(data stored in ACNUC7421 zone)

EMBL: CP001791

ID   CP001791; SV 1; circular; genomic DNA; STD; PRO; 3592487 BP.
XX
AC   CP001791; ABHZ01000000-ABHZ01000028;
XX
PR   Project:PRJNA13376;
XX
DT   01-JUN-2010 (Rel. 105, Created)
DT   01-SEP-2017 (Rel. 134, Last updated, Version 5)
XX
DE   [Bacillus] selenitireducens MLS10 chromosome, complete genome.
XX
KW   .
XX
OS   [Bacillus] selenitireducens MLS10
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Sporolactobacillaceae;
OC   unclassified Sporolactobacillaceae.
XX
RN   [1]
RP   1-3592487
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G., Stolz J.;
RT   "Complete sequence of Bacillus selenitireducens MLS10";
RL   Unpublished.
XX
RN   [2]
RP   1-3592487
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G., Stolz J.;
RT   ;
RL   Submitted (06-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 07070be4b9635a7a4af19b0b4e48abf4.
DR   BioSample; SAMN00000036.
DR   EnsemblGenomes-Gn; Bsel_R0001.
DR   EnsemblGenomes-Gn; Bsel_R0002.
DR   EnsemblGenomes-Gn; Bsel_R0003.
DR   EnsemblGenomes-Gn; Bsel_R0004.
DR   EnsemblGenomes-Gn; Bsel_R0005.
DR   EnsemblGenomes-Gn; Bsel_R0006.
DR   EnsemblGenomes-Gn; Bsel_R0007.
DR   EnsemblGenomes-Gn; Bsel_R0008.
DR   EnsemblGenomes-Gn; Bsel_R0009.
DR   EnsemblGenomes-Gn; Bsel_R0010.
DR   EnsemblGenomes-Gn; Bsel_R0011.
DR   EnsemblGenomes-Gn; Bsel_R0012.
DR   EnsemblGenomes-Gn; Bsel_R0013.
DR   EnsemblGenomes-Gn; Bsel_R0014.
DR   EnsemblGenomes-Gn; Bsel_R0015.
DR   EnsemblGenomes-Gn; Bsel_R0016.
DR   EnsemblGenomes-Gn; Bsel_R0017.
DR   EnsemblGenomes-Gn; Bsel_R0018.
DR   EnsemblGenomes-Gn; Bsel_R0019.
DR   EnsemblGenomes-Gn; Bsel_R0020.
DR   EnsemblGenomes-Gn; Bsel_R0021.
DR   EnsemblGenomes-Gn; Bsel_R0022.
DR   EnsemblGenomes-Gn; Bsel_R0023.
DR   EnsemblGenomes-Gn; Bsel_R0024.
DR   EnsemblGenomes-Gn; Bsel_R0025.
DR   EnsemblGenomes-Gn; Bsel_R0026.
DR   EnsemblGenomes-Gn; Bsel_R0027.
DR   EnsemblGenomes-Gn; Bsel_R0028.
DR   EnsemblGenomes-Gn; Bsel_R0029.
DR   EnsemblGenomes-Gn; Bsel_R0030.
DR   EnsemblGenomes-Gn; Bsel_R0031.
DR   EnsemblGenomes-Gn; Bsel_R0032.
DR   EnsemblGenomes-Gn; Bsel_R0033.
DR   EnsemblGenomes-Gn; Bsel_R0034.
DR   EnsemblGenomes-Gn; Bsel_R0035.
DR   EnsemblGenomes-Gn; Bsel_R0036.
DR   EnsemblGenomes-Gn; Bsel_R0037.
DR   EnsemblGenomes-Gn; Bsel_R0038.
DR   EnsemblGenomes-Gn; Bsel_R0039.
DR   EnsemblGenomes-Gn; Bsel_R0040.
DR   EnsemblGenomes-Gn; Bsel_R0041.
DR   EnsemblGenomes-Gn; Bsel_R0042.
DR   EnsemblGenomes-Gn; Bsel_R0043.
DR   EnsemblGenomes-Gn; Bsel_R0044.
DR   EnsemblGenomes-Gn; Bsel_R0045.
DR   EnsemblGenomes-Gn; Bsel_R0046.
DR   EnsemblGenomes-Gn; Bsel_R0047.
DR   EnsemblGenomes-Gn; Bsel_R0048.
DR   EnsemblGenomes-Gn; Bsel_R0049.
DR   EnsemblGenomes-Gn; Bsel_R0050.
DR   EnsemblGenomes-Gn; Bsel_R0051.
DR   EnsemblGenomes-Gn; Bsel_R0052.
DR   EnsemblGenomes-Gn; Bsel_R0053.
DR   EnsemblGenomes-Gn; Bsel_R0054.
DR   EnsemblGenomes-Gn; Bsel_R0055.
DR   EnsemblGenomes-Gn; Bsel_R0056.
DR   EnsemblGenomes-Gn; Bsel_R0057.
DR   EnsemblGenomes-Gn; Bsel_R0058.
DR   EnsemblGenomes-Gn; Bsel_R0059.
DR   EnsemblGenomes-Gn; Bsel_R0060.
DR   EnsemblGenomes-Gn; Bsel_R0061.
DR   EnsemblGenomes-Gn; Bsel_R0062.
DR   EnsemblGenomes-Gn; Bsel_R0063.
DR   EnsemblGenomes-Gn; Bsel_R0064.
DR   EnsemblGenomes-Gn; Bsel_R0065.
DR   EnsemblGenomes-Gn; Bsel_R0066.
DR   EnsemblGenomes-Gn; Bsel_R0067.
DR   EnsemblGenomes-Gn; Bsel_R0068.
DR   EnsemblGenomes-Gn; Bsel_R0069.
DR   EnsemblGenomes-Gn; Bsel_R0070.
DR   EnsemblGenomes-Gn; Bsel_R0071.
DR   EnsemblGenomes-Gn; Bsel_R0072.
DR   EnsemblGenomes-Gn; Bsel_R0073.
DR   EnsemblGenomes-Gn; Bsel_R0074.
DR   EnsemblGenomes-Gn; Bsel_R0075.
DR   EnsemblGenomes-Gn; Bsel_R0076.
DR   EnsemblGenomes-Gn; Bsel_R0077.
DR   EnsemblGenomes-Gn; Bsel_R0078.
DR   EnsemblGenomes-Gn; Bsel_R0079.
DR   EnsemblGenomes-Gn; Bsel_R0080.
DR   EnsemblGenomes-Gn; Bsel_R0081.
DR   EnsemblGenomes-Gn; Bsel_R0082.
DR   EnsemblGenomes-Gn; Bsel_R0083.
DR   EnsemblGenomes-Gn; Bsel_R0084.
DR   EnsemblGenomes-Gn; Bsel_R0085.
DR   EnsemblGenomes-Gn; Bsel_R0086.
DR   EnsemblGenomes-Gn; Bsel_R0087.
DR   EnsemblGenomes-Gn; Bsel_R0088.
DR   EnsemblGenomes-Gn; Bsel_R0089.
DR   EnsemblGenomes-Gn; Bsel_R0090.
DR   EnsemblGenomes-Gn; Bsel_R0091.
DR   EnsemblGenomes-Gn; Bsel_R0092.
DR   EnsemblGenomes-Gn; Bsel_R0093.
DR   EnsemblGenomes-Gn; Bsel_R0094.
DR   EnsemblGenomes-Gn; Bsel_R0095.
DR   EnsemblGenomes-Gn; EBG00001225757.
DR   EnsemblGenomes-Gn; EBG00001225758.
DR   EnsemblGenomes-Gn; EBG00001225759.
DR   EnsemblGenomes-Gn; EBG00001225760.
DR   EnsemblGenomes-Gn; EBG00001225761.
DR   EnsemblGenomes-Gn; EBG00001225762.
DR   EnsemblGenomes-Gn; EBG00001225763.
DR   EnsemblGenomes-Gn; EBG00001225764.
DR   EnsemblGenomes-Gn; EBG00001225765.
DR   EnsemblGenomes-Gn; EBG00001225766.
DR   EnsemblGenomes-Gn; EBG00001225767.
DR   EnsemblGenomes-Gn; EBG00001225768.
DR   EnsemblGenomes-Gn; EBG00001225769.
DR   EnsemblGenomes-Gn; EBG00001225770.
DR   EnsemblGenomes-Gn; EBG00001225771.
DR   EnsemblGenomes-Gn; EBG00001225772.
DR   EnsemblGenomes-Gn; EBG00001225773.
DR   EnsemblGenomes-Gn; EBG00001225774.
DR   EnsemblGenomes-Gn; EBG00001225775.
DR   EnsemblGenomes-Gn; EBG00001225776.
DR   EnsemblGenomes-Gn; EBG00001225777.
DR   EnsemblGenomes-Gn; EBG00001225778.
DR   EnsemblGenomes-Gn; EBG00001225779.
DR   EnsemblGenomes-Gn; EBG00001225780.
DR   EnsemblGenomes-Gn; EBG00001225781.
DR   EnsemblGenomes-Gn; EBG00001225782.
DR   EnsemblGenomes-Gn; EBG00001225783.
DR   EnsemblGenomes-Gn; EBG00001225784.
DR   EnsemblGenomes-Gn; EBG00001225785.
DR   EnsemblGenomes-Gn; EBG00001225786.
DR   EnsemblGenomes-Gn; EBG00001225787.
DR   EnsemblGenomes-Gn; EBG00001225788.
DR   EnsemblGenomes-Gn; EBG00001225789.
DR   EnsemblGenomes-Gn; EBG00001225790.
DR   EnsemblGenomes-Gn; EBG00001225791.
DR   EnsemblGenomes-Gn; EBG00001225792.
DR   EnsemblGenomes-Gn; EBG00001225793.
DR   EnsemblGenomes-Gn; EBG00001225794.
DR   EnsemblGenomes-Gn; EBG00001225795.
DR   EnsemblGenomes-Gn; EBG00001225796.
DR   EnsemblGenomes-Gn; EBG00001225797.
DR   EnsemblGenomes-Gn; EBG00001225798.
DR   EnsemblGenomes-Gn; EBG00001225799.
DR   EnsemblGenomes-Gn; EBG00001225800.
DR   EnsemblGenomes-Gn; EBG00001225801.
DR   EnsemblGenomes-Gn; EBG00001225802.
DR   EnsemblGenomes-Gn; EBG00001225803.
DR   EnsemblGenomes-Gn; EBG00001225804.
DR   EnsemblGenomes-Gn; EBG00001225805.
DR   EnsemblGenomes-Gn; EBG00001225806.
DR   EnsemblGenomes-Gn; EBG00001225807.
DR   EnsemblGenomes-Gn; EBG00001225808.
DR   EnsemblGenomes-Gn; EBG00001225809.
DR   EnsemblGenomes-Gn; EBG00001225810.
DR   EnsemblGenomes-Gn; EBG00001225811.
DR   EnsemblGenomes-Gn; EBG00001225812.
DR   EnsemblGenomes-Gn; EBG00001225813.
DR   EnsemblGenomes-Gn; EBG00001225814.
DR   EnsemblGenomes-Gn; EBG00001225815.
DR   EnsemblGenomes-Gn; EBG00001225816.
DR   EnsemblGenomes-Gn; EBG00001225817.
DR   EnsemblGenomes-Gn; EBG00001225818.
DR   EnsemblGenomes-Gn; EBG00001225819.
DR   EnsemblGenomes-Gn; EBG00001225820.
DR   EnsemblGenomes-Gn; EBG00001225821.
DR   EnsemblGenomes-Gn; EBG00001225822.
DR   EnsemblGenomes-Gn; EBG00001225823.
DR   EnsemblGenomes-Gn; EBG00001225824.
DR   EnsemblGenomes-Gn; EBG00001225825.
DR   EnsemblGenomes-Gn; EBG00001225826.
DR   EnsemblGenomes-Gn; EBG00001225827.
DR   EnsemblGenomes-Gn; EBG00001225828.
DR   EnsemblGenomes-Gn; EBG00001225829.
DR   EnsemblGenomes-Gn; EBG00001225830.
DR   EnsemblGenomes-Gn; EBG00001225831.
DR   EnsemblGenomes-Gn; EBG00001225832.
DR   EnsemblGenomes-Gn; EBG00001225833.
DR   EnsemblGenomes-Gn; EBG00001225834.
DR   EnsemblGenomes-Gn; EBG00001225835.
DR   EnsemblGenomes-Gn; EBG00001225836.
DR   EnsemblGenomes-Gn; EBG00001225837.
DR   EnsemblGenomes-Gn; EBG00001225838.
DR   EnsemblGenomes-Gn; EBG00001225839.
DR   EnsemblGenomes-Gn; EBG00001225840.
DR   EnsemblGenomes-Gn; EBG00001225841.
DR   EnsemblGenomes-Gn; EBG00001225842.
DR   EnsemblGenomes-Gn; EBG00001225843.
DR   EnsemblGenomes-Gn; EBG00001225844.
DR   EnsemblGenomes-Gn; EBG00001225845.
DR   EnsemblGenomes-Gn; EBG00001225846.
DR   EnsemblGenomes-Gn; EBG00001225847.
DR   EnsemblGenomes-Gn; EBG00001225848.
DR   EnsemblGenomes-Gn; EBG00001225849.
DR   EnsemblGenomes-Gn; EBG00001225850.
DR   EnsemblGenomes-Gn; EBG00001225851.
DR   EnsemblGenomes-Gn; EBG00001225852.
DR   EnsemblGenomes-Gn; EBG00001225853.
DR   EnsemblGenomes-Gn; EBG00001225854.
DR   EnsemblGenomes-Gn; EBG00001225855.
DR   EnsemblGenomes-Gn; EBG00001225856.
DR   EnsemblGenomes-Gn; EBG00001225857.
DR   EnsemblGenomes-Gn; EBG00001225858.
DR   EnsemblGenomes-Gn; EBG00001225859.
DR   EnsemblGenomes-Gn; EBG00001225860.
DR   EnsemblGenomes-Gn; EBG00001225861.
DR   EnsemblGenomes-Gn; EBG00001225862.
DR   EnsemblGenomes-Gn; EBG00001225863.
DR   EnsemblGenomes-Gn; EBG00001225864.
DR   EnsemblGenomes-Gn; EBG00001225865.
DR   EnsemblGenomes-Gn; EBG00001225866.
DR   EnsemblGenomes-Gn; EBG00001225867.
DR   EnsemblGenomes-Gn; EBG00001225868.
DR   EnsemblGenomes-Gn; EBG00001225869.
DR   EnsemblGenomes-Gn; EBG00001225870.
DR   EnsemblGenomes-Gn; EBG00001225871.
DR   EnsemblGenomes-Gn; EBG00001225872.
DR   EnsemblGenomes-Tr; Bsel_R0001-1.
DR   EnsemblGenomes-Tr; Bsel_R0002-1.
DR   EnsemblGenomes-Tr; Bsel_R0003-1.
DR   EnsemblGenomes-Tr; Bsel_R0004-1.
DR   EnsemblGenomes-Tr; Bsel_R0005-1.
DR   EnsemblGenomes-Tr; Bsel_R0006-1.
DR   EnsemblGenomes-Tr; Bsel_R0007-1.
DR   EnsemblGenomes-Tr; Bsel_R0008-1.
DR   EnsemblGenomes-Tr; Bsel_R0009-1.
DR   EnsemblGenomes-Tr; Bsel_R0010-1.
DR   EnsemblGenomes-Tr; Bsel_R0011-1.
DR   EnsemblGenomes-Tr; Bsel_R0012-1.
DR   EnsemblGenomes-Tr; Bsel_R0013-1.
DR   EnsemblGenomes-Tr; Bsel_R0014-1.
DR   EnsemblGenomes-Tr; Bsel_R0015-1.
DR   EnsemblGenomes-Tr; Bsel_R0016-1.
DR   EnsemblGenomes-Tr; Bsel_R0017-1.
DR   EnsemblGenomes-Tr; Bsel_R0018-1.
DR   EnsemblGenomes-Tr; Bsel_R0019-1.
DR   EnsemblGenomes-Tr; Bsel_R0020-1.
DR   EnsemblGenomes-Tr; Bsel_R0021-1.
DR   EnsemblGenomes-Tr; Bsel_R0022-1.
DR   EnsemblGenomes-Tr; Bsel_R0023-1.
DR   EnsemblGenomes-Tr; Bsel_R0024-1.
DR   EnsemblGenomes-Tr; Bsel_R0025-1.
DR   EnsemblGenomes-Tr; Bsel_R0026-1.
DR   EnsemblGenomes-Tr; Bsel_R0027-1.
DR   EnsemblGenomes-Tr; Bsel_R0028-1.
DR   EnsemblGenomes-Tr; Bsel_R0029-1.
DR   EnsemblGenomes-Tr; Bsel_R0030-1.
DR   EnsemblGenomes-Tr; Bsel_R0031-1.
DR   EnsemblGenomes-Tr; Bsel_R0032-1.
DR   EnsemblGenomes-Tr; Bsel_R0033-1.
DR   EnsemblGenomes-Tr; Bsel_R0034-1.
DR   EnsemblGenomes-Tr; Bsel_R0035-1.
DR   EnsemblGenomes-Tr; Bsel_R0036-1.
DR   EnsemblGenomes-Tr; Bsel_R0037-1.
DR   EnsemblGenomes-Tr; Bsel_R0038-1.
DR   EnsemblGenomes-Tr; Bsel_R0039-1.
DR   EnsemblGenomes-Tr; Bsel_R0040-1.
DR   EnsemblGenomes-Tr; Bsel_R0041-1.
DR   EnsemblGenomes-Tr; Bsel_R0042-1.
DR   EnsemblGenomes-Tr; Bsel_R0043-1.
DR   EnsemblGenomes-Tr; Bsel_R0044-1.
DR   EnsemblGenomes-Tr; Bsel_R0045-1.
DR   EnsemblGenomes-Tr; Bsel_R0046-1.
DR   EnsemblGenomes-Tr; Bsel_R0047-1.
DR   EnsemblGenomes-Tr; Bsel_R0048-1.
DR   EnsemblGenomes-Tr; Bsel_R0049-1.
DR   EnsemblGenomes-Tr; Bsel_R0050-1.
DR   EnsemblGenomes-Tr; Bsel_R0051-1.
DR   EnsemblGenomes-Tr; Bsel_R0052-1.
DR   EnsemblGenomes-Tr; Bsel_R0053-1.
DR   EnsemblGenomes-Tr; Bsel_R0054-1.
DR   EnsemblGenomes-Tr; Bsel_R0055-1.
DR   EnsemblGenomes-Tr; Bsel_R0056-1.
DR   EnsemblGenomes-Tr; Bsel_R0057-1.
DR   EnsemblGenomes-Tr; Bsel_R0058-1.
DR   EnsemblGenomes-Tr; Bsel_R0059-1.
DR   EnsemblGenomes-Tr; Bsel_R0060-1.
DR   EnsemblGenomes-Tr; Bsel_R0061-1.
DR   EnsemblGenomes-Tr; Bsel_R0062-1.
DR   EnsemblGenomes-Tr; Bsel_R0063-1.
DR   EnsemblGenomes-Tr; Bsel_R0064-1.
DR   EnsemblGenomes-Tr; Bsel_R0065-1.
DR   EnsemblGenomes-Tr; Bsel_R0066-1.
DR   EnsemblGenomes-Tr; Bsel_R0067-1.
DR   EnsemblGenomes-Tr; Bsel_R0068-1.
DR   EnsemblGenomes-Tr; Bsel_R0069-1.
DR   EnsemblGenomes-Tr; Bsel_R0070-1.
DR   EnsemblGenomes-Tr; Bsel_R0071-1.
DR   EnsemblGenomes-Tr; Bsel_R0072-1.
DR   EnsemblGenomes-Tr; Bsel_R0073-1.
DR   EnsemblGenomes-Tr; Bsel_R0074-1.
DR   EnsemblGenomes-Tr; Bsel_R0075-1.
DR   EnsemblGenomes-Tr; Bsel_R0076-1.
DR   EnsemblGenomes-Tr; Bsel_R0077-1.
DR   EnsemblGenomes-Tr; Bsel_R0078-1.
DR   EnsemblGenomes-Tr; Bsel_R0079-1.
DR   EnsemblGenomes-Tr; Bsel_R0080-1.
DR   EnsemblGenomes-Tr; Bsel_R0081-1.
DR   EnsemblGenomes-Tr; Bsel_R0082-1.
DR   EnsemblGenomes-Tr; Bsel_R0083-1.
DR   EnsemblGenomes-Tr; Bsel_R0084-1.
DR   EnsemblGenomes-Tr; Bsel_R0085-1.
DR   EnsemblGenomes-Tr; Bsel_R0086-1.
DR   EnsemblGenomes-Tr; Bsel_R0087-1.
DR   EnsemblGenomes-Tr; Bsel_R0088-1.
DR   EnsemblGenomes-Tr; Bsel_R0089-1.
DR   EnsemblGenomes-Tr; Bsel_R0090-1.
DR   EnsemblGenomes-Tr; Bsel_R0091-1.
DR   EnsemblGenomes-Tr; Bsel_R0092-1.
DR   EnsemblGenomes-Tr; Bsel_R0093-1.
DR   EnsemblGenomes-Tr; Bsel_R0094-1.
DR   EnsemblGenomes-Tr; Bsel_R0095-1.
DR   EnsemblGenomes-Tr; EBT00001794686.
DR   EnsemblGenomes-Tr; EBT00001794687.
DR   EnsemblGenomes-Tr; EBT00001794688.
DR   EnsemblGenomes-Tr; EBT00001794689.
DR   EnsemblGenomes-Tr; EBT00001794690.
DR   EnsemblGenomes-Tr; EBT00001794691.
DR   EnsemblGenomes-Tr; EBT00001794692.
DR   EnsemblGenomes-Tr; EBT00001794693.
DR   EnsemblGenomes-Tr; EBT00001794694.
DR   EnsemblGenomes-Tr; EBT00001794695.
DR   EnsemblGenomes-Tr; EBT00001794696.
DR   EnsemblGenomes-Tr; EBT00001794697.
DR   EnsemblGenomes-Tr; EBT00001794698.
DR   EnsemblGenomes-Tr; EBT00001794699.
DR   EnsemblGenomes-Tr; EBT00001794700.
DR   EnsemblGenomes-Tr; EBT00001794701.
DR   EnsemblGenomes-Tr; EBT00001794702.
DR   EnsemblGenomes-Tr; EBT00001794703.
DR   EnsemblGenomes-Tr; EBT00001794704.
DR   EnsemblGenomes-Tr; EBT00001794705.
DR   EnsemblGenomes-Tr; EBT00001794706.
DR   EnsemblGenomes-Tr; EBT00001794707.
DR   EnsemblGenomes-Tr; EBT00001794708.
DR   EnsemblGenomes-Tr; EBT00001794709.
DR   EnsemblGenomes-Tr; EBT00001794710.
DR   EnsemblGenomes-Tr; EBT00001794711.
DR   EnsemblGenomes-Tr; EBT00001794712.
DR   EnsemblGenomes-Tr; EBT00001794713.
DR   EnsemblGenomes-Tr; EBT00001794714.
DR   EnsemblGenomes-Tr; EBT00001794715.
DR   EnsemblGenomes-Tr; EBT00001794716.
DR   EnsemblGenomes-Tr; EBT00001794717.
DR   EnsemblGenomes-Tr; EBT00001794718.
DR   EnsemblGenomes-Tr; EBT00001794719.
DR   EnsemblGenomes-Tr; EBT00001794720.
DR   EnsemblGenomes-Tr; EBT00001794721.
DR   EnsemblGenomes-Tr; EBT00001794722.
DR   EnsemblGenomes-Tr; EBT00001794723.
DR   EnsemblGenomes-Tr; EBT00001794724.
DR   EnsemblGenomes-Tr; EBT00001794725.
DR   EnsemblGenomes-Tr; EBT00001794726.
DR   EnsemblGenomes-Tr; EBT00001794727.
DR   EnsemblGenomes-Tr; EBT00001794728.
DR   EnsemblGenomes-Tr; EBT00001794729.
DR   EnsemblGenomes-Tr; EBT00001794730.
DR   EnsemblGenomes-Tr; EBT00001794731.
DR   EnsemblGenomes-Tr; EBT00001794732.
DR   EnsemblGenomes-Tr; EBT00001794733.
DR   EnsemblGenomes-Tr; EBT00001794734.
DR   EnsemblGenomes-Tr; EBT00001794735.
DR   EnsemblGenomes-Tr; EBT00001794736.
DR   EnsemblGenomes-Tr; EBT00001794737.
DR   EnsemblGenomes-Tr; EBT00001794738.
DR   EnsemblGenomes-Tr; EBT00001794739.
DR   EnsemblGenomes-Tr; EBT00001794740.
DR   EnsemblGenomes-Tr; EBT00001794741.
DR   EnsemblGenomes-Tr; EBT00001794742.
DR   EnsemblGenomes-Tr; EBT00001794743.
DR   EnsemblGenomes-Tr; EBT00001794744.
DR   EnsemblGenomes-Tr; EBT00001794745.
DR   EnsemblGenomes-Tr; EBT00001794746.
DR   EnsemblGenomes-Tr; EBT00001794747.
DR   EnsemblGenomes-Tr; EBT00001794748.
DR   EnsemblGenomes-Tr; EBT00001794749.
DR   EnsemblGenomes-Tr; EBT00001794750.
DR   EnsemblGenomes-Tr; EBT00001794751.
DR   EnsemblGenomes-Tr; EBT00001794752.
DR   EnsemblGenomes-Tr; EBT00001794753.
DR   EnsemblGenomes-Tr; EBT00001794754.
DR   EnsemblGenomes-Tr; EBT00001794755.
DR   EnsemblGenomes-Tr; EBT00001794756.
DR   EnsemblGenomes-Tr; EBT00001794757.
DR   EnsemblGenomes-Tr; EBT00001794758.
DR   EnsemblGenomes-Tr; EBT00001794759.
DR   EnsemblGenomes-Tr; EBT00001794760.
DR   EnsemblGenomes-Tr; EBT00001794761.
DR   EnsemblGenomes-Tr; EBT00001794762.
DR   EnsemblGenomes-Tr; EBT00001794763.
DR   EnsemblGenomes-Tr; EBT00001794764.
DR   EnsemblGenomes-Tr; EBT00001794765.
DR   EnsemblGenomes-Tr; EBT00001794766.
DR   EnsemblGenomes-Tr; EBT00001794767.
DR   EnsemblGenomes-Tr; EBT00001794768.
DR   EnsemblGenomes-Tr; EBT00001794769.
DR   EnsemblGenomes-Tr; EBT00001794770.
DR   EnsemblGenomes-Tr; EBT00001794771.
DR   EnsemblGenomes-Tr; EBT00001794772.
DR   EnsemblGenomes-Tr; EBT00001794773.
DR   EnsemblGenomes-Tr; EBT00001794774.
DR   EnsemblGenomes-Tr; EBT00001794775.
DR   EnsemblGenomes-Tr; EBT00001794776.
DR   EnsemblGenomes-Tr; EBT00001794777.
DR   EnsemblGenomes-Tr; EBT00001794778.
DR   EnsemblGenomes-Tr; EBT00001794779.
DR   EnsemblGenomes-Tr; EBT00001794780.
DR   EnsemblGenomes-Tr; EBT00001794781.
DR   EnsemblGenomes-Tr; EBT00001794782.
DR   EnsemblGenomes-Tr; EBT00001794783.
DR   EnsemblGenomes-Tr; EBT00001794784.
DR   EnsemblGenomes-Tr; EBT00001794785.
DR   EnsemblGenomes-Tr; EBT00001794786.
DR   EnsemblGenomes-Tr; EBT00001794787.
DR   EnsemblGenomes-Tr; EBT00001794788.
DR   EnsemblGenomes-Tr; EBT00001794789.
DR   EnsemblGenomes-Tr; EBT00001794790.
DR   EnsemblGenomes-Tr; EBT00001794791.
DR   EnsemblGenomes-Tr; EBT00001794792.
DR   EnsemblGenomes-Tr; EBT00001794793.
DR   EnsemblGenomes-Tr; EBT00001794794.
DR   EnsemblGenomes-Tr; EBT00001794795.
DR   EnsemblGenomes-Tr; EBT00001794796.
DR   EnsemblGenomes-Tr; EBT00001794797.
DR   EnsemblGenomes-Tr; EBT00001794798.
DR   EnsemblGenomes-Tr; EBT00001794799.
DR   EnsemblGenomes-Tr; EBT00001794800.
DR   EnsemblGenomes-Tr; EBT00001794801.
DR   EuropePMC; PMC2952212; 20716528.
DR   EuropePMC; PMC3617157; 23593409.
DR   EuropePMC; PMC3899277; 24466148.
DR   EuropePMC; PMC4674931; 26664656.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP001791.
DR   SILVA-SSU; CP001791.
