234874
FT                   /locus_tag="Pecwa_0210"
FT   CDS_pept        230846..234874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0210"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0223 DNA-directed RNA polymerase
FT                   subunit beta; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   Rpb2 domain 7; RNA polymerase Rpb2 domain 3; RNA polymerase
FT                   Rpb2 domain 2; RNA polymerase beta subunit; DNA-directed
FT                   RNA polymerase, beta subunit, external 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86065"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ACX86065.1"
FT   gene            234981..239204
FT                   /locus_tag="Pecwa_0211"
FT   CDS_pept        234981..239204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0211"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: pct:PC1_0206 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86066"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ACX86066.1"
FT                   SSDDE"
FT   gene            239529..240926
FT                   /locus_tag="Pecwa_0212"
FT   CDS_pept        239529..240926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0212"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: major facilitator superfamily
FT                   MFS_1; General substrate transporter; KEGG: eca:ECA0225
FT                   shikimate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86067"
FT                   /inference="protein motif:TFAM:TIGR00883"
FT                   /protein_id="ACX86067.1"
FT                   SADDLPR"
FT   gene            complement(240995..241186)
FT                   /locus_tag="Pecwa_0213"
FT   CDS_pept        complement(240995..241186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0213"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   pct:PC1_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86068"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACX86068.1"
FT                   DNGLKDIGLKRSDLDRFR"
FT   gene            241360..242796
FT                   /locus_tag="Pecwa_0214"
FT   CDS_pept        241360..242796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0214"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain protein"
FT                   /note="PFAM: aminotransferase class I and II; regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   eca:ECA0227 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86069"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACX86069.1"
FT   gene            complement(243180..244301)
FT                   /locus_tag="Pecwa_0215"
FT   CDS_pept        complement(243180..244301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0215"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="TIGRFAM: thiazole biosynthesis protein ThiH; PFAM:
FT                   biotin and thiamin synthesis associated; Radical SAM domain
FT                   protein; KEGG: eca:ECA0228 thiamine biosynthesis protein
FT                   ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86070"
FT                   /inference="protein motif:TFAM:TIGR02351"
FT                   /protein_id="ACX86070.1"
FT   gene            complement(244301..245083)
FT                   /locus_tag="Pecwa_0216"
FT   CDS_pept        complement(244301..245083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0216"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   eca:ECA0229 thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86071"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ACX86071.1"
FT   gene            complement(245085..245285)
FT                   /locus_tag="Pecwa_0217"
FT   CDS_pept        complement(245085..245285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0217"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: eca:ECA0229A sulfur carrier
FT                   protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86072"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ACX86072.1"
FT   gene            complement(245282..246061)
FT                   /locus_tag="Pecwa_0218"
FT   CDS_pept        complement(245282..246061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0218"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: eca:ECA0230 thiamine
FT                   biosynthesis protein ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86073"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACX86073.1"
FT   gene            complement(246063..246704)
FT                   /locus_tag="Pecwa_0219"
FT   CDS_pept        complement(246063..246704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0219"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0215 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86074"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACX86074.1"
FT   gene            complement(246701..248641)
FT                   /locus_tag="Pecwa_0220"
FT   CDS_pept        complement(246701..248641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0220"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: pct:PC1_0216
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86075"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACX86075.1"
FT                   SATSLPAEENQ"
FT   misc_binding    complement(248755..248908)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 66.51"
FT   gene            complement(249031..249492)
FT                   /locus_tag="Pecwa_0221"
FT   CDS_pept        complement(249031..249492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0221"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: eca:ECA0233 anti-RNA polymerase sigma 70
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86076"
FT                   /inference="protein motif:PFAM:PF04353"
FT                   /protein_id="ACX86076.1"
FT   gene            249601..250383
FT                   /locus_tag="Pecwa_0222"
FT   CDS_pept        249601..250383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0222"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number=""
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: eca:ECA0234 NADH
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86077"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86077.1"
FT   gene            250500..251564
FT                   /locus_tag="Pecwa_0223"
FT   CDS_pept        250500..251564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0223"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0219 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86078"
FT                   /inference="protein motif:TFAM:TIGR01464"
FT                   /protein_id="ACX86078.1"
FT                   FVEAVHRLSRPYHA"
FT   gene            251580..252269
FT                   /locus_tag="Pecwa_0224"
FT   CDS_pept        251580..252269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0224"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number=""
FT                   /note="PFAM: Endonuclease V; KEGG: pct:PC1_0220
FT                   deoxyribonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86079"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86079.1"
FT                   QAASVLS"
FT   gene            252347..252937
FT                   /locus_tag="Pecwa_0225"
FT   CDS_pept        252347..252937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0225"
FT                   /product="protein of unknown function DUF416"
FT                   /note="PFAM: protein of unknown function DUF416; KEGG:
FT                   pct:PC1_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86080"
FT                   /inference="protein motif:PFAM:PF04222"
FT                   /protein_id="ACX86080.1"
FT   gene            253142..253414
FT                   /locus_tag="Pecwa_0226"
FT   CDS_pept        253142..253414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0226"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   pct:PC1_0222 histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86081"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACX86081.1"
FT   gene            253419..254102
FT                   /locus_tag="Pecwa_0227"
FT   CDS_pept        253419..254102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0227"
FT                   /product="protein of unknown function DUF1481"
FT                   /note="PFAM: protein of unknown function DUF1481; KEGG:
FT                   eca:ECA0239 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86082"
FT                   /inference="protein motif:PFAM:PF07356"
FT                   /protein_id="ACX86082.1"
FT                   CQWQP"
FT   gene            complement(254170..255456)
FT                   /locus_tag="Pecwa_0228"
FT   CDS_pept        complement(254170..255456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0228"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0240 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain; protein of
FT                   unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86083"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACX86083.1"
FT   gene            complement(255474..257063)
FT                   /locus_tag="Pecwa_0229"
FT   CDS_pept        complement(255474..257063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0229"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0241 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; SMART: AICARFT/IMPCHase bienzyme formylation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86084"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ACX86084.1"
FT                   AMIFTDMRHFRH"
FT   gene            257675..259205
FT                   /locus_tag="Pecwa_R0009"
FT   rRNA            257675..259205
FT                   /locus_tag="Pecwa_R0009"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            259351..259426
FT                   /locus_tag="Pecwa_R0010"
FT                   /note="tRNA-Glu2"
FT   tRNA            259351..259426
FT                   /locus_tag="Pecwa_R0010"
FT                   /product="tRNA-Glu"
FT   gene            259663..262568
FT                   /locus_tag="Pecwa_R0011"
FT   rRNA            259663..262568
FT                   /locus_tag="Pecwa_R0011"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            262710..262824
FT                   /locus_tag="Pecwa_R0012"
FT   rRNA            262710..262824
FT                   /locus_tag="Pecwa_R0012"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(263184..263945)
FT                   /locus_tag="Pecwa_0230"
FT   CDS_pept        complement(263184..263945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0230"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pct:PC1_0226 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86085"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86085.1"
FT   gene            complement(263954..265048)
FT                   /locus_tag="Pecwa_0231"
FT   CDS_pept        complement(263954..265048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0231"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA0243 L-amino
FT                   acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86086"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACX86086.1"
FT   gene            complement(265058..266236)
FT                   /locus_tag="Pecwa_0232"
FT   CDS_pept        complement(265058..266236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0232"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA0244 L-amino
FT                   acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86087"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACX86087.1"
FT   gene            complement(266303..267328)
FT                   /locus_tag="Pecwa_0233"
FT   CDS_pept        complement(266303..267328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0233"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   pct:PC1_0229 extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86088"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACX86088.1"
FT                   R"
FT   gene            complement(267714..268379)
FT                   /locus_tag="Pecwa_0234"
FT   CDS_pept        complement(267714..268379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0234"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA0246
FT                   putative amino-acid transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86089"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACX86089.1"
FT   gene            complement(268468..269235)
FT                   /locus_tag="Pecwa_0235"
FT   CDS_pept        complement(268468..269235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0235"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA0247 putative cystine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86090"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACX86090.1"
FT   gene            269529..270674
FT                   /locus_tag="Pecwa_0236"
FT   CDS_pept        269529..270674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0236"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   eca:ECA0251 endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86091"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACX86091.1"
FT   gene            270737..271140
FT                   /pseudo
FT                   /locus_tag="Pecwa_0237"
FT   gene            271343..271726
FT                   /locus_tag="Pecwa_0238"
FT   CDS_pept        271343..271726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE2358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86092"
FT                   /inference="similar to AA sequence:KEGG:YE2358"
FT                   /protein_id="ACX86092.1"
FT   gene            271882..272277
FT                   /locus_tag="Pecwa_0239"
FT   CDS_pept        271882..272277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pay:PAU_02290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86093"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86093.1"
FT   gene            complement(272607..272903)
FT                   /locus_tag="Pecwa_0240"
FT   CDS_pept        complement(272607..272903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0240"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: pct:PC1_0236
FT                   transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86094"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="ACX86094.1"
FT   gene            complement(272927..273892)
FT                   /locus_tag="Pecwa_0241"
FT   CDS_pept        complement(272927..273892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0241"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: eca:ECA0256
FT                   tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86095"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACX86095.1"
FT   gene            complement(274250..274984)
FT                   /locus_tag="Pecwa_0242"
FT   CDS_pept        complement(274250..274984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0242"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: eca:ECA0257 carbonic
FT                   anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86096"
FT                   /inference="protein motif:PFAM:PF00194"
FT                   /protein_id="ACX86096.1"
FT   gene            complement(275166..276053)
FT                   /locus_tag="Pecwa_0243"
FT   CDS_pept        complement(275166..276053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0243"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: ribosomal L11 methyltransferase; Methyltransferase
FT                   type 12; methyltransferase small; putative RNA methylase;
FT                   KEGG: eca:ECA0258 ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86097"
FT                   /inference="protein motif:TFAM:TIGR00406"
FT                   /protein_id="ACX86097.1"
FT                   REEWCRITGQRRAS"
FT   gene            complement(276071..277522)
FT                   /locus_tag="Pecwa_0244"
FT   CDS_pept        complement(276071..277522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0244"
FT                   /product="sodium/pantothenate symporter"
FT                   /note="TIGRFAM: sodium/pantothenate symporter; SSS sodium
FT                   solute transporter superfamily; PFAM: Na+/solute symporter;
FT                   KEGG: pct:PC1_0240 sodium/pantothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86098"
FT                   /inference="protein motif:TFAM:TIGR02119"
FT                   /protein_id="ACX86098.1"
FT   gene            complement(277512..277754)
FT                   /locus_tag="Pecwa_0245"
FT   CDS_pept        complement(277512..277754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0245"
FT                   /product="protein of unknown function DUF997"
FT                   /note="PFAM: protein of unknown function DUF997; KEGG:
FT                   pct:PC1_0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86099"
FT                   /inference="protein motif:PFAM:PF06196"
FT                   /protein_id="ACX86099.1"
FT   gene            278442..278870
FT                   /locus_tag="Pecwa_0246"
FT   CDS_pept        278442..278870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0246"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: pct:PC1_0242 TOBE
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86100"
FT                   /inference="protein motif:PFAM:PF03459"
FT                   /protein_id="ACX86100.1"
FT   gene            279140..280177
FT                   /locus_tag="Pecwa_0247"
FT   CDS_pept        279140..280177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0247"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: pmr:PMI2675
FT                   iron compound ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86101"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACX86101.1"
FT                   LLRVA"
FT   gene            280174..281169
FT                   /locus_tag="Pecwa_0248"
FT   CDS_pept        280174..281169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0248"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: pmr:PMI2676 iron compound ABC transporter,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86102"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACX86102.1"
FT   gene            281166..281924
FT                   /locus_tag="Pecwa_0249"
FT   CDS_pept        281166..281924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0249"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pmr:PMI2677 iron compound ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86103"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86103.1"
FT   gene            281971..282792
FT                   /locus_tag="Pecwa_0250"
FT   CDS_pept        281971..282792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmr:PMI2678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86104"
FT                   /inference="similar to AA sequence:KEGG:PMI2678"
FT                   /protein_id="ACX86104.1"
FT   gene            282789..283637
FT                   /locus_tag="Pecwa_0251"
FT   CDS_pept        282789..283637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0251"
FT                   /product="modD protein"
FT                   /EC_number=""
FT                   /note="KEGG: pmr:PMI2679 molybdenum transport protein ModD;
FT                   TIGRFAM: modD protein; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86105"
FT                   /inference="protein motif:TFAM:TIGR01334"
FT                   /protein_id="ACX86105.1"
FT                   L"
FT   gene            283734..285725
FT                   /locus_tag="Pecwa_0252"
FT   CDS_pept        283734..285725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0252"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: cko:CKO_01203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86106"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACX86106.1"
FT   gene            complement(285790..287133)
FT                   /locus_tag="Pecwa_0253"
FT   CDS_pept        complement(285790..287133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0253"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   biotin carboxylase domain protein;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: pct:PC1_0243 acetyl-CoA carboxylase, biotin
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86107"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ACX86107.1"
FT   gene            complement(287145..287612)
FT                   /locus_tag="Pecwa_0254"
FT   CDS_pept        complement(287145..287612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0254"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: eca:ECA0261 acetyl-CoA
FT                   carboxylase biotin carboxyl carrier protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86108"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ACX86108.1"
FT   gene            complement(287637..288089)
FT                   /locus_tag="Pecwa_0255"
FT   CDS_pept        complement(287637..288089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0255"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0262 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86109"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACX86109.1"
FT   gene            complement(288331..288930)
FT                   /locus_tag="Pecwa_0256"
FT   CDS_pept        complement(288331..288930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0256"
FT                   /product="Ferric reductase domain protein protein
FT                   transmembrane component domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; KEGG: pct:PC1_0246 ferric reductase
FT                   domain protein protein transmembrane component domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86110"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACX86110.1"
FT   gene            complement(288967..289968)
FT                   /locus_tag="Pecwa_0257"
FT   CDS_pept        complement(288967..289968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0257"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   pct:PC1_0247 oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86111"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACX86111.1"
FT   gene            complement(290252..290776)
FT                   /locus_tag="Pecwa_0258"
FT   CDS_pept        complement(290252..290776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86112"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86112.1"
FT                   FLSMPTSEDAL"
FT   gene            complement(290869..291393)
FT                   /locus_tag="Pecwa_0259"
FT   CDS_pept        complement(290869..291393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86113"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86113.1"
FT                   FLSTPTAIDAL"
FT   gene            complement(291662..292639)
FT                   /locus_tag="Pecwa_0260"
FT   CDS_pept        complement(291662..292639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0260"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   eca:ECA0265 putative zinc-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86114"
FT                   /inference="protein motif:TFAM:TIGR02823"
FT                   /protein_id="ACX86114.1"
FT   gene            292666..292815
FT                   /locus_tag="Pecwa_0261"
FT   CDS_pept        292666..292815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86115"
FT                   /inference="similar to AA sequence:KEGG:PC1_0250"
FT                   /protein_id="ACX86115.1"
FT                   LFRV"
FT   gene            292948..294885
FT                   /locus_tag="Pecwa_0262"
FT   CDS_pept        292948..294885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0262"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: eca:ECA0266 regulatory protein CsrD; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86116"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX86116.1"
FT                   LKKYSPQHRV"
FT   gene            295127..296246
FT                   /pseudo
FT                   /locus_tag="Pecwa_0263"
FT   gene            296410..297393
FT                   /locus_tag="Pecwa_0264"
FT   CDS_pept        296410..297393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0264"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: eca:ECA0268 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86117"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ACX86117.1"
FT   gene            297390..297878
FT                   /locus_tag="Pecwa_0265"
FT   CDS_pept        297390..297878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0265"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: pct:PC1_0254 rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86118"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ACX86118.1"
FT   gene            297887..298480
FT                   /locus_tag="Pecwa_0266"
FT   CDS_pept        297887..298480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0266"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: pct:PC1_0255 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86119"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACX86119.1"
FT   gene            298470..299939
FT                   /locus_tag="Pecwa_0267"
FT   CDS_pept        298470..299939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0267"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: pct:PC1_0256 ribonuclease, Rne/Rng family;
FT                   TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA-binding
FT                   protein AU-1/Ribonuclease E/G; RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86120"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ACX86120.1"
FT   gene            299981..303811
FT                   /locus_tag="Pecwa_0268"
FT   CDS_pept        299981..303811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86121"
FT                   /inference="similar to AA sequence:KEGG:ECA0272"
FT                   /protein_id="ACX86121.1"
FT   gene            303868..305313
FT                   /locus_tag="Pecwa_0269"
FT   CDS_pept        303868..305313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0269"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   eca:ECA0273 protease TldD"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86122"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACX86122.1"
FT   gene            complement(305345..306289)
FT                   /locus_tag="Pecwa_0270"
FT   CDS_pept        complement(305345..306289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0270"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA0276 putative DNA-binding
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86123"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACX86123.1"
FT   gene            306650..306853
FT                   /locus_tag="Pecwa_0271"
FT   CDS_pept        306650..306853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0271"
FT                   /product="protein of unknown function DUF1656"
FT                   /note="PFAM: protein of unknown function DUF1656; KEGG:
FT                   eca:ECA0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86124"
FT                   /inference="protein motif:PFAM:PF07869"
FT                   /protein_id="ACX86124.1"
FT   gene            306861..307826
FT                   /locus_tag="Pecwa_0272"
FT   CDS_pept        306861..307826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0272"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   eca:ECA0278 p-hydroxybenzoic acid efflux subunit AaeA"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86125"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACX86125.1"
FT   gene            307838..309826
FT                   /locus_tag="Pecwa_0273"
FT   CDS_pept        307838..309826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0273"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: pct:PC1_0264 fusaric acid resistance protein
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86126"
FT                   /db_xref="GOA:D0KEK2"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="InterPro:IPR023706"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0KEK2"
FT                   /inference="protein motif:PFAM:PF04632"
FT                   /protein_id="ACX86126.1"
FT   gene            complement(309879..310430)
FT                   /locus_tag="Pecwa_0274"
FT   CDS_pept        complement(309879..310430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0274"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   pct:PC1_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86127"
FT                   /inference="protein motif:PFAM:PF04751"
FT                   /protein_id="ACX86127.1"
FT   gene            310798..312138
FT                   /locus_tag="Pecwa_0275"
FT   CDS_pept        310798..312138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0275"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   pct:PC1_0267 peptidase U62 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86128"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACX86128.1"
FT   gene            complement(312210..312620)
FT                   /locus_tag="Pecwa_0276"
FT   CDS_pept        complement(312210..312620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0276"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: eca:ECA0283 nucleoside diphosphate kinase
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86129"
FT                   /inference="similar to AA sequence:KEGG:ECA0283"
FT                   /protein_id="ACX86129.1"
FT   gene            complement(312774..313046)
FT                   /locus_tag="Pecwa_0277"
FT   CDS_pept        complement(312774..313046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0277"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: pct:PC1_0270
FT                   phosphotransferase system, phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86130"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACX86130.1"
FT   gene            complement(313078..313935)
FT                   /locus_tag="Pecwa_0278"
FT   CDS_pept        complement(313078..313935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pct:PC1_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86131"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ACX86131.1"
FT                   RKPS"
FT   gene            complement(314090..314563)
FT                   /locus_tag="Pecwa_0279"
FT   CDS_pept        complement(314090..314563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0279"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: eca:ECA0286 PTS
FT                   IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86132"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ACX86132.1"
FT   gene            complement(314644..314931)
FT                   /locus_tag="Pecwa_0280"
FT   CDS_pept        complement(314644..314931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0280"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   eca:ECA0287 putative sigma(54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86133"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACX86133.1"
FT   gene            complement(314955..316388)
FT                   /locus_tag="Pecwa_0281"
FT   CDS_pept        complement(314955..316388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0281"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor core-binding region; sigma-54 factor;
FT                   sigma-54 DNA-binding domain protein; KEGG: eca:ECA0288 RNA
FT                   polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86134"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACX86134.1"
FT   gene            complement(316438..317163)
FT                   /locus_tag="Pecwa_0282"
FT   CDS_pept        complement(316438..317163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0282"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pct:PC1_0275 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86135"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86135.1"
FT   gene            complement(317167..317739)
FT                   /locus_tag="Pecwa_0283"
FT   CDS_pept        complement(317167..317739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0283"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG: pct:PC1_0276
FT                   lipopolysaccharide transport periplasmic protein LptA"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86136"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ACX86136.1"
FT   gene            complement(317720..318286)
FT                   /locus_tag="Pecwa_0284"
FT   CDS_pept        complement(317720..318286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0284"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   eca:ECA0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86137"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ACX86137.1"
FT   gene            complement(318283..318849)
FT                   /locus_tag="Pecwa_0285"
FT   CDS_pept        complement(318283..318849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0285"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: eca:ECA0292
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86138"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ACX86138.1"
FT   gene            complement(318869..319906)
FT                   /locus_tag="Pecwa_0286"
FT   CDS_pept        complement(318869..319906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0286"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0293 D-arabinose 5-phosphate isomerase;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: sugar isomerase
FT                   (SIS); CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86139"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ACX86139.1"
FT                   RAGVV"
FT   gene            complement(319947..320912)
FT                   /locus_tag="Pecwa_0287"
FT   CDS_pept        complement(319947..320912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0287"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   pct:PC1_0280 Na+/Ca+ antiporter, CaCA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86140"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ACX86140.1"
FT   gene            321300..322112
FT                   /locus_tag="Pecwa_0288"
FT   CDS_pept        321300..322112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0288"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA0295 putative ABC transporter ATP-binding
FT                   protein YrbF"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86141"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86141.1"
FT   gene            322120..322902
FT                   /locus_tag="Pecwa_0289"
FT   CDS_pept        322120..322902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0289"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pct:PC1_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86142"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACX86142.1"
FT   gene            322907..323473
FT                   /locus_tag="Pecwa_0290"
FT   CDS_pept        322907..323473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0290"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: pct:PC1_0283 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86143"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACX86143.1"
FT   gene            323486..324115
FT                   /locus_tag="Pecwa_0291"
FT   CDS_pept        323486..324115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0291"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   eca:ECA0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86144"
FT                   /inference="protein motif:PFAM:PF05494"
FT                   /protein_id="ACX86144.1"
FT   gene            324129..324419
FT                   /locus_tag="Pecwa_0292"
FT   CDS_pept        324129..324419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86145"
FT                   /inference="similar to AA sequence:KEGG:ECA0299"
FT                   /protein_id="ACX86145.1"
FT   gene            324543..324797
FT                   /locus_tag="Pecwa_0293"
FT   CDS_pept        324543..324797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0293"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: pct:PC1_0286 BolA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86146"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ACX86146.1"
FT   gene            324878..326140
FT                   /locus_tag="Pecwa_0294"
FT   CDS_pept        324878..326140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0294"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   pct:PC1_0287 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86147"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACX86147.1"
FT   gene            complement(326246..327343)
FT                   /locus_tag="Pecwa_0295"
FT   CDS_pept        complement(326246..327343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0295"
FT                   /product="periplasmic serine protease DegS"
FT                   /note="KEGG: eca:ECA0302 serine endoprotease; TIGRFAM:
FT                   periplasmic serine protease DegS; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86148"
FT                   /inference="protein motif:TFAM:TIGR02038"
FT                   /protein_id="ACX86148.1"
FT   gene            complement(327479..328849)
FT                   /locus_tag="Pecwa_0296"
FT   CDS_pept        complement(327479..328849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0296"
FT                   /product="protease Do"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0303 exported protease; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86149"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ACX86149.1"
FT   gene            complement(329097..329501)
FT                   /locus_tag="Pecwa_0297"
FT   CDS_pept        complement(329097..329501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0297"
FT                   /product="protein of unknown function DUF1043"
FT                   /note="PFAM: protein of unknown function DUF1043; KEGG:
FT                   pct:PC1_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86150"
FT                   /inference="protein motif:PFAM:PF06295"
FT                   /protein_id="ACX86150.1"
FT   gene            329717..330868
FT                   /locus_tag="Pecwa_0298"
FT   CDS_pept        329717..330868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0298"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: pct:PC1_0291
FT                   AFG1-family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86151"
FT                   /inference="protein motif:PFAM:PF03969"
FT                   /protein_id="ACX86151.1"
FT   gene            331105..331533
FT                   /locus_tag="Pecwa_0299"
FT   CDS_pept        331105..331533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0299"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: eca:ECA0306 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86152"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACX86152.1"
FT   gene            331549..331941
FT                   /locus_tag="Pecwa_0300"
FT   CDS_pept        331549..331941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0300"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: eca:ECA0307 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86153"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACX86153.1"
FT   gene            332269..332910
FT                   /locus_tag="Pecwa_0301"
FT   CDS_pept        332269..332910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0301"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   pct:PC1_0294 glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86154"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACX86154.1"
FT   gene            332916..333419
FT                   /locus_tag="Pecwa_0302"
FT   CDS_pept        332916..333419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0302"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   eca:ECA0309 ClpXP protease specificity-enhancing factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86155"
FT                   /inference="protein motif:PFAM:PF04386"
FT                   /protein_id="ACX86155.1"
FT                   RVVK"
FT   gene            complement(333495..334268)
FT                   /locus_tag="Pecwa_0303"
FT   CDS_pept        complement(333495..334268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0303"
FT                   /product="acetoin reductase"
FT                   /note="TIGRFAM: acetoin reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   eca:ECA0310 acetoin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86156"
FT                   /inference="protein motif:TFAM:TIGR02415"
FT                   /protein_id="ACX86156.1"
FT   gene            complement(334516..335934)
FT                   /locus_tag="Pecwa_0304"
FT   CDS_pept        complement(334516..335934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0304"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pct:PC1_0298 glutamate synthase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86157"
FT                   /inference="protein motif:TFAM:TIGR01318"
FT                   /protein_id="ACX86157.1"
FT                   GRKAADGIMNYLEV"
FT   gene            complement(335944..340404)
FT                   /locus_tag="Pecwa_0305"
FT   CDS_pept        complement(335944..340404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0305"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number=""
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamate
FT                   synthase; glutamine amidotransferase class-II; KEGG:
FT                   eca:ECA0312 glutamate synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86158"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86158.1"
FT   gene            341056..341985
FT                   /locus_tag="Pecwa_0306"
FT   CDS_pept        341056..341985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0313 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86159"
FT                   /inference="protein motif:TFAM:TIGR01212"
FT                   /protein_id="ACX86159.1"
FT   gene            342104..344473
FT                   /locus_tag="Pecwa_0307"
FT   CDS_pept        342104..344473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0307"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: pct:PC1_0301 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   Hpt domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein; Hpt
FT                   domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86160"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACX86160.1"
FT   gene            344980..345636
FT                   /locus_tag="Pecwa_0308"
FT   CDS_pept        344980..345636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0308"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: pct:PC1_0302
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86161"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACX86161.1"
FT   gene            345666..346367
FT                   /locus_tag="Pecwa_0309"
FT   CDS_pept        345666..346367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0309"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: pct:PC1_0303 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86162"
FT                   /inference="protein motif:TFAM:TIGR02070"
FT                   /protein_id="ACX86162.1"
FT                   GEAFLRDNNLN"
FT   gene            346439..347734
FT                   /locus_tag="Pecwa_0310"
FT   CDS_pept        346439..347734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86163"
FT                   /inference="similar to AA sequence:KEGG:PC1_0304"
FT                   /protein_id="ACX86163.1"
FT   gene            complement(347839..348411)
FT                   /locus_tag="Pecwa_0311"
FT   CDS_pept        complement(347839..348411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0311"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   eca:ECA0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86164"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACX86164.1"
FT   gene            complement(348423..349013)
FT                   /locus_tag="Pecwa_0312"
FT   CDS_pept        complement(348423..349013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0312"
FT                   /product="DnaA initiator-associating protein DiaA"
FT                   /note="KEGG: eca:ECA0320 DnaA initiator-associating protein
FT                   DiaA"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86165"
FT                   /inference="similar to AA sequence:KEGG:ECA0320"
FT                   /protein_id="ACX86165.1"
FT   gene            complement(349055..349411)
FT                   /locus_tag="Pecwa_0313"
FT   CDS_pept        complement(349055..349411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0313"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   pct:PC1_0307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86166"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ACX86166.1"
FT                   KAFNWLPNAFAAQG"
FT   gene            complement(349408..351426)
FT                   /locus_tag="Pecwa_0314"
FT   CDS_pept        complement(349408..351426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0314"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: pct:PC1_0308
FT                   LppC family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86167"
FT                   /db_xref="GOA:D0KEP3"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0KEP3"
FT                   /inference="protein motif:PFAM:PF04348"
FT                   /protein_id="ACX86167.1"
FT   gene            351488..352375
FT                   /locus_tag="Pecwa_0315"
FT   CDS_pept        351488..352375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0315"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: eca:ECA0323
FT                   putative tetrapyrrole methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86168"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACX86168.1"
FT                   LEQEGDSDESGDDK"
FT   gene            352461..352763
FT                   /gene="rnpB"
FT                   /locus_tag="Pecwa_R0013"
FT   ncRNA           352461..352763
FT                   /gene="rnpB"
FT                   /locus_tag="Pecwa_R0013"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam(RF000
FT                   10), score 264.75"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            353623..354255
FT                   /locus_tag="Pecwa_0316"
FT   CDS_pept        353623..354255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86169"
FT                   /inference="similar to AA sequence:KEGG:YE1937"
FT                   /protein_id="ACX86169.1"
FT   gene            354263..354595
FT                   /locus_tag="Pecwa_0317"
FT   CDS_pept        354263..354595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86170"
FT                   /inference="similar to AA sequence:KEGG:YPTB0567"
FT                   /protein_id="ACX86170.1"
FT                   GVFFYF"
FT   gene            354876..355130
FT                   /locus_tag="Pecwa_0318"
FT   CDS_pept        354876..355130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0318"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: eca:ECA0325
FT                   putative plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86171"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACX86171.1"
FT   gene            355120..355407
FT                   /locus_tag="Pecwa_0319"
FT   CDS_pept        355120..355407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0319"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: eca:ECA0326
FT                   putative plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86172"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ACX86172.1"
FT   gene            355586..356374
FT                   /locus_tag="Pecwa_0320"
FT   CDS_pept        355586..356374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0320"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: pct:PC1_0310 extradiol
FT                   ring-cleavage dioxygenase class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86173"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ACX86173.1"
FT   gene            complement(356462..357622)
FT                   /locus_tag="Pecwa_0321"
FT   CDS_pept        complement(356462..357622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0321"
FT                   /product="glutathionylspermidine synthase"
FT                   /note="PFAM: glutathionylspermidine synthase; KEGG:
FT                   eca:ECA0328 putative glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86174"
FT                   /inference="protein motif:PFAM:PF03738"
FT                   /protein_id="ACX86174.1"
FT   gene            complement(357634..358302)
FT                   /locus_tag="Pecwa_0322"
FT   CDS_pept        complement(357634..358302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0322"
FT                   /product="protein of unknown function DUF1190"
FT                   /note="PFAM: protein of unknown function DUF1190; KEGG:
FT                   pct:PC1_0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86175"
FT                   /inference="protein motif:PFAM:PF06693"
FT                   /protein_id="ACX86175.1"
FT                   "
FT   gene            complement(358585..359976)
FT                   /locus_tag="Pecwa_0323"
FT   CDS_pept        complement(358585..359976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0323"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   pct:PC1_0313 type I secretion outer membrane protein, TolC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86176"
FT                   /inference="protein motif:TFAM:TIGR01844"
FT                   /protein_id="ACX86176.1"
FT                   ASAQR"
FT   gene            360315..360947
FT                   /locus_tag="Pecwa_0324"
FT   CDS_pept        360315..360947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0324"
FT                   /product="ADP-ribose diphosphatase"
FT                   /EC_number=""
FT                   /note="PFAM: NUDIX hydrolase; KEGG: eca:ECA0331 ADP-ribose
FT                   pyrophosphatase NudF"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86177"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86177.1"
FT   gene            360952..361383
FT                   /locus_tag="Pecwa_0325"
FT   CDS_pept        360952..361383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0325"
FT                   /product="protein of unknown function DUF1249"
FT                   /note="PFAM: protein of unknown function DUF1249; KEGG:
FT                   pct:PC1_0316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86178"
FT                   /inference="protein motif:PFAM:PF06853"
FT                   /protein_id="ACX86178.1"
FT   gene            361490..362317
FT                   /locus_tag="Pecwa_0326"
FT   CDS_pept        361490..362317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0326"
FT                   /product="Calcineurin phosphoesterase domain protein"
FT                   /note="PFAM: Calcineurin phosphoesterase domain protein;
FT                   metallophosphoesterase; KEGG: pct:PC1_0317 calcineurin
FT                   phosphoesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86179"
FT                   /inference="protein motif:PFAM:PF08413"
FT                   /protein_id="ACX86179.1"
FT   gene            362317..362898
FT                   /locus_tag="Pecwa_0327"
FT   CDS_pept        362317..362898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0327"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   pct:PC1_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86180"
FT                   /inference="protein motif:PFAM:PF05728"
FT                   /protein_id="ACX86180.1"
FT   gene            362983..364878
FT                   /locus_tag="Pecwa_0328"
FT   CDS_pept        362983..364878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0328"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0335 DNA topoisomerase IV subunit B;
FT                   TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86181"
FT                   /inference="protein motif:TFAM:TIGR01055"
FT                   /protein_id="ACX86181.1"
FT   gene            364921..365817
FT                   /locus_tag="Pecwa_0329"
FT   CDS_pept        364921..365817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0329"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pct:PC1_0321 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86182"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACX86182.1"
FT                   ITCFLDFMSEKLTENPL"
FT   gene            complement(365858..366439)
FT                   /locus_tag="Pecwa_0330"
FT   CDS_pept        complement(365858..366439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0330"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   eca:ECA0337 putative modulator of drug activity B"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86183"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACX86183.1"
FT   gene            complement(366646..367506)
FT                   /locus_tag="Pecwa_0331"
FT   CDS_pept        complement(366646..367506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0331"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0338 hypothetical protein; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86184"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ACX86184.1"
FT                   KATLY"
FT   gene            complement(367596..368447)
FT                   /locus_tag="Pecwa_0332"
FT   CDS_pept        complement(367596..368447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0332"
FT                   /product="Tagatose-bisphosphate aldolase"
FT                   /EC_number=""
FT                   /note="PFAM: ketose-bisphosphate aldolase class-II; KEGG:
FT                   eca:ECA0339 sugar-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86185"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86185.1"
FT                   KA"
FT   gene            complement(368459..369550)
FT                   /locus_tag="Pecwa_0333"
FT   CDS_pept        complement(368459..369550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0333"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PFAM: phosphotransferase system EIIC; KEGG:
FT                   eca:ECA0340 PTS system, IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86186"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACX86186.1"
FT   gene            complement(369576..369890)
FT                   /locus_tag="Pecwa_0334"
FT   CDS_pept        complement(369576..369890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0334"
FT                   /product="PTS system, fructose-specific, IIB subunnit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PFAM: phosphotransferase system PTS
FT                   fructose-specific IIB subunit; KEGG: pct:PC1_0326 PTS
FT                   system, fructose-specific, IIB subunnit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86187"
FT                   /inference="protein motif:TFAM:TIGR00829"
FT                   /protein_id="ACX86187.1"
FT                   "
FT   gene            complement(369904..370383)
FT                   /locus_tag="Pecwa_0335"
FT   CDS_pept        complement(369904..370383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0335"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: pct:PC1_0327
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86188"
FT                   /inference="protein motif:TFAM:TIGR00848"
FT                   /protein_id="ACX86188.1"
FT   gene            complement(370432..371982)
FT                   /locus_tag="Pecwa_0336"
FT   CDS_pept        complement(370432..371982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0336"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: PRD domain protein; Helix-turn-helix type 11
FT                   domain protein; M trans-acting positive regulator;
FT                   regulatory protein DeoR; KEGG: eca:ECA0343 PTS system