DR   StrainInfo; 118218; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000241
CC   Source DNA and bacteria available from John Stolz
CC   (stozl@mailbox.cr.duq.edu)
CC   Contacts: John Stolz (stolz@mailbox.cr.duq.edu)
CC        David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Bacillus selenitireducens MLS-10
CC   Culture Collection ID :: ATCC 700615
CC   GOLD Stamp ID         :: Gi00921
CC   Greengenes ID         :: 250140
CC   Isolation Site        :: Anoxic muds of Mono Lake California
CC   Isolation Country     :: USA
CC   Latitude              :: 37.986853
CC   Longitude             :: -119.045711
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Salinity              :: Halophile
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water
CC   Phenotypes            :: Alkalophile, Arsenic metabolizer,
CC                            Respiratory arsenate reductase
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3592487
FT                   /organism="[Bacillus] selenitireducens MLS10"
FT                   /strain="MLS10"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:Mono Lake California"
FT                   /lat_lon="37.99 N 119.05 W"
FT                   /isolation_source="anoxic mud"
FT                   /db_xref="taxon:439292"
FT                   /type_material="type strain of [Bacillus] selenitireducens"
FT   gene            654..2009
FT                   /locus_tag="Bsel_0001"
FT   CDS_pept        654..2009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   gur:Gura_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97553"
FT                   /db_xref="GOA:D6XUZ5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADH97553.1"
FT                   /translation="MENLNDLWDQVLSKIEQKVSKPSFDTWFKYTVVDSIDQSSNTITV
FT                   IAPNEFARDWLENRYFSILTETLYELTGAELEARFILPKDEGSDLDFVEKNNPPVLQED
FT                   LDNGETTKHMLNTKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTH
FT                   LMHAIGHYVVDHNPDAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDILLIDDIQF
FT                   LAGKEQTQEEFFHTFNALHEERKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPD
FT                   LETRIAILRKKAKAENLDIPKEVMNYIANQIDTNIRELEGALIRVVAYSSLINQDMNAD
FT                   LAAVALKDIIPNSKPKKVTIESVQEAVAAHFQIRVEEMKAKKRTKTVAYPRQIAMYMAR
FT                   EMTDSSLPKIGNEFGKRDHTTVIHAHEKISRLFADDEELQQHIREITEKLRS"
FT   gene            2218..3360
FT                   /locus_tag="Bsel_0002"
FT   CDS_pept        2218..3360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: glo:Glov_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97554"
FT                   /db_xref="GOA:D6XUZ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ6"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADH97554.1"
FT                   /translation="MKFTIQRDAFVQSVADVSKAISPRTTIQILTGIKIVADQDGITLT
FT                   GSDSDLSIESFIPKEKDGEELVNIQEEGSIVLQARFFGDMIKKLPETSIEVAVNDQFIA
FT                   QITSGGSVFNINGIDPDEYPRLPDVEEADLFRMPKNLLKTLIRQTAFAVSSVETRPILT
FT                   GIHWHLEDSVLTCTATDSHRLAMRMAKVDDNENNLSFSNVVIPGKTLTELNKILNDTDE
FT                   LLEVVVAGNQILFKGDYFLLYSRLLEGNYPATKNMIPTGSKTSVKLETKRLLDAIERAL
FT                   LLSREGKNNVVHVKNLESGELEITSVTPEVGKVTEHVTTMSYEGDELKISFNGKNLIDA
FT                   LRVMEASEVHINFTGAMSPFVLKPIDEDHMLHLFSPVRTY"
FT   gene            3670..3897
FT                   /locus_tag="Bsel_0003"
FT   CDS_pept        3670..3897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: glo:Glov_0173
FT                   S4 domain protein YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97555"
FT                   /db_xref="GOA:D6XUZ7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ7"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADH97555.1"
FT                   /translation="MEERVTISTEYMTLGQVLKEVAAIGSGGQAKWFLKDIPVFINDEE
FT                   EPETRRGRKLYPGDTVDIDGQTTVLIEADA"
FT   gene            3921..5042
FT                   /locus_tag="Bsel_0004"
FT   CDS_pept        3921..5042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: gur:Gura_0003 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97556"
FT                   /db_xref="GOA:D6XUZ8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ8"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADH97556.1"
FT                   /translation="MHINELKLTDYRNYTKLHLTFENRVNVFLGENAQGKTNVMEAIYV
FT                   LAMARSHRTAKDRELIRWDQPFARVEGAVTNRNGAMKLEMIFSGRGKKVKLNALERKRL
FT                   SDYIGACTIVMFAPEDLALVKGSPQIRRRFLDMEMGQIFTIYLYYLSQYYKLLKQRNTW
FT                   LKQLQQKSSSFDEGMWHVLTEQLVEAGAEVIQRRFSFLNKLEAWATPIHSAISRDKETL
FT                   TLHYESTVKADDEMSVDVIKQVFFEQFQQVMEQEIRRGTTIIGPHRDDVAFFVNDRNVQ
FT                   TYGSQGQQRTAALSVKLAEIELIHEKTGEYPILLLDDVLSELDDHRQTHLLNSIQGKVQ
FT                   TFVTTTSVEGIHHEMLEKASTYLVNDGVIEQQE"
FT   gene            5053..5343
FT                   /locus_tag="Bsel_0005"
FT   CDS_pept        5053..5343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97557"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97557.1"
FT                   /translation="MFIHLGGDHVLKTERIIAILDHQSQGLSKENVTFMEGYQGTMRTV
FT                   YVSEDQPKSMVVTEDEIFMSPISSHTLKRRAETNDASDELEDAIDVAEQKE"
FT   gene            5429..7342
FT                   /locus_tag="Bsel_0006"
FT   CDS_pept        5429..7342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: glo:Glov_0004 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; TOPRIM domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97558"
FT                   /db_xref="GOA:D6XV00"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV00"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADH97558.1"
FT                   /translation="MSLDQQSYDESQIQVLEGLEAVRKRPGMYIGSTNERGLHHLVWEI
FT                   VDNSIDEAMAGHCSHIWVTIEEDNTITVEDDGRGIPVGIHEKMGRPAVEVIMTVLHAGG
FT                   KFGGGGYKVSGGLHGVGASVVNALSSFLEVEVHKEGEVHYISFERGAVKEELNVIGSTE
FT                   KTGTLIRFKADNMIFTETTVYDFDVLANRLRELSFLNKGLTIEITDKREEDKSAKYFYE
FT                   GGISSFVEHLNRTKTALHEPPIFIESEKEGIQVEVAMQYNDSFASNLYSFANNINTHEG
FT                   GTHESGFKTALTRVINDYARKNGLFKENDPNLIGDDVREGLTAIVSVKIENPQFEGQTK
FT                   TKLGNSEARTITDSLFTEHMAKFMAENPTVARQIVEKGIMASRARDAAKKARELTRRKS
FT                   ALEVSSLPGKLADCSTKDASISEIYVVEGDSAGGSAKQGRDRHFQAILPLRGKIINVEK
FT                   ARLDKILANNEIRAIITALGTGIGEEFDITKARYHKIIIMTDADVDGAHIRTLLLTFLY
FT                   RYMRPLIEEGYIYIAQPPLYQIKQGKAVHYAFNEKEMERILGELSASPKPGLQRYKGLG
FT                   EMNPTQLWETTMDPATRTLLQVSLKDAMLADEVFETLMGDRVEPRRDFIQENAHYVKNL
FT                   DI"
FT   gene            7401..9908
FT                   /locus_tag="Bsel_0007"
FT   CDS_pept        7401..9908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: gur:Gura_0005 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97559"
FT                   /db_xref="GOA:D6XV01"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV01"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADH97559.1"
FT                   /translation="MSDQDQSRVTEINISQEMRTSFMDYAMSVIVSRALPDVRDGMKPV
FT                   HRRILYAMNELGITSDKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDSAAAMRYTEARMSKISMELLRDINKDTIDYQDNYDGSEREPVVLPAR
FT                   FPNLLVNGASGIAVGMATNIPPHNLSEVIDGVLALSKNPEITIEQLMEHISGPDFPTGA
FT                   EIVGISGIRRAYETGKGSIMIRSNARIEDHNGKPWIIVDELPYQVNKARLIEKIAELVR
FT                   DKKIDGITDLRDESDRTGMRIVIELRRDVNANVLLNNLYKQTALQTSFGINTLALVNGR
FT                   PQVLNLKETLVHYLDHQRVVIRRRTEFELRKAEARAHILEGLRVALDHLDEVIALIRGS
FT                   QTTDIARDGLMEQFDLSHDQAQAILDMRLQRLTGLERDKIENEYNELMARIAELKAILA
FT                   DDEKVLEIIREELLEIRDRFGDDRRTTITFGEDSMEDEDLIPRQNVVITVSHHGYIKRI
FT                   PVSTYRSQKRGGRGVQGMGTHDEDFVRHLFVTNSHDHMLFFTNKGKVYRMKGYEVPEQK
FT                   RTSKGIPIINLLQIEKDEYISTVIPISEFDANHSLIFMTKYGVSKRTELDAFKNIRKGG
FT                   LFAIKLREGDELHGVRLTDGSKELVVGTKKGMSIRFSETDVRLMGRTATGVKGLRLQSE
FT                   DEVVGMDIIEPDSDILIVTENGFGKRTPIDEYRQQSRGGKGIKTCNITDKNGQLVSLKV
FT                   VGSDHDLMMITTNGVLIRIHVSDISKTSRNTQGVRLIRLGDEEFVSTVARVNVNDDDVE
FT                   DADDPDADEVESDVEHIEETEED"
FT   gene            9990..11099
FT                   /locus_tag="Bsel_0008"
FT   CDS_pept        9990..11099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0008"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sse:Ssed_1799 metal dependent phosphohydrolase
FT                   domain-containing protein; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97560"
FT                   /db_xref="GOA:D6XV02"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV02"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADH97560.1"
FT                   /translation="MHVHVNKLIPGCVLREDVYVKTASPVMKRKTVLTDDHIYILEKFL
FT                   VEDVEVFQKLANGQVFNPAGGIKEEQDDTPNDEDDQATIEKDSFLDRYLTAVQSYKKHF
FT                   KNWQAGAKIEAYDVRKIFLPLYEREPNKYELMQLLALSTKQEYTYHHAVAVSIFSYLIG
FT                   KAEGLKSGEVIQLGLSGLLSDCGMAKLPFSVSSKTGSLTAEEYDEIKKHPIYGYRMLES
FT                   VPGFSKNALLGVLQHHEREDGSGYPLQVKRDKLHPFAKIIAIADTYHAMTSERPYRSAK
FT                   SPYHVMDELLMDGFGKLDHHLIHKLIPMLTDLSIGDRVVLNNDMAGEVVFLNQERPTKP
FT                   VVRLDNDKQIDLIKERDVHIEYLVSNASS"
FT   gene            11616..13170
FT                   /locus_tag="Bsel_R0001"
FT   rRNA            11616..13170
FT                   /locus_tag="Bsel_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            13445..16378
FT                   /locus_tag="Bsel_R0002"
FT   rRNA            13445..16378
FT                   /locus_tag="Bsel_R0002"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            16478..16593
FT                   /locus_tag="Bsel_R0003"
FT   rRNA            16478..16593
FT                   /locus_tag="Bsel_R0003"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(16705..17337)
FT                   /locus_tag="Bsel_0009"
FT   CDS_pept        complement(16705..17337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97561"
FT                   /db_xref="GOA:D6XV03"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97561.1"
FT                   /translation="MTIDDYLHEFQSRLTYVSEKEQTKIKYDIRSEIEQIKENLLEHEE
FT                   LDEEEAEHQAVASYLSPADMAQEINDQYFESIDEQFSGRSIAFIFVLSVILTPLGILII
FT                   PFVTGSFNGFSDQLIPRLVFMLIAALILFFYYPKHITSEQLRSLRQIFVVLYWYPVILV
FT                   FAFVLNLFRSDGFSMNLTLYLAVSLFIWLLILFGTRIFYQKQLNKPL"
FT   gene            complement(17324..17674)
FT                   /locus_tag="Bsel_0010"
FT   CDS_pept        complement(17324..17674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0010"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: cvi:CV_3776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97562"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV04"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADH97562.1"
FT                   /translation="MNESKWHMQISKGILEVAIMKLVEHEERYGYEITGMIQKGGTLSI
FT                   ANGSIYPILKRLEEQEWIVSRQIEHNGRLRKYYRLTKAGHTQLKVRERYLQELNQLLVT
FT                   LDQREAGNRDHR"
FT   gene            17985..19440
FT                   /pseudo
FT                   /locus_tag="Bsel_0011"
FT   gene            19638..21035
FT                   /locus_tag="Bsel_0012"
FT   CDS_pept        19638..21035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0012"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: csa:Csal_1549 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97563"
FT                   /db_xref="GOA:D6XV05"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV05"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ADH97563.1"
FT                   /translation="MLKKWGYALAAVTVSAAVLVPTERAEASYEPTVDTVILVDAKSGR
FT                   VLFERNIDQPLPPASMTKMMSEYLILEAVNDGDISWDTNVPISDFLASLSHNRSLSNVP
FT                   LRVDGEYNVEELYESVAIYSANASTMALAELISGSEGAFVSEMNEKGVELGLGTLMREA
FT                   GGEYGLEDLGEISEEGLGSFQFVNSTGLPNRLLEGNHPEGTGAEEDNYMSARAAATLAY
FT                   YLVNDYPEVLDVAGIPHKVFREGTGDAIDMPNWNNMIPGTENSHLDYEYVDGLKTGHTN
FT                   AAGFTFTGTGEKDGQRLVSVVMGADSIEHRFQETQRVLEWGFNTFYEEEIYAAGYSPDG
FT                   FETIAVSKGEEEEVPLESTEAIHRLIQEGDEELYSYEVVLDEDLLDEDGAMEAPVEAGT
FT                   VVGQMIISFDGEEDYIHDEIDRTTVVDLITTSDVERSGWFTLMLESIGGFFTGLWHSVT
FT                   ETVRGWL"
FT   gene            21160..22047
FT                   /locus_tag="Bsel_0013"
FT   CDS_pept        21160..22047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0013"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: apa:APP7_0616 pyridoxal biosynthesis lyase
FT                   PdxS; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97564"
FT                   /db_xref="GOA:D6XV06"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV06"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADH97564.1"
FT                   /translation="MEKQVGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARMADLTIVEEVQKAVSIPVMAKARIGHIVEARVLESMGVDYIDE
FT                   SEVLTPADEVFHLNKRDYTVPFVCGARNLGEASRRIGEGASMLRTKGEPGTGNIVEAVR
FT                   HQRLIQAQINKVVHMSEDELMTEAKNLGAPYEVLLEIKRNGRLPLVNFAAGGIATPADA
FT                   ALMMHLGSDGVFVGSGIFKSEDPAKFAKAIVEATTHYDDFKLIAEVSKGLGSAMPGLEI
FT                   SSLEDKDRMQERGW"
FT   gene            22066..22659
FT                   /locus_tag="Bsel_0014"
FT   CDS_pept        22066..22659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0014"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97565"
FT                   /db_xref="GOA:D6XV07"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV07"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ADH97565.1"
FT                   /translation="MIKIGVLALQGAVREHVKALQAPDVDVITIKRKEQLAGIDGLVFP
FT                   GGESTTMRRLINQYGFYEPLKAFAAKGKPIFGTCAGAILMASEIANQDDPHLAVMDMTV
FT                   ERNAFGRQKESFEVMLNMKDVAPDIEAVFIRAPIIQSVGPDVDVLAEYDGQIVAARQGP
FT                   FLACSFHPELTDDDRMHQYFVTLVRDAVQTVNNV"
FT   gene            22972..24246
FT                   /locus_tag="Bsel_0015"
FT   CDS_pept        22972..24246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0015"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: gme:Gmet_3528
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97566"
FT                   /db_xref="GOA:D6XV08"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV08"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADH97566.1"
FT                   /translation="MLDMKRLRADFEGVREKLATRNEDISALDDFQKLDEERRQVIQKV
FT                   EELKGKRNTVSEEISKMKRNKEDASDVIAEMKDVSAEIKALDEKQRDVDEKMKTLMLSI
FT                   PNIPHESAPVGLDETENEEIRTWGERPAFDFEGKAHWDLAVTHDIVDFERASKITGSRF
FT                   AIYKGAGARLERALMNFMMDFHEDKHGYTEVLPPYMVNRDSMTGTGQLPKFEEDAFQIR
FT                   EEDYFLIPTAEVPVTNMHRDEILTADELPIAYSAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVRFVKPEDSYAELEKLTGHAEKILQQLNLPYRVLNMCTGDLGFTAAKKYDIEVW
FT                   LPSYGEYKEISSCSNFEDFQARRANIRFKRDQKGKAEFVHTLNGSGLAIGRTVAAILEN
FT                   YQQADGTIKIPKVLQPYMGGKTRIG"
FT   gene            24835..25848
FT                   /locus_tag="Bsel_0016"
FT   CDS_pept        24835..25848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0016"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97567"
FT                   /db_xref="GOA:D6XV09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV09"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH97567.1"
FT                   /translation="MSNQDALLEIKDLHTGFTIDGKMHYAVKDVSFSVKPREVVCVVGE
FT                   SGCGKSVMSLSVMKLLPKHNGTIDKGQILYKGRDLVPLNDKEMNKIRGKDISMIFQEPM
FT                   TALNPVMTIGWQMDEVLHNHTDNSREEIRKKSISLLKQVGISRGEQIVNEYPHQLSGGM
FT                   RQRVMIAMAIACQPQLLIADEPTTALDVTVQAQILELITKIQDEVGMAVMLITHDLGVV
FT                   AEMADRVVVMYAGQVVEESDVDRIFYDPKHPYTKALLSSIPRMDEDREVLNTIKGIVPS
FT                   LKNMPEKGCRFVNRCPEAMPECSEIDPELGETEKGHSVRCILYDASKPGASTEVQQ"
FT   gene            25845..26834
FT                   /locus_tag="Bsel_0017"
FT   CDS_pept        25845..26834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0017"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: bja:blr1357 peptide ABC transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97568"
FT                   /db_xref="GOA:D6XV10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV10"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH97568.1"
FT                   /translation="MTKATETSEHLLVVEELKKYYPVRGGFFRRKVGDVKAVDNISLEL
FT                   KRGETFGLVGESGCGKSTAGRTITRLFKPTEGKITFEGRDITDLRGSELRNIRKDIQMV
FT                   FQDPYASLNPKMMVGSIITEPIINFNGGNESKYKEEVMQLLTRVGLPEDAYFKYPHEFS
FT                   GGQRQRIGIARALALKPKLIVADEPVSALDVSVQSQVLNLLKELQEEFNLTLLFIAHDL
FT                   SVVKHMSDRIGVMYLGNLVEIADADEIYANPKHPYTQALISAIPQPDPRNKSERIILSG
FT                   DVPSPQNPPVGCPFHPRCPQVMPECSEKKPELKGVNGEHRVSCLLYEK"
FT   gene            26876..28666
FT                   /locus_tag="Bsel_0018"
FT   CDS_pept        26876..28666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0018"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: pca:Pcar_1870 dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97569"
FT                   /db_xref="GOA:D6XV11"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV11"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADH97569.1"
FT                   /translation="MKRSKFLLPAALLSTTMVVAACGGNNDDGNENNTDPANDGNNDNA
FT                   EMNDDNDDNDETADGDVPQGGTVTYGYTSPFAGLLDWAWYEGQDDSLALSLFNGEALYQ
FT                   VRSENEFELEPSLAREWEWSDDNTTVTFHLEEGVMWHDGVELTAEDFKFSYETIAHPDG
FT                   NTARQSNVDRIVGYDEYRAGETDELAGVEVIDDYTFSVEFKEVQANNLANLWSYPMSVN
FT                   HLGHLEVSEMEDADEIRRNPVGLGAFVVDNVVPGEMIEYSAFEDYWQGAPNLDGVVYRI
FT                   VDGELSGELLAQGEVDVIELTGGQALPLQDDDRVYLEEIEALSYMYIGFKLGHWDDEEG
FT                   TAVMDNEKFQSKELRHAFAHAIDRQGIIDSFMEGYGTVINAPESVIRWSYPDESALNQY
FT                   EHDPDRARELLEEAGYEDVTGDGFVEDPNGDEFTVNFAAMNAPADIAEPRAQYIIQNLQ
FT                   DVGINAQLMDGQLLDFNLFYDLVEEDDSDIDIFMGAWGLATADPDLSGLWLSTDFWNFT
FT                   RWVNEESDELIRAGVSEEALDFEYRQSVYQEWHQLFNEELPMIPISSPVNIYGIAADVG
FT                   GITAEVRDAAGDAHLWYREQ"
FT   gene            28773..29738
FT                   /locus_tag="Bsel_0019"
FT   CDS_pept        28773..29738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oan:Oant_3319
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97570"
FT                   /db_xref="GOA:D6XV12"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV12"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97570.1"
FT                   /translation="MLIYTMRRILVMIPIMIMISVVVFVLALMMPGDALSGQIDPSNSN
FT                   PEYIAEMREELGLNDPAHVQYGRWISGVVQWDFGRSVVHRMGVMDLIGERLPNTIRLSV
FT                   LSLIITYILAFFMGRYAGRNPYTPGDYTIQGVNYLMLAIPSFVASIFAIFIFSFQLGWF
FT                   PATGSIGSGMTPGTFEYWMSRLHHVALPALVLGMLTTASYTQFLRNDIIESSQKDYVRT
FT                   ARAKGTPENEIYNKHILRNSIIPIVTLFGFDIASIIGGSVIIETIFSYRGIGELLITSI
FT                   QQRDSAVVVAVTLMLSIATLIGNLIADLVYGVVDPRIRVE"
FT   gene            29753..30655
FT                   /locus_tag="Bsel_0020"
FT   CDS_pept        29753..30655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sat:SYN_01342 oligopeptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97571"
FT                   /db_xref="GOA:D6XV13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV13"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97571.1"
FT                   /translation="MATIDKAKEKELEKRAKKQSPWSIARKKFFNNKLAMISLVFLVVV
FT                   TTLAILSYWIAPFDPSRVDPTNRFTEPGGDHLLGTDGAGRDVWTLLLYGARTSLLIGFT
FT                   ATIGIVIIATVIGSVSGYYGGIVDAVLMRFTDFMMNFPFLVFVIVLASIFRDSGVFALI
FT                   LVLMVLSWTGAARVVRSKTMSEKENEYVLAAISIGGTPFKVIRKHMLPNVMTTIIVQAT
FT                   LLLAVMIVAETALSFLGFGVPQGTPSWGNMMSEASNPNVIRNYWWIWMPPGLAITFTIL
FT                   SINFIGEGIKDAFNPKSLR"
FT   gene            30731..31255
FT                   /locus_tag="Bsel_0021"
FT   CDS_pept        30731..31255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0021"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gem:GM21_3629 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97572"
FT                   /db_xref="GOA:D6XV14"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV14"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADH97572.1"
FT                   /translation="MKTSQQLKDEAYMKEALTEADKAEAIGEVPIGAVIVKDDIIIARG
FT                   YNERETKQRATGHAELVAIEEACRILKTWRLEGCTLYVTLEPCPMCAGAIVQSRIDRVV
FT                   YGADDPKGGSCGTVVNLLDEPKFNHAPLVTSGTLKEEAADRLSSFFRALREARKQKKKE
FT                   GIPHETESDFT"
FT   gene            31230..31382
FT                   /locus_tag="Bsel_0022"
FT   CDS_pept        31230..31382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97573"
FT                   /db_xref="InterPro:IPR025550"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97573.1"
FT                   /translation="MRPNQISLETAQMLSEKLNMPLEHVMHTPPHILMAKLKEIEDQQE
FT                   ADKKD"
FT   gene            31614..31727
FT                   /gene="ffs"
FT                   /locus_tag="Bsel_R0004"
FT   ncRNA           31614..31727
FT                   /gene="ffs"
FT                   /locus_tag="Bsel_R0004"
FT                   /product="SRP RNA; RNA component of signal"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            31959..33761
FT                   /locus_tag="Bsel_0023"
FT   CDS_pept        31959..33761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0023"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: AAA ATPase; TIGRFAM: DNA polymerase III,
FT                   subunits gamma and tau; KEGG: gbm:Gbem_0212 DNA polymerase
FT                   III, subunits gamma and tau; PFAM: AAA ATPase central
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97574"
FT                   /db_xref="GOA:D6XV16"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV16"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADH97574.1"
FT                   /translation="MAYQALYRVWRPQVLKDVVGQEHITRTLRNALLQQKLSHAYLFSG
FT                   PRGTGKTSAAKIIAKAVNCEQAPVEEPCNTCSTCTGIQDGSIVDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSGASYKVYIIDEVHMLTTGAFNALLKTLEEPPRHVIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITAHTMIKRMEEIIEDGDLAVDPDALSMIARASEGGMRDALSLLD
FT                   QAISYADTSVTLDDVLSIIGAASQDLMYDVMEALLDQQVADGLTAIDRLMSDGKDPGRF
FT                   MEDFIFLTRDLLMVQAAPALDESGDRKLGDQRFEILASKASQSWLFALMEKLNHFQQQM
FT                   KWASHPAVFLEMFVVQACQMPSREPEKAGLPEEVRQQISTLEHKLADLERRLQQAPSQA
FT                   PAGRPDQPASPSQPQAPVRKQPQAASTGASRANMQRVKGVLNEATKAHLKAIHQKWAQI
FT                   QDTVKQQNVAASAWLNDCKPVVASSGHYVLAFRNEMHRGMVDDKFRDLIEGVVSQVMDT
FT                   QLVMYTLLEQDWEEVKAAFVKEQKKKQASQPADGNQESEDVPQDGDSEAAGQAVEDEPE
FT                   EDQGEAVVDEAIKMFGSDLVRIEE"
FT   gene            33801..34103
FT                   /locus_tag="Bsel_0024"
FT   CDS_pept        33801..34103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dal:Dalk_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97575"
FT                   /db_xref="GOA:D6XV17"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV17"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADH97575.1"
FT                   /translation="MGNMMKQMQKMQKDMAKAQEQLKDETVEATAGGGMVKVIASGEKR
FT                   ILDIQINEEAVDPDDVEMLEDLVLAATNEALNKVDEVVNEKMGKFTKGMNIPGMM"
FT   gene            34207..34803
FT                   /locus_tag="Bsel_0025"
FT   CDS_pept        34207..34803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0025"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: Zinc
FT                   finger C4-type, RecR; TOPRIM domain protein; KEGG:
FT                   ade:Adeh_3635 recombination protein RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97576"
FT                   /db_xref="GOA:D6XV18"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV18"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADH97576.1"
FT                   /translation="MQYPQPVTKLIEGFMKLPGIGPKTAARLAFYVLDMNEDDVLDFAK
FT                   ALVNAKRELTYCSVCHHITDTDPCRICDDQSRDRSIICVVQDAKDVIAMEKMREYTGMY
FT                   HVLHGAISPVDGIGPEDIFIPDLLKRLQDETVQELIIATNPNIEGEATAMYISRLVKPT
FT                   GMKVTRIAHGLPVGGDLEYADEMTLSRAIEGRREL"
FT   gene            34833..35045
FT                   /locus_tag="Bsel_0026"
FT   CDS_pept        34833..35045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0026"
FT                   /product="Protein of unknown function DUF2508"
FT                   /note="PFAM: Protein of unknown function DUF2508"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97577"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV19"
FT                   /inference="protein motif:PFAM:PF10704"
FT                   /protein_id="ADH97577.1"
FT                   /translation="MFSRKGKMRREKDAELIALLDRFKRQADEQDARIHQSVNASPEIE
FT                   RQSKLARAKYYFLLREARHRRTRFQ"
FT   gene            35368..36922
FT                   /locus_tag="Bsel_R0005"
FT   rRNA            35368..36922
FT                   /locus_tag="Bsel_R0005"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            37197..40130
FT                   /locus_tag="Bsel_R0006"
FT   rRNA            37197..40130
FT                   /locus_tag="Bsel_R0006"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            40230..40345
FT                   /locus_tag="Bsel_R0007"
FT   rRNA            40230..40345
FT                   /locus_tag="Bsel_R0007"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            40519..40926
FT                   /locus_tag="Bsel_0027"
FT   CDS_pept        40519..40926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0027"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="KEGG: hha:Hhal_1881 GTP cyclohydrolase I; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97578"
FT                   /db_xref="GOA:D6XV20"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV20"
FT                   /inference="protein motif:TFAM:TIGR03139"
FT                   /protein_id="ADH97578.1"
FT                   /translation="MSENYYLPRSGPMPRPASVEEGRNVLRDEAFPAPDVSVVRFKALE
FT                   FTAVCPKTGQPDFGQVEIEYVPRNKCIESKSLKFYLWSYRDEGAYCESLAAQIADDVMA
FT                   AIEPARVKVMVHQTPRGGIQLETEAERIHEA"
FT   gene            40916..41563
FT                   /locus_tag="Bsel_0028"
FT   CDS_pept        40916..41563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6876 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: protein of unknown
FT                   function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97579"
FT                   /db_xref="GOA:D6XV21"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV21"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ADH97579.1"
FT                   /translation="MKLNLTRSELLVLLNVIFATSLVIANVLAGKLVAFGEFIVIPAAV
FT                   ITYAFTFLITDVIHEKYGHETAKRTIIFGFIAQIFASTMIVLGGFLPVAPFAAESQAAY
FT                   ETLLGQNYRFAFASMAAYLGSQFFDVYVFKKLKEKTRSEKKWLRNNVSTASSQFVDTTI
FT                   FITIAFAGTVPNLWIMIVSQYAVKLIIALIDTPIFYLLTRRSSEEEESRQAS"
FT   gene            41662..42186
FT                   /locus_tag="Bsel_0029"
FT   CDS_pept        41662..42186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97580"
FT                   /db_xref="GOA:D6XV22"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97580.1"
FT                   /translation="MIHNRMVKRMMYIVILGVLLAGPLLIEVNRPVPYYLIVLAVFLYL
FT                   FRDIQDPDRSRNRFLYKCYQQRRRSYHVNAFREGAVFLLQVSFILAVSLSGGIEPFTVY
FT                   IRELWGLWIVVLVIALPLGYIRVEMNETLYEEAVQKMVENGETLRFLEEDPIERERILK
FT                   NQTGDDRQPLL"
FT   gene            42164..42646
FT                   /locus_tag="Bsel_0030"
FT   CDS_pept        42164..42646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97581"
FT                   /db_xref="GOA:D6XV23"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97581.1"
FT                   /translation="MTVNRFFNRHGKKLLILVYVLFLFSVPAFVDMVHSVLYLIAVAIL
FT                   SFIVIRRELAPEASERAFMAKWIEKRKRSVHVNGLINAGLTFVTMAASIFIVPFIVDGR
FT                   LMEWSALSAGQWTVIVLFLAVFSLAPGYVSVWEREKRYDKLVVKHERMRKHAEGDG"
FT   gene            complement(42673..43281)
FT                   /locus_tag="Bsel_0031"
FT   CDS_pept        complement(42673..43281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97582"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97582.1"
FT                   /translation="MLRSLFVSLPAAFLITLSACGTEADQNRGNEQPERDIDHVSGEAA
FT                   HMERGQETNNGAERNDETAPVSFTEQEAISLLHDYEETLQAFFEEAQAHGQTLESVGEI
FT                   GEVENELTRILSAEGADMHLNTYFREEDGTVTVIPTEAPVWFDETAPYTFYDNEQGSPR
FT                   LEQERENELIGHVRMIYSFSYDDRQETWRISDIDSEPMS"
FT   gene            complement(43326..43625)
FT                   /locus_tag="Bsel_0032"
FT   CDS_pept        complement(43326..43625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0032"
FT                   /product="CGLD25; hypothetical protein"
FT                   /note="KEGG: CGLD25; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97583"
FT                   /db_xref="GOA:D6XV25"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV25"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_82483"
FT                   /protein_id="ADH97583.1"
FT                   /translation="MSMYPYLLVFILLTGYAIFFAPGAGGGTDAIFQALIRGEFDAVDP
FT                   LVTAVFSSLGVYPFLFLMILTRIDTYRIPAWPFALFSFGLGAFAVLPGTLSCFA"
FT   gene            43792..45258
FT                   /locus_tag="Bsel_0033"
FT   CDS_pept        43792..45258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0033"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region; KEGG:
FT                   Os03g0848100; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97584"
FT                   /db_xref="GOA:D6XV26"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV26"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADH97584.1"
FT                   /translation="MDQRNEPLIEALQKRASEHPVSFHVPGHKHGRLFSDEGHDVLREA
FT                   AKWDQTEVQGLDDLYSASGVIQEAQVLLGALYQSGYSRFLTGGSTVGNLAMLYLASKRG
FT                   TKVLIQDNSHQSVYHGLALFQLEGIVMRTDREAFTGLPLGVSYKTLHKTLEAHPDAAMV
FT                   LLTSPSYEGYAQSLGDHLALSKSFGLLTGVDEAHGAHFLHPSFPNTALHDGADLVVQSA
FT                   HKMLPALTMGAWLHVGQEAPLPEEEVQQALNMLQTSSPSYLIMASLDAARAVLARLMED
FT                   PLNGEKTKLQTLLACLSQETAACVMPARLGTYVRDRIKLPLVARKPGMTHRWKERMERA
FT                   HAYPELHSARHLLLTLPLSGGERDIEKLQTHAKAWFGEAEGASNDVSFAVKSPDAAWYK
FT                   ADTQGGDHEGERARIPLSDAVGMKSAETVTPYPPGIPLIQRGQRITKTEIDAVIGADQA
FT                   GVRFQTGNRWKYEGIDVYIQKQGDDSNETT"
FT   gene            45245..45877
FT                   /locus_tag="Bsel_0034"
FT   CDS_pept        45245..45877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0034"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: dvm:DvMF_0023
FT                   dTMP kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97585"
FT                   /db_xref="GOA:D6XV27"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV27"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADH97585.1"
FT                   /translation="MRQHKRFITVEGGEGAGKTSVLKDLHQALILEGHDVLMTREPGGS
FT                   VIAEKIRDVILDPAHKEMDDRTEALLYAAARRQHLTEKVLPHLEKGGVVLCDRYVDSSL
FT                   VYQGGARGIGIEEVRELNHFATEAFYPGKTFYFDVSPEVGLGRIAANKGREFNRLDGES
FT                   LAFHEQVRATYLTLAKEEPARITVIDAERTQDEVLRDVLQKTRAHLG"
FT   gene            45933..46262
FT                   /locus_tag="Bsel_0035"
FT   CDS_pept        45933..46262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0035"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97586"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV28"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADH97586.1"
FT                   /translation="MKLIMAVIQDKDSNRLSDALVEHDFQATKLASTGGFLKAGNTTFM
FT                   IGVEDEHVNEVLTIINENCKAREQLVAPISPMGGNADSYVPYPVEVQVGGATVFVLPVD
FT                   QFEKF"
FT   gene            46299..47291
FT                   /locus_tag="Bsel_0036"
FT   CDS_pept        46299..47291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0036"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: geo:Geob_2151 DNA polymerase III, delta prime
FT                   subunit; TIGRFAM: DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97587"
FT                   /db_xref="GOA:D6XV29"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV29"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADH97587.1"
FT                   /translation="MALDFTAAEKTQPVAAGILKRTIEKNRLAHAYLFEGSRGTGKQEI
FT                   AKLVAKAFLCQVRESADPCGDCGDCRRVDSGNHPDVHLIEPDGTTIKVEQIRGLKKEFS
FT                   MRGMESGRKVYLVQDADLMTASAGNSLLKFLEEPDGEALAILMTTRPQRILKTILSRVQ
FT                   VLSFHPLAPDEFVKTLVNHDVKERDALLLSRMTSNLDEALSMTEEDWIAEARNKVIQLI
FT                   DDLVTRPGYSLISLQDDWIPFFKEKTDVQLGIDLMTLWYRDVLRTKVDQMEQIVYVDQE
FT                   DRLQKQAFSLSEERLARHLEAIVDTKRRIDANTTPQLAMEQMLIRLQEG"
FT   gene            47297..48124
FT                   /locus_tag="Bsel_0037"
FT   CDS_pept        47297..48124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0037"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: signal
FT                   peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97588"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV30"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADH97588.1"
FT                   /translation="MHRVIGVRFKKAGKIYYFSPGKMDIPTDEYVIVETARGVEFGKAV
FT                   IGTKEVDDNDVVLPLKNVLRVATDKDKTIVKENKVESAKAFEICHEKIQKHKLEMKLVD
FT                   VEYTFDRSKVLFYFTADGRIDFRELVKDLASVFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDMYESAKKELPDM
FT                   YKKLDTSYGRGKVVGLNMLERLVRVEIQESKQVVEFTLDELIEEGAVKTKQVK"
FT   gene            48140..48508
FT                   /locus_tag="Bsel_0038"
FT   CDS_pept        48140..48508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0038"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97589"
FT                   /db_xref="GOA:D6XV31"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV31"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ADH97589.1"
FT                   /translation="MNKNELFARVGQMEEQIGGLHRDLGELKNQLAEMLEENTHLQLEN
FT                   EHLRERLMNELTEKEPDRQAAAGEAPAVKQNVTPGFGEGYDNLARLYQEGFHICNLHYG
FT                   SIRKEGDCLFCLSFLNKK"
FT   gene            48580..49305
FT                   /locus_tag="Bsel_0039"
FT   CDS_pept        48580..49305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0039"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: dol:Dole_0543
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97590"
FT                   /db_xref="GOA:D6XV32"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV32"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADH97590.1"
FT                   /translation="MQERHDLLPGSCRKIVQRADLFSYSMDAVLLGKFATITKKTGRII
FT                   DLCSGTGAVPLVMSERTNAAIDAIEIQEALVTMSRKTMAINGVSERVTIHHGDVSDAGA
FT                   VVPWNRFDLVTCNPPYFKVTEDADLDGHDPFVVARHEVHLSLEVMIETAKKLLKSKGRL
FT                   AMVHRPERTGDIFAALEAQRFQAKRMQFVHPDQSREANMVLIEAVRDGQPGLSVLPPLI
FT                   VYDETKDFTKEFRDHYVSS"
FT   gene            49292..49573
FT                   /locus_tag="Bsel_0040"
FT   CDS_pept        49292..49573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0040"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="KEGG: shm:Shewmr7_0131 excinuclease ABC subunit C;
FT                   PFAM: Excinuclease ABC C subunit domain protein; SMART:
FT                   Excinuclease ABC C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97591"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV33"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ADH97591.1"
FT                   /translation="MSPVNHYVYMLRCKDNTLYTGYTTDPKRRLSMHETGKGARYTKGR
FT                   GPFVLEHLECYGTKGEAMSREHAIKALTRRQKEALIKAGKMTEMRDQG"
FT   gene            49570..50472
FT                   /locus_tag="Bsel_0041"
FT   CDS_pept        49570..50472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0041"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: gur:Gura_3753
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97592"
FT                   /db_xref="GOA:D6XV34"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV34"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADH97592.1"
FT                   /translation="MKYQQTFKGYDAQTGMLMLVPTPIGNLDDITYRAVQTLKEADVIA
FT                   AEDTRHSKKLSHVFDITTPLISYHEHNKHAREQELVDRARRGETIALVTDAGTPGISDP
FT                   GSELVSRFIEEDLPVHALPGANAAVTALVASGLPTETFSFIGFLDRNKKKRLETLNLWE
FT                   KAPSTLIFYESPHRLKEMLKAALDALGDRRAVISREITKQYETILRGSLSELFHWIEQE
FT                   GVKGECVVLIEGATGDEEAAVFGEEPEEAWWKDLGIADHVAHYVKAGMRSKEAIKEVAK
FT                   ERALPKRDVYQAYHVDQDG"
FT   gene            complement(50546..50833)
FT                   /locus_tag="Bsel_0042"
FT   CDS_pept        complement(50546..50833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0042"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97593"
FT                   /db_xref="GOA:D6XV35"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV35"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADH97593.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDIAEKDALEIYVDDERIIL
FT                   QKYKPNMTCQVTGEVSDDNLSIGNGKIILSPMGAKEIMKELEDYVAKNEA"
FT   gene            51640..53628
FT                   /locus_tag="Bsel_0043"
FT   CDS_pept        51640..53628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0043"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: gsu:GSU2232 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97594"
FT                   /db_xref="GOA:D6XV36"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV36"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADH97594.1"
FT                   /translation="MSNEKNTFYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLRGFD
FT                   VRYLTGTDEHGQKIEQKAEENGKSPQQFVDDISSDIQELWKKLDISYDDFIRTTEDRHK
FT                   QVVQHIFERFLEQGDIYLDEYEGWYSVSDETFYTELQLEDKEYDDNGNVTGGKSPDSGH
FT                   PVEKVREKSYFFKMSKYADRLLAYYEDNPEFIQPESRKNEMINNFIKPGLEDLAVSRTS
FT                   FRWGVPVKSDPEHVVYVWIDALSNYITALGYSTDENGLFQSHWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVPLIERYGLDALRYYLLR
FT                   EVPFGSDGVFTPEGFVERVNYDLANDLGNLLNRSVAMINKYFDGEVPAYVKDATSYDET
FT                   LTDLVEATVNKVEESMENMQFSVALTAIGQLISRTNKYIDETQPWILAKDETAREQLGS
FT                   VLHHLVESLRQVSIMLQPFMTETPKKIQEQLSIPDSLMGWDTLVTFGQIPAGKKVVAKG
FT                   EPIFPRLDTEEEVKAIVEMMGGQVKTEEPEPEVEAPEVDEITIDDFTKVDLRVAEVLEA
FT                   EKVKKADKLLKVQLDLGYEKRQVVAGIAKHYSPEDIIGKKVICVSNLKPVKLRGELSQG
FT                   MILAGSHGDTLTLATVSDHLPNGSQVK"
FT   gene            53672..54457
FT                   /locus_tag="Bsel_0044"
FT   CDS_pept        53672..54457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0044"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: pca:Pcar_1695 Mg-dependent DNase; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97595"
FT                   /db_xref="GOA:D6XV37"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV37"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADH97595.1"
FT                   /translation="MLFDTHVHLNADHFEDDLEEVLARAKEAGVDEMVVVGFDDKTIRI
FT                   AMDLIERYSFLYAAIGWHPVDAIDLTGEKLRWIEELSSHPKVVAIGETGLDYHWDKSPK
FT                   DVQKEAFRKQIALAKKVKLPIIIHDRDAHQDIVDILREENAADIGGIMHCFGGSVEIAR
FT                   QCLDMNFYISLGGPVTFKNAKRPKEVAKAVPADRLLVETDAPFLAPHPYRGKRNEPAYV
FT                   KLVAEQIAELREQSFEEIALQTTENARTLFGLSSKKEAD"
FT   gene            54665..55879
FT                   /locus_tag="Bsel_0045"
FT   CDS_pept        54665..55879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0045"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; protein of unknown function
FT                   DUF348; G5 domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97596"
FT                   /db_xref="GOA:D6XV38"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV38"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADH97596.1"
FT                   /translation="MVQKIKQASERFSARTFAVSVVGVLMLSGIIALVLMEVTKAEVAV
FT                   DMNGEEAVVYTHAENVGDVLNEQGIEIGEHDLVEPSVDTKIEANMTIAYTEAQEVRVSI
FT                   GEDTETVWTTADTVGDLLDDMNQEVGEHDQVEPDLNERLESGMDIAYQEAFPVTVTSDG
FT                   ETEEVWTVSTTVGDLLDAQAIELGELDRVEPEADEELNIEEDVRVVRVEKVTDVVEETI
FT                   SYGTVTENDSSMARGTEEVLEPGEEGKKEKRYEVVLEDGEEVSRELIDEEVVSESQDRV
FT                   VAVGTRSTQQNVSRSGNASSSSSSSSAGEWMNFTATAYTAYCTGCSGVTRTGIDLRANP
FT                   NSRVIAVDPSVIPLGSRVEVEGRGTFLAADTGGAINGRKIDIFMPDRSAALAFGRQSVR
FT                   VRIVE"
FT   gene            56059..56649
FT                   /locus_tag="Bsel_0046"
FT   CDS_pept        56059..56649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0046"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; KEGG:
FT                   predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97597"
FT                   /db_xref="GOA:D6XV39"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV39"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADH97597.1"
FT                   /translation="MERERIGPMIVVEGKNDSLTLKRWFDCDTIETNGSAVPDAVLERI
FT                   ALALGRRGVIVFTDPDYPGDQIRKIIDREVPGCSHAFLPKADAIDVRKGKVGIEHAGYR
FT                   ALQEALASVRRPGDDAQEDPSFETVPLRRLTEAGLLDGPDARSRRRILGELLGIGYNNS
FT                   KQLPKRLHQFRISLREFEEAQAAMIKEMEQFER"
FT   gene            56639..57535
FT                   /locus_tag="Bsel_0047"
FT   CDS_pept        56639..57535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0047"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: gme:Gmet_1304 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97598"
FT                   /db_xref="GOA:D6XV40"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV40"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADH97598.1"
FT                   /translation="MSDRDIATPTRTKAILERYGFSFKKSLGQNFLIEPNVLRKIVETA
FT                   ELSPDSGVIEIGPGIGALTEQSAKMARKVLAYEIDQRLLPILADTLSLYPHVEIRHGDV
FT                   LKADVHADVREVFEADQDLAVVANLPYYVTTPIMMKLLEEKLPVRVMVMMMQKEVAERI
FT                   AADPGSKNYGSLSIAVQYYAEAKLMFTVPKTVFVPQPNVDSAILRLTRRSEPPVDVLDE
FT                   GFFFDVIQGAFTQRRKTLLNNLSVFFKDSLSKPEVQAALEALEIDPKRRAETVSMAEFA
FT                   RISDAFLARKRAGTEED"
FT   gene            57755..58000
FT                   /locus_tag="Bsel_0048"
FT   CDS_pept        57755..58000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0048"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97599"
FT                   /db_xref="GOA:D6XV41"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV41"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADH97599.1"
FT                   /translation="MAKQTLADIKRSIECYVGQEVTICANGGRKKTIERSGMLEGVYPS
FT                   VFTVKLDRDKYPIERLSFSYTDLLTESVTLSLAEKV"
FT   gene            58187..59053
FT                   /locus_tag="Bsel_0049"
FT   CDS_pept        58187..59053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0049"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="KEGG: gme:Gmet_2849
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97600"
FT                   /db_xref="GOA:D6XV42"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV42"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADH97600.1"
FT                   /translation="MYLTEKAPAKINLTLDVLRKRKDGYHDVEMIMTTVDLADRIHLHP
FT                   LEKDEIVIEVENGILPLDKNNLAYQAASLLKKRCKVTTGVKIVIDKIIPVSAGLAGGST
FT                   DAAAVLRGLNKLWRLGLSLDDLAEIGLRIGSDVPFCVYGGTAIARGRGEDLTFIDAPPK
FT                   VWVLLAKPPQGVSTKEIYKRLKPGEMAHPDTAGMVEAIRTKDYRGICERLENVMEPVTF
FT                   SLAPDVARIKKRLESSGADGTVMSGSGPTVFSLIANDQKAHRLYNTLRGFMDQVYLVRL
FT                   IGERHQI"
FT   gene            59204..60025
FT                   /locus_tag="Bsel_0050"
FT   CDS_pept        59204..60025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0050"
FT                   /product="purine operon repressor, PurR"
FT                   /note="KEGG: pap:PSPA7_6072 xanthine
FT                   phosphoribosyltransferase; TIGRFAM: pur operon repressor;
FT                   PFAM: purine repressor; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97601"
FT                   /db_xref="GOA:D6XV43"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV43"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ADH97601.1"
FT                   /translation="MKFRRSGRLVDMTQYLLNHPHQQIPLTFFSERYLSAKSSISEDIG
FT                   IVKETFEGKNLGKVETSAGATGGVKFVPVIGNEDAVRQVDQLCEKLEDPARILPGGYLY
FT                   MMDVIGDPKAMQDLGRVIASHYQDAGVDAIMTMATKGIPLAYAVAQLLNVPVSIVRHEQ
FT                   RITEGSIVSINYVSGSKKQIQTMSLARRSLKPASNVLIIDDFMKAGGTIRGMMDLAEEF
FT                   QATVAGAAILTEAVHEEEKLVSDYVSLTRLTEVDVKERKITVKRGSLFDAD"
FT   gene            60190..60501
FT                   /locus_tag="Bsel_0051"
FT   CDS_pept        60190..60501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0051"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bba:Bd2801
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97602"
FT                   /db_xref="GOA:D6XV44"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV44"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADH97602.1"
FT                   /translation="MNVTDVRLRRTDESGRMLAIASITIDDEFVVHDIRVIDGDNGLFV
FT                   AMPSKRTPDGDFRDIAHPICSEARMKIQSAVLDEYAKAKEQKETVYEESGTSGSAGMK"
FT   gene            60679..62037
FT                   /locus_tag="Bsel_0052"
FT   CDS_pept        60679..62037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0052"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: ppd:Ppro_0501 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97603"
FT                   /db_xref="GOA:D6XV45"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV45"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADH97603.1"
FT                   /translation="MKNRYAVVLAAGKGTRMKSSLYKVLHPVCGKPMVQHIVDQLTACE
FT                   VDDIVTIVGHGADKVKDQLGERTSYALQAEQLGTGHAVMQAESVLGGKDGTTLVVSGDT
FT                   PLLTAETLTELMKHHEETGAKATILTAVAEDPTGYGRVLRNDGDQVERIVEHKDATYKE
FT                   RRVKEINTGTYVFDNTALFDALANVGNDNVQGEYYLPDVIEILQTRGETVSAHIAPDFN
FT                   ETMGVNDRVALSEAEKWMKRRINRHWMTQGVSMTDPEQTYISSDAVIGADTVIEPGSMI
FT                   KGNVTIGQGCVIGPHTVIEESAVADNSVIRQSTVNRSRVGSGVAIGPFAHLRPETTLGN
FT                   DVKVGNFVELKKMSMGDGSKASHLSYLGDADIGSDVNMGCGSITVNYDGKNKFLTTIED
FT                   GAFVGCNANLIAPVTVGKGAYVAAGSTITDDVPGESLAIARARQTNKEGYSKK"
FT   gene            62081..63031
FT                   /locus_tag="Bsel_0053"
FT   CDS_pept        62081..63031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0053"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   gur:Gura_3682 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97604"
FT                   /db_xref="GOA:D6XV46"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV46"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADH97604.1"
FT                   /translation="MATYGDKHLKVFTLNSNPALAQEIAASIGVKLGHSSVTRFSDGEI
FT                   QINIEESVRGCDIFVIQSTSSPANEHIMELLIMIDALKRASARTINVVIPYYGYARQDR
FT                   KARSREPITAKLVANLLETAGANRVITLDLHASQIQGFFDIPVDQLIGVPILASHFEKK
FT                   NLEDLVIVSPDHGGVVRARKMADRLKAPIAIIDKRRPKPNMSEVMNIVGKIEGKTAIII
FT                   DDIIDTAGTMTLAANAMKKSGAKEVYACSTHPVLSGPAIERIQQSEIKELVVTNTIPLP
FT                   EEKQIDKIIQLSVGDLLGKAIVHVFEDRSVSNLFD"
FT   gene            63130..63771
FT                   /locus_tag="Bsel_0054"
FT   CDS_pept        63130..63771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0054"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: dat:HRM2_16820 RplY; TIGRFAM: ribosomal 5S
FT                   rRNA E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal
FT                   protein L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97605"
FT                   /db_xref="GOA:D6XV47"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV47"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADH97605.1"
FT                   /translation="MATILKAAPRNEMKGSTLTTIRSAGWIPAVVYGKEYGNKPVQVEE
FT                   IDFIKTYRAEGKTGVFSLDVEGEKTDVMIYDIQYDMMKNQYVHIDFYAANMKEEMDADV
FT                   PVNVVGEAQGVKDGGVLQQGVFELSVRALPKELPDSIDVNVEELEVNDSIFVKDLKSGA
FT                   DFEFNNDPEEMVVSIVPPTDEPEEETAEEEEGAEPELVAGEEGEEENMEE"
FT   gene            63891..64466
FT                   /locus_tag="Bsel_0055"
FT   CDS_pept        63891..64466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0055"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG: tcx:Tcr_0394
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97606"
FT                   /db_xref="GOA:D6XV48"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV48"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADH97606.1"
FT                   /translation="MKLAVGLGNPGKAYERTRHNVGFDVIDHVSDQLGIPLDQNKFKGV
FT                   FGTHRTPKGPFTLLKPMTFMNLSGESIRQIADYYDIPPEDILVIYDDLDLPPGKIRLRT
FT                   KGGHGGHNGIRSTLSHLNTESFNRIRIGIGRPEPGTKVTDHVLGRFSPDDRELVDEAVR
FT                   QAAKAVEAWMDDSFILVMNDFNSKVNGP"
FT   gene            64608..68168
FT                   /locus_tag="Bsel_0056"
FT   CDS_pept        64608..68168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0056"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   transcription factor CarD; helicase domain protein; TRCF
FT                   domain protein; DEAD/DEAH box helicase domain protein; type
FT                   III restriction protein res subunit; KEGG: ppd:Ppro_0499
FT                   transcription-repair coupling factor; SMART: DEAD-like
FT                   helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97607"
FT                   /db_xref="GOA:D6XV49"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV49"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ADH97607.1"
FT                   /translation="MEGLLNSLSAAGELEKVIKGIEDGAGDQSLVGISGSARAMHLAAL
FT                   FRRTGKSQLIVTHNLFQAQKLYDDLITVLNTDDVLLYPANELISSEIAVASPEMRGQRL
FT                   EVMNEWSTGAKRIVIAPVAGVRRLLSPPDLWQEQRLTFTVGEDVDFDRTLGQFVNMGYS
FT                   RADMVSAPGEFSVRGGIIDVYPLTEEYPVRIELFDTEVDSIRLFDVETQRSVDERSTVV
FT                   AGPAREIIVQDVQYIRAAERLDEQLAKSLKRLKDDQIKETMINNVGEEIESLKNRQFFD
FT                   AIYKYMTLLYERPATLFDYMPDDTLVVLDEWARVQETAATLEREEAEWMTMMIAQGAMV
FT                   HDLSVSATLEHLVSETERQKLYIMLFGRQIPKVGPDRTYNVQTKTMQQFHGQIHLLKTE
FT                   VERWKEAGYAIVFVSGDDERAEKLERVLADYEIEASPAKAGSEPVKGKALIVQGLLHNG
FT                   FELPLQRIVVIAEEDVFTRKSRKPKRRQKLSNAERIKNYSELKTGDWVVHINHGIGKYL
FT                   GIETLQVGDVHKDYLHISYAGNDKLYVPVDQIDQVQKYVANEDKDPKLYSLGGSEWKKV
FT                   KKKVQSSVQDIADDLIKLYAERQETKGFAFSPDGLEQREFESTFPYQETDDQLQAIEEI
FT                   KKDMEQDRPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAILVPTTILAQQHYETIRE
FT                   RFQDFAINIGMLSRFRTRKQMKETTEALRKGTCDIVVGTHRILSKDVAFKELGLLVVDE
FT                   EQRFGVTHKEKIKQLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEHNDAFVREAIERELAREGQVFYLYNRVEDIEMVADRIGMMVPDANIAFAHGRMTEA
FT                   QLEAVMLDFLSGETDVLVTTTIIETGVDIPNVNTLIIQEADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTHQQDKVLTEVAERRLQSIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IASVGFDLYSQMLKEAIDDRKAGMDGKEEAEAQPSQAPDIDLDIQVDAYIPESYIYDSK
FT                   QKIDMYKRFKAIESFDDVEDLQVELIDRFGDFPDEVVRLFSVAKIRLYAKQEGVTSIAE
FT                   KNKECKVVLEEEAAAKIDGAKLFSLVNKLSSHITLSSDGKGITIHIKTKQIDDNLYLRL
FT                   LEEVLARLDEVEKSRVTQGG"
FT   gene            68161..69747
FT                   /locus_tag="Bsel_0057"
FT   CDS_pept        68161..69747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0057"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: afw:Anae109_1483 integral
FT                   membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97608"
FT                   /db_xref="GOA:D6XV50"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV50"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADH97608.1"
FT                   /translation="MAEKTADSWMAGALWLSLAALTAKVLSALYKVPYQNLTGDAGFYV
FT                   YQQVYPLYGVALVLGTAGFPLVLAGMTGDMTDQRRERLRFLFSVLSGVYIVMALAVFSL
FT                   ASVLASVMGDPALAGPLRWMALPFLLIPVLAFYRGVFQGQGETGPSALSQVLEQLARVV
FT                   VILAVAAWVTRVGGSAYEAGISAGAGAFTGGLAGVVILVVMMNKREPALIRGVYTFRGP
FT                   LLPSRWRSDLRNLLVPGLLVSLSALALIAFQLTDALTVYRGLLASGLAADEAAMTKGIY
FT                   DRSWPLIQFGAVITTVFSYAALPVVVRAVREGKHAEVKREIARAVQICLVFGSAAAVGL
FT                   AVIMPEVNAMLFTDEAGTTALRIAGLGVLPGSLFMTAAVLWHAVGKAGKPAVWLLAGVG
FT                   VKGLGNAVLVPLYGITGAAVASLAGFTLMAVAVLVQLIRSSRLPAIPRVFTGKLLIALG
FT                   LMGVAARIAGAAAGLLPVDGVRLTATLEALTGAGAGAVVFLFVIRALRLFDADTWHGLP
FT                   LIGSRLPYPHD"
FT   gene            69779..71236
FT                   /locus_tag="Bsel_0058"
FT   CDS_pept        69779..71236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0058"
FT                   /product="MazG family protein"
FT                   /note="KEGG: geo:Geob_1879 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97609"
FT                   /db_xref="GOA:D6XV51"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV51"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADH97609.1"
FT                   /translation="MGTIRILGLGAGDLDQLSLGVYREIRQAEQLFVRTARHPLIAALE
FT                   DEGVSFESFDTIYETESAFSDVYARIAGALLEKAEATEATIFYAVPGHPLVAEETVQRL
FT                   LRQEQVPVSIAGGGSFLDAMFTTLNIDPIEGFQLLDGLSMEPSDLMLKGHTVIGQVYDS
FT                   LSASEVKLKLMERLPDDFDVTIVDAAGTDRESVTVVPLYELDRSVTTSNLTAVYVPPAE
FT                   EEAIHYRTFDTLRGVIRTLRGPDGCPWDREQTHESLKRYMIEEAYELLEAIDEEDDDHI
FT                   ADELGDVLLQVMLHAQIGEDNGYFSIDDVIGNLSEKMVRRHPHVFSDTSVSGADQVVTN
FT                   WEAIKAEEKGHEDRHSMLDGIPKGLPGLMTAAKLQKKAGKVGFDWGEEGPMWEKLFEEI
FT                   HEWAQEVHTGTPDRSMKEFGDVLFAFVNIARFHQIDPEEALRQTNEKFRRRFQHVESRV
FT                   EESGLDWSAFSLEALDRWWEEAKDKGL"
FT   gene            71254..71523
FT                   /locus_tag="Bsel_0059"
FT   CDS_pept        71254..71523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0059"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: afr:AFE_0164 S4 domain protein; PFAM:
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97610"