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86189"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ACX86189.1"
FT   gene            complement(372400..374802)
FT                   /locus_tag="Pecwa_0337"
FT   CDS_pept        complement(372400..374802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0337"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: pct:PC1_0329 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86190"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACX86190.1"
FT   gene            375022..375525
FT                   /locus_tag="Pecwa_0338"
FT   CDS_pept        375022..375525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86191"
FT                   /inference="similar to AA sequence:KEGG:PC1_0331"
FT                   /protein_id="ACX86191.1"
FT                   YHYR"
FT   gene            375698..377968
FT                   /locus_tag="Pecwa_0339"
FT   CDS_pept        375698..377968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0339"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0345 DNA topoisomerase IV subunit A;
FT                   TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; SMART: DNA gyrase/topoisomerase IV subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86192"
FT                   /inference="protein motif:TFAM:TIGR01062"
FT                   /protein_id="ACX86192.1"
FT                   SEE"
FT   gene            378113..378850
FT                   /locus_tag="Pecwa_0340"
FT   CDS_pept        378113..378850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0340"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0333 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86193"
FT                   /inference="protein motif:TFAM:TIGR00530"
FT                   /protein_id="ACX86193.1"
FT   gene            379005..380420
FT                   /locus_tag="Pecwa_0341"
FT   CDS_pept        379005..380420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0341"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 2; KEGG: pct:PC1_0334 multicopper oxidase type
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86194"
FT                   /inference="protein motif:PFAM:PF07732"
FT                   /protein_id="ACX86194.1"
FT                   RGSTGQLIVQTAM"
FT   gene            380743..381480
FT                   /locus_tag="Pecwa_0342"
FT   CDS_pept        380743..381480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0342"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein Crp; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: eca:ECA0348
FT                   GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86195"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACX86195.1"
FT   gene            complement(381523..382350)
FT                   /locus_tag="Pecwa_0343"
FT   CDS_pept        complement(381523..382350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0343"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number=""
FT                   /note="PFAM: aldo/keto reductase; KEGG: eca:ECA0349
FT                   2,5-diketo-D-gluconate reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86196"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86196.1"
FT   gene            382906..383424
FT                   /locus_tag="Pecwa_0344"
FT   CDS_pept        382906..383424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0344"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   pct:PC1_0054 type VI secretion system effector, Hcp1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86197"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACX86197.1"
FT                   DDWRAPVEA"
FT   gene            383546..385405
FT                   /locus_tag="Pecwa_0345"
FT   CDS_pept        383546..385405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0345"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: eca:ECA2867 putative rhs accessory genetic
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86198"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACX86198.1"
FT   gene            385472..385912
FT                   /locus_tag="Pecwa_0346"
FT   CDS_pept        385472..385912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0346"
FT                   /product="Domain of unknown function DUF1795"
FT                   /note="PFAM: Domain of unknown function DUF1795; KEGG:
FT                   eta:ETA_30010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86199"
FT                   /inference="protein motif:PFAM:PF08786"
FT                   /protein_id="ACX86199.1"
FT   gene            385930..390069
FT                   /locus_tag="Pecwa_0347"
FT   CDS_pept        385930..390069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0347"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; PAAR
FT                   repeat-containing protein; YD repeat-containing protein;
FT                   KEGG: eta:ETA_08660 rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86200"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACX86200.1"
FT   gene            390074..390418
FT                   /locus_tag="Pecwa_0348"
FT   CDS_pept        390074..390418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86201"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86201.1"
FT                   KILREISNIS"
FT   gene            complement(390509..390627)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0349"
FT   gene            390648..391571
FT                   /locus_tag="Pecwa_0350"
FT   CDS_pept        390648..391571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0350"
FT                   /product="RHS protein"
FT                   /note="PFAM: RHS protein; KEGG: eta:ETA_30000 putative
FT                   membrane-bound sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86202"
FT                   /inference="protein motif:PFAM:PF03527"
FT                   /protein_id="ACX86202.1"
FT   variation       390685
FT                   /locus_tag="Pecwa_0350"
FT                   /replace=""
FT                   /note="SNP"
FT   gene            391581..392000
FT                   /locus_tag="Pecwa_0351"
FT   CDS_pept        391581..392000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86203"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86203.1"
FT   gene            392155..392469
FT                   /pseudo
FT                   /locus_tag="Pecwa_0352"
FT   gene            392613..392933
FT                   /locus_tag="Pecwa_0353"
FT   CDS_pept        392613..392933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86204"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86204.1"
FT                   EF"
FT   gene            complement(393088..393399)
FT                   /locus_tag="Pecwa_0354"
FT   CDS_pept        complement(393088..393399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0354"
FT                   /product="Domain of unknown function DUF1813 HSP20-like
FT                   protein"
FT                   /note="PFAM: Domain of unknown function DUF1813 HSP20-like;
FT                   KEGG: sfv:SFV_0629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86205"
FT                   /inference="protein motif:PFAM:PF08845"
FT                   /protein_id="ACX86205.1"
FT   gene            complement(393473..393742)
FT                   /locus_tag="Pecwa_0355"
FT   CDS_pept        complement(393473..393742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu3590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86206"
FT                   /inference="similar to AA sequence:KEGG:plu3590"
FT                   /protein_id="ACX86206.1"
FT   gene            394684..394947
FT                   /locus_tag="Pecwa_0356"
FT   CDS_pept        394684..394947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86207"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1285"
FT                   /protein_id="ACX86207.1"
FT   gene            394971..395207
FT                   /locus_tag="Pecwa_0357"
FT   CDS_pept        394971..395207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86208"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1286"
FT                   /protein_id="ACX86208.1"
FT   gene            395320..395694
FT                   /locus_tag="Pecwa_0358"
FT   CDS_pept        395320..395694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86209"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86209.1"
FT   gene            complement(395782..395901)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0359"
FT   gene            395922..396842
FT                   /locus_tag="Pecwa_0360"
FT   CDS_pept        395922..396842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0360"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /note="PFAM: guanine-specific ribonuclease N1 and T1; RHS
FT                   protein; KEGG: eta:ETA_30000 putative membrane-bound
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86210"
FT                   /inference="protein motif:PFAM:PF00545"
FT                   /protein_id="ACX86210.1"
FT   gene            396842..397174
FT                   /locus_tag="Pecwa_0361"
FT   CDS_pept        396842..397174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0361"
FT                   /product="Barstar (barnase inhibitor)"
FT                   /note="PFAM: Barstar (barnase inhibitor); KEGG:
FT                   rlg:Rleg_3292 barstar (barnase inhibitor)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86211"
FT                   /inference="protein motif:PFAM:PF01337"
FT                   /protein_id="ACX86211.1"
FT                   LLCLVK"
FT   gene            complement(397256..397375)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0362"
FT   gene            397378..398081
FT                   /pseudo
FT                   /locus_tag="Pecwa_0363"
FT   gene            398262..398594
FT                   /locus_tag="Pecwa_0364"
FT   CDS_pept        398262..398594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86212"
FT                   /inference="similar to AA sequence:KEGG:PFL_2671"
FT                   /protein_id="ACX86212.1"
FT                   KPNGLK"
FT   gene            complement(398679..398958)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0365"
FT   gene            398959..400302
FT                   /pseudo
FT                   /locus_tag="Pecwa_0366"
FT   gene            400312..400707
FT                   /locus_tag="Pecwa_0367"
FT   CDS_pept        400312..400707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_03890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86213"
FT                   /inference="similar to AA sequence:KEGG:ESA_03890"
FT                   /protein_id="ACX86213.1"
FT   gene            400837..401688
FT                   /locus_tag="Pecwa_0368"
FT   CDS_pept        400837..401688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pct:PC1_0051 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86214"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86214.1"
FT                   FQ"
FT   gene            401654..402121
FT                   /locus_tag="Pecwa_0369"
FT   CDS_pept        401654..402121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86215"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86215.1"
FT   gene            complement(402179..402473)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0370"
FT   gene            402922..403359
FT                   /pseudo
FT                   /locus_tag="Pecwa_0371"
FT   gene            403391..403915
FT                   /locus_tag="Pecwa_0372"
FT   CDS_pept        403391..403915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86216"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86216.1"
FT                   DVSASALSWRV"
FT   gene            404039..404305
FT                   /locus_tag="Pecwa_0373"
FT   CDS_pept        404039..404305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA2869 putative rhs protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86217"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86217.1"
FT   gene            404293..404508
FT                   /locus_tag="Pecwa_0374"
FT   CDS_pept        404293..404508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAL1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86218"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86218.1"
FT   gene            404524..404961
FT                   /locus_tag="Pecwa_0375"
FT   CDS_pept        404524..404961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_1019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86219"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_1019"
FT                   /protein_id="ACX86219.1"
FT   gene            405816..406259
FT                   /locus_tag="Pecwa_0376"
FT   CDS_pept        405816..406259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu0353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86220"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86220.1"
FT   gene            406246..406575
FT                   /locus_tag="Pecwa_0377"
FT   CDS_pept        406246..406575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86221"
FT                   /inference="similar to AA sequence:KEGG:PSEEN4592"
FT                   /protein_id="ACX86221.1"
FT                   PFPSE"
FT   gene            complement(406676..406759)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0378"
FT   gene            complement(406922..407155)
FT                   /locus_tag="Pecwa_0379"
FT   CDS_pept        complement(406922..407155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0379"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   ent:Ent638_4321 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86222"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACX86222.1"
FT   gene            complement(407290..408453)
FT                   /locus_tag="Pecwa_0380"
FT   CDS_pept        complement(407290..408453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0380"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   eca:ECA0350 putative iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86223"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACX86223.1"
FT   gene            complement(408457..409197)
FT                   /locus_tag="Pecwa_0381"
FT   CDS_pept        complement(408457..409197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0381"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pct:PC1_0338
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86224"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACX86224.1"
FT   gene            409385..410425
FT                   /locus_tag="Pecwa_0382"
FT   CDS_pept        409385..410425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0382"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC-type transcriptional regulator domain
FT                   protein; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   eca:ECA0352 AraC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86225"
FT                   /inference="protein motif:PFAM:PF06719"
FT                   /protein_id="ACX86225.1"
FT                   MAVEEG"
FT   gene            complement(410455..411114)
FT                   /locus_tag="Pecwa_0383"
FT   CDS_pept        complement(410455..411114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0383"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   eca:ECA0353 DedA family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86226"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACX86226.1"
FT   gene            complement(411431..412621)
FT                   /locus_tag="Pecwa_0384"
FT   CDS_pept        complement(411431..412621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0384"
FT                   /product="cystathionine beta-lyase"
FT                   /note="TIGRFAM: cystathionine beta-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; KEGG:
FT                   eca:ECA0354 cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86227"
FT                   /inference="protein motif:TFAM:TIGR01324"
FT                   /protein_id="ACX86227.1"
FT   gene            complement(412946..414238)
FT                   /locus_tag="Pecwa_0385"
FT   CDS_pept        complement(412946..414238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0385"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: eca:ECA0355 DedA family
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86228"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACX86228.1"
FT   gene            complement(414256..414762)
FT                   /locus_tag="Pecwa_0386"
FT   CDS_pept        complement(414256..414762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0386"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: eca:ECA0356 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86229"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ACX86229.1"
FT                   MLGSS"
FT   gene            complement(414888..415865)
FT                   /locus_tag="Pecwa_0387"
FT   CDS_pept        complement(414888..415865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0387"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: eca:ECA0357 substrate-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86230"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ACX86230.1"
FT   gene            416537..417535
FT                   /locus_tag="Pecwa_0388"
FT   CDS_pept        416537..417535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0388"
FT                   /product="tonB-system energizer ExbB"
FT                   /note="TIGRFAM: tonB-system energizer ExbB; PFAM:
FT                   MotA/TolQ/ExbB proton channel; KEGG: pct:PC1_0345
FT                   TonB-system energizer ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86231"
FT                   /inference="protein motif:TFAM:TIGR02797"
FT                   /protein_id="ACX86231.1"
FT   gene            417539..417964
FT                   /locus_tag="Pecwa_0389"
FT   CDS_pept        417539..417964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0389"
FT                   /product="TonB system transport protein ExbD"
FT                   /note="TIGRFAM: TonB system transport protein ExbD; PFAM:
FT                   Biopolymer transport protein ExbD/TolR; KEGG: eca:ECA0359
FT                   biopolymer transport protein ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86232"
FT                   /inference="protein motif:TFAM:TIGR02803"
FT                   /protein_id="ACX86232.1"
FT   gene            complement(418188..419207)
FT                   /locus_tag="Pecwa_0390"
FT   CDS_pept        complement(418188..419207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecr:ECIAI1_4101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86233"
FT                   /inference="similar to AA sequence:KEGG:ECIAI1_4101"
FT                   /protein_id="ACX86233.1"
FT   gene            complement(419608..420627)
FT                   /locus_tag="Pecwa_0391"
FT   CDS_pept        complement(419608..420627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0391"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: eca:ECA0360 sucrose operon repressor; TIGRFAM:
FT                   D-fructose-responsive transcription factor; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86234"
FT                   /inference="protein motif:TFAM:TIGR02417"
FT                   /protein_id="ACX86234.1"
FT   gene            complement(420658..422067)
FT                   /locus_tag="Pecwa_0392"
FT   CDS_pept        complement(420658..422067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0392"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /note="KEGG: eca:ECA0361 sucrose-6-phosphate hydrolase;
FT                   TIGRFAM: sucrose-6-phosphate hydrolase; PFAM: Glycosyl
FT                   hydrolase family 32 domain protein; SMART: glycoside
FT                   hydrolase family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86235"
FT                   /inference="protein motif:TFAM:TIGR01322"
FT                   /protein_id="ACX86235.1"
FT                   QHWLLAPCVIE"
FT   gene            complement(422064..423437)
FT                   /locus_tag="Pecwa_0393"
FT   CDS_pept        complement(422064..423437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0393"
FT                   /product="PTS system, sucrose-specific IIBC subunit"
FT                   /note="TIGRFAM: PTS system, sucrose-specific IIBC subunit;
FT                   PTS system, glucose-like IIB subunint; PTS system, maltose
FT                   and glucose-specific subfamily, IIC subunit; PFAM:
FT                   phosphotransferase system EIIC; Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site; KEGG: eca:ECA0362 PTS
FT                   system, sucrose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86236"
FT                   /inference="protein motif:TFAM:TIGR01996"
FT                   /protein_id="ACX86236.1"
FT   gene            complement(423508..425067)
FT                   /locus_tag="Pecwa_0394"
FT   CDS_pept        complement(423508..425067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0394"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: pct:PC1_0350 porin LamB
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86237"
FT                   /inference="protein motif:PFAM:PF02264"
FT                   /protein_id="ACX86237.1"
FT                   WF"
FT   gene            complement(425255..426190)
FT                   /locus_tag="Pecwa_0395"
FT   CDS_pept        complement(425255..426190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0395"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: eca:ECA0364
FT                   aminoimidazole riboside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86238"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACX86238.1"
FT   gene            426661..427212
FT                   /locus_tag="Pecwa_0396"
FT   CDS_pept        426661..427212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0396"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   eca:ECA0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86239"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ACX86239.1"
FT   gene            427240..429963
FT                   /locus_tag="Pecwa_0397"
FT   CDS_pept        427240..429963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0397"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3; SMART:
FT                   DEAD-like helicase; KEGG: dda:Dd703_3591 CRISPR-associated
FT                   helicase Cas3"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86240"
FT                   /inference="protein motif:TFAM:TIGR01587"
FT                   /protein_id="ACX86240.1"
FT   gene            430597..432168
FT                   /locus_tag="Pecwa_0398"
FT   CDS_pept        430597..432168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0398"
FT                   /product="CRISPR-associated protein, Cse1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse1 family;
FT                   PFAM: CRISPR-associated protein Cse1; KEGG: dda:Dd703_3590
FT                   CRISPR-associated protein, CSE1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86241"
FT                   /inference="protein motif:TFAM:TIGR02547"
FT                   /protein_id="ACX86241.1"
FT                   VDGEHG"
FT   gene            432152..432787
FT                   /locus_tag="Pecwa_0399"
FT   CDS_pept        432152..432787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0399"
FT                   /product="CRISPR-associated protein, Cse2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse2 family;
FT                   PFAM: CRISPR-associated protein Cse2; KEGG: dda:Dd703_3589
FT                   CRISPR-associated protein, CSE2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86242"
FT                   /inference="protein motif:TFAM:TIGR02548"
FT                   /protein_id="ACX86242.1"
FT   gene            432791..433858
FT                   /locus_tag="Pecwa_0400"
FT   CDS_pept        432791..433858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0400"
FT                   /product="CRISPR-associated protein, Cse4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse4 family;
FT                   PFAM: CRISPR-associated protein CT1975; KEGG:
FT                   dda:Dd703_3588 CRISPR-associated protein, CSE4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86243"
FT                   /inference="protein motif:TFAM:TIGR01869"
FT                   /protein_id="ACX86243.1"
FT                   NEGGSLQGLLDFISQ"
FT   gene            433868..434602
FT                   /locus_tag="Pecwa_0401"
FT   CDS_pept        433868..434602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0401"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5; PFAM: CRISPR-associated
FT                   protein CT1976; KEGG: dda:Dd703_3587 CRISPR-associated
FT                   protein Cas5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86244"
FT                   /inference="protein motif:TFAM:TIGR01868"
FT                   /protein_id="ACX86244.1"
FT   gene            434602..435249
FT                   /locus_tag="Pecwa_0402"
FT   CDS_pept        434602..435249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0402"
FT                   /product="CRISPR-associated protein, Cse3 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse3 family;
FT                   PFAM: CRISPR-associated protein CT1974; KEGG:
FT                   dda:Dd703_3586 CRISPR-associated protein, CSE3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86245"
FT                   /inference="protein motif:TFAM:TIGR01907"
FT                   /protein_id="ACX86245.1"
FT   gene            435277..436194
FT                   /locus_tag="Pecwa_0403"
FT   CDS_pept        435277..436194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0403"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: dda:Dd703_3585
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86246"
FT                   /inference="protein motif:TFAM:TIGR03638"
FT                   /protein_id="ACX86246.1"
FT   gene            436195..436488
FT                   /locus_tag="Pecwa_0404"
FT   CDS_pept        436195..436488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0404"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   CRISPR-associated protein Cas2; KEGG: dda:Dd703_3584
FT                   CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86247"
FT                   /inference="protein motif:TFAM:TIGR01873"
FT                   /protein_id="ACX86247.1"
FT   repeat_region   436573..437577
FT                   /rpt_unit_range=436573..436601
FT                   /note="CRISPRS"
FT   gene            complement(437595..437966)
FT                   /locus_tag="Pecwa_0405"
FT   CDS_pept        complement(437595..437966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0405"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: esa:ESA_00803
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86248"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX86248.1"
FT   gene            complement(438040..438300)
FT                   /locus_tag="Pecwa_0406"
FT   CDS_pept        complement(438040..438300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0406"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   ypb:YPTS_3250 plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86249"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACX86249.1"
FT   gene            438451..438756
FT                   /locus_tag="Pecwa_0407"
FT   CDS_pept        438451..438756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0407"
FT                   /product="Protein of unknown function DUF2136"
FT                   /note="PFAM: Protein of unknown function DUF2136; KEGG:
FT                   eca:ECA0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86250"
FT                   /inference="protein motif:PFAM:PF09907"
FT                   /protein_id="ACX86250.1"
FT   gene            438753..439169
FT                   /locus_tag="Pecwa_0408"
FT   CDS_pept        438753..439169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0408"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: eca:ECA0367 putative