FT                   /db_xref="GOA:D6XV52"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV52"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADH97610.1"
FT                   /translation="MMRLDKFLKVSRLIKRRTMAKEVADQGRVSINGQKAKASSTVQEG
FT                   DELKVEFGQKIVTLTVDRLKEAVKKDEAQTMYTIVSEERKQGEA"
FT   gene            71627..72013
FT                   /locus_tag="Bsel_0060"
FT   CDS_pept        71627..72013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0060"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   geo:Geob_2927 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97611"
FT                   /db_xref="GOA:D6XV53"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV53"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADH97611.1"
FT                   /translation="MAADGKERLKQLTEEVERKHRMYEEALRKKRRGLMRRLSVFGVVM
FT                   LLMTGVSVFTIIHQNSQVTEQEELISSLKEEQDVLQEEERRLGREIESLHDPAYIAEIA
FT                   RRDFFLTKPGEILFQVPREGQSDD"
FT   gene            72085..72507
FT                   /locus_tag="Bsel_0061"
FT   CDS_pept        72085..72507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0061"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG: S1 RNA
FT                   binding domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97612"
FT                   /db_xref="GOA:D6XV54"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV54"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADH97612.1"
FT                   /translation="MSIEIGSKVEGKITGITHFGAFVELPGKKTGLVHISEVADGYVEN
FT                   IKDVLTVGDTVTVKVLKIADDGKIALSIRKAAEKPAGEKPRRRPPGKPSGGDRRQEGTK
FT                   GSFEDKMSRFLKDSEERLSTLRKQTDSKRGGRSTKR"
FT   gene            72669..73430
FT                   /locus_tag="Bsel_0062"
FT   CDS_pept        72669..73430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0062"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   prw:PsycPRwf_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97613"
FT                   /db_xref="GOA:D6XV55"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV55"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ADH97613.1"
FT                   /translation="MSERADEMMDICLLAGEIMLSYGAETYRVEETLERMSVAAGFANV
FT                   HCFATTTGIFLSFEEKKGNGDLMQMVRIDNRMQDLNKVMEVNQVSREFTSGDLTIPEAH
FT                   ERLKEIYHAPVLYPLWVIHLFAGVAGSGFSYLFGGGLFDLLPAYIAAVASSVALVEFER
FT                   YLKVRFASEFMGAFTGGTVAILLVMFGLGNNLDQIIIGSLMPLVPGVPLTNSVRDLLSG
FT                   DLLAGMSRGVEALLTSLSIAGGVALTISIFL"
FT   gene            73447..73899
FT                   /locus_tag="Bsel_0063"
FT   CDS_pept        73447..73899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97614"
FT                   /db_xref="GOA:D6XV56"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV56"
FT                   /inference="similar to AA sequence:KEGG:Abu_0318"
FT                   /protein_id="ADH97614.1"
FT                   /translation="MVTFILQLIITFAATVAFGILFNVPKRALLIGGAIGVCTWAVLSI
FT                   SMMLGAAQVVSTGLASISAAVNAHFLARKLKLPVTTLSIPGILPLVPGSRAYFTMLAFV
FT                   DGDYLQGLEYGVETMLIAGAIAGGLVVGLSIFTFGKGGSHRYESNH"
FT   gene            73883..75310
FT                   /locus_tag="Bsel_0064"
FT   CDS_pept        73883..75310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0064"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: sat:SYN_02776 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein; Protein of unkown function DUF1946 PP-loop
FT                   ATpase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97615"
FT                   /db_xref="GOA:D6XV57"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV57"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADH97615.1"
FT                   /translation="MNQTIDAFIDRHRLIQAGDHLLVAVSGGVDSMVLLHLLHERRTRL
FT                   SITLSAVHAHHHLRRESADRDAELVASFCRELAIPFHLVHLSVEEERKLRNGSVQAVAR
FT                   DLRYEAFRHVMTETGANRLVTAHHGDDQIETVLLQLLRNTAQGGSGMRALRPIEGGTLI
FT                   RPLLDTEKASLYRYAKDSGIPFREDESNDSRHYRRNRIRQDILPVLKEEHPGIHRQIGR
FT                   YTEERQTESDYLDHLADEMLQEPSFSLMMKESGLQFSRPAFQRLPSALQKRAVHLLLTY
FT                   LSEHLRIRVAHNRRNLEQAVAVICGEKPNAAAFFHDGLKLVCAYGLVTIGLTDESLDSF
FT                   SSFVIQGEGEWVLPTGTLSCRLSETEDPLPETSAQAVTVPGQMLPITVRPRKPGDRITL
FT                   RSGEGRKKLKKIMIDEKIPQSMRDVWPILVDRHDTILWAPELAVSGELLRIETGHQENR
FT                   HFHIRFQRFEHETAILE"
FT   gene            75343..75885
FT                   /locus_tag="Bsel_0065"
FT   CDS_pept        75343..75885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0065"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: dps:DP0449 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97616"
FT                   /db_xref="GOA:D6XV58"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV58"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADH97616.1"
FT                   /translation="MKDDILEVLVSEEEIQEKVAELGGEITKMYEGKFPLVIGILKGCL
FT                   PFMGDLIQKVDTHLEFDMMDVSSYGEGFVSSGEVKIVKDLNTSVAGRDLLIVEDIIDSG
FT                   TTLHYLVNLFYHRGANSVKIVTLLDKPDGRTADVKADLAGFIVPDKFVVGYGLDYIEKY
FT                   RNLPFVGVLKPEVYQGK"
FT   gene            75947..77992
FT                   /locus_tag="Bsel_0066"
FT   CDS_pept        75947..77992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0066"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: pca:Pcar_0997 ATP-dependent
FT                   zinc protease/cell division protein; PFAM: peptidase M41;
FT                   peptidase M41 FtsH extracellular; AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97617"
FT                   /db_xref="GOA:D6XV59"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV59"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADH97617.1"
FT                   /translation="MNRIFSNTLFFLLIFLVIVGIVSLFSQEPGDTSEMSFTEFKQEFQ
FT                   EGNVESLSIQPNLDVYSARGQLEGAAEDEFFTVNIPDLQVFLEDIVTASGSESLNELTI
FT                   EPADEPSGWITFFTVLIPFIIIFILFFFLISQSQGGGSKVMNFGKSKAKLVSEDKKKAR
FT                   FKDVAGADEEKQELEEVVEFLKEPRKFAEIGARIPKGVLLVGPPGTGKTLIARAVAGEA
FT                   GVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRRRGAGLGGGH
FT                   DEREQTLNQLLVEMDGFGVNEGIILIAATNRADILDPALLRPGRFDRQIMVGRPDVKGR
FT                   EAVLEVHAKNKPLADDVELKTIAQRTPGFSGADLENLLNEAALVAARTDKKKIDMESVE
FT                   EAIDRTIAGPSKKSRVISEKEKNIVAHHEAGHTVVGVKLVNADMVHKVTIVPRGQAGGY
FT                   AMMLPREDRYFMTKPELIDKIVGLLGGRVAEEVMFDEVSTGAHNDFQRATGIARKMVME
FT                   YGMSDKLGPVQFGNSQGEVFLGRDINSEQNYSEAIAHEIDMEVQRIIKEAYAYCKEILT
FT                   EHKDKLELVAQMLIEYETLDAEQIYSLVEEGKMPENHHMIKKLNGESEEQQVDSDEQHK
FT                   EDDASESDGETAESGDTSEVDKADQPTDTEDAGDRDEPSTDDDERK"
FT   gene            78077..78844
FT                   /locus_tag="Bsel_0067"
FT   CDS_pept        78077..78844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0067"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="KEGG: glo:Glov_1318 pantothenate kinase; TIGRFAM:
FT                   transcriptional activator, Baf family; PFAM: Bvg accessory
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97618"
FT                   /db_xref="GOA:D6XV60"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV60"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADH97618.1"
FT                   /translation="MLMKLVMDIGNTTISIGLYKKQTRIAEWTVQTDYEKTVDEYGVLL
FT                   GQLFMMNNLLTSEVKRIMVSSVVPPLDETIRQVCARYLAIEPVFVGPGVKTGLNISTEN
FT                   PREVGSDRIVNAVAALEHYTPPLIVVDFGTATTVCYVNAKRQYVGGVIAPGMSIAMDAL
FT                   YDKASKLPKIDLTATDSVIGRNTTDAMRSGYLYGYLGQMEGIVQRMKDEQGEATVVATG
FT                   DHAVILGEHSRLIDHVHPHLTLDGLAILDERQP"
FT   gene            78880..79776
FT                   /locus_tag="Bsel_0068"
FT   CDS_pept        78880..79776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0068"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gme:Gmet_0041 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97619"
FT                   /db_xref="GOA:D6XV61"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV61"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADH97619.1"
FT                   /translation="MTNDYLVKALAYEDQVRIYAINSTDMTDEAARRHQTWRTVTAALG
FT                   RALSAGTMMGSMLKGDEKLTIKIEGNGPASPMVIDANAKGKARGYVGRVDVDPERREDG
FT                   KLNVGAVVGNEGHISVVKDLGMKDYFTGSVPLVSGELGDDFTYYFASSEQTPSSVALGV
FT                   LIGEEEKVLASGGFILQLMPEASDATIDEVERILQGLPSVTEMLSEGMTPEDIVARLSG
FT                   GTHRILEKLDTAFECNCSRERIETALYSIQEDELELMITEDEGAETSCHFCNEIYTFTK
FT                   ADLETILSNRKNGIQPE"
FT   gene            79875..80807
FT                   /pseudo
FT                   /locus_tag="Bsel_0069"
FT   gene            80967..82388
FT                   /locus_tag="Bsel_0070"
FT   CDS_pept        80967..82388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0070"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: gsu:GSU2383 anthranilate synthase component I;
FT                   PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97620"
FT                   /db_xref="GOA:D6XV62"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV62"
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /protein_id="ADH97620.1"
FT                   /translation="MARFATGISMSLSELGEDWYATFRKMIQPDGRHVLLESGRGGRYS
FT                   IMGLSPFATLTGKDERLHIDCHGKHETRTGPLLASLRSWMADWQIEADPVLPDIQGGLI
FT                   GQISYDLIREVETIPTEAADDLDTRDVELLAFDELYVVDHRAERLYAIAVSKDRDDTSR
FT                   AAGLLRDWQRHANAGESFTFSEKKDVLKSEDTPVRSLDEEAFSQAVEQVQTYIRQGDVF
FT                   QVNLSVRETRALKTPPEHLYDKLREINPSPYMGYLSLGDVTYVSASPELLVKIRGDEIS
FT                   TRPIAGTRSRGKSPEDDDRLARTLLENEKERAEHIMLVDLERNDLGRVSAFGTVEVDEL
FT                   MVIEKYSHVQHIVSNVKGQIRDDCDAFDVIAATFPGGTITGAPKIRTMEIIEELEPVRR
FT                   GAYTGSMGWIGFQGDMELNITIRTMVIRDGDVHVQAGAGIVIDSDPSAEFKECLKKAKA
FT                   LWHAKEQSEAEWSGQ"
FT   gene            82413..83009
FT                   /locus_tag="Bsel_0071"
FT   CDS_pept        82413..83009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0071"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: gur:Gura_1732 anthranilate synthase component
FT                   II; TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97621"
FT                   /db_xref="GOA:D6XV63"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV63"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADH97621.1"
FT                   /translation="MIVMIDNYDSFTYNLVQYLGEMGEELVVKRNDQVTLEEIEDLAPD
FT                   FLMISPGPCSPDEAGISMDVIRHFAGKIPVFGVCLGHQSLAQVFGGDVVQAERLMHGKT
FT                   SPVLHDGKTIFQGLESPFTATRYHSLIVKRETLPDCLEISAETAEGEIMALRHKEFAVE
FT                   GVQFHPESIMTDTGKQLLRNFLDVHRQGEAPCTSK"
FT   gene            82994..83854
FT                   /locus_tag="Bsel_0072"
FT   CDS_pept        82994..83854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0072"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: hch:HCH_06836
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97622"
FT                   /db_xref="GOA:D6XV64"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV64"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADH97622.1"
FT                   /translation="MYIKVNGTIIPEEEARISPLDHGFLYGMGLFETFRTYDGHPFLLD
FT                   EHMKRLREGADEMNIQLPAYDRQDVVETIRALLAANKNRDLYFRWNVTAGHGGVGLTAE
FT                   PYEEPGELVFVKDAPTPPATKQARVLTQTRNTPEGAVRRKSHHYMNSMLAKQELGQDPG
FT                   TEGMMLTSDGHVSEGIVSNVFWVKKDTLYTPSLETGCLPGVTRAWVADYADKQRLPFQE
FT                   GFFTAADMMQAEAVFVTNAIQEIVPVTAIDGRPFDSQTNPHLLALKQQYEIDKKQAYSL
FT                   GECGL"
FT   gene            83888..84748
FT                   /locus_tag="Bsel_0073"
FT   CDS_pept        83888..84748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0073"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   geo:Geob_3422 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97623"
FT                   /db_xref="GOA:D6XV65"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV65"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADH97623.1"
FT                   /translation="MMKEYFSTMKWDRYELNFADKTLIMGILNVTPDSFSDGGKFQSEQ
FT                   EWQDRAKEMVRQGADIIDIGGESTRPGSTPVPADEELGRVIPAIRAIRSVVDVPISIDT
FT                   YKSDVAEAAIQAGASIINDVWGARYDSGMAEVAARFDVPIILMHNRERMDYTDLITDMK
FT                   EDLRKSVRIAKEAGVKDERIILDPGIGFAKTYEDNLTVMRELDAFMDLGYPMLLGTSRK
FT                   SLIAKTLNLPVHERVEGTGATVCLGIEKGCDIVRVHDVLEMSRMARMMDVMIGKSQVPL
FT                   EKSGA"
FT   gene            84773..85147
FT                   /locus_tag="Bsel_0074"
FT   CDS_pept        84773..85147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0074"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   hypothetical protein; K01633 dihydroneopterin aldolase;
FT                   PFAM: dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97624"
FT                   /db_xref="GOA:D6XV66"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV66"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADH97624.1"
FT                   /translation="MDKVFVEGMKFYGYHGAYRAENELGQRFEADVLMEMDSKKAAETD
FT                   ALEDTVNYALVYETVRDIIEGEAVNLVETLANRVADDILRKFHLVEACTVKVTKPDPPI
FT                   PGHYDAVAVQVRRSRDHHAH"
FT   gene            85137..85658
FT                   /locus_tag="Bsel_0075"
FT   CDS_pept        85137..85658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0075"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: pca:Pcar_0250
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97625"
FT                   /db_xref="GOA:D6XV67"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV67"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADH97625.1"
FT                   /translation="MHTDAAKHAFIAFGSNQGERIDCLKKALKALSDHPDLSLVDVSAI
FT                   YETAPVGMTDQPSFLNMVAVFHSKLTAEALLNVTQSIEQDGGRERKERWGPRTIDLDIL
FT                   RHGTDTVDTAHLQIPHPRMMERAFVLVPLLDVAHHDPALCEDTLHEALKGCADRADVKR
FT                   ISDGLPDVDA"
FT   gene            85693..86691
FT                   /locus_tag="Bsel_0076"
FT   CDS_pept        85693..86691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0076"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: fph:Fphi_1896 tRNA-dihydrouridine synthase;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; NADH:flavin
FT                   oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97626"
FT                   /db_xref="GOA:D6XV68"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV68"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADH97626.1"
FT                   /translation="MTLSIGEITLKNPVVLAPMAGVCNPAFRLIAKEFGTGLVCAEMVS
FT                   DKAILHQNKRSINMLYVAEREKPLSLQIFGGTKETLVEAAKIVDTQTNADIIDINMGCP
FT                   VPKVTSCDAGARWLLNPDRIYEMVDAVVQAVDKPVTVKMRKGWDDDTVYAVDNAKAVEA
FT                   AGGKAIALHGRTRVQMYEGEADWSIIKTVKEAVGIPIIGNGDVQTPEDAKRMMTETGAD
FT                   GVMIGRAALGNPWMLYRTIHFLETGENIAEPSPEEKMRVAILHMDRLIDWKGERVAVKE
FT                   MRKHASYYMRGIRGAAKLRDQVNQMETREEMAGVMERIGLLDQERIPAGGS"
FT   gene            86869..88380
FT                   /locus_tag="Bsel_0077"
FT   CDS_pept        86869..88380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0077"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: gsu:GSU2271
FT                   lysyl-tRNA synthetase; PFAM: tRNA synthetase class II (D K
FT                   and N); nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97627"
FT                   /db_xref="GOA:D6XV69"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV69"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADH97627.1"
FT                   /translation="MTHEFDATDQLQVRREKLQNLLDLGMDPFGSKFERSHMAQPLHDD
FT                   YEEVEKDELADKDIKVTLGGRIMTKRGKGKAGFAHVQDLTGQIQIYVRKDQVGDEAYEL
FT                   FTKTDIGDIVGVSGVLFKTKVGELSIKVSSFEMLTKSLRPLPDKYHGLKDVEQRYRQRY
FT                   LDLIVNPEVRDTFVLRSKILQSMRRYLDDHGYLEVETPMMHAIPGGASAKPFITHHNAL
FT                   DMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHD
FT                   VMALTENLIAHIAQDVLGTTKVHYGDSEIDLEPKWRRLHMVDAIKEETGVDFWQEMTDE
FT                   EARDLAKKHGVPHKDTMKFGHIVNEFFEHFIEEKLIEPTFVYGHPLDISPLAKKNDEDP
FT                   RFTDRFELFIVGREHANAFSELNDPVDQRARFEAQLLEREQGDDEAHMMDEDFVESLEY
FT                   GLPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPQMRNSQPSGEQES"
FT   gene            88782..90336
FT                   /locus_tag="Bsel_R0008"
FT   rRNA            88782..90336
FT                   /locus_tag="Bsel_R0008"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            90465..90541
FT                   /locus_tag="Bsel_R0009"
FT                   /note="tRNA-Ile1"
FT   tRNA            90465..90541
FT                   /locus_tag="Bsel_R0009"
FT                   /product="tRNA-Ile"
FT   gene            90567..90642
FT                   /locus_tag="Bsel_R0010"
FT                   /note="tRNA-Ala1"
FT   tRNA            90567..90642
FT                   /locus_tag="Bsel_R0010"
FT                   /product="tRNA-Ala"
FT   gene            90833..93766
FT                   /locus_tag="Bsel_R0011"
FT   rRNA            90833..93766
FT                   /locus_tag="Bsel_R0011"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            93868..93983
FT                   /locus_tag="Bsel_R0012"
FT   rRNA            93868..93983
FT                   /locus_tag="Bsel_R0012"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            93995..94070
FT                   /locus_tag="Bsel_R0013"
FT                   /note="tRNA-Val1"
FT   tRNA            93995..94070
FT                   /locus_tag="Bsel_R0013"
FT                   /product="tRNA-Val"
FT   gene            94080..94155
FT                   /locus_tag="Bsel_R0014"
FT                   /note="tRNA-Thr1"
FT   tRNA            94080..94155
FT                   /locus_tag="Bsel_R0014"
FT                   /product="tRNA-Thr"
FT   gene            94163..94238
FT                   /locus_tag="Bsel_R0015"
FT                   /note="tRNA-Lys1"
FT   tRNA            94163..94238
FT                   /locus_tag="Bsel_R0015"
FT                   /product="tRNA-Lys"
FT   gene            94255..94341
FT                   /locus_tag="Bsel_R0016"
FT                   /note="tRNA-Leu1"
FT   tRNA            94255..94341
FT                   /locus_tag="Bsel_R0016"
FT                   /product="tRNA-Leu"
FT   gene            94367..94441
FT                   /locus_tag="Bsel_R0017"
FT                   /note="tRNA-Gly1"
FT   tRNA            94367..94441
FT                   /locus_tag="Bsel_R0017"
FT                   /product="tRNA-Gly"
FT   gene            94464..94552
FT                   /locus_tag="Bsel_R0018"
FT                   /note="tRNA-Leu2"
FT   tRNA            94464..94552
FT                   /locus_tag="Bsel_R0018"
FT                   /product="tRNA-Leu"
FT   gene            94571..94647
FT                   /locus_tag="Bsel_R0019"
FT                   /note="tRNA-Arg1"
FT   tRNA            94571..94647
FT                   /locus_tag="Bsel_R0019"
FT                   /product="tRNA-Arg"
FT   gene            94653..94729
FT                   /locus_tag="Bsel_R0020"
FT                   /note="tRNA-Pro1"
FT   tRNA            94653..94729
FT                   /locus_tag="Bsel_R0020"
FT                   /product="tRNA-Pro"
FT   gene            94749..94824
FT                   /locus_tag="Bsel_R0021"
FT                   /note="tRNA-Ala2"
FT   tRNA            94749..94824
FT                   /locus_tag="Bsel_R0021"
FT                   /product="tRNA-Ala"
FT   gene            94958..96512
FT                   /locus_tag="Bsel_R0022"
FT   rRNA            94958..96512
FT                   /locus_tag="Bsel_R0022"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            96787..99720
FT                   /locus_tag="Bsel_R0023"
FT   rRNA            96787..99720
FT                   /locus_tag="Bsel_R0023"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            99822..99937
FT                   /locus_tag="Bsel_R0024"
FT   rRNA            99822..99937
FT                   /locus_tag="Bsel_R0024"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(100459..101574)
FT                   /pseudo
FT                   /locus_tag="Bsel_0078"
FT   gene            101687..102397
FT                   /locus_tag="Bsel_0079"
FT   CDS_pept        101687..102397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0079"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: pca:Pcar_1965
FT                   putative MgtC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97628"
FT                   /db_xref="GOA:D6XV70"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV70"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ADH97628.1"
FT                   /translation="MDWSFLMTEDIDVMMIRLVMAAILGGLVGIEREYNHHPAGFRTHL
FT                   LVSVGSCLMMLLAFYGFQDYIAANEGNVNFDPSRLAAYVVSGIGFLGAGTILVQGSSVK
FT                   GLTTAASIWVVAGIGLTVGAGMYGPALIATLIVIISLFILAKVNFRISAEEKEEALMVK
FT                   LDGEMGRLGDVISILDGLGINVSFVSSEKQQAYHEKSMVEYRLVVEYKQWSDIYEAMET
FT                   IQQLDPVQSVSLDQ"
FT   gene            102499..102975
FT                   /locus_tag="Bsel_0080"
FT   CDS_pept        102499..102975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0080"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97629"
FT                   /db_xref="GOA:D6XV71"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV71"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADH97629.1"
FT                   /translation="MRNISDVIEGYLKQIIEKNDQELIEVKRSELAEQFDCVPSQINYV
FT                   IRTRFTVEKGYMVQSKRGGGGYIRITRVTPDNHLQLYDQLIDLSGDEISQTAAMHLIGR
FT                   LLEEEAITKREANLMESVMNREVLSIRLPYRDRLRAELLKAMLTTLKYKELEDS"
FT   gene            102994..103533
FT                   /locus_tag="Bsel_0081"
FT   CDS_pept        102994..103533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0081"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97630"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV72"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADH97630.1"
FT                   /translation="MLCQECQHYPATLHFTKIVNGEKMEMHLCETCAKDKGDYVPGSNS
FT                   FSIHQLLSGLMDQDASFPPKTDGSEQTRRPELQCPECGMTYRQFGEGGRFGCAVCYETF
FT                   DDKLDPVLARIHGGNHSHTGKIPKRQGKDLHLFREIEEQKEKLRKLIDEEAFEEAAAVR
FT                   DRIRELRQKTEQKEDE"
FT   gene            103535..104632
FT                   /locus_tag="Bsel_0082"
FT   CDS_pept        103535..104632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0082"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97631"
FT                   /db_xref="GOA:D6XV73"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV73"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADH97631.1"
FT                   /translation="MSLQSFISEAISPWMKNEGPESDIVISTRVRLARNEAHTAFPIAA
FT                   MNDRLEEVLNRVKQNFAGRSHRRFGELELLAMTDLSPNERRMLVEKHLISPNLAAGEHG
FT                   SGVLLSEDESLSVMINEEDHYRIQCLMSGFQLDACLKYANAMDDWMEEKVDFAFHENRG
FT                   YLTSCPTNVGTGLRSSVMMHLPALVLTNQFNRIVPAISQLGLVVRGIYGEGSEALGNLF
FT                   QISNQTTLGKTEADIVDNLKGVVKQLIQHERAARQTLYEQSQLFLEDRVYRSLGTLAYS
FT                   RRMETQEAMQRLSDVRLGIDLGIINHMQGKILNELMVLTQPGFLQHYAEQELSAEERDE
FT                   RRATFIRERLQLEKKNDHTNGGGQP"
FT   gene            104629..107076
FT                   /locus_tag="Bsel_0083"
FT   CDS_pept        104629..107076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0083"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: CLPC; CLPC (HEAT SHOCK PROTEIN 93-V); ATP
FT                   binding / ATPase; PFAM: ATPase AAA-2 domain protein; Clp
FT                   ATPase-like; AAA ATPase central domain protein; UvrB/UvrC
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; Clp domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97632"
FT                   /db_xref="GOA:D6XV74"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV74"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADH97632.1"
FT                   /translation="MMFGRFTERAQKVLSLAQEEASRLGHSNIGTEHILLGLIREGEGI
FT                   AAKALKGLGLGADKIQDEVEKLIGVGEQPAGQVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGNSDNGNGQNGSMAGQGGQAG
FT                   ASTPTLDSLARDLTAIAKEGQVDPVIGRSKEIQRVIQILSRRTKNNPVLIGEPGVGKTA
FT                   ISEGLAQQIVDNEVPEILRNKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRNAGNVI
FT                   LFIDELHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTMDEYRKYIEKDAALERRF
FT                   QPIQVDEPTVEESVQILAGLRDRYEAHHRVTITDEAIKAAVEMSDRYISDRFLPDKAID
FT                   LIDEAGSKVRLSTYTAPPNLKEKEQELEELRKEKDASVQSQEFEKAASLRDNEQKLKDE
FT                   LETLKDEWKKKQGQEDSEVTMEDIAQVVSTWTGVPVSKLAEEETDRLLKMEDILHGRVI
FT                   GQDEAVTAVSKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAETLFGDEDAII
FT                   RIDMSEYMEKHNTSRLVGSPPGYVGHDEGGQLTEKVRRKPYSVILLDEIEKAHPEVFNI
FT                   LLQVLEDGFLTDSKGRRVDFRNTAVIMTSNVGAQALKQEKSLGFTANQEDAKYKDMKSK
FT                   VMEELKKSFRPEFLNRIDETIVFHSLEKSHISEIVTLMAGELQKRLKEQEIDFELSDKA
FT                   KEKIADEGFDPEYGARPLRRALQKQVEDRLSEELLRGTISKGQSVVLDVEDGEYVVRQK
FT                   ERA"
FT   gene            107163..108575
FT                   /locus_tag="Bsel_0084"
FT   CDS_pept        107163..108575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0084"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: dal:Dalk_2956 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97633"
FT                   /db_xref="GOA:D6XV75"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV75"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADH97633.1"
FT                   /translation="MAKKKTKFICQECGYESAKWMGKCPGCSGWNTLVEEMEKPASSAH
FT                   EKRSFVTAGGGIRQKPQSIMDIEQKEENRVSTYINELNRVLGGGIVPGSLVLVGGDPGI
FT                   GKSTLLLQVSATLSEHKKKVLYISGEESLKQTKLRANRLGVGNDYLFVHSETDVEYIEQ
FT                   AIDQVNPDLVIIDSIQTVYLDHITSAPGSVSQVRESTSVFMRIAKTRGIAIFLVGHVTK
FT                   QGSIAGPRILEHMVDSVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMKETGLEEVLN
FT                   PSEIFLEERSSGASGSAVVASMEGTRPVLVEMQSLIAPTSFGNPRRMATGVDHNRISLI
FT                   MAVLEKRAGILLQNHDAYVKVAGGVRLDEPSIDLAIAISIVSSFRDQPSRAGDVIIGEV
FT                   GLTGEIRRVSRIEQRVQEAAKLGFERVIIPDRNFGGWTVPDGIEVIGARDINEAINEAL
FT                   GGRASGAPKFEL"
FT   gene            108550..109632
FT                   /locus_tag="Bsel_0085"
FT   CDS_pept        108550..109632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0085"
FT                   /product="DNA integrity scanning, DisA, linker region"
FT                   /note="PFAM: DNA integrity scanning, DisA, linker region;
FT                   protein of unknown function DUF147; KEGG: sse:Ssed_0374
FT                   ERCC4 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97634"
FT                   /db_xref="GOA:D6XV76"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV76"
FT                   /inference="protein motif:PFAM:PF10635"
FT                   /protein_id="ADH97634.1"
FT                   /translation="MEHRNLSFDDSLTRRILTFVAPGTPLREGIDNVLRANTGGLIVVG
FT                   FNEEMQKIVNGGFYINTDFSPAYLYELAKMDGAIILNEDATRILYANTQLVPENLIEST
FT                   ETGIRHRTAQRVAKQAGNLVISISQRRHVITLYQGRYRYSLKDIGVILTKANQAIQTLE
FT                   KYKSVLDQSITNLGALEFEELVTFQEVSQVMHRIEMVLRIKSELMNYVIELGDEGRLIS
FT                   MQLEELVLNIEQIALDLIMDYQKDSGTPPEDVLENLKRLSSDELLDDQIIVKLFGYGKI
FT                   VNLSDFPVSPRGYRILRKIPRIPPKVIRNLVRQFGTLSEMIRADIQELDEVEGIGEARA
FT                   NKIQDGLSRIQEQLIIDRHI"
FT   gene            109786..110895
FT                   /locus_tag="Bsel_0086"
FT   CDS_pept        109786..110895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0086"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: sat:SYN_01402 hypothetical protein; PFAM: PilT
FT                   protein domain protein; deoxyribonuclease/rho motif-related
FT                   TRAM; SMART: Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97635"
FT                   /db_xref="GOA:D6XV77"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV77"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADH97635.1"
FT                   /translation="MMKRIVQLLLAFTGGVLGYLFIADLTYLSLGMVGLDSLPGWLVNN
FT                   YTGALAGALILYLLFFWSVDPIVRFIQLLEDKLMNFPVADLIFGTVGLVVGLLLAFLVT
FT                   VAVNNIEIAFISAIVPIFLTLLLGYLGFQVGYKKKDELLGVFRQSKEDKDGDQANADEA
FT                   DARLPVPKLLDTSVIIDGRIADICQTGFLEGKLVIPNFVLEELQHIADSSDSLKRNRGR
FT                   RGLDILKRIQKEIPIEVEITDEDFDEIQEVDSKLVKLAKKTNGLVVTNDFNLNKVCDLQ
FT                   GVSVLNINDLANAVKPVVLPGEEMAIQIIKDGKEQNQGIGYLDDGTMIVVEGGRNAIGK
FT                   TIDVIVTSVLQTSAGRMIFAKPKSMDKAQ"
FT   gene            110911..111615
FT                   /locus_tag="Bsel_0087"
FT   CDS_pept        110911..111615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0087"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: ppd:Ppro_2969 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97636"
FT                   /db_xref="GOA:D6XV78"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV78"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADH97636.1"
FT                   /translation="MKPYKAVIPAAGQGSRMKAGHNKQFIHIGHDPLLVHTLRVFQEDS
FT                   SCQGIVVSVNPSEMASVQTLIDEAGITKVETLTAGGKERQESVYLGLKKLSGNPVVLIH
FT                   DGARPFIDQGAIKRLTAAVEPGVGVVVGVPVKDTIKRTREHIVQETLKRDELWSIQTPQ
FT                   GFLLTDILAAHAHAEEQGFPATDDASVFEFSGRPVKVVEGNYANIKVTTPEDLIFAEAI
FT                   LRSRSKNQQEKE"
FT   gene            111622..112119
FT                   /locus_tag="Bsel_0088"
FT   CDS_pept        111622..112119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0088"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; KEGG: ppd:Ppro_0012 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97637"
FT                   /db_xref="GOA:D6XV79"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV79"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADH97637.1"
FT                   /translation="MRIGQGFDVHQLKEGRPLILGGIEIPHEQGLDGHSDADVLLHTIA
FT                   DACLGAVAEGDIGKHFPDTDPAFKDADSAKLLEHVWQIVKEKGYTLGNLDCTIMAQRPK
FT                   MAPHIDAMRTRIAGLLEADVSQINVKATTTEKLGFTGREEGIASQAVVLLVEQPTAFTS
FT                   VP"
FT   gene            112188..113642
FT                   /locus_tag="Bsel_0089"
FT   CDS_pept        112188..113642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0089"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: glutamyl-tRNA synthetase family protein;
FT                   K01885 glutamyl-tRNA synthetase; TIGRFAM: glutamyl-tRNA
FT                   synthetase; PFAM: Glutamyl/glutaminyl-tRNA synthetase,
FT                   class Ic, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97638"
FT                   /db_xref="GOA:D6XV80"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV80"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADH97638.1"
FT                   /translation="MSNDIRVRFAPSPTGHLHIGGARSALFNYLFARNQGGKFIVRIED
FT                   TDQARNVETATEKLMESMKWLGIDWDESVDVGGPHAPYRSMERLDLYNRYVDQLLKEGK
FT                   AFHCYMTEEELEAEREEQRKRGETPMYSGRDRHLTDEQKRAYEAEGKKPVVRFMVPKGQ
FT                   EIVVDDAVRGKVTFDSDGIGDFVIVRTDGIPTYNFAVTVDDHTMGISHVIRGEEHLSNA
FT                   PLQVMLYEALGFETPTFAHASLILNEDRQKMSKRDESIIQFVEQYRDLGYMPEAIVNFI
FT                   ALLGWSPGGEQEIMTKNELIEAFSLDRVVKAPAVFDTKKLSWMNNQYMKEADDDQVVWL
FT                   AQPHLQKAGKLPEMMSDEQKQWAYDLIVLHKEKMDCGADIVPLTELFFQDEIEYDEDAK
FT                   AILGEEQVPEVLEAFLKNLDSLEEFEAAAIKKAMKDVQKSTGHKGKKLFMPIRVAVSGQ
FT                   QHGPDLPQMIALLGRTVVTTRLKGLL"
FT   gene            113728..114684
FT                   /locus_tag="Bsel_0090"
FT   CDS_pept        113728..114684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0090"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: glo:Glov_2614 serine O-acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97639"
FT                   /db_xref="GOA:D6XV81"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV81"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADH97639.1"
FT                   /translation="MRLLRASPDPPLNAPWSTRTKAAQAVDLRRQGAVMIPVKVKDSGQ
FT                   AAVVRILKQSGTARKRLCVPIRAQRRFFYPDHQEEHPSRIDRHEGGPPVKQAFKTLKND
FT                   VDIVLDQDPAARNRFEVIMTYSGVHAIWNHRIAHALWNRKFFFLARVISQISRFFTGIE
FT                   IHPGAQIGQHLFIDHGMGVVIGETCEIGDNVTIFQGVTLGGTGKEKGKRHPTIEDHVLI
FT                   ATGAKVLGSMTIGAHSRIGAGSVVLKEVPPHATVVGIPGKVVMKNGVKVADSHDHHKLP
FT                   DPIADKFDSLEQELKELREEVARLKKQGGQDRDHTAL"
FT   gene            114665..116068
FT                   /locus_tag="Bsel_0091"
FT   CDS_pept        114665..116068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0091"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   gme:Gmet_0057 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia; Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97640"
FT                   /db_xref="GOA:D6XV82"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV82"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADH97640.1"
FT                   /translation="MTIQLYNTLTRQKETFQPIEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   VVFDMVRRYLEYRGYDVTYVSNFTDVDDKIIKAANELDEDVMTVAERYIAAYYNDTEAL
FT                   GVRKADLHPRVTESMDDIITFITRLIDKGYAYESSGDVYFRTRKFDTYGQLSQQSLDDL
FT                   QAGARIQVEEKKEDPLDFVLWKTAKEGEIAWSSPWGEGRPGWHIECSAMVKKHLGDTID
FT                   IHAGGQDLSFPHHENEIAQSEALNEQRMANYWIHNGYINIDNEKMSKSLNNFILVHDII
FT                   RQFDPDVVRFFIVNAHYRSPINFSDEQLETAKTSLERIQTTYENLTYRLGESADLGGGQ
FT                   DKWFALIRKEGERFIASMDDDFNSANAVAVMFDLVRQANIYLTEKHTSKEVLEAFLKQF
FT                   DDMAFVLGIAVKRQAELLDEDVEQLIEERIQARKDRDFARADEIRDSLKDQGIILEDTP
FT                   QGTRWKRGS"
FT   gene            116072..116497
FT                   /locus_tag="Bsel_0092"
FT   CDS_pept        116072..116497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0092"
FT                   /product="ribonuclease III"
FT                   /note="KEGG: hypothetical protein; PFAM: ribonuclease III;
FT                   SMART: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97641"
FT                   /db_xref="GOA:D6XV83"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV83"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADH97641.1"
FT                   /translation="MDLNETVNEPEQLNALALAYMGDGVFDVYIRYRLISQGQVRPNQL
FT                   HRRATAYVSAKAQALILYSMQEQGVLREEEEAVVRRGRNAKSGTIPKHTDQQTYRMSTA
FT                   FEALIGYLYLTKQHERMDELIQYAVDWIEGKEELSHD"
FT   gene            116490..117257
FT                   /locus_tag="Bsel_0093"
FT   CDS_pept        116490..117257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0093"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: afw:Anae109_2230 RNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97642"
FT                   /db_xref="GOA:D6XV84"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV84"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADH97642.1"
FT                   /translation="MTDANQDYVYGKNPVIEVLRSGQTVHKVWIAEDSMKGQMNQVLGL
FT                   CKKMNVQVQTVPRKRLDQMADGIAHQGVIAQAAAYEYAEIDDLFARAKERGEDPFFLVL
FT                   DELEDPHNLGSILRTADASGAHGVIIPKRRSVGLTSTVAKTSAGAIAHVPVARVTNLAR
FT                   TMDELKKQGLWFVGTDAKGDVSYEGMTVDLPLALVIGSEGKGMSRLVKEKCDFLVSIPL
FT                   MGKVTSLNASVAASLLMYEVLRKRRELGMGADA"
FT   gene            117250..117759
FT                   /locus_tag="Bsel_0094"
FT   CDS_pept        117250..117759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0094"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   hypothetical protein; K06962"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97643"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV85"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADH97643.1"
FT                   /translation="MRNILLVDGYNIIGDWVELRDLQKTDLEGARDQLIEKMAEYQAYT
FT                   GTEVIIVFDAHMVPGLGKSYRNFSVEILYTREKETADERIEKLVTELKRVDTKIYVATS
FT                   DFVEQRVIFASGAYRKSARELRTEVSQLEKKIASDVSRTKATKLRGGIPINDEVKKMFE
FT                   RMRRGK"
FT   gene            117987..118631
FT                   /locus_tag="Bsel_0095"
FT   CDS_pept        117987..118631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0095"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: hip:CGSHiEE_09090 RNA polymerase sigma factor
FT                   RpoE; TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97644"
FT                   /db_xref="GOA:D6XV86"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV86"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ADH97644.1"
FT                   /translation="MNRNLQQSMHQLTDEEVVEYVREGDSQALEYLIEKYRNFVRAKSR
FT                   SYFLIGADHEDILQEGMIGLYKAIRDFKQGKESSFRAFAELCITRQIITAIKTATRQKH
FT                   IPLNSYVSLDKPIYEEDSDRTLLDVIMSSEELDPEEMFISQEDAARIEGTMNNVLSDLE
FT                   QKALMLYLEGSSYQEISEELNRHVKSIDNALQRVKRKLENHKDFKSAELFD"
FT   gene            118777..119331
FT                   /locus_tag="Bsel_0096"
FT   CDS_pept        118777..119331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0096"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: pfo:Pfl01_0184 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
FT                   type 2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97645"
FT                   /db_xref="GOA:D6XV87"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV87"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97645.1"
FT                   /translation="MDEELVKDALKGDERAFETLHARHADDVFRYVYMKVGNRQDAEEL
FT                   LQDVFVKMVRNLAGFSGKSTFRTWLFSIVRHTVIDYYRKKGRLQKEQPVENDLLEAVSD
FT                   TTASAEEVASNREKRSHVSDAFNSLPEGHREILYLRFMEGFSLKETARITGKSVMAVKS
FT                   LQKRAQAKMGEQVDEEVNIHV"
FT   gene            119324..120853
FT                   /locus_tag="Bsel_0097"
FT   CDS_pept        119324..120853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97646"
FT                   /db_xref="GOA:D6XV88"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97646.1"
FT                   /translation="MSENRINEQLKQEKDAIGEVSPSQEAKEKSLRAMKNEIHAQDNIL
FT                   QSMAKKKRRNQMLTGFTATVAAAAIGGLVLISSDDMAGWFNPAGTVDDGDHNENEEEAP
FT                   EPLDTNENEEEEEDERDEEDVETEEEQPSDVTADTFNDRTQRFYNIDLRAVDADDQEDV
FT                   IEEQSMRLLYEDGMPYSVYIPADWTLTTAEGQSYTRYEMADDHGTVFHLLQFETGDEAA
FT                   ARSELNRQLDDRDAEAVSEDEQWLQDFHWTMEMGDEPVEQYRAEDGDRVHNWSFVNPEG
FT                   YPDTPVILHSVETVENDDQIERAGYFHSSFQRVYPTVIDESDETGMNDRALEAEILSMS
FT                   DHGPGTRETVLNEAADLGVSFYYRERFSDSETGDRGQRMIRNESENDLSFVELGRFDTV
FT                   DEALAYQQDWRETGNGLPEQGEEPEMHLGNRYSGDWLVNRDVLGISGEVREELETEGGL
FT                   SAFNDEEMFFVFERNGYGYYMMTGGDIYFSEYIDLILHTWQWEDGTMLLDE"
FT   gene            120974..121123
FT                   /locus_tag="Bsel_0098"
FT   CDS_pept        120974..121123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0098"
FT                   /product="ribosomal protein L33"
FT                   /note="KEGG: sfu:Sfum_1542 50S ribosomal protein L33;
FT                   TIGRFAM: ribosomal protein L33; PFAM: ribosomal protein
FT                   L33"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97647"
FT                   /db_xref="GOA:D6XV89"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV89"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADH97647.1"
FT                   /translation="MSTKAVLACSECHSRNYTTMKTDSAGSDRLTIKKYCKTCKAHTVH
FT                   KETK"
FT   gene            121139..121345
FT                   /locus_tag="Bsel_0099"
FT   CDS_pept        121139..121345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0099"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: dol:Dole_0696 preprotein translocase, SecE
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97648"
FT                   /db_xref="GOA:D6XV90"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV90"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADH97648.1"
FT                   /translation="MAEQEQPKSKNPIKFLKDVSTEMKRVTWPNRQELTKYTIVVSTTV
FT                   IIMAIFFAISDFAISGILDLITN"
FT   gene            121454..121987
FT                   /locus_tag="Bsel_0100"
FT   CDS_pept        121454..121987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0100"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain protein; KEGG: cvi:CV_4198
FT                   transcription antitermination protein NusG; SMART: NGN
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97649"
FT                   /db_xref="GOA:D6XV91"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV91"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADH97649.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKTNLEKRVESMEMTDKIFRILVPVEEE
FT                   NEVKNGKSKVVTKKVFPGYVIVEMVMTDDSWYVVRNTPGVTGFVGSTGAGSKPTALLPD
FT                   EADAILRQMGVEAPKAEVDFDLKESVKVKEGPFANFIGSIEDISAEKRKLKVHVNMFGR
FT                   ETPVELDFHQVEKI"
FT   gene            122120..122587
FT                   /locus_tag="Bsel_0101"
FT   CDS_pept        122120..122587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0101"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: ribosomal
FT                   protein L11; KEGG: gur:Gura_1057 50S ribosomal protein L11;
FT                   SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97650"
FT                   /db_xref="GOA:D6XV92"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV92"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADH97650.1"
FT                   /translation="MLGLPHHGLKEVCRVAKKVIKVVKLQIPAGKANPAPPVGPALGQA
FT                   GVNIMGFCKEFNARTQEDAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIDSGSG
FT                   EPNKNKVATIKRDKVKEIAETKMPDLNAADVEAAMRMVEGTARSMGIVVED"
FT   gene            122704..123399
FT                   /locus_tag="Bsel_0102"
FT   CDS_pept        122704..123399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0102"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: gur:Gura_1058 50S ribosomal protein L1;
FT                   TIGRFAM: ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97651"
FT                   /db_xref="GOA:D6XVM8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVM8"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADH97651.1"
FT                   /translation="MAKKGKKYQDALKQIDREKLYNISEAVELVQKNATSKFDETIEMA
FT                   ARLGVDPKKADQQIRGAMVLPHGTGKTQTVLVFAKGDKAKEAEAAGADFVGEDDLINKV
FT                   AQGWMDFDVVVATPDMMAQVGKLGRTLGPKGLMPNPKTGTVTFDVTKAVEEIKAGKVEY
FT                   RVDKSGNIHVPLGKASFDQQKLEENFTAMVDQLVKIKPAASKGTYLRNVSITSTMGPGL
FT                   KVDVSGFKL"
FT   gene            123633..124133
FT                   /locus_tag="Bsel_0103"
FT   CDS_pept        123633..124133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0103"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: rpf:Rpic12D_2969
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97652"
FT                   /db_xref="GOA:D6XVM9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVM9"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADH97652.1"
FT                   /translation="MSAVIEQKKQVVDEIKTKLEESQSTIVVDYRGLDVSEITELRKQL
FT                   REAGVDFKVYKNSMVRRATEAAGLTDLDEHLTGPTAIAFSNEDVVAPAKILNGFAKDHE
FT                   ALELKAGVIEGKVTGLEEIKALATLPSRDGLVSMLLSVLQAPIRNFALATKAVADQKEE
FT                   QEA"
FT   gene            124204..124569
FT                   /locus_tag="Bsel_0104"
FT   CDS_pept        124204..124569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0104"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: vha:VIBHAR_00226 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97653"
FT                   /db_xref="GOA:D6XVN0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN0"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADH97653.1"
FT                   /translation="MTHQDMIAAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAAGAGAG
FT                   EEAAAEQTEFDVVLESAGSSKIGVIKIVREITGLGLKDAKALVDGVPAPVKEGVEKAEA
FT                   EEIKGKLEEAGASVELK"
FT   gene            124700..125305
FT                   /locus_tag="Bsel_0105"
FT   CDS_pept        124700..125305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0105"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; putative RNA
FT                   methylase; KEGG: tgr:Tgr7_2883 methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97654"
FT                   /db_xref="GOA:D6XVN1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN1"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADH97654.1"
FT                   /translation="MSDHYYTNKPGVKSSRRSFTDELRGQRLTFTVDKGVFSGGGVDFG
FT                   SRLLIESFTEPETEGDLLDIGCGWGPIGIALAMSTDQRRINMIDVNERSVELARLNAEA
FT                   NGVADNVHIEQRDATEGLPGDGCAAILTNPPIRAGKDVVFAIYEEASRQLKHGGELWVV
FT                   IQKKQGAPSTEEKLKALGLDVRTVTKKKGYVIFAGKKD"
FT   gene            125727..129272
FT                   /locus_tag="Bsel_0106"
FT   CDS_pept        125727..129272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0106"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   KEGG: similar to DNA-directed RNA polymerase beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 7; RNA polymerase Rpb2
FT                   domain 3; RNA polymerase Rpb2 domain 2; DNA-directed RNA
FT                   polymerase, beta subunit, external 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97655"
FT                   /db_xref="GOA:D6XVN2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN2"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADH97655.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLDLPNLIEIQTASYQWFLDEGI
FT                   REMFQDISPISDFTGNLVLEFIDYSLGDPKYPVDESKERDVTYSAPLRVKVRLINQETG
FT                   EVKEQEVFMGDFPLMTDTGTFIINGAERVIVSQLVRSPSVYFNNKVDKNGKKGYTATVI
FT                   PNRGAWLELETDAKDVVYVRIDRTRKIPATVLLRALGFGSDQEIIDLLGEDAYLRNTLD
FT                   KDNTDSSEKALLEIYERLRPGEPPTVESAKSLLDSRFFDPKRYDLASVGRYKMNKKLHI
FT                   KNRLFNQKLAETLVDPDTGEILAEEGTVIDRRVLDKLMPYLENNLGFRRINLNGGVVDD
FT                   EETEIQSVMIYSQEPTAEEGEKIKVIANGTVGEKVKNITPADIIASVSYFFNLLHGVGN
FT                   TDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNVITPQALINIRPVIA
FT                   SIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMC
FT                   PIETPEGPNIGLINSLSSYAKVNPFGFIESPYRKVDHDTGIVSEQVDYLTADEEDNYIV
FT                   AQANAKLNEDGTFTDENIICRFRGENIIVSRDRVDYMDVSPKQVVSAATACIPFLENDD
FT                   SNRALMGANMQRQAVPLLEPHSPLVGTGMEYVSAKDSGAAIVARARGRVEKVTAKFVDV
FT                   RELADVDGKETEGDLKRYNFMKFERSNQGTCYNQRPIVSEGMIVEKGEILADGSSMEKG
FT                   EMALGQNVLVGFMTWDGYNYEDAIILSERLVKDDVYTSIHIEEYESEARDTKLGPEEIT
FT                   RDIPNVGEDALRNLDERGIIRTGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKA
FT                   REVRDTSLRAPHGGDGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKINEGDKMAGR
FT                   HGNKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARQLGIHI
FT                   ATPVFDGAREEDVWETIEEAGMARDGKTVLYDGRTGEPFDSRVSVGVMYMIKLAHMVDD
FT                   KLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDTIG
FT                   RVKTYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMLSSNDEEIDMLEHEDDDEQT
FT                   GDKLNLNMESGESNA"
FT   gene            129404..133009
FT                   /locus_tag="Bsel_0107"
FT   CDS_pept        129404..133009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0107"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; KEGG:
FT                   gme:Gmet_0620 DNA-directed RNA polymerase, subunit
FT                   beta-prime; SMART: RNA polymerase I subunit A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97656"
FT                   /db_xref="GOA:D6XVN3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN3"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADH97656.1"
FT                   /translation="MIDVNNFEYMKIGLASSDKIRSWSRGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRSLEEVIYFASYVVTDPGETPLETKQLLSEKEYRAYYDKYG
FT                   RSFKATMGAEAIRKLLEDIDLDKEADMLKEELETAQGQRRTRAIKRLEVLEAFRHSDND
FT                   PSWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGQGLAHNIKSAKRKVERVQPEVWD
FT                   VLEDIIKEHPVLLNRAPTLHRLGIQAFEPILVEGRAIKLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAESRLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGSIFT
FT                   GPNEVLSAYQAGYVHLHTRIAMPVTSINKTNFEDAVQDHYLLTSVGKVIFNEILPDSFP
FT                   YINEPSAVNLEEVTPRKYFVPRGTDIKAEFKERELISPFKKGFLGDIIAEVFKKFKISE
FT                   TSVMLDKMKELGFYYSTKAGITIGVSDIVVLKDKQDILDEADEKVTRVTKQFRRGLITE
FT                   EERYDKVIEIWSNAKDVIQEKLLGTLVKTNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRTDDCGTDRGLEVKAIKEGTEVIESLYDRLVGRVSFQRIYHPETGELLADRNQDITED
FT                   MAKVIEDAGVQNVMIRSVFTCDTKHGACKKCYGRNLATGAEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEVFEARNPKGQAVISEIEGTVAEIKDQNDKKE
FT                   IVIQGPVETRNYPTMYGARMKVKEGDTILAGQELTEGSIDPKELLQVSGVQGVQEYLLR
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMMRKVRVIDSGDTDILPGSLVEIHQYSDANREVLL
FT                   KGGRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDQLVGLKENVII
FT                   GKLVPAGTGMQRYRQLKAVNTEDNSDIIEQPAGTE"
FT   gene            133095..133343
FT                   /locus_tag="Bsel_0108"
FT   CDS_pept        133095..133343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97657"
FT                   /db_xref="GOA:D6XVN4"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97657.1"
FT                   /translation="MSYEKVAQATNKVIGTKQTVKALEHQQVKELIVAEDADRHVLDKA
FT                   LQIASDSQVGISWVDSMKKLGKACGIDVGAAIVAIKK"
FT   gene            133451..133864
FT                   /locus_tag="Bsel_0109"
FT   CDS_pept        133451..133864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0109"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: gem:GM21_3333 ribosomal protein S12; TIGRFAM:
FT                   ribosomal protein S12; PFAM: ribosomal protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97658"
FT                   /db_xref="GOA:D6XVN5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN5"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADH97658.1"
FT                   /translation="MPTINQLVRKGRKSKVKSPDSPALNKGYNSFKKHQTDEDSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGSLDTAGVEGRMQSRSKYGTKRPKK"
FT   gene            133925..134395
FT                   /locus_tag="Bsel_0110"
FT   CDS_pept        133925..134395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0110"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: dvu:DVU1299 30S ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97659"
FT                   /db_xref="GOA:D6XVN6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN6"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADH97659.1"
FT                   /translation="MPRKGPVARRDVLADPIYNSKLVTRLINRIMVHGKRGKAQTILYN
FT                   AFDLVRERTGNDPQEVFEQALKNIMPVLEVKARRVGGANYQVPIEVKPDRRTTLGLRWL
FT                   VSYARLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            134494..136572
FT                   /locus_tag="Bsel_0111"
FT   CDS_pept        134494..136572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0111"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: gsu:GSU2860 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor G domain protein; elongation factor Tu domain 2
FT                   protein; elongation factor G domain IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97660"
FT                   /db_xref="GOA:D6XVN7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN7"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADH97660.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTATERILFYSGRIHKIGETHD
FT                   GGSQMDWMEQEQERGITITSAATTAQWNEHRINIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGADFIYSLGTLEDRLGANAAAVQ
FT                   LPIGAEDDFEGIIDLINMQAYFYLDDLGTRSEAREIPDEYKDQAEEYRDKLMEKVSEFD
FT                   EDFMMKYLEGEEITTDELKRAIRAATVSVEFYPVFCGSAFKNKGVQLLLDGVIDYLPAP
FT                   TDVAAITGIDLDTEEEVVRKPGDNEPFSALAFKVATDPFVGKLTFFRVYSGMVNAGSYV
FT                   KNSTKGKRERMGRILQMHANHREEIPTCFSGDIAAGVGLKDTGTGDTLCGEKENIILES
FT                   MEFPDPVISLSVEPKSKADQDKMGMALAKLAEEDPTFKTHTDDETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVDANVGAPQVSYRETLRQAANCEGKFVRQSGGRGQYGHVWIEFMPNDE
FT                   GAGFEFVDNIVGGVVPREYIGSVEAGVKDALDNGLLAGYPLVDVKARLYDGSYHDVDSN
FT                   EMAFKVAASMALKEAKKKCNPVLLEPIMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQIVKAMVPLSEMFGYATSLRSNTQGRGNYSMHFDHYEEVPKSISEEIIKKQGGE"
FT   gene            136696..137886
FT                   /locus_tag="Bsel_0112"
FT   CDS_pept        136696..137886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0112"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: nme:NMB0139 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97661"
FT                   /db_xref="GOA:D6XVN8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN8"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADH97661.1"
FT                   /translation="MGKEKFDRSKTHANIGTIGHVDHGKTTLTAAISTVLHKKSGKGSA
FT                   MAYDQIDGAPEERERGITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSRQVGVPYIVVFLNKVDMVDDEELLELVEMEVRDLLSEYD
FT                   FPGDDIPVIAGSALKALEGDADYEAKIFELMEAVDAYIPTPERDKDKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQLNVGDEVDIIGLEDETKKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVGRDDINRGQVLAKPGTITPHTKFQAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDV
FT                   TGIIHLPDGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGVVASITE"
FT   gene            138028..138849
FT                   /locus_tag="Bsel_0113"
FT   CDS_pept        138028..138849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97662"
FT                   /db_xref="GOA:D6XVN9"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97662.1"
FT                   /translation="MGIHDYYKQAGRAYFYLAAVSGLLFVVFFLLYFVLDQGPLAGLDG
FT                   LILLGVMAVGFLITGFVKRNRSVTPYPKGAVADSDHDLHSVSRVVIAPLVHLLREYQIF
FT                   SLDGKKIAEVRDVVTGWRRYRSFILELMGIRMFFPKTMEVATEDGVIYRLEKYGGFHEV
FT                   YELYTIEGTQIASFRMNVWNPFRTYATIHDRDGKQIGENDGGLSGQRFIVKDQEGNRLV