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86251"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX86251.1"
FT   gene            439267..439362
FT                   /locus_tag="Pecwa_0409"
FT   CDS_pept        439267..439362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86252"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86252.1"
FT                   /translation="MAETHCKKLLKGMPVDLDGLLLASFSSIENQ"
FT   gene            440027..440485
FT                   /locus_tag="Pecwa_0410"
FT   CDS_pept        440027..440485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86253"
FT                   /inference="similar to AA sequence:KEGG:PC1_0353"
FT                   /protein_id="ACX86253.1"
FT   gene            complement(440566..441918)
FT                   /locus_tag="Pecwa_0411"
FT   CDS_pept        complement(440566..441918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0411"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   eca:ECA0369 putative pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86254"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ACX86254.1"
FT   gene            complement(441949..443235)
FT                   /locus_tag="Pecwa_0412"
FT   CDS_pept        complement(441949..443235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0412"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86255"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX86255.1"
FT   gene            443375..443821
FT                   /locus_tag="Pecwa_0413"
FT   CDS_pept        443375..443821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0413"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: pct:PC1_0356
FT                   transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86256"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACX86256.1"
FT   gene            443831..444328
FT                   /locus_tag="Pecwa_0414"
FT   CDS_pept        443831..444328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86257"
FT                   /inference="similar to AA sequence:KEGG:ECA0372"
FT                   /protein_id="ACX86257.1"
FT                   RE"
FT   gene            444355..445008
FT                   /locus_tag="Pecwa_0415"
FT   CDS_pept        444355..445008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86258"
FT                   /inference="similar to AA sequence:KEGG:ECA0373"
FT                   /protein_id="ACX86258.1"
FT   gene            complement(445020..445484)
FT                   /locus_tag="Pecwa_0416"
FT   CDS_pept        complement(445020..445484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0416"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; KEGG: pct:PC1_0359 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86259"
FT                   /inference="protein motif:TFAM:TIGR02491"
FT                   /protein_id="ACX86259.1"
FT   gene            complement(445566..447704)
FT                   /locus_tag="Pecwa_0417"
FT   CDS_pept        complement(445566..447704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0417"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0375 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: formate
FT                   C-acetyltransferase glycine radical; ATP-cone domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86260"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ACX86260.1"
FT                   KQEEVKRRIKHLGNGQLG"
FT   gene            complement(448105..448491)
FT                   /locus_tag="Pecwa_0418"
FT   CDS_pept        complement(448105..448491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0418"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: pct:PC1_0365 endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86261"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ACX86261.1"
FT   gene            complement(448590..449054)
FT                   /locus_tag="Pecwa_0419"
FT   CDS_pept        complement(448590..449054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0419"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: Aspartate carbamoyltransferase regulatory
FT                   subunit-like; KEGG: pct:PC1_0366 aspartate
FT                   carbamoyltransferase, regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86262"
FT                   /inference="protein motif:TFAM:TIGR00240"
FT                   /protein_id="ACX86262.1"
FT   gene            complement(449070..450005)
FT                   /locus_tag="Pecwa_0420"
FT   CDS_pept        complement(449070..450005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0420"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0382 aspartate carbamoyltransferase
FT                   catalytic subunit; TIGRFAM: aspartate carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86263"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ACX86263.1"
FT   gene            450454..450918
FT                   /locus_tag="Pecwa_0421"
FT   CDS_pept        450454..450918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   eca:ECA0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86264"
FT                   /inference="protein motif:PFAM:PF04074"
FT                   /protein_id="ACX86264.1"
FT   gene            451293..451976
FT                   /locus_tag="Pecwa_0422"
FT   CDS_pept        451293..451976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0422"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: pct:PC1_0371 transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86265"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACX86265.1"
FT                   IIIRG"
FT   gene            451981..452646
FT                   /locus_tag="Pecwa_0423"
FT   CDS_pept        451981..452646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0423"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: PAS fold-4 domain protein; SMART: regulatory
FT                   protein LuxR; KEGG: pct:PC1_0372 putative PAS/PAC sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86266"
FT                   /inference="protein motif:PFAM:PF08448"
FT                   /protein_id="ACX86266.1"
FT   gene            452706..452780
FT                   /pseudo
FT                   /locus_tag="Pecwa_0424"
FT   gene            complement(452817..453824)
FT                   /locus_tag="Pecwa_0425"
FT   CDS_pept        complement(452817..453824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0425"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: eca:ECA0384 ornithine
FT                   carbamoyltransferase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86267"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACX86267.1"
FT   gene            453986..454408
FT                   /locus_tag="Pecwa_0426"
FT   CDS_pept        453986..454408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0426"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260; KEGG:
FT                   pct:PC1_0375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86268"
FT                   /inference="protein motif:PFAM:PF06877"
FT                   /protein_id="ACX86268.1"
FT   gene            complement(454559..455062)
FT                   /locus_tag="Pecwa_0427"
FT   CDS_pept        complement(454559..455062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0427"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA0386 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86269"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX86269.1"
FT                   LKVL"
FT   gene            455357..456538
FT                   /locus_tag="Pecwa_0428"
FT   CDS_pept        455357..456538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0428"
FT                   /product="protein of unknown function DUF898 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF898
FT                   transmembrane; KEGG: eca:ECA0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86270"
FT                   /inference="protein motif:PFAM:PF05987"
FT                   /protein_id="ACX86270.1"
FT   gene            456555..457592
FT                   /locus_tag="Pecwa_0429"
FT   CDS_pept        456555..457592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0429"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: pct:PC1_0378
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86271"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACX86271.1"
FT                   EMNKH"
FT   gene            457934..459013
FT                   /locus_tag="Pecwa_0430"
FT   CDS_pept        457934..459013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0430"
FT                   /product="Homoserine O-acetyltransferase"
FT                   /EC_number=""
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pct:PC1_0379
FT                   homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86272"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86272.1"
FT   gene            459227..460846
FT                   /locus_tag="Pecwa_0431"
FT   CDS_pept        459227..460846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0431"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: pct:PC1_0380 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86273"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX86273.1"
FT   gene            461098..462876
FT                   /locus_tag="Pecwa_0432"
FT   CDS_pept        461098..462876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0432"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; Hemolysin activator HlyB domain protein;
FT                   KEGG: eca:ECA0391 putative activator or transporter protein
FT                   of haemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86274"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ACX86274.1"
FT                   FETSPAVFGFSLSWRY"
FT   gene            462948..469985
FT                   /locus_tag="Pecwa_0433"
FT   CDS_pept        462948..469985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0433"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: filamentous
FT                   haemagglutinin domain protein; Haemagluttinin
FT                   repeat-containing protein; protein of unknown function
FT                   DUF638 hemagglutinin/hemolysin putative; KEGG: pct:PC1_2330
FT                   filamentous hemagglutinin family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86275"
FT                   /inference="protein motif:TFAM:TIGR01901"
FT                   /protein_id="ACX86275.1"
FT   gene            469991..470350
FT                   /locus_tag="Pecwa_0434"
FT   CDS_pept        469991..470350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86276"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86276.1"
FT                   CIVPPKSDAIYINKG"
FT   gene            complement(470401..470535)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0435"
FT   gene            470594..471961
FT                   /pseudo
FT                   /locus_tag="Pecwa_0436"
FT   gene            471965..472360
FT                   /locus_tag="Pecwa_0437"
FT   CDS_pept        471965..472360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pay:PAU_03360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86277"
FT                   /inference="similar to AA sequence:KEGG:PAU_03360"
FT                   /protein_id="ACX86277.1"
FT   gene            complement(472361..472903)
FT                   /locus_tag="Pecwa_0438"
FT   CDS_pept        complement(472361..472903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0438"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   eca:ECA0395 RNA 2'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86278"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ACX86278.1"
FT                   DNGVWLTDIVPYRFIQE"
FT   gene            complement(472963..473205)
FT                   /locus_tag="Pecwa_0439"
FT   CDS_pept        complement(472963..473205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0439"
FT                   /product="Domain of unknown function DUF1813 HSP20-like
FT                   protein"
FT                   /note="PFAM: Domain of unknown function DUF1813 HSP20-like;
FT                   KEGG: eca:ECA4289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86279"
FT                   /inference="protein motif:PFAM:PF08845"
FT                   /protein_id="ACX86279.1"
FT   gene            473441..474451
FT                   /locus_tag="Pecwa_0440"
FT   CDS_pept        473441..474451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PB0000188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86280"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PB0000188"
FT                   /protein_id="ACX86280.1"
FT   gene            474454..475074
FT                   /locus_tag="Pecwa_0441"
FT   CDS_pept        474454..475074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0441"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mlo:mlr3188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86281"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACX86281.1"
FT   gene            complement(475164..478019)
FT                   /locus_tag="Pecwa_0442"
FT   CDS_pept        complement(475164..478019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0442"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: pct:PC1_0386
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86282"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ACX86282.1"
FT   gene            complement(478032..478481)
FT                   /locus_tag="Pecwa_0443"
FT   CDS_pept        complement(478032..478481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0443"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number=""
FT                   /note="PFAM: DNA polymerase III chi subunit HolC; KEGG:
FT                   pct:PC1_0387 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86283"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86283.1"
FT   gene            complement(478586..480097)
FT                   /locus_tag="Pecwa_0444"
FT   CDS_pept        complement(478586..480097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0444"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number=""
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: pct:PC1_0388 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86284"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86284.1"
FT   gene            480379..481491
FT                   /locus_tag="Pecwa_0445"
FT   CDS_pept        480379..481491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0445"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   pct:PC1_0389 permease YjgP/YjgQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86285"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ACX86285.1"
FT   gene            481491..482567
FT                   /locus_tag="Pecwa_0446"
FT   CDS_pept        481491..482567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0446"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   pct:PC1_0390 permease YjgP/YjgQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86286"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ACX86286.1"
FT                   LPSSVFLFISVALLLKRR"
FT   gene            482784..482868
FT                   /locus_tag="Pecwa_R0014"
FT                   /note="tRNA-Leu1"
FT   tRNA            482784..482868
FT                   /locus_tag="Pecwa_R0014"
FT                   /product="tRNA-Leu"
FT   gene            483089..484348
FT                   /locus_tag="Pecwa_0447"
FT   CDS_pept        483089..484348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0447"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   dze:Dd1591_3702 integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86287"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACX86287.1"
FT   gene            484399..484689
FT                   /locus_tag="Pecwa_0448"
FT   CDS_pept        484399..484689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86288"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86288.1"
FT   gene            484740..485012
FT                   /locus_tag="Pecwa_0449"
FT   CDS_pept        484740..485012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0449"
FT                   /product="Insertion element protein"
FT                   /note="PFAM: Insertion element protein; KEGG: sdy:SDY_P213
FT                   iso-IS1 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86289"
FT                   /inference="protein motif:PFAM:PF03811"
FT                   /protein_id="ACX86289.1"
FT   gene            484997..485434
FT                   /pseudo
FT                   /locus_tag="Pecwa_0450"
FT   gene            complement(485409..486989)
FT                   /locus_tag="Pecwa_0451"
FT   CDS_pept        complement(485409..486989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0451"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   smt:Smal_1674 protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86290"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ACX86290.1"
FT                   PISRTCIFQ"
FT   gene            complement(486979..488157)
FT                   /locus_tag="Pecwa_0452"
FT   CDS_pept        complement(486979..488157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smt:Smal_1675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86291"
FT                   /inference="similar to AA sequence:KEGG:Smal_1675"
FT                   /protein_id="ACX86291.1"
FT   gene            488565..489835
FT                   /pseudo
FT                   /locus_tag="Pecwa_0453"
FT   gene            complement(489899..490888)
FT                   /locus_tag="Pecwa_0454"
FT   CDS_pept        complement(489899..490888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0454"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   sek:SSPA3985 DNA methyltransferase SptAIM; protects DNA
FT                   against PvuII endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86292"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ACX86292.1"
FT   gene            490944..491180
FT                   /locus_tag="Pecwa_0455"
FT   CDS_pept        490944..491180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0455"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: sek:SSPA3986 subunit
FT                   S of type I restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86293"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX86293.1"
FT   gene            491177..491740
FT                   /locus_tag="Pecwa_0456"
FT   CDS_pept        491177..491740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0456"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number=""
FT                   /note="KEGG: sek:SSPA3987 subunit R of type I
FT                   restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86294"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86294.1"
FT   gene            492175..493226
FT                   /pseudo
FT                   /locus_tag="Pecwa_0457"
FT   gene            493458..493589
FT                   /locus_tag="Pecwa_0458"
FT   CDS_pept        493458..493589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86295"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86295.1"
FT   gene            493746..494207
FT                   /locus_tag="Pecwa_0459"
FT   CDS_pept        493746..494207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypy:YPK_3136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86296"
FT                   /inference="similar to AA sequence:KEGG:YPK_3136"
FT                   /protein_id="ACX86296.1"
FT   gene            494266..494793
FT                   /locus_tag="Pecwa_0460"
FT   CDS_pept        494266..494793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86297"
FT                   /inference="similar to AA sequence:KEGG:Sbal_0630"
FT                   /protein_id="ACX86297.1"
FT                   GDQPKQTPPTQQ"
FT   gene            complement(495042..495275)
FT                   /locus_tag="Pecwa_0461"
FT   CDS_pept        complement(495042..495275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86298"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86298.1"
FT   gene            complement(495739..496221)
FT                   /locus_tag="Pecwa_0462"
FT   CDS_pept        complement(495739..496221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ent:Ent638_4231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86299"
FT                   /inference="similar to AA sequence:KEGG:Ent638_4231"
FT                   /protein_id="ACX86299.1"
FT   gene            complement(496232..496936)
FT                   /locus_tag="Pecwa_0463"
FT   CDS_pept        complement(496232..496936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ent:Ent638_4232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86300"
FT                   /inference="similar to AA sequence:KEGG:Ent638_4232"
FT                   /protein_id="ACX86300.1"
FT                   SLYNQRTALKVS"
FT   gene            complement(496961..498496)
FT                   /locus_tag="Pecwa_0464"
FT   CDS_pept        complement(496961..498496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0464"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   ent:Ent638_4233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86301"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACX86301.1"
FT   gene            complement(498486..499718)
FT                   /locus_tag="Pecwa_0465"
FT   CDS_pept        complement(498486..499718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0465"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ent:Ent638_4234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86302"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACX86302.1"
FT                   KIEPAESLREI"
FT   gene            complement(499699..500367)
FT                   /locus_tag="Pecwa_0466"
FT   CDS_pept        complement(499699..500367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0466"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ent:Ent638_4235 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86303"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86303.1"
FT                   "
FT   gene            complement(500385..502364)
FT                   /locus_tag="Pecwa_0467"
FT   CDS_pept        complement(500385..502364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0467"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   ent:Ent638_4236 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86304"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACX86304.1"
FT   gene            complement(502374..503354)
FT                   /locus_tag="Pecwa_0468"
FT   CDS_pept        complement(502374..503354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ent:Ent638_4237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86305"
FT                   /inference="similar to AA sequence:KEGG:Ent638_4237"
FT                   /protein_id="ACX86305.1"
FT   gene            complement(503361..506027)
FT                   /locus_tag="Pecwa_0469"
FT   CDS_pept        complement(503361..506027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0469"
FT                   /product="Virulence effector, SrfC"
FT                   /note="PFAM: Virulence effector, SrfC; KEGG:
FT                   ent:Ent638_4238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86306"
FT                   /inference="protein motif:PFAM:PF10139"
FT                   /protein_id="ACX86306.1"
FT                   QNEKLGAIIHRIKTAQE"
FT   gene            complement(506027..509029)
FT                   /locus_tag="Pecwa_0470"
FT   CDS_pept        complement(506027..509029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0470"
FT                   /product="virulence protein SrfB"
FT                   /note="PFAM: virulence protein SrfB; KEGG: ent:Ent638_4239
FT                   virulence protein SrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86307"
FT                   /inference="protein motif:PFAM:PF07520"
FT                   /protein_id="ACX86307.1"
FT                   HYWLDSGSVKS"
FT   gene            complement(509030..510394)
FT                   /locus_tag="Pecwa_0471"
FT   CDS_pept        complement(509030..510394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ent:Ent638_4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86308"
FT                   /inference="similar to AA sequence:KEGG:Ent638_4240"
FT                   /protein_id="ACX86308.1"
FT   gene            complement(510760..511971)
FT                   /locus_tag="Pecwa_0472"
FT   CDS_pept        complement(510760..511971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0472"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: ent:Ent638_4241 von
FT                   Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86309"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACX86309.1"
FT                   EGCQ"
FT   gene            512384..513505
FT                   /locus_tag="Pecwa_0473"
FT   CDS_pept        512384..513505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0473"
FT                   /product="Cupin 4 family protein"
FT                   /note="PFAM: Cupin 4 family protein; SMART: transcription
FT                   factor jumonji jmjC domain protein; KEGG: pct:PC1_0392
FT                   cupin 4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86310"
FT                   /inference="protein motif:PFAM:PF08007"
FT                   /protein_id="ACX86310.1"
FT   gene            513802..514932
FT                   /locus_tag="Pecwa_0474"
FT   CDS_pept        513802..514932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0474"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: eca:ECA0421 putative
FT                   exported lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86311"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ACX86311.1"
FT   gene            complement(514996..516174)
FT                   /locus_tag="Pecwa_0475"
FT   CDS_pept        complement(514996..516174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0475"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: pct:PC1_0394
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86312"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACX86312.1"
FT   gene            complement(516168..517286)
FT                   /locus_tag="Pecwa_0476"
FT   CDS_pept        complement(516168..517286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86313"
FT                   /inference="similar to AA sequence:KEGG:ECA0423"
FT                   /protein_id="ACX86313.1"
FT   gene            complement(517286..518284)
FT                   /locus_tag="Pecwa_0477"
FT   CDS_pept        complement(517286..518284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86314"
FT                   /inference="similar to AA sequence:KEGG:ECA0424"
FT                   /protein_id="ACX86314.1"
FT   gene            complement(518281..519696)
FT                   /locus_tag="Pecwa_0478"
FT   CDS_pept        complement(518281..519696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0478"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pct:PC1_0397 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86315"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACX86315.1"
FT                   SDYQTQYAIQVMP"
FT   gene            complement(520262..522052)
FT                   /locus_tag="Pecwa_0479"
FT   CDS_pept        complement(520262..522052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0479"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cko:CKO_00841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86316"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86316.1"
FT   gene            complement(522326..523765)
FT                   /locus_tag="Pecwa_0480"
FT   CDS_pept        complement(522326..523765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0480"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; Fumarase C-like; KEGG: pct:PC1_0398 aspartate
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86317"
FT                   /inference="protein motif:TFAM:TIGR00839"
FT                   /protein_id="ACX86317.1"
FT   gene            complement(524017..525012)
FT                   /locus_tag="Pecwa_0481"
FT   CDS_pept        complement(524017..525012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0481"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pct:PC1_0399 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86318"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACX86318.1"
FT   gene            complement(525737..526072)
FT                   /locus_tag="Pecwa_0482"
FT   CDS_pept        complement(525737..526072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86319"
FT                   /inference="similar to AA sequence:KEGG:PC1_0400"
FT                   /protein_id="ACX86319.1"
FT                   DVPLTTQ"
FT   gene            complement(526654..526971)
FT                   /locus_tag="Pecwa_0483"
FT   CDS_pept        complement(526654..526971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0483"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: pen:PSEEN5219 Cro/CI
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86320"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX86320.1"
FT                   G"
FT   gene            complement(527073..527417)
FT                   /locus_tag="Pecwa_0484"
FT   CDS_pept        complement(527073..527417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86321"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86321.1"
FT                   KMLYRYHVLS"
FT   gene            complement(527432..527701)
FT                   /locus_tag="Pecwa_0485"
FT   CDS_pept        complement(527432..527701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86322"
FT                   /inference="similar to AA sequence:KEGG:YE0485"
FT                   /protein_id="ACX86322.1"
FT   gene            complement(527862..529439)
FT                   /locus_tag="Pecwa_0486"
FT   CDS_pept        complement(527862..529439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0486"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: regulator of RNA terminal phosphate cyclase;
FT                   sigma-54 factor interaction domain-containing protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: pct:PC1_0403 sigma 54 interacting
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86323"
FT                   /inference="protein motif:PFAM:PF06956"
FT                   /protein_id="ACX86323.1"
FT                   SWEGLKRV"
FT   gene            529631..530866
FT                   /locus_tag="Pecwa_0487"
FT   CDS_pept        529631..530866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0487"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   pct:PC1_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86324"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACX86324.1"
FT                   VHTLRQVVCVKG"
FT   gene            530871..531662
FT                   /locus_tag="Pecwa_0488"
FT   CDS_pept        530871..531662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0488"
FT                   /product="Nucleotidyltransferase, predicted"
FT                   /note="PFAM: Nucleotidyltransferase, predicted; KEGG:
FT                   pct:PC1_0405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86325"
FT                   /inference="protein motif:PFAM:PF10127"
FT                   /protein_id="ACX86325.1"
FT   gene            531708..533309
FT                   /locus_tag="Pecwa_0489"
FT   CDS_pept        531708..533309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypg:YpAngola_A1898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86326"
FT                   /inference="similar to AA sequence:KEGG:YpAngola_A1898"
FT                   /protein_id="ACX86326.1"
FT                   RERLSAIASAFEAMKG"
FT   gene            complement(533332..534114)
FT                   /locus_tag="Pecwa_0490"
FT   CDS_pept        complement(533332..534114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86327"
FT                   /inference="similar to AA sequence:KEGG:ECA0432"
FT                   /protein_id="ACX86327.1"
FT   gene            534267..535364
FT                   /locus_tag="Pecwa_0491"
FT   CDS_pept        534267..535364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0491"
FT                   /product="protein of unknown function DUF1615"
FT                   /note="PFAM: protein of unknown function DUF1615; KEGG:
FT                   eca:ECA0433 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86328"
FT                   /inference="protein motif:PFAM:PF07759"
FT                   /protein_id="ACX86328.1"
FT   gene            complement(535460..537409)
FT                   /locus_tag="Pecwa_0492"
FT   CDS_pept        complement(535460..537409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0492"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: Nitrate and nitrite sensing domain protein;
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   eca:ECA0434 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86329"
FT                   /inference="protein motif:PFAM:PF08376"
FT                   /protein_id="ACX86329.1"
FT                   SAPLQPLPHALLSR"
FT   gene            complement(537760..540471)
FT                   /locus_tag="Pecwa_0493"
FT   CDS_pept        complement(537760..540471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0493"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /note="TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; cation
FT                   transporting ATPase domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: eca:ECA0435 magnesium
FT                   transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86330"
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /protein_id="ACX86330.1"
FT   gene            540549..540695
FT                   /locus_tag="Pecwa_0494"
FT   CDS_pept        540549..540695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86331"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86331.1"
FT                   VAK"
FT   gene            complement(540937..542514)
FT                   /locus_tag="Pecwa_0495"
FT   CDS_pept        complement(540937..542514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0495"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: pct:PC1_0416
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86332"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX86332.1"
FT                   QDHMLRIH"
FT   gene            complement(542943..543257)
FT                   /locus_tag="Pecwa_0496"
FT   CDS_pept        complement(542943..543257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0496"
FT                   /product="L-rhamnose 1-epimerase"
FT                   /note="TIGRFAM: L-rhamnose 1-epimerase; PFAM: protein of
FT                   unknown function DUF718; KEGG: eca:ECA0437 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86333"
FT                   /inference="protein motif:TFAM:TIGR02625"
FT                   /protein_id="ACX86333.1"
FT                   "
FT   gene            complement(543342..544166)
FT                   /locus_tag="Pecwa_0497"
FT   CDS_pept        complement(543342..544166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0497"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0418 rhamnulose-1-phosphate aldolase;
FT                   TIGRFAM: rhamnulose-1-phosphate aldolase; PFAM: class II
FT                   aldolase/adducin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86334"
FT                   /inference="protein motif:TFAM:TIGR02624"
FT                   /protein_id="ACX86334.1"
FT   gene            complement(544171..545433)
FT                   /locus_tag="Pecwa_0498"
FT   CDS_pept        complement(544171..545433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0498"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0419 L-rhamnose isomerase; TIGRFAM:
FT                   L-rhamnose isomerase; PFAM: L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86335"
FT                   /inference="protein motif:TFAM:TIGR01748"
FT                   /protein_id="ACX86335.1"
FT   gene            complement(545430..546920)
FT                   /locus_tag="Pecwa_0499"
FT   CDS_pept        complement(545430..546920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0499"
FT                   /product="rhamnulokinase"
FT                   /note="TIGRFAM: rhamnulokinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; KEGG: eca:ECA0440 rhamnulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86336"
FT                   /inference="protein motif:TFAM:TIGR02627"
FT                   /protein_id="ACX86336.1"
FT   gene            547289..548128
FT                   /locus_tag="Pecwa_0500"
FT   CDS_pept        547289..548128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0500"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; KEGG: eca:ECA0441
FT                   transcriptional activator RhaS"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86337"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACX86337.1"
FT   gene            548153..549007
FT                   /locus_tag="Pecwa_0501"
FT   CDS_pept        548153..549007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0501"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   Cupin 2 conserved barrel domain protein; SMART:
FT                   Helix-turn-helix, AraC domain; KEGG: eca:ECA0442 L-rhamnose
FT                   operon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86338"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACX86338.1"
FT                   DAE"
FT   gene            549069..549359
FT                   /locus_tag="Pecwa_0502"
FT   CDS_pept        549069..549359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0502"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: pct:PC1_0423 transcriptional regulator, CopG
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86339"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACX86339.1"
FT   gene            549347..549652
FT                   /locus_tag="Pecwa_0503"
FT   CDS_pept        549347..549652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0503"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   pct:PC1_0424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86340"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACX86340.1"
FT   gene            complement(549712..551400)
FT                   /locus_tag="Pecwa_0504"
FT   CDS_pept        complement(549712..551400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0504"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: pct:PC1_0425 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86341"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX86341.1"
FT   gene            complement(551397..552263)
FT                   /locus_tag="Pecwa_0505"
FT   CDS_pept        complement(551397..552263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0505"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0426
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86342"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX86342.1"
FT                   LAKGEAR"
FT   gene            complement(552256..553215)
FT                   /locus_tag="Pecwa_0506"
FT   CDS_pept        complement(552256..553215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0506"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0427
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86343"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX86343.1"
FT   gene            complement(553193..554806)
FT                   /locus_tag="Pecwa_0507"
FT   CDS_pept        complement(553193..554806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0507"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA0448 putative ABC transporter extracellular
FT                   solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86344"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACX86344.1"
FT   gene            555341..555955
FT                   /locus_tag="Pecwa_0508"
FT   CDS_pept        555341..555955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0508"
FT                   /product="protein of unknown function DUF1440"
FT                   /note="PFAM: protein of unknown function DUF1440; KEGG:
FT                   pct:PC1_0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86345"
FT                   /inference="protein motif:PFAM:PF07274"
FT                   /protein_id="ACX86345.1"
FT   gene            complement(556255..556719)
FT                   /locus_tag="Pecwa_0509"
FT   CDS_pept        complement(556255..556719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86346"
FT                   /inference="similar to AA sequence:KEGG:PSEEN0545"
FT                   /protein_id="ACX86346.1"
FT   gene            complement(556990..557217)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0510"
FT   gene            complement(557251..558285)
FT                   /locus_tag="Pecwa_0511"
FT   CDS_pept        complement(557251..558285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0511"
FT                   /product="L-rhamnose-proton symporter, RhaT family, DMT
FT                   superfamily"
FT                   /note="TIGRFAM: L-rhamnose-proton symporter, RhaT family,
FT                   DMT superfamily; PFAM: RhaT l-rhamnose-proton symport 2;
FT                   KEGG: eca:ECA0450 rhamnose-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86347"
FT                   /inference="protein motif:TFAM:TIGR00776"
FT                   /protein_id="ACX86347.1"
FT                   GMAV"
FT   gene            558738..559244
FT                   /locus_tag="Pecwa_0512"
FT   CDS_pept        558738..559244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pct:PC1_0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86348"
FT                   /inference="protein motif:PFAM:PF03350"
FT                   /protein_id="ACX86348.1"
FT                   KSKTA"
FT   gene            559339..560376
FT                   /locus_tag="Pecwa_0513"
FT   CDS_pept        559339..560376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0513"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: pct:PC1_0432 alcohol dehydrogenase
FT                   zinc-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86349"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACX86349.1"
FT                   VGPDA"
FT   gene            560464..560610
FT                   /locus_tag="Pecwa_0514"
FT   CDS_pept        560464..560610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0514"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: pct:PC1_0433 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86350"
FT                   /inference="similar to AA sequence:KEGG:PC1_0433"
FT                   /protein_id="ACX86350.1"
FT                   LGF"
FT   gene            complement(560772..561146)
FT                   /locus_tag="Pecwa_0515"
FT   CDS_pept        complement(560772..561146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efe:EFER_1461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86351"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86351.1"
FT   gene            complement(561253..561333)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0516"
FT   gene            complement(561454..561942)
FT                   /locus_tag="Pecwa_0517"
FT   CDS_pept        complement(561454..561942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86352"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86352.1"
FT   gene            complement(562429..562713)
FT                   /locus_tag="Pecwa_0518"
FT   CDS_pept        complement(562429..562713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86353"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86353.1"
FT   gene            complement(563077..563270)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0519"
FT   gene            complement(563350..564375)
FT                   /locus_tag="Pecwa_0520"
FT   CDS_pept        complement(563350..564375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86354"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86354.1"
FT                   I"
FT   gene            complement(564345..565037)
FT                   /locus_tag="Pecwa_0521"
FT   CDS_pept        complement(564345..565037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0521"
FT                   /product="Rhs family protein-like protein"
FT                   /note="KEGG: eta:ETA_30000 putative membrane-bound
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86355"
FT                   /inference="protein motif:COG:COG3209"
FT                   /protein_id="ACX86355.1"
FT                   KSCGKKIT"
FT   gene            565075..565158
FT                   /pseudo
FT                   /locus_tag="Pecwa_0522"
FT   gene            complement(565242..565526)
FT                   /locus_tag="Pecwa_0523"
FT   CDS_pept        complement(565242..565526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86356"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86356.1"
FT   gene            complement(565884..566240)
FT                   /locus_tag="Pecwa_0524"
FT   CDS_pept        complement(565884..566240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0524"
FT                   /product="RHS protein"
FT                   /note="PFAM: RHS protein; KEGG: ypy:YPK_0403 YD
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86357"
FT                   /inference="protein motif:PFAM:PF03527"
FT                   /protein_id="ACX86357.1"
FT                   NGQAQDLIGLAGGD"
FT   gene            complement(566339..566992)
FT                   /locus_tag="Pecwa_0525"
FT   CDS_pept        complement(566339..566992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86358"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86358.1"
FT   gene            complement(566992..567771)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0526"
FT   gene            complement(567941..568429)
FT                   /locus_tag="Pecwa_0527"
FT   CDS_pept        complement(567941..568429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86359"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86359.1"
FT   gene            complement(568607..568951)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0528"
FT   gene            complement(569000..569422)
FT                   /locus_tag="Pecwa_0529"
FT   CDS_pept        complement(569000..569422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86360"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86360.1"
FT   gene            complement(569422..569874)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0530"
FT   gene            complement(569855..570379)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0531"
FT   gene            complement(570426..570692)
FT                   /locus_tag="Pecwa_0532"
FT   CDS_pept        complement(570426..570692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0532"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   pct:PC1_2184 PaaR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86361"
FT                   /inference="protein motif:PFAM:PF05488"
FT                   /protein_id="ACX86361.1"
FT   gene            complement(570784..571158)
FT                   /locus_tag="Pecwa_0533"
FT   CDS_pept        complement(570784..571158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0533"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   pct:PC1_0054 type VI secretion system effector, Hcp1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86362"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACX86362.1"
FT   gene            complement(571346..571648)
FT                   /locus_tag="Pecwa_0534"
FT   CDS_pept        complement(571346..571648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86363"
FT                   /inference="similar to AA sequence:KEGG:PC1_0438"
FT                   /protein_id="ACX86363.1"
FT   gene            complement(571662..572027)
FT                   /locus_tag="Pecwa_0535"
FT   CDS_pept        complement(571662..572027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86364"
FT                   /inference="similar to AA sequence:KEGG:PC1_0438"
FT                   /protein_id="ACX86364.1"
FT                   YHSYRFYTRISLCPIAY"
FT   gene            complement(572024..572458)
FT                   /locus_tag="Pecwa_0536"
FT   CDS_pept        complement(572024..572458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmr:PMI2877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86365"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86365.1"
FT   gene            complement(572623..572922)
FT                   /locus_tag="Pecwa_0537"
FT   CDS_pept        complement(572623..572922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86366"
FT                   /inference="similar to AA sequence:KEGG:ECA0454"
FT                   /protein_id="ACX86366.1"
FT   gene            complement(572941..573374)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0538"
FT   gene            complement(573661..574872)
FT                   /locus_tag="Pecwa_0539"
FT   CDS_pept        complement(573661..574872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0539"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase
FT                   FAD-binding; KEGG: eca:ECA0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86367"
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /protein_id="ACX86367.1"
FT                   SAGK"
FT   gene            complement(574902..576080)
FT                   /locus_tag="Pecwa_0540"
FT   CDS_pept        complement(574902..576080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0540"
FT                   /product="2-polyprenyl-6-methoxyphenol 4-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenyl-6-methoxyphenol 4-hydroxylase;
FT                   Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6
FT                   family; PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: eca:ECA0458
FT                   2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86368"
FT                   /inference="protein motif:TFAM:TIGR01984"
FT                   /protein_id="ACX86368.1"
FT   gene            complement(576106..577431)
FT                   /locus_tag="Pecwa_0541"
FT   CDS_pept        complement(576106..577431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0541"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   pct:PC1_0444 peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86369"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACX86369.1"
FT   gene            complement(577493..578080)
FT                   /locus_tag="Pecwa_0542"
FT   CDS_pept        complement(577493..578080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0542"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: protein of
FT                   unknown function UPF0149; KEGG: eca:ECA0460 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86370"
FT                   /inference="protein motif:TFAM:TIGR02292"
FT                   /protein_id="ACX86370.1"
FT   gene            578273..578602
FT                   /locus_tag="Pecwa_0543"
FT   CDS_pept        578273..578602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0543"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   eca:ECA0461 Z-ring-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86371"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ACX86371.1"
FT                   GTQFE"
FT   gene            578677..578861
FT                   /locus_tag="Pecwa_R0015"
FT   ncRNA           578677..578861
FT                   /locus_tag="Pecwa_R0015"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score1
FT                   20.34"
FT                   /ncRNA_class="other"
FT   gene            578901..579542
FT                   /locus_tag="Pecwa_0544"
FT   CDS_pept        578901..579542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0544"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   pct:PC1_0447 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86372"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACX86372.1"
FT   gene            complement(579539..580792)
FT                   /locus_tag="Pecwa_0545"
FT   CDS_pept        complement(579539..580792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0545"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: eca:ECA0463 nicotinamide-nucleotide
FT                   adenylyltransferase; TIGRFAM: nicotinamide-nucleotide
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86373"
FT                   /inference="protein motif:TFAM:TIGR01526"
FT                   /protein_id="ACX86373.1"
FT                   ELVQQMLGHDRSPEQIKS"
FT   gene            complement(580924..582306)
FT                   /locus_tag="Pecwa_0546"
FT   CDS_pept        complement(580924..582306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0546"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: pct:PC1_0449 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86374"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACX86374.1"
FT                   DL"
FT   gene            complement(582324..583301)
FT                   /locus_tag="Pecwa_0547"
FT   CDS_pept        complement(582324..583301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0547"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0465 phosphoserine phosphatase;
FT                   TIGRFAM: phosphoserine phosphatase SerB; HAD-superfamily
FT                   hydrolase, subfamily IB (PSPase-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86375"
FT                   /inference="protein motif:TFAM:TIGR00338"
FT                   /protein_id="ACX86375.1"
FT   gene            583458..584156
FT                   /locus_tag="Pecwa_0548"
FT   CDS_pept        583458..584156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0548"
FT                   /product="Virulence factor, hemolysin regulator"
FT                   /note="PFAM: Virulence factor, haemolysin regulator; KEGG:
FT                   eca:ECA0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86376"
FT                   /inference="protein motif:PFAM:PF10144"
FT                   /protein_id="ACX86376.1"
FT                   VKKDGEEKSL"
FT   gene            584362..584673
FT                   /locus_tag="Pecwa_0549"
FT   CDS_pept        584362..584673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0549"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: amc:MADE_04053
FT                   transcriptional regulator, XRE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86377"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX86377.1"
FT   gene            584666..585880
FT                   /locus_tag="Pecwa_0550"
FT   CDS_pept        584666..585880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0550"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="TIGRFAM: HipA N-terminal domain protein; PFAM: HipA
FT                   domain protein; KEGG: amc:MADE_04052 HipA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86378"
FT                   /inference="protein motif:TFAM:TIGR03071"
FT                   /protein_id="ACX86378.1"
FT                   DIPLR"
FT   gene            586161..587750
FT                   /locus_tag="Pecwa_0551"
FT   CDS_pept        586161..587750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0551"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   pct:PC1_0453 peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86379"
FT                   /inference="protein motif:TFAM:TIGR00503"
FT                   /protein_id="ACX86379.1"
FT                   YPEVTFHQTREH"
FT   gene            588274..588882
FT                   /locus_tag="Pecwa_0552"
FT   CDS_pept        588274..588882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0552"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   pct:PC1_0454 transport-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86380"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACX86380.1"
FT   gene            589034..589195
FT                   /locus_tag="Pecwa_0553"
FT   CDS_pept        589034..589195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0553"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   eca:ECA0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86381"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ACX86381.1"