FT                   ELKHQGIPMEALELFSGVNGDLVDISQDRIDEELRPVFIMAPILVKLHFRK"
FT   gene            139115..139423
FT                   /locus_tag="Bsel_0114"
FT   CDS_pept        139115..139423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0114"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: ank:AnaeK_1933 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97663"
FT                   /db_xref="GOA:D6XVP0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP0"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADH97663.1"
FT                   /translation="MAKQKIRIRLKAYEHRVLDQSAEKIVETAKRSGASVAGPIPLPTE
FT                   KTVYTVLRAVHKYKDSREQFEMRTHKRLIDIVEPTPQTVDALMRLDLPSGVDIEIKL"
FT   gene            139469..140095
FT                   /locus_tag="Bsel_0115"
FT   CDS_pept        139469..140095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0115"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: glo:Glov_1346 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97664"
FT                   /db_xref="GOA:D6XVP1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP1"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADH97664.1"
FT                   /translation="MTKGILGKKLGMTQIFSENGEQVPVTVIEASPNVVLQKKTAEGEG
FT                   YEAIQIGYDDKKANRQNSPEKGHAEKAKTAPKRFVKEIRDVNTADYEIGQEIKVDIFAE
FT                   GDAIDVTGTSKGKGFQGAIKRHNQSRGPMSHGSRYHRRPGSMGPVDPNHVRPGKLLPGQ
FT                   MGGETVTIQNLEVVKVDTERNVILVKGNVPGARKSFVTITSATKA"
FT   gene            140123..140746
FT                   /locus_tag="Bsel_0116"
FT   CDS_pept        140123..140746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0116"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: sat:SYN_00986
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97665"
FT                   /db_xref="GOA:D6XVP2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP2"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADH97665.1"
FT                   /translation="MPKVNLYNQTGSQAGDIELNDAVFGIEPNESVVYDAIIMQQASMR
FT                   QGTHAVKGRSDVRGGGRKPWRQKGTGRARHGTNRSPIWVGGGVVFGPTPRSYAYNMPKK
FT                   QRRLALKSALSSKVNEDAIYVMEGLSFDAPKTKEMKKVLEALSAGKKVLVVTADYEDNV
FT                   ALSARNLPNVKFVTAEGVNVLDLVNFESLVITQDAVKQVEEVLA"
FT   gene            140746..141036
FT                   /locus_tag="Bsel_0117"
FT   CDS_pept        140746..141036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0117"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: sfu:Sfum_1557
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97666"
FT                   /db_xref="GOA:D6XVP3"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP3"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADH97666.1"
FT                   /translation="MATARDIIKRPIITERSADLMVDKKYTFEVNPRANKVQIRNAVEE
FT                   IFGVTVTNVNTMNYKGKFKRFGRYSGYTRKRKKAIVELSADSKELEFFEGV"
FT   gene            141067..141897
FT                   /locus_tag="Bsel_0118"
FT   CDS_pept        141067..141897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0118"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: glo:Glov_1349 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97667"
FT                   /db_xref="GOA:D6XVP4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP4"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADH97667.1"
FT                   /translation="MAIKKYKPTTNGRRGMSVLDFQEITTDKPEKSLLAPIHKRGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATIEYDPNRTANIALINYADGEKRYI
FT                   LAAKNMKVGQEIMSGKDADIKMGNALQLKDIPVGTIIHNIELRPGKGGQLVRSAGADAQ
FT                   VLGKEGNYVLVRLRSGETRLILATCRATIGQVGNIEHELVTIGKAGRSRWLGKRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGYKTRSKNKESNKYIVRRRKK"
FT   gene            141958..142236
FT                   /locus_tag="Bsel_0119"
FT   CDS_pept        141958..142236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0119"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: mmw:Mmwyl1_4272 ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97668"
FT                   /db_xref="GOA:D6XVP5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP5"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADH97668.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQSENNDKKVIKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYVQEDMVGHKLGEFAPTRTYKGHASDDRKTKR"
FT   gene            142259..142600
FT                   /locus_tag="Bsel_0120"
FT   CDS_pept        142259..142600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0120"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: pca:Pcar_0706 50S ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97669"
FT                   /db_xref="GOA:D6XVP6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP6"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADH97669.1"
FT                   /translation="MEAKAVAKQVRIAPRKVRLVIDLIRGKEVGEAISILNHTPKKASP
FT                   VVEKLLNSAIANAEHNYEMEPDNLVVSQAFVDEGVTLKRFRPRAQGRASRINKRTSHIT
FT                   LVLTEKKEG"
FT   gene            142603..143262
FT                   /locus_tag="Bsel_0121"
FT   CDS_pept        142603..143262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0121"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; KH type 2 domain protein;
FT                   Ribosomal protein S3 domain; KEGG: ppd:Ppro_0686 30S
FT                   ribosomal protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97670"
FT                   /db_xref="GOA:D6XVP7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP7"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADH97670.1"
FT                   /translation="MGQKINPNGLRVGVIKGWESKWYAGKDYADLLHEDIRIREFLENR
FT                   LTEASVSTIEIERAANRVNVTIFTAKPGMVIGKGGSEVEALRKALNDMTGKRVHININE
FT                   IKRPDLDSKLVAENIARQLENRISFRRAMKQTIQRTMRSGAKGIRTQVSGRLGGADIAR
FT                   SESYSEGTVPLHTLRADIDYGTAEADTTYGKLGIKVWIYKGEVLPTKGTKQEEGGN"
FT   gene            143265..143699
FT                   /locus_tag="Bsel_0122"
FT   CDS_pept        143265..143699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0122"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: gsu:GSU2850 50S ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97671"
FT                   /db_xref="GOA:D6XVP8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP8"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADH97671.1"
FT                   /translation="MLMPKRVKFRREHRGKMRGRAKGGKEIAFGEYGLQALEASWITNR
FT                   QIESARIAMTRYMKRGGKVWIKIFPDKPYTSKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLASHKLPVRTKFVKREEVGGDANES"
FT   gene            143689..143892
FT                   /locus_tag="Bsel_0123"
FT   CDS_pept        143689..143892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0123"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: pca:Pcar_0709 ribosomal protein L29; TIGRFAM:
FT                   ribosomal protein L29; PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97672"
FT                   /db_xref="GOA:D6XVP9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP9"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADH97672.1"
FT                   /translation="MKANDIRNLTTAEIEQKSKSLKEELFNLRFQLATGQLDNPARIRE
FT                   VKRSIARAKTVLRERELGITNE"
FT   gene            143914..144174
FT                   /locus_tag="Bsel_0124"
FT   CDS_pept        143914..144174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0124"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: prw:PsycPRwf_0435 ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97673"
FT                   /db_xref="GOA:D6XVQ0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ0"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADH97673.1"
FT                   /translation="MERNNRKSYVGRVTSDKMDKTITVVVETYKMHPLYGKRVRYSKKL
FT                   KAHDENNTAKKNDVVRIMETKPLSKDKRFRLVEVLEEAVIV"
FT   gene            144214..144582
FT                   /locus_tag="Bsel_0125"
FT   CDS_pept        144214..144582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0125"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: abo:ABO_0407 50S ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97674"
FT                   /db_xref="GOA:D6XVQ1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ1"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADH97674.1"
FT                   /translation="MIQQESRLKVADNSGAREVQCIKVLGGTGRKTANIGDVIVCSVKQ
FT                   ATPGGVVKKGEVVRAVIVRSKSGMRRKDGSYIRFDENAAVIVRPDKGPRGTRIFGPVAR
FT                   ELRDNQFMKIVSLAPEVL"
FT   gene            144623..144949
FT                   /locus_tag="Bsel_0126"
FT   CDS_pept        144623..144949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0126"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: rfe:RF_0289 50S ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97675"
FT                   /db_xref="GOA:D6XVQ2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ2"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADH97675.1"
FT                   /translation="MKQPTLHVKKGDNVKVISGKDKGKEGKILEAYPSQSRVLVEGVNM
FT                   VKKHAKPSQANPQGGILTQEAAIHVSNVMPIDPKTGEPTRVGYKEENGKKVRIAKKSGE
FT                   SLDN"
FT   gene            144981..145520
FT                   /locus_tag="Bsel_0127"
FT   CDS_pept        144981..145520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0127"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: gur:Gura_1078 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97676"
FT                   /db_xref="GOA:D6XVQ3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ3"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ADH97676.1"
FT                   /translation="MSRLKEKFNTEITPSLKEKFNYSSVMEVPRVDKIVVNMGVGDAVQ
FT                   NSKVLDKAVEELAQITGQKPLITKAKKSIAGFKLREGMPIGAKVTLRGERMYDFLDKLI
FT                   AVSLPRVRDFRGVSKKAFDGRGNYTMGVKEQLIFPEINYDDVDQVRGMDIVIVTTADSD
FT                   EEARELLTQMGMPFQK"
FT   gene            145551..145736
FT                   /locus_tag="Bsel_0128"
FT   CDS_pept        145551..145736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0128"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: abu:Abu_0765 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97677"
FT                   /db_xref="GOA:D6XVQ4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ4"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADH97677.1"
FT                   /translation="MAKKSMIAKQQRTKKFAVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAHKGQIPGVRKASW"
FT   gene            145766..146164
FT                   /locus_tag="Bsel_0129"
FT   CDS_pept        145766..146164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0129"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: ppd:Ppro_0694 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97678"
FT                   /db_xref="GOA:D6XVQ5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ5"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADH97678.1"
FT                   /translation="MVMTDPIADMLTRIRNANTVRHNSLELPSSKMKIQIADILKREGF
FT                   IRDYENIEDNKQGILRIFLKYGADNQKVITGLKKISKPGLRVYAKSDELPRVLGGLGIA
FT                   VISTSDGIVTDKEARQKKAGGEVIAYVW"
FT   gene            146195..146731
FT                   /locus_tag="Bsel_0130"
FT   CDS_pept        146195..146731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0130"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: bbt:BBta_5055 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97679"
FT                   /db_xref="GOA:D6XVQ6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ6"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADH97679.1"
FT                   /translation="MSRIGLKPVEIPSGVEVKLDGNVMTVKGPKGELSRELHADMEVTV
FT                   EDAQVTVARPSDHKDHRALHGTTRSMINNMVEGVSKGFEKKLELVGVGYRAQKSGKKLI
FT                   LNVGLSHQVEFEDGENIEIEVPNNTNITVKGIDKEAVGALASNIRATRKPEPYKGKGIR
FT                   YEGEYVRRKEGKTGK"
FT   gene            146765..147127
FT                   /locus_tag="Bsel_0131"
FT   CDS_pept        146765..147127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0131"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: dat:HRM2_36100 RplR; TIGRFAM: ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97680"
FT                   /db_xref="GOA:D6XVQ7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ7"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADH97680.1"
FT                   /translation="MITKTDKNAVRKKRHAHVRRSITGTAERPRLNVFRSNNHIYAQLI
FT                   DDVAGVTLASASTVDKELNIEKGGNKEAARKVGELVAKRALDKGYESIVFDRGGYLYHG
FT                   RVKELADGAREAGLKF"
FT   gene            147153..147650
FT                   /locus_tag="Bsel_0132"
FT   CDS_pept        147153..147650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0132"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: pca:Pcar_0718 30S ribosomal protein S5;
FT                   TIGRFAM: ribosomal protein S5; PFAM: Ribosomal protein S5;
FT                   ribosomal protein S5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97681"
FT                   /db_xref="GOA:D6XVQ8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ8"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADH97681.1"
FT                   /translation="MRIDPTKLEIEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHV
FT                   GFGMGKALEVPEAIRKAIEDGKKNMIQVPIQGTTIPHQITGKFGAGSVLLKPASEGTGV
FT                   IAGGPVRAVLELAGIGDILSKSLGSNNPINMVRATIQGLDEMKSPEEVAKLRGKSVEEL
FT                   LG"
FT   gene            147663..147851
FT                   /locus_tag="Bsel_0133"
FT   CDS_pept        147663..147851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0133"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: sat:SYN_01593 50S ribosomal protein L30P;
FT                   TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein
FT                   L30"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97682"
FT                   /db_xref="GOA:D6XVQ9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ9"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADH97682.1"
FT                   /translation="MAKKLEITLTRSLIGRPEDQRVTVKTLGLRKMHQTVVQEDNEAMR
FT                   GMVNKVSHLVTVNEIDA"
FT   gene            147881..148324
FT                   /locus_tag="Bsel_0134"
FT   CDS_pept        147881..148324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0134"
FT                   /product="ribosomal protein L15"
FT                   /note="KEGG: pca:Pcar_0720 ribosomal protein L15; TIGRFAM:
FT                   ribosomal protein L15; PFAM: ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97683"
FT                   /db_xref="GOA:D6XVR0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR0"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADH97683.1"
FT                   /translation="MKLHELKPAAGSRNKTRNRVGRGIGSGNGKTAGRGHKGQNARSGG
FT                   GVRPGFEGGQMPIFRRLPKRGFKNPNRVEYAIVNLDTLNRFEDGTEVTPELLVETGTVK
FT                   NERGGIKILGNGTLERKVTVKAHKFSSTAKEAIEAAGGTAEVL"
FT   gene            148713..149366
FT                   /locus_tag="Bsel_0135"
FT   CDS_pept        148713..149366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0135"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: sfu:Sfum_1576 adenylate kinases; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97684"
FT                   /db_xref="GOA:D6XVR1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR1"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADH97684.1"
FT                   /translation="MNLILMGLPGAGKGTQAEKIVEQYNIPHISTGDMFRAAIKNGTEL
FT                   GLKAKAFMDEGNLVPDEVTVGIVKERLSQDDCSDGFLLDGFPRTVAQASALEEMLASLD
FT                   RKLDHVIYVQVPEEELFKRLTGRWICPTCGTAYHEVFNPPKENGKCDKDGSDLMQRDDD
FT                   RPETVEKRLKVNMEQTQPLVDFYSEKGYLRDIDGNREIGNVFADIEDLLKGSRQ"
FT   gene            149363..150112
FT                   /locus_tag="Bsel_0136"
FT   CDS_pept        149363..150112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0136"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: pca:Pcar_0723 methionine aminopeptidase, type
FT                   I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97685"
FT                   /db_xref="GOA:D6XVR2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR2"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADH97685.1"
FT                   /translation="MIICKTPRELDIMRHAGKIVALTHQELQKHIAPGITTMELDQIAD
FT                   RFIRDHDAIPSFKGYGGFTGSICASVNEELVHGIPGERVLEDGDIISIDIGAKYQGYHG
FT                   DSAWTYPVGTIDAASQKLLDVTENSLFKGLEHAAPGARLSDISHAIQAYVEDNGFSVVR
FT                   EYVGHGVGQELHEDPQIPHFGPPGKGPRLKKGMVLAVEPMINAGKRHVKTLSDNWTVVT
FT                   SDGERCAHFEHTIAIVDKGYEILTKAD"
FT   gene            150137..150439
FT                   /locus_tag="Bsel_0137"
FT   CDS_pept        150137..150439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97686"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97686.1"
FT                   /translation="MKDPESDVQVGELVRILNGRDKDQFACVIEVLDERFVLIADGDKR
FT                   KVDRAKRKNISHIEPMKIVVPEVRNSIDDTGRVTNAKLRFAISSYLEDHLLKKGE"
FT   gene            150444..150662
FT                   /locus_tag="Bsel_0138"
FT   CDS_pept        150444..150662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0138"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: dps:DP1147 translation initiation factor IF-1;
FT                   TIGRFAM: translation initiation factor IF-1; PFAM: S1 IF1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97687"
FT                   /db_xref="GOA:D6XVR4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR4"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADH97687.1"
FT                   /translation="MAKEDVIEVEGKVIEPLPNAMFRVELDNGHKILAHVSGKIRMHYI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            150712..150825
FT                   /locus_tag="Bsel_0139"
FT   CDS_pept        150712..150825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0139"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: pca:Pcar_0724 ribosomal protein L36; TIGRFAM:
FT                   ribosomal protein L36; PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97688"
FT                   /db_xref="GOA:D6XVR5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR5"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADH97688.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG"
FT   gene            150847..151212
FT                   /locus_tag="Bsel_0140"
FT   CDS_pept        150847..151212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0140"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: gme:Gmet_0650 30S ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97689"
FT                   /db_xref="GOA:D6XVR6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR6"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADH97689.1"
FT                   /translation="MARVAGVDIPRDKRVVVSLTYVFGIGRSKAAQILTEAGVSENTRV
FT                   RDLTEDELAKIREVVDGVKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQKTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            151236..151628
FT                   /locus_tag="Bsel_0141"
FT   CDS_pept        151236..151628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0141"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: sfu:Sfum_1580 30S ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97690"
FT                   /db_xref="GOA:D6XVR7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR7"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADH97690.1"
FT                   /translation="MAKPKTTRQKRRQRKNIESGVAHIRSTFNNTIVTITDTQGNAISW
FT                   ASAGALGFKGSRKSTPFAAQTAAETAAKAAMEHGMKTVVVSVKGPGAGREAAIRSLQAA
FT                   GLEVNMIKDVTPVPHNGCRPPKRRRV"
FT   gene            151805..152749
FT                   /locus_tag="Bsel_0142"
FT   CDS_pept        151805..152749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0142"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase alpha subunit
FT                   domain protein; RNA polymerase dimerisation; KEGG:
FT                   gme:Gmet_0653 DNA-directed RNA polymerase subunit alpha;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97691"
FT                   /db_xref="GOA:D6XVR8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR8"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADH97691.1"
FT                   /translation="MIEIEKPKIEAVELSEDGTYGKFVVEPLERGYGTTLGNSLRRILL
FT                   NSLPGSAVTSVQFNNVLHEFSTIEGVVEDVTTIILNLKKLSLKIFSEEEKTLEIEAQGE
FT                   GVITARDLTHDSDVEVLNPDLHIATLSKGAQVQMKVTAKRGRGYVPAEGNNTDDLPIGV
FT                   IPVDSIFTPVSRVNYQVENTRVGQITNFDKLTLDVWTDGSIRPEEATSLGAKILNEHLN
FT                   IFVGLTDQAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTHKS
FT                   EEDMMKVRNLGRKSLEEVQEKLHELSLGLRKEE"
FT   gene            152806..153168
FT                   /locus_tag="Bsel_0143"
FT   CDS_pept        152806..153168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0143"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: glo:Glov_1374 50S ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97692"
FT                   /db_xref="GOA:D6XVR9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR9"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADH97692.1"
FT                   /translation="MGYRKLGRDSSARKALLRDLATDLIINERIETTEKKAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRKEVADEETGQFAVAKLFDDVAKRYEDRQGGYTRVMKL
FT                   GPRRGDGAEMAIIELV"
FT   gene            153277..154107
FT                   /locus_tag="Bsel_0144"
FT   CDS_pept        153277..154107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0144"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sat:SYN_00209 ABC-type cobalt transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97693"
FT                   /db_xref="GOA:D6XVS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97693.1"
FT                   /translation="MDRKITVDHVYFKYADDSPDVLRDVSLTIKDGEWVTILGPNGSGK
FT                   STLARLFNALILPDRGAVTSLGIDTADEKHWPALRRQVGMVFQNPDNQLVAPTVADDVA
FT                   FGLENAGIPLEEMKTRVKESIATFGLSGLENAEPHRLSGGQKQRVAIAGVMALAPDVII
FT                   FDEATSMLDPEGKREVWAAMDKLRKDQAITLISITHDVSEAVKADRVIVMHEGGILKEG
FT                   TPASVLGDQEVMHTAKLKPPFPQTVAAELLKAGIDVPESILTEEELIKALWTSM"
FT   gene            154092..154988
FT                   /locus_tag="Bsel_0145"
FT   CDS_pept        154092..154988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0145"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gsu:GSU1281 cobalt ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97694"
FT                   /db_xref="GOA:D6XVS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97694.1"
FT                   /translation="MDIHVKDMTHLYMPGTPFEQDALKSVNLTFSDRQWTTIVGRTGSG
FT                   KSTFIQHLNGLLKPYHGSLTVKGVTITRETKQRTLHQLRKKVGMVFQFPEQQLFAEEVI
FT                   TDVMYGPLNLGKTKDEARALAEEALSLTGLDPSLYEQSPFELSGGQMRRVAIAGVMAMD
FT                   PELLILDEPTAGLDPDSHVRMMAMFEEWYRSRPKRGVVLVTHQMQDAARFSDEVLVMHG
FT                   GRLAEQETPEALFLNDTLLKRYSLSAPPSLELIRLFMDRVGMQEQIDTLPLTAGDTAQA
FT                   LKALLERKETEGADRDV"
FT   gene            154981..155787
FT                   /locus_tag="Bsel_0146"
FT   CDS_pept        154981..155787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0146"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: sat:SYN_00208
FT                   ABC-type cobalt transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97695"
FT                   /db_xref="GOA:D6XVS2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:D6XVS2"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADH97695.1"
FT                   /translation="MFDSIIIGQYVPGDSVVHRLDPRVKLTAVFIFLVFMFMTRDPLLL
FT                   TVAVLLSFGGLLASRVPLSFYAKGMRFISIIIVLTFVLHLFMTGGGEVIVELPFATIYS
FT                   GGLIEGFMLAMKLAMIITIASLLTLTTTPIDLTDGMERMLAPFKRVKLPTHELALMMSI
FT                   ALRFIPTLIEETRTIVLAQLARGTNFSEGSLWKRLKALIPILVPLFTQSFKRAEELATA
FT                   MEARGYAGGEGRTKYRQLHWGLKDSVVLAVFLLFAAAVMAERFMGG"
FT   gene            155806..156591
FT                   /locus_tag="Bsel_0147"
FT   CDS_pept        155806..156591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0147"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase A; KEGG:
FT                   gur:Gura_1048 tRNA pseudouridine synthase A; PFAM:
FT                   Pseudouridine synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97696"
FT                   /db_xref="GOA:D6XVS3"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS3"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADH97696.1"
FT                   /translation="MRRMLIRIEYDGSGFNGYQKQPNARTVQGELERALSVMHKAESWP
FT                   CTSSGRTDTGVHGVRQPVHFDSPLTIPDERWPMALNSLLPDDIQVLGAMEVDASFHARY
FT                   DTVGKVYRYRVDTAKRQTVFRRSFAAHFPGNMDIEAMREAAKHLEGTHDFTSLSSPKTD
FT                   VKDKVRTLFAVSLEEREDGFDVVFAGSGFLYQMVRILMGTLIKVGSGDWPPDVIPAIIE
FT                   KQERQAAGPTAPGHGLYLEDVFYTKEALDACVKRLEEKK"
FT   gene            156749..157186
FT                   /locus_tag="Bsel_0148"
FT   CDS_pept        156749..157186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0148"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: mmw:Mmwyl1_2400 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97697"
FT                   /db_xref="GOA:D6XVS4"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS4"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADH97697.1"
FT                   /translation="MRTTYMAKGHEVERKWYVVDAEGQTLGRLSSEVASILRGKHKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLMDKKYYRHSRYPGSLKTTTAGEMRANKPERLLEL
FT                   SIKGMMPKGSLGRQMTKKLNVYAGPEHPHAAQKPEAYELRG"
FT   gene            157207..157599
FT                   /locus_tag="Bsel_0149"
FT   CDS_pept        157207..157599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0149"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: glo:Glov_3190 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97698"
FT                   /db_xref="GOA:D6XVS5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS5"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADH97698.1"
FT                   /translation="MAQVQYIGTGRRKNSTARVRLVPGDGQITINKRNIDEYFDLETLK
FT                   VIVKQPLAETQTEGTYDVHVNVHGGGYTGQAGAIRHGVARALLQADPEFRASLKSAGYL
FT                   TRDARMKERKKYGLKAARRAPQFSKR"
FT   gene            158250..159518
FT                   /locus_tag="Bsel_0150"
FT   CDS_pept        158250..159518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0150"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: neu:NE2190 integron/retron-type RNA-directed
FT                   DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97699"
FT                   /db_xref="GOA:D6XVS6"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS6"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADH97699.1"
FT                   /translation="MQLIDRVVCPDNLNLAMNRVISNKGNPGVDGMTVDQLEAHVRQYA
FT                   KPLIAKIQKGTYQPLPVKRVEIPKENGKKRKLGIPAVRDRMVQQAIFQVIEPIIDPHFS
FT                   PNSYGFRPGKNAKQAIKQAAKYYDEGFKMVVDIDLKSYFDTIPHQKLMNYLEQYIQDPI