FT                   LFTGRKRP"
FT   gene            589323..589511
FT                   /locus_tag="Pecwa_0554"
FT   CDS_pept        589323..589511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86382"
FT                   /inference="similar to AA sequence:KEGG:PC1_0456"
FT                   /protein_id="ACX86382.1"
FT                   GYGKAHEEVSSEKTTLH"
FT   gene            589611..590408
FT                   /locus_tag="Pecwa_0555"
FT   CDS_pept        589611..590408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0555"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; amidohydrolase
FT                   2; KEGG: eca:ECA0472 TatD family deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86383"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ACX86383.1"
FT   gene            590825..592102
FT                   /locus_tag="Pecwa_0556"
FT   CDS_pept        590825..592102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0556"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na+ dependent
FT                   nucleoside transporter domain protein; nucleoside
FT                   recognition domain protein; Na+ dependent nucleoside
FT                   transporter; KEGG: pct:PC1_0458 nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86384"
FT                   /inference="protein motif:TFAM:TIGR00804"
FT                   /protein_id="ACX86384.1"
FT   gene            592251..592967
FT                   /locus_tag="Pecwa_0557"
FT   CDS_pept        592251..592967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0557"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   eca:ECA0474 enterobactin synthetase component D
FT                   (4'-phosphopantetheinyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86385"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACX86385.1"
FT                   GAYLLREYDVTTFLCC"
FT   gene            complement(593017..594990)
FT                   /locus_tag="Pecwa_0558"
FT   CDS_pept        complement(593017..594990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0558"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: pct:PC1_0460 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86386"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACX86386.1"
FT   gene            complement(595107..595544)
FT                   /locus_tag="Pecwa_0559"
FT   CDS_pept        complement(595107..595544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0559"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: pct:PC1_0461 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86387"
FT                   /inference="similar to AA sequence:KEGG:PC1_0461"
FT                   /protein_id="ACX86387.1"
FT   gene            595876..597072
FT                   /locus_tag="Pecwa_0560"
FT   CDS_pept        595876..597072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0560"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: eca:ECA0477 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86388"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ACX86388.1"
FT   gene            597069..598697
FT                   /locus_tag="Pecwa_0561"
FT   CDS_pept        597069..598697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0561"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /note="TIGRFAM: 2,3-dihydroxybenzoate-AMP ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: pct:PC1_0463
FT                   2,3-dihydroxybenzoate-AMP ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86389"
FT                   /inference="protein motif:TFAM:TIGR02275"
FT                   /protein_id="ACX86389.1"
FT   variation       597272
FT                   /locus_tag="Pecwa_0561"
FT                   /replace=""
FT                   /note="SNP"
FT   gene            598724..598831
FT                   /locus_tag="Pecwa_0562"
FT   CDS_pept        598724..598831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86390"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86390.1"
FT   gene            598840..599622
FT                   /locus_tag="Pecwa_0563"
FT   CDS_pept        598840..599622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0563"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: eca:ECA0481
FT                   2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86391"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX86391.1"
FT   gene            complement(599703..601211)
FT                   /locus_tag="Pecwa_0564"
FT   CDS_pept        complement(599703..601211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0564"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pct:PC1_0469 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86392"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACX86392.1"
FT   gene            complement(601314..609776)
FT                   /locus_tag="Pecwa_0565"
FT   CDS_pept        complement(601314..609776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0565"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; SMART: Dystroglycan-type
FT                   cadherin domain protein; Cadherin; KEGG: pct:PC1_0470 Ig
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86393"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACX86393.1"
FT                   QG"
FT   gene            complement(610133..610945)
FT                   /locus_tag="Pecwa_0566"
FT   CDS_pept        complement(610133..610945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0566"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG: pct:PC1_0471
FT                   tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86394"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACX86394.1"
FT   gene            complement(611219..613324)
FT                   /locus_tag="Pecwa_0567"
FT   CDS_pept        complement(611219..613324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0567"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: pct:PC1_0472 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86395"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACX86395.1"
FT                   GIRESGF"
FT   gene            complement(613321..614649)
FT                   /locus_tag="Pecwa_0568"
FT   CDS_pept        complement(613321..614649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86396"
FT                   /inference="similar to AA sequence:KEGG:PC1_0473"
FT                   /protein_id="ACX86396.1"
FT   gene            complement(614646..615449)
FT                   /locus_tag="Pecwa_0569"
FT   CDS_pept        complement(614646..615449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0569"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   pct:PC1_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86397"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACX86397.1"
FT   gene            complement(615733..617814)
FT                   /locus_tag="Pecwa_0570"
FT   CDS_pept        complement(615733..617814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86398"
FT                   /inference="similar to AA sequence:KEGG:ECA0485"
FT                   /protein_id="ACX86398.1"
FT   gene            617906..618004
FT                   /locus_tag="Pecwa_0571"
FT   CDS_pept        617906..618004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86399"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86399.1"
FT                   /translation="MLYLLDNDYRYTNKLVCGHRFLHKCKPLFNMV"
FT   gene            618519..619451
FT                   /locus_tag="Pecwa_0572"
FT   CDS_pept        618519..619451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0572"
FT                   /product="phosphoenolpyruvate phosphomutase"
FT                   /note="TIGRFAM: phosphoenolpyruvate phosphomutase; KEGG:
FT                   eca:ECA0487 phosphoenolpyruvate phosphomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86400"
FT                   /inference="protein motif:TFAM:TIGR02320"
FT                   /protein_id="ACX86400.1"
FT   gene            619642..620796
FT                   /locus_tag="Pecwa_0573"
FT   CDS_pept        619642..620796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0573"
FT                   /product="phosphonopyruvate decarboxylase"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   KEGG: eca:ECA0488 phosphonopyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86401"
FT                   /inference="protein motif:TFAM:TIGR03297"
FT                   /protein_id="ACX86401.1"
FT   gene            620829..621722
FT                   /locus_tag="Pecwa_0574"
FT   CDS_pept        620829..621722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0574"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: eca:ECA0489 putative 2-hydroxy-3-oxopropionate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86402"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACX86402.1"
FT                   TACFSYLSRTLLTGRD"
FT   gene            621723..622166
FT                   /locus_tag="Pecwa_0575"
FT   CDS_pept        621723..622166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0575"
FT                   /product="phosphonate C-P lyase system protein PhnG"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnG;
FT                   PFAM: phosphonate metabolism PhnG; KEGG: eca:ECA0490
FT                   putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86403"
FT                   /inference="protein motif:TFAM:TIGR03293"
FT                   /protein_id="ACX86403.1"
FT   gene            622173..622754
FT                   /locus_tag="Pecwa_0576"
FT   CDS_pept        622173..622754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0576"
FT                   /product="phosphonate C-P lyase system protein PhnH"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnH;
FT                   PFAM: phosphonate metabolism; KEGG: eca:ECA0491
FT                   carbon-phosphorus lyase complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86404"
FT                   /inference="protein motif:TFAM:TIGR03292"
FT                   /protein_id="ACX86404.1"
FT   gene            622754..623857
FT                   /locus_tag="Pecwa_0577"
FT   CDS_pept        622754..623857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0577"
FT                   /product="phosphonate metabolism"
FT                   /note="PFAM: phosphonate metabolism; KEGG: eca:ECA0492
FT                   putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86405"
FT                   /inference="protein motif:PFAM:PF05861"
FT                   /protein_id="ACX86405.1"
FT   gene            623857..624762
FT                   /locus_tag="Pecwa_0578"
FT   CDS_pept        623857..624762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0578"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /note="PFAM: phosphonate metabolism PhnJ; KEGG:
FT                   pct:PC1_0482 phosphonate metabolism PhnJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86406"
FT                   /inference="protein motif:PFAM:PF06007"
FT                   /protein_id="ACX86406.1"
FT   gene            624759..625547
FT                   /locus_tag="Pecwa_0579"
FT   CDS_pept        624759..625547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0579"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /note="KEGG: eca:ECA0494 phosphonate C-P lyase system
FT                   protein PhnK; TIGRFAM: phosphonate C-P lyase system protein
FT                   PhnK; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86407"
FT                   /inference="protein motif:TFAM:TIGR02323"
FT                   /protein_id="ACX86407.1"
FT   gene            625569..626285
FT                   /locus_tag="Pecwa_0580"
FT   CDS_pept        625569..626285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0580"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /note="KEGG: eca:ECA0495 putative phosphonate ABC
FT                   transporter ATP-binding protein; TIGRFAM: phosphonate C-P
FT                   lyase system protein PhnL; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86408"
FT                   /inference="protein motif:TFAM:TIGR02324"
FT                   /protein_id="ACX86408.1"
FT                   YSMTMTSRTQENVNDH"
FT   gene            626275..627411
FT                   /locus_tag="Pecwa_0581"
FT   CDS_pept        626275..627411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0581"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /note="TIGRFAM: phosphonate metabolism protein PhnM; PFAM:
FT                   Amidohydrolase 3; amidohydrolase; KEGG: eca:ECA0496
FT                   putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86409"
FT                   /inference="protein motif:TFAM:TIGR02318"
FT                   /protein_id="ACX86409.1"
FT   gene            627414..627980
FT                   /locus_tag="Pecwa_0582"
FT   CDS_pept        627414..627980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0582"
FT                   /product="phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN"
FT                   /note="TIGRFAM: phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN; SMART:
FT                   guanylate kinase/L-type calcium channel region; KEGG:
FT                   eca:ECA0497 ribose 1,5-bisphosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86410"
FT                   /db_xref="GOA:D0KG93"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0KG93"
FT                   /inference="protein motif:TFAM:TIGR02322"
FT                   /protein_id="ACX86410.1"
FT   gene            628007..628780
FT                   /locus_tag="Pecwa_0583"
FT   CDS_pept        628007..628780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0583"
FT                   /product="phosphonate metabolism protein PhnP"
FT                   /note="TIGRFAM: phosphonate metabolism protein PhnP; PFAM:
FT                   beta-lactamase domain protein; KEGG: pct:PC1_0487
FT                   phosphonate metabolism protein PhnP"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86411"
FT                   /inference="protein motif:TFAM:TIGR03307"
FT                   /protein_id="ACX86411.1"
FT   gene            629384..630790
FT                   /locus_tag="Pecwa_0584"
FT   CDS_pept        629384..630790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0584"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /note="TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase; KEGG: eca:ECA0499 putative capsular
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86412"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ACX86412.1"
FT                   FKGFIGENAY"
FT   gene            630780..632066
FT                   /locus_tag="Pecwa_0585"
FT   CDS_pept        630780..632066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0585"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /note="KEGG: eca:ECA0500 putative capsular polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86413"
FT                   /inference="similar to AA sequence:KEGG:ECA0500"
FT                   /protein_id="ACX86413.1"
FT   gene            632068..632625
FT                   /locus_tag="Pecwa_0586"
FT   CDS_pept        632068..632625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0586"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: eca:ECA0501 putative capsular
FT                   polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86414"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ACX86414.1"
FT   gene            632628..634760
FT                   /locus_tag="Pecwa_0587"
FT   CDS_pept        632628..634760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0587"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   eca:ECA0502 putative capsulatr polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86415"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ACX86415.1"
FT                   SLNHRMNALIDSTGHL"
FT   gene            634774..635985
FT                   /locus_tag="Pecwa_0588"
FT   CDS_pept        634774..635985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0588"
FT                   /product="putative capsular polysaccharide bisynthesis
FT                   protein"
FT                   /note="KEGG: eca:ECA0503 putative capsular polysaccharide
FT                   bisynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86416"
FT                   /inference="similar to AA sequence:KEGG:ECA0503"
FT                   /protein_id="ACX86416.1"
FT                   MTEP"
FT   gene            635982..637364
FT                   /locus_tag="Pecwa_0589"
FT   CDS_pept        635982..637364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0589"
FT                   /product="putative capsular polysaccharide bisynthesis
FT                   protein"
FT                   /note="KEGG: eca:ECA0504 putative capsular polysaccharide
FT                   bisynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86417"
FT                   /inference="similar to AA sequence:KEGG:ECA0504"
FT                   /protein_id="ACX86417.1"
FT                   YE"
FT   gene            637357..638346
FT                   /locus_tag="Pecwa_0590"
FT   CDS_pept        637357..638346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0590"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   eca:ECA0505 capsular polysaccharide bisynthesis glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86418"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX86418.1"
FT   gene            638353..639567
FT                   /locus_tag="Pecwa_0591"
FT   CDS_pept        638353..639567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0591"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eca:ECA0506 capsular polysaccharide bisynthesis glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86419"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX86419.1"
FT                   ILIEK"
FT   gene            639569..640681
FT                   /locus_tag="Pecwa_0592"
FT   CDS_pept        639569..640681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0592"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; Protein of
FT                   unknown function DUF1972; KEGG: eca:ECA0507 putative
FT                   capsular polysaccharide bisynthesis glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86420"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX86420.1"
FT   gene            640684..641091
FT                   /locus_tag="Pecwa_0593"
FT   CDS_pept        640684..641091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86421"
FT                   /inference="similar to AA sequence:KEGG:ECA0508"
FT                   /protein_id="ACX86421.1"
FT   gene            641130..642524
FT                   /locus_tag="Pecwa_0594"
FT   CDS_pept        641130..642524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86422"
FT                   /inference="similar to AA sequence:KEGG:ECA0509"
FT                   /protein_id="ACX86422.1"
FT                   STVTVR"
FT   gene            642551..643051
FT                   /locus_tag="Pecwa_0595"
FT   CDS_pept        642551..643051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0595"
FT                   /product="putative capsular polysacharide biosynthesis
FT                   transferase"
FT                   /note="KEGG: eca:ECA0510 putative capsular polysacharide
FT                   biosynthesis transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86423"
FT                   /inference="similar to AA sequence:KEGG:ECA0510"
FT                   /protein_id="ACX86423.1"
FT                   ELN"
FT   gene            643282..643680
FT                   /pseudo
FT                   /locus_tag="Pecwa_0596"
FT   gene            643687..643983
FT                   /pseudo
FT                   /locus_tag="Pecwa_0597"
FT   gene            643971..644348
FT                   /pseudo
FT                   /locus_tag="Pecwa_0598"
FT   gene            644914..645978
FT                   /locus_tag="Pecwa_0599"
FT   CDS_pept        644914..645978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0599"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   plu:plu1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86424"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACX86424.1"
FT                   LTKNAKCIVCGELS"
FT   gene            645975..647210
FT                   /locus_tag="Pecwa_0600"
FT   CDS_pept        645975..647210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0600"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ypb:YPTS_1931 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86425"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX86425.1"
FT                   SVIKKQNNEEVI"
FT   gene            647207..648013
FT                   /locus_tag="Pecwa_0601"
FT   CDS_pept        647207..648013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0601"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: ypb:YPTS_1935 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86426"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACX86426.1"
FT   gene            647998..649764
FT                   /locus_tag="Pecwa_0602"
FT   CDS_pept        647998..649764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0602"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; GCN5-related
FT                   N-acetyltransferase; KEGG: ypb:YPTS_1936 Orn/DAP/Arg
FT                   decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86427"
FT                   /inference="protein motif:PFAM:PF02784"
FT                   /protein_id="ACX86427.1"
FT                   FHDQNVYSHIAP"
FT   gene            649985..650242
FT                   /locus_tag="Pecwa_0603"
FT   CDS_pept        649985..650242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0603"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_2939 plasmid pRiA4b ORF-3 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86428"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86428.1"
FT   gene            complement(650280..650444)
FT                   /pseudo
FT                   /locus_tag="Pecwa_0604"
FT   gene            650732..651619
FT                   /locus_tag="Pecwa_0605"
FT   CDS_pept        650732..651619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86429"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3748"
FT                   /protein_id="ACX86429.1"
FT                   SAVPFQISAEREDS"
FT   gene            651619..652005
FT                   /locus_tag="Pecwa_0606"
FT   CDS_pept        651619..652005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86430"
FT                   /inference="similar to AA sequence:KEGG:ECA0518"
FT                   /protein_id="ACX86430.1"
FT   gene            651998..653359
FT                   /locus_tag="Pecwa_0607"
FT   CDS_pept        651998..653359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0607"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: ypi:YpsIP31758_3747
FT                   replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86431"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACX86431.1"
FT   gene            653359..655083
FT                   /locus_tag="Pecwa_0608"
FT   CDS_pept        653359..655083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86432"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05337"
FT                   /protein_id="ACX86432.1"
FT   gene            655073..655312
FT                   /locus_tag="Pecwa_0609"
FT   CDS_pept        655073..655312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0609"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="PFAM: zinc finger DksA/TraR C4-type; KEGG:
FT                   plu:plu1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86433"
FT                   /inference="protein motif:PFAM:PF01258"
FT                   /protein_id="ACX86433.1"
FT   gene            655309..655974
FT                   /locus_tag="Pecwa_0610"
FT   CDS_pept        655309..655974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86434"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05339"
FT                   /protein_id="ACX86434.1"
FT   gene            655967..656083
FT                   /locus_tag="Pecwa_0611"
FT   CDS_pept        655967..656083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86435"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86435.1"
FT   gene            656080..656661
FT                   /locus_tag="Pecwa_0612"
FT   CDS_pept        656080..656661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE3512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86436"
FT                   /inference="similar to AA sequence:KEGG:YE3512"
FT                   /protein_id="ACX86436.1"
FT   gene            656663..656893
FT                   /locus_tag="Pecwa_0613"
FT   CDS_pept        656663..656893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86437"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05341"
FT                   /protein_id="ACX86437.1"
FT   gene            656890..657087
FT                   /locus_tag="Pecwa_0614"
FT   CDS_pept        656890..657087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86438"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86438.1"
FT   gene            657087..657329
FT                   /locus_tag="Pecwa_0615"
FT   CDS_pept        657087..657329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86439"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86439.1"
FT   gene            657326..658624
FT                   /locus_tag="Pecwa_0616"
FT   CDS_pept        657326..658624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE3511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86440"
FT                   /inference="similar to AA sequence:KEGG:YE3511"
FT                   /protein_id="ACX86440.1"
FT   gene            659131..659883
FT                   /locus_tag="Pecwa_0617"
FT   CDS_pept        659131..659883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0617"
FT                   /product="Domain of unknown function DUF1845"
FT                   /note="PFAM: Domain of unknown function DUF1845; KEGG:
FT                   spq:SPAB_05346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86441"
FT                   /inference="protein motif:PFAM:PF08900"
FT                   /protein_id="ACX86441.1"
FT   gene            659898..661907
FT                   /locus_tag="Pecwa_0618"
FT   CDS_pept        659898..661907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0618"
FT                   /product="DNA topoisomerase III"
FT                   /note="KEGG: spq:SPAB_05347 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86442"
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /protein_id="ACX86442.1"
FT   gene            662542..663051
FT                   /locus_tag="Pecwa_0619"
FT   CDS_pept        662542..663051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86443"
FT                   /inference="similar to AA sequence:KEGG:ECA0528"
FT                   /protein_id="ACX86443.1"
FT                   YAENSF"
FT   gene            663111..663659
FT                   /locus_tag="Pecwa_0620"
FT   CDS_pept        663111..663659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0620"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: stt:t4237 single-stranded DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86444"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACX86444.1"
FT   gene            663763..664347
FT                   /locus_tag="Pecwa_0621"
FT   CDS_pept        663763..664347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86445"
FT                   /inference="similar to AA sequence:KEGG:Neut_0078"
FT                   /protein_id="ACX86445.1"
FT   gene            664419..664856
FT                   /locus_tag="Pecwa_0622"
FT   CDS_pept        664419..664856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0622"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   eca:ECA0531 putative plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86446"
FT                   /inference="protein motif:PFAM:PF01724"
FT                   /protein_id="ACX86446.1"
FT   gene            665007..666350
FT                   /locus_tag="Pecwa_0623"
FT   CDS_pept        665007..666350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0623"
FT                   /product="putative type IV pilus protein"
FT                   /note="KEGG: eca:ECA0532 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86447"
FT                   /inference="similar to AA sequence:KEGG:ECA0532"
FT                   /protein_id="ACX86447.1"
FT   gene            666350..666796
FT                   /locus_tag="Pecwa_0624"
FT   CDS_pept        666350..666796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0624"
FT                   /product="putative type IV pilus protein"
FT                   /note="KEGG: eca:ECA0533 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86448"
FT                   /inference="similar to AA sequence:KEGG:ECA0533"
FT                   /protein_id="ACX86448.1"
FT   gene            666806..668470
FT                   /locus_tag="Pecwa_0625"
FT   CDS_pept        666806..668470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0625"
FT                   /product="type IVB pilus formation outer membrane protein,
FT                   R64 PilN family"
FT                   /note="TIGRFAM: type IVB pilus formation outer membrane
FT                   protein, R64 PilN family; PFAM: Secretin domain protein;
FT                   KEGG: eca:ECA0534 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86449"
FT                   /inference="protein motif:TFAM:TIGR02520"
FT                   /protein_id="ACX86449.1"
FT   gene            668481..669794
FT                   /locus_tag="Pecwa_0626"
FT   CDS_pept        668481..669794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0626"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t4243 putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86450"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86450.1"
FT   gene            669791..670300
FT                   /locus_tag="Pecwa_0627"
FT   CDS_pept        669791..670300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0627"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /note="TIGRFAM: type IV pilus biogenesis protein PilP;
FT                   KEGG: eca:ECA0537 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86451"
FT                   /inference="protein motif:TFAM:TIGR03021"
FT                   /protein_id="ACX86451.1"
FT                   QTGVAQ"
FT   gene            670300..670437
FT                   /locus_tag="Pecwa_0628"
FT   CDS_pept        670300..670437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0628"
FT                   /product="putative type IV pilus protein"
FT                   /note="KEGG: eca:ECA0537 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86452"
FT                   /inference="similar to AA sequence:KEGG:ECA0537"
FT                   /protein_id="ACX86452.1"
FT                   "
FT   gene            670437..671996
FT                   /locus_tag="Pecwa_0629"
FT   CDS_pept        670437..671996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0629"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   eca:ECA0538 putative type IV pilus nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86453"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACX86453.1"
FT                   CV"
FT   gene            671999..673165
FT                   /locus_tag="Pecwa_0630"
FT   CDS_pept        671999..673165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0630"
FT                   /product="putative type IV pilus protein"
FT                   /note="KEGG: eca:ECA0540 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86454"
FT                   /inference="similar to AA sequence:KEGG:ECA0540"
FT                   /protein_id="ACX86454.1"
FT   gene            673222..673818
FT                   /locus_tag="Pecwa_0631"
FT   CDS_pept        673222..673818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0631"
FT                   /product="PilS domain protein"
FT                   /note="PFAM: PilS domain protein; KEGG: eca:ECA0541
FT                   putative type IV pilus prepilin"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86455"
FT                   /inference="protein motif:PFAM:PF08805"
FT                   /protein_id="ACX86455.1"
FT   gene            673818..674345
FT                   /locus_tag="Pecwa_0632"
FT   CDS_pept        673818..674345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0632"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   eca:ECA0542 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86456"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACX86456.1"
FT                   RLLRERRGIVLK"
FT   gene            674342..674995
FT                   /locus_tag="Pecwa_0633"
FT   CDS_pept        674342..674995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0633"
FT                   /product="putative prepilin peptidase"
FT                   /note="KEGG: eca:ECA0543 putative prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86457"
FT                   /inference="similar to AA sequence:KEGG:ECA0543"
FT                   /protein_id="ACX86457.1"
FT   gene            675009..676607
FT                   /locus_tag="Pecwa_0634"
FT   CDS_pept        675009..676607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0634"
FT                   /product="shufflon domain protein"
FT                   /note="PFAM: shufflon domain protein; Tail Collar domain
FT                   protein; KEGG: eca:ECA0544 putative type IV pilus prepilin
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86458"
FT                   /inference="protein motif:PFAM:PF04917"
FT                   /protein_id="ACX86458.1"
FT                   NRPTNIAVMFIIKAG"
FT   gene            676679..677101
FT                   /locus_tag="Pecwa_0635"
FT   CDS_pept        676679..677101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0635"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG: eca:ECA0545
FT                   alternative C-terminus for the PilV protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86459"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACX86459.1"
FT   gene            complement(677588..678022)
FT                   /locus_tag="Pecwa_0636"
FT   CDS_pept        complement(677588..678022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0636"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG: eca:ECA0545
FT                   alternative C-terminus for the PilV protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86460"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACX86460.1"
FT   gene            complement(678324..678746)
FT                   /locus_tag="Pecwa_0637"
FT   CDS_pept        complement(678324..678746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0637"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG: eca:ECA0545
FT                   alternative C-terminus for the PilV protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86461"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACX86461.1"
FT   gene            complement(678818..679291)
FT                   /locus_tag="Pecwa_0638"
FT   CDS_pept        complement(678818..679291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0638"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG: eca:ECA0545
FT                   alternative C-terminus for the PilV protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86462"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACX86462.1"
FT   gene            679339..680463
FT                   /locus_tag="Pecwa_0639"
FT   CDS_pept        679339..680463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0639"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: eca:ECA0546
FT                   shufflon-specific DNA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86463"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACX86463.1"
FT   gene            680568..681371
FT                   /locus_tag="Pecwa_0640"
FT   CDS_pept        680568..681371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86464"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05369"
FT                   /protein_id="ACX86464.1"
FT   gene            681380..682087
FT                   /locus_tag="Pecwa_0641"
FT   CDS_pept        681380..682087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0641"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86465"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05370"
FT                   /protein_id="ACX86465.1"
FT                   LQQGENGWQIAAF"
FT   gene            682066..682716
FT                   /locus_tag="Pecwa_0642"
FT   CDS_pept        682066..682716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0642"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ypi:YpsIP31758_3720 transglycosylase SLT domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86466"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACX86466.1"
FT   gene            682713..683264
FT                   /locus_tag="Pecwa_0643"
FT   CDS_pept        682713..683264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE3494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86467"
FT                   /inference="similar to AA sequence:KEGG:YE3494"
FT                   /protein_id="ACX86467.1"
FT   gene            683279..683815
FT                   /locus_tag="Pecwa_0644"
FT   CDS_pept        683279..683815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0644"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86468"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86468.1"
FT                   ASRNYPHKGEDKVDE"
FT   gene            683808..685919
FT                   /locus_tag="Pecwa_0645"
FT   CDS_pept        683808..685919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0645"
FT                   /product="TraG-family protein"
FT                   /note="KEGG: yen:YE3493 TraG-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86469"
FT                   /inference="similar to AA sequence:KEGG:YE3493"
FT                   /protein_id="ACX86469.1"
FT                   AFEPKDEVA"
FT   gene            685919..686671
FT                   /locus_tag="Pecwa_0646"
FT   CDS_pept        685919..686671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0646"
FT                   /product="putative inner membrane protein"
FT                   /note="KEGG: yen:YE3492 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86470"
FT                   /inference="similar to AA sequence:KEGG:YE3492"
FT                   /protein_id="ACX86470.1"
FT   gene            687024..687542
FT                   /locus_tag="Pecwa_0647"
FT   CDS_pept        687024..687542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0647"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   pct:PC1_3239 type VI secretion system effector, Hcp1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86471"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACX86471.1"
FT                   DDWRAPVEA"
FT   gene            687663..689492
FT                   /locus_tag="Pecwa_0648"
FT   CDS_pept        687663..689492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0648"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: eca:ECA2867 putative rhs accessory genetic
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86472"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACX86472.1"
FT   gene            689521..689964
FT                   /locus_tag="Pecwa_0649"
FT   CDS_pept        689521..689964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0649"
FT                   /product="Domain of unknown function DUF1795"
FT                   /note="PFAM: Domain of unknown function DUF1795; KEGG:
FT                   eca:ECA2868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86473"
FT                   /inference="protein motif:PFAM:PF08786"
FT                   /protein_id="ACX86473.1"
FT   gene            689957..694225
FT                   /locus_tag="Pecwa_0650"
FT   CDS_pept        689957..694225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0650"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: PAAR
FT                   repeat-containing protein; YD repeat-containing protein;
FT                   KEGG: eca:ECA2869 putative rhs protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86474"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACX86474.1"
FT   gene            694222..694779
FT                   /locus_tag="Pecwa_0651"
FT   CDS_pept        694222..694779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcj:BCAS0661B hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86475"
FT                   /inference="similar to AA sequence:KEGG:BCAS0661B"
FT                   /protein_id="ACX86475.1"
FT   gene            694946..695254
FT                   /locus_tag="Pecwa_0652"
FT   CDS_pept        694946..695254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0652"
FT                   /product="Protein of unknown function, RAQPRD"
FT                   /note="PFAM: Protein of unknown function, RAQPRD; KEGG:
FT                   yen:YE3490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86476"
FT                   /inference="protein motif:PFAM:PF09686"
FT                   /protein_id="ACX86476.1"
FT   gene            695251..695487
FT                   /locus_tag="Pecwa_0653"
FT   CDS_pept        695251..695487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmr:PMI2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86477"
FT                   /inference="similar to AA sequence:KEGG:PMI2584"
FT                   /protein_id="ACX86477.1"
FT   gene            695516..695875
FT                   /locus_tag="Pecwa_0654"
FT   CDS_pept        695516..695875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86478"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3711"
FT                   /protein_id="ACX86478.1"
FT                   LVAVIWLATKALDIL"
FT   gene            695887..696261
FT                   /locus_tag="Pecwa_0655"
FT   CDS_pept        695887..696261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86479"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05381"
FT                   /protein_id="ACX86479.1"
FT   gene            696258..696917
FT                   /locus_tag="Pecwa_0656"
FT   CDS_pept        696258..696917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86480"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3709"
FT                   /protein_id="ACX86480.1"
FT   gene            696914..697810
FT                   /locus_tag="Pecwa_0657"
FT   CDS_pept        696914..697810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86481"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3708"
FT                   /protein_id="ACX86481.1"
FT                   PVIPAKPVKSTSRGVTK"
FT   gene            697807..699348
FT                   /locus_tag="Pecwa_0658"
FT   CDS_pept        697807..699348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86482"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3707"
FT                   /protein_id="ACX86482.1"
FT   gene            699351..700154
FT                   /locus_tag="Pecwa_0659"
FT   CDS_pept        699351..700154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0659"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecq:ECED1_3575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86483"
FT                   /inference="similar to AA sequence:KEGG:ECED1_3575"
FT                   /protein_id="ACX86483.1"
FT   gene            700141..700602
FT                   /locus_tag="Pecwa_0660"
FT   CDS_pept        700141..700602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0660"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA0571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86484"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86484.1"
FT   gene            700595..701005
FT                   /locus_tag="Pecwa_0661"
FT   CDS_pept        700595..701005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0661"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86485"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05386"
FT                   /protein_id="ACX86485.1"
FT   gene            701005..703830
FT                   /locus_tag="Pecwa_0662"
FT   CDS_pept        701005..703830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0662"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86486"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3705"
FT                   /protein_id="ACX86486.1"
FT                   ARGIMTETEAA"
FT   gene            703827..704225
FT                   /locus_tag="Pecwa_0663"
FT   CDS_pept        703827..704225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86487"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05389"
FT                   /protein_id="ACX86487.1"
FT   gene            704395..705297
FT                   /locus_tag="Pecwa_0664"
FT   CDS_pept        704395..705297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: elf:LF82_p665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86488"
FT                   /inference="similar to AA sequence:KEGG:LF82_p665"
FT                   /protein_id="ACX86488.1"
FT   gene            complement(705294..705521)
FT                   /locus_tag="Pecwa_0665"
FT   CDS_pept        complement(705294..705521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0665"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86489"
FT                   /inference="similar to AA sequence:KEGG:HS_1734"
FT                   /protein_id="ACX86489.1"
FT   gene            705711..708098
FT                   /locus_tag="Pecwa_0666"
FT   CDS_pept        705711..708098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0666"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86490"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_7657"
FT                   /protein_id="ACX86490.1"
FT   gene            708322..708594
FT                   /locus_tag="Pecwa_0667"
FT   CDS_pept        708322..708594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0667"
FT                   /product="Insertion element protein"
FT                   /note="PFAM: Insertion element protein; KEGG: sdy:SDY_P213
FT                   iso-IS1 ORF1"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86491"
FT                   /inference="protein motif:PFAM:PF03811"
FT                   /protein_id="ACX86491.1"
FT   gene            708579..709016
FT                   /pseudo
FT                   /locus_tag="Pecwa_0668"
FT   gene            709059..710021
FT                   /locus_tag="Pecwa_0669"
FT   CDS_pept        709059..710021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0669"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecv:APECO1_381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86492"
FT                   /inference="similar to AA sequence:KEGG:APECO1_381"
FT                   /protein_id="ACX86492.1"
FT   gene            710037..711038
FT                   /locus_tag="Pecwa_0670"
FT   CDS_pept        710037..711038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0670"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecz:ECS88_1342 conserved hypothetical protein
FT                   from phage origin"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86493"
FT                   /inference="similar to AA sequence:KEGG:ECS88_1342"
FT                   /protein_id="ACX86493.1"
FT   gene            complement(711295..712284)
FT                   /locus_tag="Pecwa_0671"
FT   CDS_pept        complement(711295..712284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0671"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: yen:YE3463
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86494"
FT                   /inference="protein motif:PFAM:PF04607"
FT                   /protein_id="ACX86494.1"
FT   gene            complement(712281..713372)
FT                   /locus_tag="Pecwa_0672"
FT   CDS_pept        complement(712281..713372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0672"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE3462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86495"
FT                   /inference="similar to AA sequence:KEGG:YE3462"
FT                   /protein_id="ACX86495.1"
FT   gene            complement(713388..713834)
FT                   /locus_tag="Pecwa_0673"
FT   CDS_pept        complement(713388..713834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0673"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amc:MADE_00113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86496"
FT                   /inference="similar to AA sequence:KEGG:MADE_00113"
FT                   /protein_id="ACX86496.1"
FT   gene            714261..714812
FT                   /locus_tag="Pecwa_0674"
FT   CDS_pept        714261..714812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0674"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sew:SeSA_A1660 sefir domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86497"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86497.1"
FT   gene            714956..715562
FT                   /pseudo
FT                   /locus_tag="Pecwa_0675"
FT   gene            715768..718461
FT                   /locus_tag="Pecwa_0676"
FT   CDS_pept        715768..718461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0676"
FT                   /product="ATPase involved in DNA repair"
FT                   /note="KEGG: vfm:VFMJ11_B0190 ATPase involved in DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86498"
FT                   /inference="similar to AA sequence:KEGG:VFMJ11_B0190"
FT                   /protein_id="ACX86498.1"
FT   gene            718493..718713
FT                   /pseudo
FT                   /locus_tag="Pecwa_0677"
FT   gene            718870..719274
FT                   /locus_tag="Pecwa_0678"
FT   CDS_pept        718870..719274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0678"
FT                   /product="protein of unknown function DUF1525"
FT                   /note="PFAM: protein of unknown function DUF1525; KEGG:
FT                   ypi:YpsIP31758_3702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86499"
FT                   /inference="protein motif:PFAM:PF07511"
FT                   /protein_id="ACX86499.1"
FT   gene            719271..720239
FT                   /locus_tag="Pecwa_0679"
FT   CDS_pept        719271..720239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0679"
FT                   /product="protein of unknown function DUF1527"
FT                   /note="PFAM: protein of unknown function DUF1527; KEGG:
FT                   spq:SPAB_05391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86500"
FT                   /inference="protein motif:PFAM:PF07513"
FT                   /protein_id="ACX86500.1"
FT   gene            720255..721682
FT                   /locus_tag="Pecwa_0680"
FT   CDS_pept        720255..721682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0680"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86501"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05392"
FT                   /protein_id="ACX86501.1"
FT                   GSQDQGFNGLSQNQGGQ"
FT   gene            721685..722029
FT                   /locus_tag="Pecwa_0681"
FT   CDS_pept        721685..722029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0681"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86502"
FT                   /inference="similar to AA sequence:KEGG:SPAB_05393"
FT                   /protein_id="ACX86502.1"
FT                   ELANLRALVA"
FT   gene            722039..723604
FT                   /locus_tag="Pecwa_0682"
FT   CDS_pept        722039..723604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86503"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3699"
FT                   /protein_id="ACX86503.1"
FT                   TKSR"
FT   gene            complement(723640..723909)
FT                   /locus_tag="Pecwa_0683"
FT   CDS_pept        complement(723640..723909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0683"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86504"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86504.1"
FT   gene            724014..724736
FT                   /locus_tag="Pecwa_0684"
FT   CDS_pept        724014..724736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0684"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecq:ECED1_3539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86505"
FT                   /inference="similar to AA sequence:KEGG:ECED1_3539"
FT                   /protein_id="ACX86505.1"
FT                   LCQRAIEILQSNKITLNN"
FT   gene            complement(724883..725731)
FT                   /locus_tag="Pecwa_0685"
FT   CDS_pept        complement(724883..725731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86506"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86506.1"
FT                   N"
FT   gene            726654..727541
FT                   /locus_tag="Pecwa_0686"
FT   CDS_pept        726654..727541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0686"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86507"
FT                   /inference="similar to AA sequence:KEGG:ECA0587"
FT                   /protein_id="ACX86507.1"
FT                   GHYVARVYNKADQE"
FT   gene            727575..727769
FT                   /locus_tag="Pecwa_0687"
FT   CDS_pept        727575..727769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86508"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86508.1"
FT   gene            728108..728455
FT                   /locus_tag="Pecwa_0688"
FT   CDS_pept        728108..728455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0688"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86509"
FT                   /inference="similar to AA sequence:KEGG:ECA0590"
FT                   /protein_id="ACX86509.1"
FT                   QQLATLRYRFQ"
FT   gene            728537..729052
FT                   /locus_tag="Pecwa_0689"
FT   CDS_pept        728537..729052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0689"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86510"
FT                   /inference="similar to AA sequence:KEGG:ECA0591"
FT                   /protein_id="ACX86510.1"
FT                   WYEGRTFY"
FT   gene            729141..729545
FT                   /locus_tag="Pecwa_0690"
FT   CDS_pept        729141..729545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0690"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86511"
FT                   /inference="similar to AA sequence:KEGG:ECA0592"
FT                   /protein_id="ACX86511.1"
FT   gene            729644..730114
FT                   /locus_tag="Pecwa_0691"
FT   CDS_pept        729644..730114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0691"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA0592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86512"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86512.1"
FT   gene            730220..730696
FT                   /locus_tag="Pecwa_0692"
FT   CDS_pept        730220..730696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0692"
FT                   /product="DNA repair protein RadC"
FT                   /note="TIGRFAM: DNA repair protein RadC; PFAM: DNA repair
FT                   protein RadC; KEGG: eca:ECA0593 putative DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86513"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ACX86513.1"
FT   gene            730788..731003
FT                   /locus_tag="Pecwa_0693"
FT   CDS_pept        730788..731003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0693"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sei:SPC_4443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86514"
FT                   /inference="similar to AA sequence:KEGG:SPC_4443"
FT                   /protein_id="ACX86514.1"
FT   gene            731015..731470
FT                   /locus_tag="Pecwa_0694"
FT   CDS_pept        731015..731470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0694"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86515"