FT                   ILKLIWKFLKSGIMIGDNWESSRNGAPQGGNLSPILSNVYLHELDKELERRGHRFVRYA
FT                   DDFCIYVKSRRAAERVLLNTTTFLEGTLKLSVNQEKSAIGSPTKRKFLGFCIHKSNNET
FT                   RCRPHHASKAKFKAKLKYLTRRNQANSFDYIILKINQVTTGWINYYGISYMKSFINSIK
FT                   QWLHHRLRQLIWKQWKKIKTRYKNLMKYGIETEEAWKMANTRKGYWRASKNETLHKAIK
FT                   IEKLAGWGLKDMSQLYEHAYSTY"
FT   gene            159696..161138
FT                   /locus_tag="Bsel_0151"
FT   CDS_pept        159696..161138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0151"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97700"
FT                   /db_xref="GOA:D6XVS7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS7"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADH97700.1"
FT                   /translation="MQSFLFFIIAVPTVLVALVLGYVWLRIRYRTARSNEALVITGPRL
FT                   GEGTDVFRDEEGRSMKIIRGGGYRLRQFQRSTPIDLKSFKLEIDTPIVITNGGVPIVAN
FT                   AIAMVKVADTLEGVARYAEQFLGKDQKQIENEISEVLSSNLRAILSKMTVEAINEDRES
FT                   FNEQVTDVAQNQLDQMGFKITSLGLSDLRDGNEENGYLENLGRPRIAKVRKDAEIAEAN
FT                   TLRETRIHKAQTDQEIQEEEYSREQEIAAAKKEKDIQEAQFKEETERARAKSEQSYELE
FT                   KAKLDKEVKEEELNIQYMERTRAVELEEQENRVKQAKADADYYAVTKKAEADANRVRID
FT                   GEASAKIKLEDGKAEAQVILERGKAEAEAREILAKAMDEHGDAILRERMIEMLPQLAAE
FT                   FAKPLSSIDSVKVIDSGSGNGVSSVGGSVARSMMEMSEPLKETTGIDLKDLLSKFTDQT
FT                   GKENKTDSGGGSEQKEKKEDGH"
FT   gene            161299..162093
FT                   /locus_tag="Bsel_0152"
FT   CDS_pept        161299..162093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0152"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: ftn:FTN_0967 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97701"
FT                   /db_xref="GOA:D6XVS8"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS8"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ADH97701.1"
FT                   /translation="MRRIYQLTAKLAIALIVSACSNETVERAAEDHGERETYIRDMPQD
FT                   VLFDDAILETVRITETEGDPPIITDPDHADVLINHDHRLDSSYIPPDLTVPDVRFSFSE
FT                   ALNRRMLREEAAAALESMFQAAEADGISLFAVSGYRSYERQRQIFDTSVQNRGEERTRE
FT                   VIAVPGTSEHQSGLAMDVSSQSNGFRLNTDFADTPEGEWVADHAHEHGYIIRYLEGYEA
FT                   VTGISFEPWHLRYVGEELAAELFRTGQPLEILMERAERVQEQ"
FT   gene            162259..163380
FT                   /locus_tag="Bsel_0153"
FT   CDS_pept        162259..163380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0153"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bur:Bcep18194_C7286 NADH-flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97702"
FT                   /db_xref="GOA:D6XVS9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS9"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADH97702.1"
FT                   /translation="MYSFMEPYTFENGATVRNRIMLAPMTNFASADNGEVTDEELAYYR
FT                   ERSKGVGTVVTAVANVTPGGKGFPGEIGIDRDDLVGGLTKLADTIKGEGAKAIIQMFHA
FT                   GRMAPTDLLPDKETVSASAVAPEREGAVTPRALTEDEIQSIIKAFGDATRRAIRAGFDG
FT                   VEIHGANTYLIQQFFSPHSNRRTDQWGGSVEKRMRFPLAVVNEVLEAAKEADESFIVGY
FT                   RISPEEIENPGITMADTLQFVGELAKEDLDYLHVSVMDFFKGSMREKDDERSRVQLIHD
FT                   EVGSRIPVVGVGSLHTPDDVERAMAGGVPLMALGRELIVEPHWIEKVEAGETEAIRTEM
FT                   SVDDREELVVPEALWNAIVNRPGWFPVKEHAES"
FT   gene            163405..163584
FT                   /locus_tag="Bsel_0154"
FT   CDS_pept        163405..163584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97703"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97703.1"
FT                   /translation="MRALFFVGSKMRSFCYTGRPRGGIIAVDPCRAERRRHCKQEAGEA
FT                   GGKRCLAKTGFENL"
FT   gene            163541..165079
FT                   /locus_tag="Bsel_0155"
FT   CDS_pept        163541..165079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0155"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: maq:Maqu_3105 deoxyribodipyrimidine
FT                   photo-lyase; PFAM: DNA photolyase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97704"
FT                   /db_xref="GOA:D6XVT1"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT1"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADH97704.1"
FT                   /translation="MVNVVWLKRDLRIFDHRPLKEAAEQGEVLPLFVWEASVWAHGDLS
FT                   VRHRDFVLQSLAELDRRLDQRGARLYTAVGEVIDVLTRLEADLGPFQLFAHEENGTPLT
FT                   FERDIAVRNWMKARGCTMKEWPHFGVTRGLKSRDDFQKGYERYVNAPVVPAPEAVRGIR
FT                   HAPAWLTKGAGEPGGIALPGTAITRGQQGGERLAHGVLKGFLEERFKAYQVRISKPFAS
FT                   AESCSRLSPYLAWGNLSVRYTYQETVARLGELGSGFHKKQLSAFLSRLHWHCHFIQRLE
FT                   DEPEIAHRTMNPVFDTVRQTWSEEAYQRWLHGRTGIPLIDAAMRCLHETGWLNFRSRAM
FT                   VISFVCNTLMLDWRRPAEDLSRLFLDYEPGIHYSQVQMQAGTTGFNTIRIYNPVKQGQE
FT                   HDPSGAFVRRFVPELSAVSDAFIHEPWKLPAGPPKGYPMPMVDVAKANGEARRILWGLK
FT                   ASKEAKAAAGEQLNKHGSRAHRKKGKKKPGAGVEQLDLFELADPHDHKEKEKGG"
FT   gene            165086..166729
FT                   /locus_tag="Bsel_0156"
FT   CDS_pept        165086..166729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0156"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   reu:Reut_B5661 CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97705"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT2"
FT                   /inference="protein motif:PFAM:PF07905"
FT                   /protein_id="ADH97705.1"
FT                   /translation="MEMTLADIQKLPAFEGVKLIAGHEGIDRVIRNVYFMEVPDIFGYI
FT                   DEGGFLLSTLYPIADDEAAIQRLIPGLVEVGMAGLAIKPARYITDVPDVMIEQANELGF
FT                   PLFVLGQGANLSTLTNTILETLLDKNTSTLQFRNDLHNKMMEELVNGASLTELTMTVSE
FT                   MIESPIILLDRELERITDTTGKRVKVDRESVPPLPVERSFCLPNHVLDQVRLSVGSDGE
FT                   IFLKDSFIQPVLAGEECFGYMILPTTDRQIDPNAKMALEQTSLLMASVFQRDKALKQKE
FT                   ENYLDAFIRDVLNEKMGSQFEVIEKAKLFKWDLQFPVALFNMSVRLEDVVKKRRILIQY
FT                   MENRVVEQFLSRKLDIHISKIKLIYMDDSICAFINVAFESGIDERLIGVCEELVAYLES
FT                   HDPDAPLSIGIADTVEGLGRFSKAYHEAIRTRELSEKIAEGGSFVRHYRDMVLYELIDQ
FT                   ISEDVRADFIDKRIGAVLRYDETKKMELLKTLEAFIDHDFNAQKAAASLFIHYNTFRYR
FT                   LEKLKELGVDYDSGFDWMETALACRMQKLL"
FT   gene            166930..168486
FT                   /locus_tag="Bsel_0157"
FT   CDS_pept        166930..168486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0157"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   lhk:LHK_01306 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97706"
FT                   /db_xref="GOA:D6XVT3"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT3"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADH97706.1"
FT                   /translation="MTHPNTPLWKKGDIDGFFGLFTNNLTNLLVMAGLLTVSLGMPAGI
FT                   VYGRIIPAVGLSIFISSLIYTWLAYRLSQREQRTTVTALPSGTSVPHMFLIVFLIMGPV
FT                   YWQTGDPMIAWYAGLAWCFIEGIIELFGSVIGPKVKQLLPRAAMLGTLAGVSITFIAMT
FT                   PAMQTFHLPYIGLITFILILLNFYGKTAMPFKIPVGLVVIVIGTIIGWTAGQMNIQELR
FT                   GALTDLEVNVPLFSFSGITEGFSVALPFLISAIPLGIYNFFETIDNIESATAAGDTYDT
FT                   RQALVADGSTTILASLFGSPFPTAVYIGHGGWKAAGAGIGYTWLTGAMVLIMTVAGIIP
FT                   VLLALIPLVAIVPILIYIGLFIGAQAFQTTEARHAPAVLLAVLPWLADWGRSQIDTGFG
FT                   EAGISAADVGFDALAKAGLEYEGMMIFGSGAILIGMLWSTALVFIIDEQLDRAAVTIWT
FT                   GAVLSWFGIIHAETVGLWIGWEMGLSYAAAGVIVWYFHKKKQSASNTTITEAGEDLPRR
FT                   N"
FT   gene            168489..169169
FT                   /locus_tag="Bsel_0158"
FT   CDS_pept        168489..169169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0158"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: lhk:LHK_01309
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97707"
FT                   /db_xref="GOA:D6XVT4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT4"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADH97707.1"
FT                   /translation="MTHVQAQAKPYEFTFDPKTTALVLIDMQRDFVAPGGFGEKLGNDI
FT                   SATRAIIPATQEMLEAAREAGMMVIHTREGHRTDLSDCPPSKLNRGKKQGAGIGDVGPM
FT                   GRILVRGEYGHDLVDELKPVEGEVVIDKPGKGAFYMTDLESVLLNRGITHLLVGGVTTH
FT                   VCVQSTIREANDRGFDCLLLEDCSAAFDPKDHEDSIRMIHQQGGIFGWTSTSDEVKKAL
FT                   ASRN"
FT   gene            169199..170761
FT                   /locus_tag="Bsel_0159"
FT   CDS_pept        169199..170761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0159"
FT                   /product="xanthine/uracil/vitamin C permease"
FT                   /note="KEGG: lhk:LHK_01305 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97708"
FT                   /db_xref="GOA:D6XVT5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT5"
FT                   /inference="similar to AA sequence:KEGG:LHK_01305"
FT                   /protein_id="ADH97708.1"
FT                   /translation="MSEQKGKGVAWFTKGDLNGFFGLFTNVLTNFLAAIGLLVFAINMP
FT                   GEIVYGRIVPAAALSIGIGSIIFAIQAKRLSEREGRTNVTALPYGLSVPHYFVVAFAVM
FT                   LPVYAMSGDWMLAWAVGIAWNVVQGIIMTIGAFIGPFIRKYIPRAAMLASLAGIALTYI
FT                   AMNPAGEVYTTPYIGLLTLTIVLAGWLAQKSLPFKMPAGLLAIVIGMIIAWSTGYMDVA
FT                   EVQSAAAEFSPALPLLAISMIPQGFAFLAPFLAAAIPLGIYDFLESLDNIESAEADGDK
FT                   YATVPTMLVPASLTLFGAALGSVYPTIIYIGHPGWKKAGARAGYSMATGIGALVVGFLG
FT                   IMPLVLSFIPLVALLPILIYITMVIGAQTFNETPRRHYPALIIALMPFIASYVITQIDN
FT                   ALGAMGTSAAEVGYETLADAGIPYLGWQAFGAADILVAMILATIVIYIIDRNFRYALVY
FT                   ALIAAVLSFFGVIHAPEIGIGQGLNAALGYLSMSVALLAMMFYRPEENRTEDVSALEEL
FT                   DQS"
FT   gene            170758..171624
FT                   /locus_tag="Bsel_0160"
FT   CDS_pept        170758..171624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhk:LHK_00981 YlbF"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97709"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97709.1"
FT                   /translation="MIRLDRHARDWLNSEASNTPVVHSIFDHVINVKTTRGTLVTIQKQ
FT                   GLPMQPATIQPGERDFVAIMDACKNPSKQIDLQFLKEREADTVSLAIPALMPLENAADP
FT                   ITFLRAWLKAHGNRGGLYAVLFPERVPAPTLMERKLAAVWAVSEEAYRFGGLTGLGVGL
FT                   TPSGDDALHGLVAVMHAFLGKEAACRVSGDSRHRLMMTTDVSRTMLTHAFSGETNESLL
FT                   ALLKVLSAGSWLETEEAFRDVNRIGSTSGTDTLIGVLKGLQLVQAEQIRRNRHHGKTGD
FT                   HQKECVL"
FT   gene            171584..173143
FT                   /locus_tag="Bsel_0161"
FT   CDS_pept        171584..173143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0161"
FT                   /product="FdrA family protein"
FT                   /note="PFAM: FdrA family protein; KEGG: ecd:ECDH10B_0307
FT                   acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97710"
FT                   /db_xref="GOA:D6XVT7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT7"
FT                   /inference="protein motif:PFAM:PF06263"
FT                   /protein_id="ADH97710.1"
FT                   /translation="MEKQVIIRKNAYYDSVTLMSLASKIEQLDGVHDAIVAMATAMNKE
FT                   LAGDIGLVTDEVEAAGDNDLLLAVSAENEKALEEAFTAIEAAFEAKSSQANKQTEKTYT
FT                   NTKEALRDHEEANLAIISVSGEFAAREAEIALKKGLHVMIFSDNVSVEDERRLKELGRN
FT                   KGLFVMGPDCGTAILNGTGLCFANSVRRGNIGLVAASGTGLQEVTVQIDRLGGGVSQGI
FT                   GTGGRDLSKDIGGLMMLQGIKALEEDPDTDVIVLISKPPAKEVQDLVLEQVKASRKPVV
FT                   ISFIDGDPAAAVSAGAIFGYSLTDTAIKAVALSKGEEAPDKPADQFDKEAWETVLNGVR
FT                   EKRSDSQIDIRGLYGGGTLCAEALSIMRQEGLSVKSNVAKREEEKLFNTRESEGHVLLD
FT                   LGEDEFTVGKPHPMIDPTTRNQRLLQEAADEKTAVILMDFELGYGSHEDPVGVSLPFIE
FT                   EARVNNPSLAIVSYVCGTATDPQGLESAESRLREAGVAVANSNVEAVRLAVHLQAAREV
FT                   SA"
FT   gene            173140..174564
FT                   /locus_tag="Bsel_0162"
FT   CDS_pept        173140..174564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0162"
FT                   /product="protein of unknown function DUF1116"
FT                   /note="PFAM: protein of unknown function DUF1116; KEGG:
FT                   lhk:LHK_01303 DUF1116 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97711"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT8"
FT                   /inference="protein motif:PFAM:PF06545"
FT                   /protein_id="ADH97711.1"
FT                   /translation="MTTTLFQTELKPVNIGTDTFKQDLTKQGLAAVQVDWRPPAGGNLA
FT                   LVKALDGLMDRPDIDEANKKVTAILKSAHPVLVDMQKAIDVIPGMHDKLFLHAGPPIEW
FT                   ARMCGPMQGAIIGAILFEGLADNEADARKLAESGELSFAPCHSHQAVGPMAGVLSPSMP
FT                   VHVVENKEHGNRAYCSINEGLGKVLRYGAFSEEVINRLTWLKESFMPVMQRALQAAKNG
FT                   IDLKALIAQALHMGDEVHNRNKAATSLFIREMLPYLMQDKDHEAMQEALSFMNQNDHYF
FT                   LNLSMPACKASLDAAHGVKNATIVTTMARNGVDFGIRVSGLGEDEWFTAPANYVKGLVF
FT                   PGFKEDDAAPDIGDSTITETMGIGGFTMGGAPAIVQFVGGTVSDAMAYSEQMYQITTDE
FT                   NSNYSIPTLDFRGSPVGIDVRKVIDTNILPIINTGMAHKTAGVGQVGAGLVEPPAACFE
FT                   QALMTLANEKEAVTHE"
FT   gene            174557..175516
FT                   /locus_tag="Bsel_0163"
FT   CDS_pept        174557..175516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0163"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="TIGRFAM: carbamate kinase; KEGG: eic:NT01EI_3529
FT                   carbamate kinase, putative; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97712"
FT                   /db_xref="GOA:D6XVT9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT9"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ADH97712.1"
FT                   /translation="MSKMLIALGGNALGETPREQKILVKETAVSIVDLVERGHQVVVVH
FT                   GNGPQVGMIHSSMDYAAANGEGTNMPFPECGAMSQGYIGFHLQNAIQNELTRRQVKRGV
FT                   ATVVTQVEVDEQDQAFRNPTKPIGGFYSKEDADRLTKEKGFTMIEDSGRGYRRVVPSPK
FT                   PVAIVEQDQIATLLDTHGIVIAAGGGGIPVIRTDEGLEGVSAVIDKDAASNRLAQDLDL
FT                   DYLFMLTAVERVAVNFNTPNQRNLDRVSVKEARDYIEDDQFPAGSMLPKVEAALDFVES
FT                   ATGRRAIIGALEKATEALNGKSGTTFFPEESPVTNHTN"
FT   gene            175711..176670
FT                   /locus_tag="Bsel_0164"
FT   CDS_pept        175711..176670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0164"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   oan:Oant_1227 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97713"
FT                   /db_xref="GOA:D6XVU0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU0"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADH97713.1"
FT                   /translation="METVARISQFFSKYFAVIVITVSLVAFFTPDTFAWIAAYITVLLG
FT                   IVMFGMGTTMRLSDFKVVAQKPLPVLIGLLAQFLVMPLTAFLIATVLGLPPELAAGLVL
FT                   VGACPGGTASNVMVYLSKGDVPVSVAMTSVSTMLAPILTPLAVLLLAGQWLPVSTGDMV
FT                   MSIVEVIIVPIALGLLARRLLPGVVDKGQAALPLVSVTAIMLIVTAVVAVNAENIITSG
FT                   LAVFAAVILHNGFGLFLGYAAAMWAGLDETKRRAISMEVGMQNSGLGAALATAHFSPLA
FT                   ALPSAIFSVWHNISGPLLVSFWNRSNKQPAETKQAVNQ"
FT   gene            176910..178595
FT                   /locus_tag="Bsel_0165"
FT   CDS_pept        176910..178595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0165"
FT                   /product="choline dehydrogenase"
FT                   /note="KEGG: dal:Dalk_0705 choline dehydrogenase; TIGRFAM:
FT                   choline dehydrogenase; PFAM: glucose-methanol-choline
FT                   oxidoreductase; FAD dependent oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97714"
FT                   /db_xref="GOA:D6XVU1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU1"
FT                   /inference="protein motif:TFAM:TIGR01810"
FT                   /protein_id="ADH97714.1"
FT                   /translation="MSEKYDVVIIGGGSAGCVMANRLSEDENRSVLVLEAGRKDFSWDL
FT                   LIQMPAALPFPAGKSLYDWKYESDPEPYMGQRRISHARGKVLGGSSSINGMIYQRGNPL
FT                   DYERWGKDPGMENWDFAHCLPYFKRLESALGSDKDDPYRGHDGPLKLERGPAKNPLFQA
FT                   FFDAAVEAGYNRTPDVNGFRQEGFGPFDKHLYKGRRMSASRAYLQPVMKRKNLTVKTRA
FT                   FVSSIDFEGKRAKGVTYKRNGKVHQIEAGEVILAGGAINTPQMLQLSGVGDAQHLRSLG
FT                   IKPVVDLPGVGENLQDHLEAYIQYSCPKPVSEQPNLSLHRMPWIGLQWIFARKGAAATN
FT                   HFEGGGFVRSNDIVDYPNLMFHFLPVAVRYDGTKADTKHGFQVHVGPMYSDARGSLKIT
FT                   SKDPRKHPSMVYNYLSTEQDRREWIEAVRISRNIMAQDAIKPYNSGEIAPGPEVQTDDE
FT                   ILEWVAKDAETALHPSCTAKMGPASDPMAVVDPESMKVHGLENVRVVDASAMPYVTNGN
FT                   IHAPVLMLAEKAADLIRGKKPLEPEHLDFYRHGVHPADAGVEKK"
FT   gene            complement(178700..178822)
FT                   /pseudo
FT                   /locus_tag="Bsel_0166"
FT   gene            178930..179853
FT                   /locus_tag="Bsel_0167"
FT   CDS_pept        178930..179853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0167"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: pen:PSEEN2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97715"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU2"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADH97715.1"
FT                   /translation="MPDRLIVLNKDEDTLSIVNADTGMTEKTVATSHNPHELVVSRDGL
FT                   KTYIACSLGNTVDILDNRTFEIVRHLTHPDFDFPHGLGLTNDGKKLYLASTFSEKVFII
FT                   DTKTDEIESVTKTGQKLSHMISFSPDGNTVYIPNIGSHNLTVMDTDTETITTHIPVGKG
FT                   PEGVAVHPDGRHLYVANQEEDTLHILDTESHEVLYKRRVGHVPVRLVFSPDGKYALIAN
FT                   RESNDVSIIDTAQHINGETRPWEIKRLPVGVWAGGIVFSPDGQKAYVANNKTNDVSVID
FT                   MTTLKEERRFDVGIHPDGIAYLEKRT"
FT   gene            complement(179915..180856)
FT                   /locus_tag="Bsel_0168"
FT   CDS_pept        complement(179915..180856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0168"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: csa:Csal_3169
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97716"
FT                   /db_xref="GOA:D6XVU3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU3"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADH97716.1"
FT                   /translation="MRTWKKSLGAFSAVAVAASLTACGNNAEDNNDNINADGANDADAA
FT                   NNADGNEAIGNGEEITISQISWAENIAVTNMWKYVLEEKGYEIDLVLLDMGSSMAALDN
FT                   GELDVNLEVWLPVQDANYVEQYGDTVNFSEATWFDNAKVGLVVPEYLEDVNSIEDLNEH
FT                   ADLFNGEIVGIEAGAGTMEVTEDLIEIYDLDLELVPSSEPAMLSEIGNRIEAGEAIVAP
FT                   LWTPHWVFSEYDLKFLEDPELVYGDVEKIHHATRADFADDFPEIQEWFNNWKMTDEEIG
FT                   ELIDYVESADEPFDGAVEWVDENRDLIDEWVQ"
FT   gene            complement(180996..181547)
FT                   /locus_tag="Bsel_0169"
FT   CDS_pept        complement(180996..181547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0169"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: rpf:Rpic12D_4272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97717"
FT                   /db_xref="GOA:D6XVU4"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU4"
FT                   /inference="protein motif:COG:COG1510"
FT                   /protein_id="ADH97717.1"
FT                   /translation="MTDSYEEQRKKIEKAKDKVIGSISETMDLYGVTPAAGNLYATMYF
FT                   KDQMTLDEMREELQMSKPSMSTSVRKLQEIDMVKKTFTRGSRKHTYIAEKDFFRFFKTF
FT                   YSEMWEREAKVNLESVESAQEDLVEIMKDANSTPDIVAESKQYYDQLEESKTYYNWLYD
FT                   LAKAIRSGEIFDMIPRDTDR"
FT   gene            181845..183317
FT                   /locus_tag="Bsel_0170"
FT   CDS_pept        181845..183317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0170"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /note="KEGG: reu:Reut_B5835 aldehyde dehydrogenase
FT                   (acceptor); TIGRFAM: betaine aldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97718"
FT                   /db_xref="GOA:D6XVU5"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU5"
FT                   /inference="protein motif:TFAM:TIGR01804"
FT                   /protein_id="ADH97718.1"
FT                   /translation="MNLTCKQYINGEWVDAVSGETRTIINPFNQDVIATVPEGNRDDAK
FT                   AAIAAARQAFDDGAWAERPATERGAIVRTIAELIERDREELAELESLDTGKTVEESRGD
FT                   MDDIAGVFRYYAEMADKSGGELIDSPVAESVSKVVYEPVGVCGQITPWNYPLLQASWKL
FT                   APALITGNTLVMKPSEITPLTTVKVFALMEEAGVPKGVANLVLGAGHTVGAELSESLDV
FT                   DLISFTGGIVTGKKIMQAASVNVKKLALELGGKNPNIIFADADFDTAVDQALNGVFFHA
FT                   GQICSAGTRLVVEESIHDAFVDALVKRVENFKLGNGFDDDTQMGPLISKEHLEKVEAYV
FT                   ENGVKEGANLVTGGKRPEDPALKNGFFYLPTIFTGCKSEMDVVQDEAFGPVITVETFKT
FT                   EEEAVTIANDSIYGLAGGVWTNDIVKAERCAKKMRMGTVWINDFNLYFPHAPWGGFKQS
FT                   GIGRELGKLGIEEYTESKHIFQNLNPQPLNWF"
FT   gene            complement(183382..183837)
FT                   /locus_tag="Bsel_0171"
FT   CDS_pept        complement(183382..183837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0171"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pat:Patl_0928 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97719"
FT                   /db_xref="GOA:D6XVU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97719.1"
FT                   /translation="MTREIRPVDASNWRAIIALKPKAHQESFIEPNAVSILESFYDRSL
FT                   KWSCYGLYEDGKPVGFMMAGAGSLYERYIWLDRFMLDGAYQGDGRGKAFLALIIRFLSA
FT                   KWYVKTIKTSMKADNEAVKHLYTSAGFVSTGTIDPEFDEEVWVYQVT"
FT   gene            complement(183862..184464)
FT                   /locus_tag="Bsel_0172"
FT   CDS_pept        complement(183862..184464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0172"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: mca:MCA2850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97720"
FT                   /db_xref="GOA:D6XVU7"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU7"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADH97720.1"
FT                   /translation="MTTMEESTMDDQTKWNDKHARRIKSGKIPGANPVLADQIPVTENA
FT                   VAIDLACGLGANALMLADRGYTVTAFDVSDTATDFVNAKAEELGRPVKAKAMDLTSIEG
FT                   QTAVTATAPVDLAVITYYLDRDLMELVKDLIRPGGYVFIETYVSLPGMENTPVREDFKL
FT                   HPAELVNSFEDWGIMYFDFDETNGTQTILVRKKTTHH"
FT   gene            complement(184556..185917)
FT                   /locus_tag="Bsel_0173"
FT   CDS_pept        complement(184556..185917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0173"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE integral
FT                   membrane region; MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: dps:DP2540 magnesium transporter;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97721"
FT                   /db_xref="GOA:D6XVU8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU8"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADH97721.1"
FT                   /translation="MNRLNEEAREQYFDQIFRALKYKKKDEFLELFLELHPTDQMELFL
FT                   DLYDDKRPMFYEYLSAEEFAEIFQGLDFENQTEVVKELDKTYAAHMFNFMQSDDVADFI
FT                   GEIEDEDAKAILSAMEQEDADEVRELLSYPDESAGSLMTKEFVAIYAHESVQNVMADLR
FT                   EKGIEAETIYYLYVIDEKDKLAGVVSLRDLITAPLDETIENLMSTRVVSVEAHTDQEDV
FT                   ARMISDYDLLAAPVVTSTNELIGIVTVDDVIDVLEEEATEDFGEIAAAKGATDVNITSF
FT                   AAAKKRSPWIIMLMFFGLITAGVIGQFEETLEEIVLLAVFIPLIMDSAGNTGTQSLAVM
FT                   VRSLATGSFEKKGLWNTIKREFGTGIMLGLICAATLMIIVPFIYGSYMLAFVVGASLFL
FT                   TLSIATIIGAVVPVIITKLKLDPAIASGPFITTVNDILGLMIYFTIATSLIAYL"
FT   gene            186442..187095
FT                   /locus_tag="Bsel_0174"
FT   CDS_pept        186442..187095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0174"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: mxa:MXAN_0609 PAP2 family protein; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97722"
FT                   /db_xref="GOA:D6XVU9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU9"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADH97722.1"
FT                   /translation="MHTNHWLTRQPLFLSTGVAFFILSMLSIVGLFDAIDLAVMDWVYH
FT                   SAPAFLTNAMTVITEFGSVELIAVMSILVLGLLLYQRRIRDMILFVAVSGGGLAVNLGL
FT                   KFLFQRERPGELNMIDAFGIELAIPSYSYPSGHTMRAAILVLLIIYLLGTWVKRREQTR
FT                   LVTTAGLLLLTLVAASRVLTGAHFPTDAVGAVLASVAFVSLCVRLYEQRWRKPS"
FT   gene            complement(187166..188023)
FT                   /locus_tag="Bsel_0175"
FT   CDS_pept        complement(187166..188023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0175"
FT                   /product="Glucan endo-1,3-beta-D-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="KEGG: hch:HCH_04792 beta-glucanase/beta-glucan
FT                   synthetase; PFAM: glycoside hydrolase family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97723"
FT                   /db_xref="GOA:D6XVV0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV0"
FT                   /inference="protein motif:PRIAM:3.2.1.39"
FT                   /protein_id="ADH97723.1"
FT                   /translation="MNKLIIMAGLSLVTLAACGNGENEAENAGIDAPEGWNLVWHDEFD
FT                   GESLDEDKWRYDIGNGFYDGDEWVEGWGNEELQSYQEDNVTLRDGSLVIEAREETVSDD
FT                   YGTFDYTSGKILTEGLFSQTHGRFEASISLPEGQGFWPAFWMMPEDDAYGNWAASGEID
FT                   IMENRGSETDIVGAAIHYGGVFPDNTYTADEYVFDDGETTTDYNVYAVEWEPGEIRWYV
FT                   NDDEYAVMNQWYSENGEFPAPFDEDFHLILNLAVGGWYGGDPDDTTPFPAEMKVDYVRV
FT                   YEQE"
FT   gene            complement(188172..188909)
FT                   /locus_tag="Bsel_0176"
FT   CDS_pept        complement(188172..188909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_1457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97724"
FT                   /db_xref="GOA:D6XVV1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR022951"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV1"
FT                   /inference="similar to AA sequence:KEGG:Oant_1457"
FT                   /protein_id="ADH97724.1"
FT                   /translation="MSFRYLDEIESRLRGIKNRQFRALTVAAEQIAATIRNDGMIYVFG
FT                   SGHSHMLGEELFYRAGGLANVRPLFVEPLMLHESGPRASALERTPGYAERFMTDLPLTP
FT                   KDLMIVVSTSGRNPVPVDAAMISREKGAYVIAVTSMAYRAALSSRHPSGQHLSDAADLV
FT                   LDNEAPVGDAALSHKALDTGFAPVSTILGITLLQAVIAEATETLAEEGFDVPVFKSGNV
FT                   DGADAHNEALISRFKDRNPALTP"
FT   gene            complement(188938..189657)
FT                   /locus_tag="Bsel_0177"
FT   CDS_pept        complement(188938..189657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0177"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bmt:BSUIS_B1410 hypothetical protein; PFAM:
FT                   UbiC transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97725"
FT                   /db_xref="GOA:D6XVV2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV2"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADH97725.1"
FT                   /translation="MIEKDSPIPIYYQLQEQLRKQIEDGTLQPGDPLPSERDLSETYGI
FT                   SRMTIRQAMTNLVNEGLLTRSKGRGTFVAEEKIEQPLMKLTGFSEDMKQRGIKPGSTLI
FT                   SFDTVAAPANVAKHLELDAGTPVYEISRLRTGDGAPMAFETSYLRQDGITIREQDLEGS
FT                   LYEAIEAQSGRKIDKARQTIEPSFASDEEARMLTIEAGSPVLLLERTTRFHNGTVFEFV
FT                   KSVYRGDRYKFIADMQR"
FT   gene            complement(189668..190408)
FT                   /locus_tag="Bsel_0178"
FT   CDS_pept        complement(189668..190408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0178"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="KEGG: spl:Spea_0760 glucosamine-6-phosphate
FT                   isomerase; TIGRFAM: glucosamine-6-phosphate isomerase;