FT                   /inference="similar to AA sequence:KEGG:ECA0594"
FT                   /protein_id="ACX86515.1"
FT   gene            731467..731739
FT                   /locus_tag="Pecwa_0695"
FT   CDS_pept        731467..731739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86516"
FT                   /inference="similar to AA sequence:KEGG:ECA0595"
FT                   /protein_id="ACX86516.1"
FT   gene            731811..732296
FT                   /locus_tag="Pecwa_0696"
FT   CDS_pept        731811..732296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0696"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86517"
FT                   /inference="similar to AA sequence:KEGG:ECA0596"
FT                   /protein_id="ACX86517.1"
FT   gene            732361..734322
FT                   /locus_tag="Pecwa_0697"
FT   CDS_pept        732361..734322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0697"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   eca:ECA0597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86518"
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /protein_id="ACX86518.1"
FT                   WERKWTREQERKAQQKVA"
FT   gene            734396..735289
FT                   /locus_tag="Pecwa_0698"
FT   CDS_pept        734396..735289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0698"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86519"
FT                   /inference="similar to AA sequence:KEGG:ECA0598"
FT                   /protein_id="ACX86519.1"
FT                   LQRDDHSSAPALRLVA"
FT   gene            735368..736294
FT                   /locus_tag="Pecwa_0699"
FT   CDS_pept        735368..736294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0699"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86520"
FT                   /inference="similar to AA sequence:KEGG:ECA0599"
FT                   /protein_id="ACX86520.1"
FT   gene            complement(736379..736672)
FT                   /locus_tag="Pecwa_0700"
FT   CDS_pept        complement(736379..736672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86521"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86521.1"
FT   gene            complement(736693..737391)
FT                   /locus_tag="Pecwa_0701"
FT   CDS_pept        complement(736693..737391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0701"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86522"
FT                   /inference="similar to AA sequence:KEGG:ECA0552"
FT                   /protein_id="ACX86522.1"
FT                   AGKSVIGIER"
FT   gene            complement(737403..738194)
FT                   /locus_tag="Pecwa_0702"
FT   CDS_pept        complement(737403..738194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86523"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86523.1"
FT   gene            complement(738194..738658)
FT                   /locus_tag="Pecwa_0703"
FT   CDS_pept        complement(738194..738658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0703"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ent:Ent638_1000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86524"
FT                   /inference="similar to AA sequence:KEGG:Ent638_1000"
FT                   /protein_id="ACX86524.1"
FT   gene            complement(738690..739340)
FT                   /locus_tag="Pecwa_0704"
FT   CDS_pept        complement(738690..739340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86525"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86525.1"
FT   gene            complement(739437..740636)
FT                   /locus_tag="Pecwa_0705"
FT   CDS_pept        complement(739437..740636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0705"
FT                   /product="putative plasmid transfer protein"
FT                   /note="KEGG: eca:ECA0549 putative plasmid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86526"
FT                   /inference="similar to AA sequence:KEGG:ECA0549"
FT                   /protein_id="ACX86526.1"
FT                   "
FT   gene            complement(740782..741777)
FT                   /locus_tag="Pecwa_0706"
FT   CDS_pept        complement(740782..741777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0706"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spq:SPAB_05446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86527"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86527.1"
FT   gene            complement(741866..742501)
FT                   /locus_tag="Pecwa_0707"
FT   CDS_pept        complement(741866..742501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0707"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86528"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_3688"
FT                   /protein_id="ACX86528.1"
FT   gene            742513..742653
FT                   /locus_tag="Pecwa_0708"
FT   CDS_pept        742513..742653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86529"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX86529.1"
FT                   T"
FT   gene            742694..744151
FT                   /locus_tag="Pecwa_0709"
FT   CDS_pept        742694..744151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0709"
FT                   /product="protein of unknown function DUF1528"
FT                   /note="PFAM: protein of unknown function DUF1528; Relaxase;
FT                   KEGG: spq:SPAB_05448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86530"
FT                   /inference="protein motif:PFAM:PF07515"
FT                   /protein_id="ACX86530.1"
FT   gene            744192..745166
FT                   /locus_tag="Pecwa_0710"
FT   CDS_pept        744192..745166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0710"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: yen:YE3450
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86531"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACX86531.1"
FT   gene            745763..746905
FT                   /locus_tag="Pecwa_0711"
FT   CDS_pept        745763..746905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0711"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: eca:ECA0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86532"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ACX86532.1"
FT   gene            complement(747128..749140)
FT                   /locus_tag="Pecwa_0712"
FT   CDS_pept        complement(747128..749140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0712"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86533"
FT                   /inference="similar to AA sequence:KEGG:Glov_0280"
FT                   /protein_id="ACX86533.1"
FT   gene            complement(749153..749752)
FT                   /locus_tag="Pecwa_0713"
FT   CDS_pept        complement(749153..749752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0713"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   sun:SUN_2116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86534"
FT                   /inference="protein motif:PFAM:PF08937"
FT                   /protein_id="ACX86534.1"
FT   gene            750091..750319
FT                   /pseudo
FT                   /locus_tag="Pecwa_0714"
FT   gene            750348..750809
FT                   /locus_tag="Pecwa_0715"
FT   CDS_pept        750348..750809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0715"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86535"
FT                   /inference="similar to AA sequence:KEGG:PC1_0868"
FT                   /protein_id="ACX86535.1"
FT   gene            750806..751027
FT                   /locus_tag="Pecwa_0716"
FT   CDS_pept        750806..751027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0716"
FT                   /product="putative transcriptional regulator, Nlp"
FT                   /note="KEGG: pct:PC1_0869 putative transcriptional
FT                   regulator, Nlp"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86536"
FT                   /inference="similar to AA sequence:KEGG:PC1_0869"
FT                   /protein_id="ACX86536.1"
FT   gene            751196..751744
FT                   /locus_tag="Pecwa_0717"
FT   CDS_pept        751196..751744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0717"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86537"
FT                   /inference="similar to AA sequence:KEGG:PC1_0870"
FT                   /protein_id="ACX86537.1"
FT   gene            complement(751931..753190)
FT                   /locus_tag="Pecwa_0718"
FT   CDS_pept        complement(751931..753190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0718"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: pct:PC1_0871
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86538"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACX86538.1"
FT   gene            complement(753354..753429)
FT                   /locus_tag="Pecwa_R0016"
FT                   /note="tRNA-Phe2"
FT   tRNA            complement(753354..753429)
FT                   /locus_tag="Pecwa_R0016"
FT                   /product="tRNA-Phe"
FT   gene            753601..754446
FT                   /locus_tag="Pecwa_0719"
FT   CDS_pept        753601..754446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0719"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; KEGG: eca:ECA0615
FT                   AraC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86539"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACX86539.1"
FT                   "
FT   gene            754482..755072
FT                   /locus_tag="Pecwa_0720"
FT   CDS_pept        754482..755072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0720"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   eca:ECA0616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86540"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACX86540.1"
FT   gene            complement(755069..755644)
FT                   /locus_tag="Pecwa_0721"
FT   CDS_pept        complement(755069..755644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0721"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: eca:ECA0617 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86541"
FT                   /inference="similar to AA sequence:KEGG:ECA0617"
FT                   /protein_id="ACX86541.1"
FT   gene            complement(755687..757438)
FT                   /locus_tag="Pecwa_0722"
FT   CDS_pept        complement(755687..757438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0722"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; Thioredoxin domain; KEGG: pct:PC1_0503 cytochrome c
FT                   biogenesis protein transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86542"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ACX86542.1"
FT                   HLRKFSP"
FT   gene            complement(757414..757746)
FT                   /locus_tag="Pecwa_0723"
FT   CDS_pept        complement(757414..757746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0723"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   eca:ECA0619 divalent-cation tolerance protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86543"
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /protein_id="ACX86543.1"
FT                   LNASLR"
FT   gene            complement(757878..759179)
FT                   /locus_tag="Pecwa_0724"
FT   CDS_pept        complement(757878..759179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0724"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; KEGG: pct:PC1_0505 anaerobic C4-dicarboxylate
FT                   antiporter, Dcu family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86544"
FT                   /inference="protein motif:TFAM:TIGR00770"
FT                   /protein_id="ACX86544.1"
FT   gene            complement(759568..761007)
FT                   /locus_tag="Pecwa_0725"
FT   CDS_pept        complement(759568..761007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0725"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; Fumarase C-like; KEGG: eca:ECA0621 aspartate
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86545"
FT                   /inference="protein motif:TFAM:TIGR00839"
FT                   /protein_id="ACX86545.1"
FT   gene            761508..761978
FT                   /locus_tag="Pecwa_0726"
FT   CDS_pept        761508..761978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0726"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   eca:ECA0623 suppressor of F plamsid exlusion of phage T7"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86546"
FT                   /inference="protein motif:PFAM:PF04186"
FT                   /protein_id="ACX86546.1"
FT   gene            762215..762508
FT                   /locus_tag="Pecwa_0727"
FT   CDS_pept        762215..762508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0727"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: pct:PC1_0508
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86547"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACX86547.1"
FT   gene            762554..764200
FT                   /locus_tag="Pecwa_0728"
FT   CDS_pept        762554..764200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0728"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: pct:PC1_0509 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86548"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACX86548.1"
FT   gene            764477..765010
FT                   /locus_tag="Pecwa_0729"
FT   CDS_pept        764477..765010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0729"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: eca:ECA0626 chorismate
FT                   pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86549"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86549.1"
FT                   PVYYTPSDEGWQVI"
FT   gene            765023..765886
FT                   /locus_tag="Pecwa_0730"
FT   CDS_pept        765023..765886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0730"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: eca:ECA0627
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86550"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ACX86550.1"
FT                   GVLFGL"
FT   gene            complement(766027..768495)
FT                   /locus_tag="Pecwa_0731"
FT   CDS_pept        complement(766027..768495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0731"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0512 glycerol-3-phosphate
FT                   O-acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86551"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86551.1"
FT                   SQAVEEAKQE"
FT   gene            768624..768989
FT                   /locus_tag="Pecwa_0732"
FT   CDS_pept        768624..768989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0732"
FT                   /product="diacylglycerol kinase"
FT                   /note="PFAM: diacylglycerol kinase; KEGG: pct:PC1_0513
FT                   diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86552"
FT                   /inference="protein motif:PFAM:PF01219"
FT                   /protein_id="ACX86552.1"
FT                   ILLAAVVWGSILWQHFA"
FT   gene            769100..769708
FT                   /locus_tag="Pecwa_0733"
FT   CDS_pept        769100..769708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0733"
FT                   /product="transcriptional repressor, LexA family"
FT                   /EC_number=""
FT                   /note="KEGG: eca:ECA0630 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: LexA DNA-binding domain protein; Peptidase
FT                   S24/S26A/S26B, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86553"
FT                   /inference="protein motif:TFAM:TIGR00498"
FT                   /protein_id="ACX86553.1"
FT   gene            complement(769738..770253)
FT                   /locus_tag="Pecwa_0734"
FT   CDS_pept        complement(769738..770253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0734"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: pct:PC1_0516
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86554"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACX86554.1"
FT                   HTVPIKKR"
FT   gene            complement(770354..771052)
FT                   /locus_tag="Pecwa_0735"
FT   CDS_pept        complement(770354..771052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0735"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: eca:ECA0633
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86555"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ACX86555.1"
FT                   LRALLIDLVV"
FT   gene            771165..772061
FT                   /locus_tag="Pecwa_0736"
FT   CDS_pept        771165..772061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0736"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pct:PC1_0518 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86556"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACX86556.1"
FT                   EAKSWFLREIPKLLNQP"
FT   gene            complement(772133..773128)
FT                   /locus_tag="Pecwa_0737"
FT   CDS_pept        complement(772133..773128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0737"
FT                   /product="Glutathione transferase"
FT                   /EC_number=""
FT                   /note="KEGG: pct:PC1_0519 glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86557"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86557.1"
FT   gene            complement(773237..773632)
FT                   /locus_tag="Pecwa_0738"
FT   CDS_pept        complement(773237..773632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0738"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: pct:PC1_0520 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86558"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACX86558.1"
FT   gene            complement(773907..774197)
FT                   /locus_tag="Pecwa_0739"
FT   CDS_pept        complement(773907..774197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0739"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86559"
FT                   /inference="similar to AA sequence:KEGG:PC1_0521"
FT                   /protein_id="ACX86559.1"
FT   gene            complement(774194..774589)
FT                   /locus_tag="Pecwa_0740"
FT   CDS_pept        complement(774194..774589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0740"
FT                   /product="Protein of unknown function DUF2311, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2311, membrane;
FT                   KEGG: eca:ECA0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86560"
FT                   /inference="protein motif:PFAM:PF10072"
FT                   /protein_id="ACX86560.1"
FT   gene            complement(774603..774908)
FT                   /locus_tag="Pecwa_0741"
FT   CDS_pept        complement(774603..774908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0741"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   eca:ECA0639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86561"
FT                   /inference="protein motif:PFAM:PF05957"
FT                   /protein_id="ACX86561.1"
FT   gene            complement(775185..775580)
FT                   /locus_tag="Pecwa_0742"
FT   CDS_pept        complement(775185..775580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0742"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86562"
FT                   /inference="similar to AA sequence:KEGG:PC1_0525"
FT                   /protein_id="ACX86562.1"
FT   gene            complement(775583..776266)
FT                   /locus_tag="Pecwa_0743"
FT   CDS_pept        complement(775583..776266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0743"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   eca:ECA0642 DedA family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86563"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACX86563.1"
FT                   AEKGR"
FT   gene            complement(776752..777528)
FT                   /locus_tag="Pecwa_0744"
FT   CDS_pept        complement(776752..777528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0744"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   pct:PC1_0527 regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86564"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACX86564.1"
FT   gene            complement(777736..779037)
FT                   /locus_tag="Pecwa_0745"
FT   CDS_pept        complement(777736..779037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0745"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: d-galactonate transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: eca:ECA0644
FT                   galacturonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86565"
FT                   /inference="protein motif:TFAM:TIGR00893"
FT                   /protein_id="ACX86565.1"
FT   gene            779458..780867
FT                   /locus_tag="Pecwa_0746"
FT   CDS_pept        779458..780867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0746"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number=""
FT                   /note="PFAM: Glucuronate isomerase; KEGG: eca:ECA0645
FT                   glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86566"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86566.1"
FT                   DNAKNYFAIEL"
FT   gene            781073..782539
FT                   /locus_tag="Pecwa_0747"
FT   CDS_pept        781073..782539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0747"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: pct:PC1_0530 mannitol
FT                   dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86567"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACX86567.1"
FT   gene            782559..784049
FT                   /locus_tag="Pecwa_0748"
FT   CDS_pept        782559..784049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0748"
FT                   /product="Altronate dehydratase"
FT                   /EC_number=""
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG: eca:ECA0647
FT                   altronate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86568"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86568.1"
FT   gene            784139..784669
FT                   /locus_tag="Pecwa_0749"
FT   CDS_pept        784139..784669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0749"
FT                   /product="Protein of unknown function, inner membrane,YgjV"
FT                   /note="PFAM: Protein of unknown function, inner
FT                   membrane,YgjV; KEGG: eca:ECA0648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86569"
FT                   /inference="protein motif:PFAM:PF10688"
FT                   /protein_id="ACX86569.1"
FT                   QRGIDPFSVEKKA"
FT   gene            complement(784756..786003)
FT                   /locus_tag="Pecwa_0750"
FT   CDS_pept        complement(784756..786003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0750"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   pct:PC1_0533 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86570"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACX86570.1"
FT                   QAEDAKLAEKDRLNLL"
FT   gene            complement(786293..787246)
FT                   /locus_tag="Pecwa_0751"
FT   CDS_pept        complement(786293..787246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0751"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   eca:ECA0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86571"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACX86571.1"
FT   gene            complement(787626..788624)
FT                   /locus_tag="Pecwa_0752"
FT   CDS_pept        complement(787626..788624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0752"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   eca:ECA0653 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86572"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACX86572.1"
FT   gene            788786..789925
FT                   /locus_tag="Pecwa_0753"
FT   CDS_pept        788786..789925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0753"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number=""
FT                   /note="PFAM: methyltransferase small; KEGG: pct:PC1_0536
FT                   rRNA (guanine-N(2)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86573"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACX86573.1"
FT   gene            complement(789942..791999)
FT                   /locus_tag="Pecwa_0754"
FT   CDS_pept        complement(789942..791999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0754"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pct:PC1_0537 2,4-dienoyl-CoA
FT                   reductase (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86574"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACX86574.1"
FT   gene            792215..792511
FT                   /locus_tag="Pecwa_0755"
FT   CDS_pept        792215..792511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0755"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pct:PC1_0538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86575"
FT                   /inference="similar to AA sequence:KEGG:PC1_0538"
FT                   /protein_id="ACX86575.1"
FT   gene            792699..793187
FT                   /locus_tag="Pecwa_0756"
FT   CDS_pept        792699..793187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0756"
FT                   /product="protein of unknown function Spy-related protein"
FT                   /note="PFAM: protein of unknown function Spy-related; KEGG:
FT                   eca:ECA0658 periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86576"
FT                   /inference="protein motif:PFAM:PF07813"
FT                   /protein_id="ACX86576.1"
FT   gene            793389..794858
FT                   /locus_tag="Pecwa_0757"
FT   CDS_pept        793389..794858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0757"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: eca:ECA0659 putative signaling membrane
FT                   protein; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86577"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX86577.1"
FT   gene            795153..797114
FT                   /locus_tag="Pecwa_0758"
FT   CDS_pept        795153..797114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0758"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, beta-glucoside-specific IIABC
FT                   subunit; PTS system, glucose subfamily, IIA subunit; PFAM:
FT                   sugar-specific permease EIIA 1 domain; phosphotransferase
FT                   system EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site; KEGG: eca:ECA0661 PTS system,
FT                   beta-glucoside-specific IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86578"
FT                   /inference="protein motif:TFAM:TIGR01995"
FT                   /protein_id="ACX86578.1"
FT                   GLSSVRHPQAGDTIIALA"
FT   gene            797170..798006
FT                   /locus_tag="Pecwa_0759"
FT   CDS_pept        797170..798006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0759"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: PRD domain protein; CAT RNA-binding domain
FT                   protein; KEGG: dda:Dd703_1406 transcriptional
FT                   antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86579"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ACX86579.1"
FT   gene            798312..799934
FT                   /locus_tag="Pecwa_0760"
FT   CDS_pept        798312..799934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pecwa_0760"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: eca:ECA1872 putative
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Pecwa_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACX86580"
FT                   /inference="protein motif:PFAM:PF02264"
FT                   /protein_id="