FT                   PFAM: glucosamine/galactosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97726"
FT                   /db_xref="GOA:D6XVV3"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV3"
FT                   /inference="protein motif:TFAM:TIGR00502"
FT                   /protein_id="ADH97726.1"
FT                   /translation="MTITIQTVDDYHAMSEQAAEYFYDAIKENPDIHIGLATGGTPSGM
FT                   YEALIQKIQDSALPLGAIQTFNLDEYIGLSQDDPNSYYTFMKDTLFAPLKLSRNQTYVP
FT                   DGNTSDHEMECRRYEALIDEHGIDLQLLGVGENGHIGFNEPGTPFDSVTHVIELNDTTR
FT                   EANARYFNSPDEVPTHAITMGIRSILKAKKIVLLASGTNKAEAISALFRDTITEDWPIT
FT                   ALKEHPDVTVIVDKAAAGQIPDEK"
FT   gene            complement(190405..191556)
FT                   /locus_tag="Bsel_0179"
FT   CDS_pept        complement(190405..191556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0179"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; KEGG: ftf:FTF1168c
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97727"
FT                   /db_xref="GOA:D6XVV4"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV4"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADH97727.1"
FT                   /translation="MKNKIYIQGGTVYNADGAPIRQPLITVNSGIIEQITEGGEPPEGA
FT                   DVLRLDGDDVILPGFIDIHIHGSHGADVMDATPEALATISRSITNEGVTSFLATTITAP
FT                   AASIEEALQQVASSEGTDGARCLGVHLEGPFINAKQAGAQPVGAILDPDAGQFKHWQAL
FT                   SGNQIRIATIAPERPGGAELVQALADSGVIGSIGHSDASSADVRAAEQDGLRHATHLFN
FT                   GMRGLHHREAGVVGGVMLSDNLKAELILDHVHVSPDAARVAYQALGANRLMLITDAMRG
FT                   KGLGDGVFDLGGQEVTIEGKEARLKNGALAGSVLTMDEAVRNARSTFNASWHDIARMTS
FT                   YNQAESLGLTGTKGTIQTGADADLTVMSRTGFIKHTIIGGEKP"
FT   gene            191722..192474
FT                   /locus_tag="Bsel_0180"
FT   CDS_pept        191722..192474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0180"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: mxa:MXAN_6161 GntR family transcriptional
FT                   regulator; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97728"
FT                   /db_xref="GOA:D6XVV5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV5"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADH97728.1"
FT                   /translation="MDHLSKEQSLHQTVKEQLITDIQSKKYPVHAQLPTEAELCKTFDV
FT                   SRTTIRNALQQLVNEGYIERVQGKGTFVRQQRIKQTLTSTEGSYVEQLKLQGKHPEVKV
FT                   VDLTVIPTDERLSLALEIAEGEPLNKLERIRYADNQPLQYETAYLPWRLTTGLRKESCE
FT                   GSLYSVLRDELELPIAKTEEHLHITRADQTVAGYLGIAEGDPCIQIETYAYLDDGTKIE
FT                   YSIACFHGDKVSFTVERHYGQTSEPGSP"
FT   gene            complement(192555..193262)
FT                   /locus_tag="Bsel_0181"
FT   CDS_pept        complement(192555..193262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0181"
FT                   /product="YdjC family protein"
FT                   /note="PFAM: YdjC family protein; KEGG: pmr:PMI2951
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97729"
FT                   /db_xref="GOA:D6XVV6"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV6"
FT                   /inference="protein motif:PFAM:PF04794"
FT                   /protein_id="ADH97729.1"
FT                   /translation="MKFIVNADDFGLSRAVNYGIFDAMTNGVVSSATLMVNMPGTLHAA
FT                   ELIHENKLSNIGVHLVLTSGRPMTNATSLTNENGDFRLSNRFASELDNGPKLDLDEVEA
FT                   EWSAQIERFFDIAGHPHHFDSHHHIHMYEPLAPVVRHLAEKYSLPVRAGNRIGVSSVSD
FT                   DFHDGFYQDAVSIDFFRKLYEQHKHKSGTIEIMSHPAYIDRTLQAYSSYQNERLAEFDV
FT                   LTSHALKESGWFA"
FT   gene            193431..194756
FT                   /locus_tag="Bsel_0182"
FT   CDS_pept        193431..194756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0182"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG: vpa:VP2634
FT                   6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97730"
FT                   /db_xref="GOA:D6XVV7"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV7"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ADH97730.1"
FT                   /translation="MAVNIAVIGGGSSYTPEIIEGLIDRYDDMPVRKITLVDVEEGQEK
FT                   LNVITNLAKRMIARSGKEISIVSTLDLEQALKGADFVTSQIRVGGLDARSMDEAIPLRK
FT                   GLVGQETNGAGGIFKAFRTIPVLMELSQAMAKICPDAWLINFTNPAGMVTEALLKYGSH
FT                   KKVIGVCNIPFNMRSGIAEMFHVPVGEVEIEFIGLNHFIFGRRVKIGGVDRTSEALAKS
FT                   IEKGVDYSPANIVSLGWTPELIRSLGMLPNPYHQYYFQTRDVIKKDMNLLDTEGTRADV
FT                   VKGVEASLFETYRAPDLDVKPKELEQRGGAYYSDAACNLMVSLHTDRQDVQTVNTLNQG
FT                   AVSDLPDDAVIEVNAVITEEGPKPVSVGKLPDEVRGIIQQMKHMEELTIKAAISGDYDD
FT                   AYLALVMNPLVSDEKLAKDLLDELLDAHQSFLPQFHSREENV"
FT   gene            194756..196063
FT                   /locus_tag="Bsel_0183"
FT   CDS_pept        194756..196063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0183"
FT                   /product="PTS system, cellobiose-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, cellobiose-specific IIC
FT                   subunit; PTS system, lactose/cellobiose family IIC subunit;
FT                   KEGG: hsm:HSM_0456 PTS system lactose/cellobiose family IIC
FT                   subunit; PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97731"
FT                   /db_xref="GOA:D6XVV8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV8"
FT                   /inference="protein motif:TFAM:TIGR00359"
FT                   /protein_id="ADH97731.1"
FT                   /translation="MNAIMNWMEKHFIPVASRIGAQRHLVAVRDGFVAIMPLIILGSFA
FT                   VLINNLPIDVFQNFMLSLFGEGWKAVGGNIWDGSFAILTLLVVAGISYNLAKSYDVDGM
FT                   SAVLIGLASFIILTPTTEDWGLAYAWTGAQGLFVGVITALVTTELFRVLYRSKFTIKMP
FT                   DGVPDGVVKSFRALIPAAIILIFIALVQIFITSLTDGSLHELIFTLIQEPLQALGNTLP
FT                   AAIIIAFLNHLLWFFGLHGTNILGPVIESIYLPLIEVNIQQFASGVSAHDVPYIITKPF
FT                   LDAYVFMGGSGTTLALIFAIFLVAKTKHYRTIGKIAAPAGGFNINEPILFGLPVVLNPV
FT                   MLIPFIFIPVLLTVTSYVALVTGVVPKTVAMVPWTTPPIISGYLVTGGSITGIILQLFN
FT                   LTLATLLYIPFIRASERAEERKQEILKQEMKGDKQS"
FT   gene            196060..196383
FT                   /locus_tag="Bsel_0184"
FT   CDS_pept        196060..196383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0184"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG:
FT                   efe:EFER_3959 putative chitobiose/cellobiose
FT                   phosphotransferase enzyme IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97732"
FT                   /db_xref="GOA:D6XVV9"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV9"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ADH97732.1"
FT                   /translation="MSEQTEQSLEEISFQIILHAGNARSDAMEGMAFAREGKFTQAHAK
FT                   LRDAEASFVEAHHVQSALLHKEAGGEGVSPSVLLIHAQDHLMTAMTVKDLAQEIVHLHE
FT                   KKA"
FT   gene            196401..196712
FT                   /locus_tag="Bsel_0185"
FT   CDS_pept        196401..196712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0185"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: yen:YE1294
FT                   putative exported PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97733"
FT                   /db_xref="GOA:D6XVW0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW0"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADH97733.1"
FT                   /translation="MKIILVCSAGMSTSMLVKKMRQAAEAKGIDAEVDATAEAGLHNEF
FT                   DSTDVILIGPQVRYLEKKIAEKSAPYKIPVAVIDSMAYGMMDGNKVLDQALDLQKTHR"
FT   gene            196903..197473
FT                   /pseudo
FT                   /locus_tag="Bsel_0186"
FT   gene            197598..198509
FT                   /locus_tag="Bsel_0187"
FT   CDS_pept        197598..198509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0187"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   oan:Oant_3124 ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97734"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW1"
FT                   /inference="protein motif:PFAM:PF01869"
FT                   /protein_id="ADH97734.1"
FT                   /translation="MFVLGIDGGGSSTVARLADYAGNSIKTVQVGEINSTMMNKDDWIQ
FT                   SCSSILNHFESYVDRIQCIFIGLSGISRLKIETIEFLKEDLKKRIHPDAEVFIVNDAVL
FT                   GLYAGTGGEDGIVNIAGTGSQTFGLKNGVEFKIGGWGHKFDHTGSGYGIAIEGIKSVIT
FT                   AYENRSPFNYFEKAVMDAWGEDSFMEMMEKINSGSSAKQIAQLSKTICALATEDEQARR
FT                   IIDRAAHDISDAITRMSEAHFAGEKGVKVILMGGLMNQQDLFLPLLEKKLPHALLKVLD
FT                   QEPVEGAVIAGLKAVKGSENGD"
FT   gene            198499..199647
FT                   /locus_tag="Bsel_0188"
FT   CDS_pept        198499..199647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mxa:MXAN_4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97735"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW2"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ADH97735.1"
FT                   /translation="MVIKTGLDNLLETNIPDLKKRSVGLVINHTSIDQRKQLSLDILYR
FT                   EGCQIKAVFTPEHGFRGTADAGEHVKDDYDGKTGIPIYSLYGKQKRPAKHMLEGLDALV
FT                   FDIQDLGVRFYTYIYTLAYCMEEAAKYGLEVWVLDRPNPINGQFVEGNRVRDNFTSFIG
FT                   NYRLPVRHGMTVGELAAYFKETFKIDVDLKVVKMIGWTREMHFTDTGLHWVNPSPSATG
FT                   ETMALCYPGTCFMEGLNVSEGRGTDYPFEQIGAPWLDGEAVCNRIKNKSMPGVNLHPVS
FT                   FTPINADYMQIACGGIFLEVTDRYQFSALETSLALVDVIHEMYPGNLKVKDPIKGRFFF
FT                   DLLFGTDEARKKMNHSESLLEWMRENDESSAFKLERKPFLMY"
FT   gene            199676..200608
FT                   /locus_tag="Bsel_0189"
FT   CDS_pept        199676..200608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0189"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hypothetical protein; K01207 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97736"
FT                   /db_xref="GOA:D6XVW3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97736.1"
FT                   /translation="MHLWEDVKQQYSDQICILWNRIYGDRFPLRKSLFQQNSIEDIHVD
FT                   ADASRLVTVGDEAVGLIIVKRDHYNRFQRSQAWIHLLMVDPTYQHRGIGSKLLKQAEAT
FT                   VVNMGASEIVIGQDPYHYFPGVPADQNAIKKWLMKRGYTNVNSVSDYVNTSPQSERKLD
FT                   TENILSSDEKGKLFSFLKAYFSSRWLYEAEEYFLKGGSGSAYVIIKDQGEIIAFCKTNI
FT                   GEKPLIGSNVNWSQRFTGILGGIGPLGVHPEWRKMKLGREIVLLATRHLLNQGVGSIYI
FT                   DWTELHGFYRSLGYTSIETYDQFKKTIEI"
FT   gene            200665..201573
FT                   /locus_tag="Bsel_0190"
FT   CDS_pept        200665..201573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0190"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="KEGG: plu:plu0403 N-acetylmuramic acid-6-phosphate
FT                   etherase; TIGRFAM: glucokinase regulatory-like protein;
FT                   PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97737"
FT                   /db_xref="GOA:D6XVW4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW4"
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /protein_id="ADH97737.1"
FT                   /translation="MTINLSDLTTERRNERTKHIDQLSSFEILSMINEEDHLIAESVKK
FT                   EMKAINNVVEVVCERFKKGGKLVYIGAGTSGRIGVLDAAEAPPTFRTDPEMIQALIAGG
FT                   DQAMFHAIEGAEDSKEQAKQDLERLNLSKDDVIIAIAASGRTPYAKGAVEYGNEINAVT
FT                   VGLSCNKGSELSALAQLAIEVEVGPEVITGSTRMKAATAQKLVLNMISTSSMILIGKIF
FT                   ENLMVDLKASNHKLQERAKSITSAITGCSEEEVEQTLIKADFEVKPAIVMLKTGVSLVE
FT                   AKEKLKQHRGFVRKAIESQSK"
FT   gene            201592..202908
FT                   /locus_tag="Bsel_0191"
FT   CDS_pept        201592..202908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0191"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: dvm:DvMF_0656 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97738"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97738.1"
FT                   /translation="MNKKQWLLKGSVISGLLVLGACGGNDNASESEGNWEDWEGTITMW
FT                   DGPRWEDEDENQYHWIEEKAAEFEDMYPNVEIEIVQQPWAELSDSLSVAIAGQNWPDIA
FT                   PIDISGGAISLNHIEEGIIETTDDLYTEEEWNDFYPNTLEAYEYEGSLYGVPTSVSVQT
FT                   MLLNLEIFEEKGVEPPEDGRWTYDEFVDKMIQLTDDDTYGFSTYIMPNYYEAWPFLLMD
FT                   GGYPLNEEMDEYTFNSPEAISGLEKLVDLKFKHETAPVEMGGSDVGGTFQSFAALDQRT
FT                   VAVQPWTTWAINSLQTEEYQMDFMVAEYPIGDLGEPVTMGGVGGFVMFMQEEDAKRQMV
FT                   GEFLKHITNTDEQYTTAVNYGTFPARESTADMDPFADNPEMARAQELTDQVVPIPMHQD
FT                   WGRIDEVIQSELQLALNGEKSAEEALNDAESEVERILAD"
FT   gene            202997..203932
FT                   /locus_tag="Bsel_0192"
FT   CDS_pept        202997..203932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0192"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00316 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97739"
FT                   /db_xref="GOA:D6XVW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97739.1"
FT                   /translation="MGQIGKEKTVINDQGKVLLRKKTVWEKVKENKAAYLFLLPKLIFF
FT                   MTFMFIPIVWAFFISFQDRGVFDVEWVWFKHYIAAFESPIFRAALWNTFVFTIVTVPAF
FT                   IITALIISSMIHPLGRRSQTFFRAAFYLPTVTSMVIIAMVWRWMYNYRFGLFNYIIEFF
FT                   GFESVNWLGQTSTALPSLMIMAILIPPGAGIIIYLAAMNNINPSLYEAADIDGATSFQK
FT                   WIRITIPLLKPTTLYLTILSTIGSFQVFTQIIMMTGGGPGYATETVVHVIYKSAFRDFN
FT                   FGLASAQSVILFFIIMVFAIFQFKTLQTEK"
FT   gene            203962..204924
FT                   /locus_tag="Bsel_0193"
FT   CDS_pept        203962..204924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0193"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xop:PXO_00882 L-arabinose
FT                   transport system permease protein AraQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97740"
FT                   /db_xref="GOA:D6XVW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97740.1"
FT                   /translation="MFQRRIKKPIIIVSLLIMALISLLPLYWVFVTALQLPSYQNEEMD
FT                   RPVSYVESSPPVLYPVGITEYVSQWQKKREAESQGDMEQAEVHSSLMTEVREKTFGSFT
FT                   HLFENTKIMRWLFNSVYIAVVTTAIIVLIDTMAGYVLAKKDFPGKWIIFWMIISTMMIP
FT                   EQVTLVPTFIIVQNLNMFDTHFALIFPMLALAFGVFLMRQFLLSIPDELIEAAKIDGAS
FT                   EWKIFRSIIVPLARPAMAVLGIFTFVLVWNSFLWPIIVINDENLMTLPAGLKTLQDANL
FT                   ADFKLLMTGATVAAVPMIIFFLMFQRYFIKGLTIGGVKE"
FT   gene            204924..206531
FT                   /locus_tag="Bsel_0194"
FT   CDS_pept        204924..206531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0194"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: beta-N-acetylglucosaminidase, putative; K01207
FT                   beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97741"
FT                   /db_xref="GOA:D6XVW8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW8"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADH97741.1"
FT                   /translation="MSLSINDKLGQMMVFGFSASKPDEVSEGIKEMIETHRVGNIILFG
FT                   RNLGSPGEIRSLTGKLQKIARDAGHERPLFISVDQENGAVRRLGEGTTVFPGAMTTGAT
FT                   GEPELAYECGYATALELKALGINWNLAPVADVNNNRHNPVIGVRSFSEDPEQAAAFAAA
FT                   SMNGMQKANIMTAVKHFPGHGDTEVDSHLSLPVIPHDMERLNHVELVPFRRCIESGADV
FT                   IMSSHIYFPALEKEKNLPVTLSHEVLTNLLRVKMGFEGLITTDCLEMDAISESVGTAVG
FT                   AVKAIHAGVDFVMISMRTDLQKQALEAVKRDIDKGLISESRIEESYQRIIAAKDRYLSW
FT                   RDTNLSDDAEYVPAIIDSAKHRELAENVFKKGISITQQDPNHFPLEKKSLKQKLVLYPK
FT                   NNYLSRVEDERYAADSLGKALAKIDPSVVYHCISEFVNGEDDLIEYAKTFDVWIIGTLS
FT                   LNQDYEQKQILEKLMEVKTDEIVVAVAMKNPYDLLWFKDAEIKIATYEFTTPAIEIAAS
FT                   ALYGDINVTGVPPVTLTL"
FT   gene            206560..207414
FT                   /locus_tag="Bsel_0195"
FT   CDS_pept        206560..207414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0195"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: reh:H16_B1066 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97742"
FT                   /db_xref="GOA:D6XVW9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW9"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADH97742.1"
FT                   /translation="MEQRGTMKLIEGMLKDLSPSERKIADFVLEKPDEVLSLTANQLGE
FT                   RSHTSSAAVIRFCKSIGFKGFQQLKLRLASDSHQDKSTEFRDIQPGESPAEVVSKMTTN
FT                   SMQTIKETADILNIYDLTQVIEALDQVNRIHFFGVGASNIIAQDAQLKFSRINKHTTAF
FT                   ADFHIASMHVANSGPGDVVFGISFSGETKEVLKILELANEKGATTIALTKFGPSTIAKT
FT                   ASICLRTSASKETTFRSSATSSRIAQLHVLDILFMSVANANYDEVIQYLNQTREAIRAI
FT                   QRK"
FT   gene            207440..208636
FT                   /locus_tag="Bsel_0196"
FT   CDS_pept        207440..208636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0196"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   fph:Fphi_1362 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97743"
FT                   /db_xref="GOA:D6XVX0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX0"
FT                   /inference="protein motif:PFAM:PF03702"
FT                   /protein_id="ADH97743.1"
FT                   /translation="MNNSTNVPKIELPIKKERVLAIGLMSGTSLDGIDAVFCEITGEGN
FT                   TTDIHMIRFITLDYEDSLKQSILAQCNPETSSVDEICRLNTILGKRFAEAAKEVVKGTG
FT                   WSIDQVDFISSHGQTIHHLPKERATLQIGELAVIAHETSCLTVGDFRPSDMAAGGEGAP
FT                   LVPFSDALLFAHPVHNRFFLNIGGMSNYTLVPSQESNISGEMVTGSDIGPGNVWVDEMV
FT                   KLITNGRQSYDRGGEIARSGVIIKRLLNKLIQEDMFYHEPFPKSTGREHYTVDKCRVYY
FT                   DEGKSLGYSDEDLVTTMTAFTVMSISEAIRKLQEKGIMIDEIYVGGGGVHNQYMLDEIG
FT                   NKVNIPVFNMERIGMDSDAKEAISFCVLGNEFLRFKHNNMPSVTNASSPKMMGKIVFP"
FT   gene            complement(208715..209314)
FT                   /locus_tag="Bsel_0197"
FT   CDS_pept        complement(208715..209314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0197"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: abu:Abu_0593
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97744"
FT                   /db_xref="GOA:D6XVX1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX1"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADH97744.1"
FT                   /translation="MDETVRWVKEHPGMTGILALYALFFLILYSDPATGDALLVNPETM
FT                   FQEPWTLITVIFATGSVMHLLLNGFLVIMFGGKLEKTIGTGTSVVLFLIMGLMGSVALF
FT                   LYAPFMTWTGEPAALASVAAIGMASIYTGLVKDAEIMGSKARRWVLIMFIMNIVLSWQN
FT                   EELTLLGPAHGLAIALGYGIGYGLRKSTEAKEHTGS"
FT   gene            209547..209840
FT                   /locus_tag="Bsel_0198"
FT   CDS_pept        209547..209840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97745"
FT                   /db_xref="GOA:D6XVX2"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97745.1"
FT                   /translation="MFWSDLVAVLIGSFINALIITRLVRFMLKKWMGDGVRVATYTFSI
FT                   SFVFYMVFNYIIISDIVIVIRYILFALLLYGYDLFKERDLRIIGGVDNQIKQ"
FT   gene            209959..211251
FT                   /locus_tag="Bsel_0199"
FT   CDS_pept        209959..211251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97746"
FT                   /db_xref="GOA:D6XVX3"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97746.1"
FT                   /translation="MDEQDQRKLVELYLTSTLAMIVFEEKILRDEIDNILKWLDRSSSP
FT                   QFKDNYRKFLDLFEQDMQDRIFEEIHNHRLFEGTSVFSTKSFNANKIGDFKERGKKNVR
FT                   NIFDHHDNQGNNQLNDEIELDNEKNDINVVQTLRQSFNDREAWDLLLSSVMAVIFVSNL
FT                   IYFISLVIAGSENMEGIYNELLLITAIFIVLSYNVYRNHYPYHHSTLYINPPVLSVKNN
FT                   LIIAVTGSLIANLIMVIAFYSYYDQLIDSSVDHVSEGITHEETEERDGNEQADSQISEN
FT                   ERVDDAKRNYLVSIADEMNFIYEELHYMSEYLYSDHYTLEEQIEELEFLYDVLYESAHR
FT                   PLYNDDYMRILNDYYYAIELFAIFVNTIISDIENLGYISDQEFAQQVQYYEDGVELFYK
FT                   GVEDFEFHLINLGEIDEYGVILDYYDDGDTI"
FT   gene            211469..213064
FT                   /locus_tag="Bsel_0200"
FT   CDS_pept        211469..213064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0200"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="KEGG: hsm:HSM_1619 type I restriction-modification
FT                   system, M subunit; TIGRFAM: type I restriction-modification
FT                   system, M subunit; PFAM: N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97747"
FT                   /db_xref="GOA:D6XVX4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX4"
FT                   /inference="protein motif:TFAM:TIGR00497"
FT                   /protein_id="ADH97747.1"
FT                   /translation="MGAELNAKLFSAADNLRSKMDASEYKNYLLGLIFYKYLSDKLLIK
FT                   VVELADESLDTYDTPDKQTELYEELLSDKDTKEDLIATVVDTLGYDIEPPHLFNVLAEQ
FT                   AKKNVFQLNDLNKAFIQLSTKYDAFSGLFDDVDLQSKKLGSDDQQRNVTVTDVIKKLND
FT                   VDLIGYEGDVIGDAYEYLIGQFASEAGKKAGEFYTPHMVSDMMSQIVAIGQEDKKWFSV
FT                   FDPTMGSGSLMLNVRNYLNHPDKVKYHGQELNTTTFNLAKMNLILHGVDPEEMRVRNGD
FT                   TLNKDWPTDEPYTFDSVVMNPPYSAKWSADDTFLDDSRFNRYGKLAPKSKADFAFVLHG
FT                   YYHLKETGTMAIVLPHGILFRGAAEGTIRQKLLEDGSIYAVIGMPPNLFFGTSIPTTVL
FT                   ILKKNRSTRDVLFIDASRDFIKGKNQNKLSKENIEKVVDTYNKRESVEKYAHLATFEEI
FT                   KENDYNLNIPRYVDTFEEEEPVDMKAVGTEMKEIQEKKQALQKSLFEDISSLQYSEEDA
FT                   EWIQGALEVFGYDK"
FT   gene            213054..214289
FT                   /locus_tag="Bsel_0201"
FT   CDS_pept        213054..214289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0201"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: shn:Shewana3_4163 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97748"
FT                   /db_xref="GOA:D6XVX5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX5"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADH97748.1"
FT                   /translation="MTNKLVPEIRFDSFKDKWLTRNLNEIMKFSNGINAPKEAYGQGRK
FT                   MISVLDILSEEYLTYDNVRNSVSVSEILEQKNKVEFGDLVFVRSSEVLNEVGLSKAYLD
FT                   NEYALYSGFSIRGKKISEYDPIFVERSLNGISRRQIERKSGGSTRYNVSQEILNSLFIN
FT                   MPTVQEQQKIGEFFKNLDDRIALQQQHITLLKESKQGFLQKMFPKDGERVPEVRFDGFS
FT                   GEWEVLEIKNIAAETYGGGTPKTSISDYWNGNIPWIQSSDLKTDVLNLVSPTKFISDAG
FT                   INNSATKLVPENSIAIVTRVGVGKLALVPYPYATSQDFLSLSSLKIDLKFALYSLYLII
FT                   KKEVNNLQGTSIKGITKPELLKKKIIIPSNLKEQQKIGEFFKNLDDSIAAHEKELELLQ
FT                   ETKKGFLQKMFV"
FT   gene            214302..217466
FT                   /locus_tag="Bsel_0202"
FT   CDS_pept        214302..217466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0202"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="TIGRFAM: type I site-specific deoxyribonuclease,
FT                   HsdR family; PFAM: type III restriction protein res
FT                   subunit; protein of unknown function DUF450; KEGG:
FT                   hsm:HSM_1615 HsdR family type I site-specific
FT                   deoxyribonuclease; SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97749"
FT                   /db_xref="GOA:D6XVX6"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX6"
FT                   /inference="protein motif:TFAM:TIGR00348"
FT                   /protein_id="ADH97749.1"
FT                   /translation="MQSLSHRSEAEIENHLIQVLGEGHNQWTFRDDLKSEADLWQNLRQ
FT                   KITQNNLSELGDTPLTDKEFDAIKTELLFRTQTPFDAAKWLKGENGIARITIEREDSHQ
FT                   GFVSLVLYSNQDIGGGISSYEVVNQIAKQSATDGGRDRRFDVTLLINGLPIVQIELKKV
FT                   TAKDGVYQAFNQIKKYAEEGMFRNNIFATLQLFVVSNEQTTRYFANAMPRNLHRKFMFS
FT                   WRTKDNKKVENLYEFCKQALNIPDAHRLIANYTIVSEDQDNKTLMVLHPYQIHAIEALF
FT                   TAVNKHQSGYVWHATGSGKTLTSFVSTKLLAKKSGIDRTIMLVDRKDLDSQTTSEFTKF
FT                   ASEFNTGISSGNTPANSLIVGTGSAQELSKTLLADANSNVVIITTRQKLDSALKHAKKQ
FT                   EEQKGSNRYEKLMGQHIVFIVDECHRALSAENMEETKKFFPNSTWFGFTGTPIFEENKK
FT                   QAKGQLARTTFDQYGDKLHSYTIKNALEDGSVLGFQVEHETTIKPISLDEMIYTKLRNS
FT                   EAYTHMPDEAINIEINKMTGMQKEAYIDKETYEKDEHIDTVIKKIFSPNNAYIKFDFKN
FT                   GKPTKSAILTTSSIDMAKRYYKAIKAMTSEENWMEEVFQDRPLRKGQTMDDPDFPRIAI
FT                   TYSLDENNENAIDQQEEMQEIIDDYNRYYKTAWSLQDIERYNGDINNRLARKRAEFQQP
FT                   GRQVDLVIVVDRLLTGFDAPTIQTLFVDRNLEYAGLIQAFSRTNRTYPDKTKGLIVTFR
FT                   KPHKMEDNVAKATKLYSEVKEESGLIYPSYDSAKKRFKKAHKELEAIIEEEGQIDEQAP
FT                   IDTRVDYVKAFQELNNAYEALVTYDSYNNDIDTSKALQAQVNVLKEEMGVYETVKGSLI
FT                   EDEPIIDPINPPDFSDLTFYSDASAKLYDIDSSYIDQLLGTYQANNPDVRDEIEEALKK
FT                   LNKAETVKDVYRSILNAIDDKEVDEAEDIFAVKRRFFTEKKEQIVEGFSNYWHVSSNEL
FT                   HASAIQYMIGMDAIPNMKSIIESKDYDAFKVEHPDVKPFKYPQMMKREWQQVLDEQIVP
FT                   LDDELR"
FT   gene            217545..218399
FT                   /locus_tag="Bsel_0203"
FT   CDS_pept        217545..218399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97750"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97750.1"
FT                   /translation="MNIEPIYKEYRRLKKSIDSQEAICLRDWNKSISVIYEKGKYKVDV
FT                   DLYTLDITNRKDITNGLYAKYEHKLKGYNFDNAKQDITNSSRRDERRIWSGYLKLKYPD
FT                   SYLDIKFIDRERPDYYLYVNGCVIAVEVVEAMFQKQGKFRNWHRSFLGKNKMISDLVNH
FT                   RYYDDSFYLEEDNNMIWSSCHKGMINSSAIRIKIIDAILSKVKKYKNYMKDVELPKEKC
FT                   ILVGYTSIGLIDESDFLDLGRRIAQEEQIRSSHIERIIVTSYLYNNLVEYDRCGEIVHY
FT                   KIT"
FT   gene            219331..220116
FT                   /locus_tag="Bsel_0204"
FT   CDS_pept        219331..220116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97751"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97751.1"
FT                   /translation="MMNGVILMYSDQEKEILVDVENVVSRYFNLSDLVINNLPHQIEND
FT                   DLYTLEEVAEILSMSIVTIRQYVRQGKLKAIKQWKNWMVPSNAIAKMIYERKNGKKLRE
FT                   NETMLVIVAGDLYEEDSSIRDYQIITAGDLLANINANSSVAIDDYIYTVMPNQKEHLIY
FT                   IEATSNINNFFRRTGDIVFSDLSKVEAPLESFLPEEKKALSHIISNRDHLIVENPNEAL
FT                   LTIKELFGEPEDVYTVLKIYKALLEVAGEEFKGQKKGDV"
FT   gene            220193..220594
FT                   /locus_tag="Bsel_0205"
FT   CDS_pept        220193..220594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97752"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97752.1"
FT                   /translation="MSVQQIADNFLNEVSHFRNVDLKPSEKNTKRINVYVSPESRKRWM
FT                   QVDINPTYLAVSMDHMEGELSLMDVSKIGISQDRSSRKTSFKVTPNTEKFSAVHFSFFE
FT                   TDNYDFSNEEFIVFLEKHYKAFLKRVRLT"
FT   gene            220905..221189
FT                   /locus_tag="Bsel_0206"
FT   CDS_pept        220905..221189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0206"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bph:Bphy_3633 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97753"
FT                   /db_xref="GOA:D6XU44"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6XU44"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADH97753.1"
FT                   /translation="MTTRKRRSFTKEFKEQIVQLHQAGKPRSELIKEYELTPSAFDKWV
FT                   RQYQGSGSFKEKDNRTSVEEELLQLKKENKQLTMENDILKQAALIIGRK"
FT   gene            221231..222019
FT                   /locus_tag="Bsel_0207"
FT   CDS_pept        221231..222019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0207"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   net:Neut_2192 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97754"
FT                   /db_xref="GOA:D6XU45"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6XU45"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADH97754.1"
FT                   /translation="MCDVLQIARSSFYYESKRQNESEQEELTELIVSIFMKSRKIYGQR
FT                   KIKAELKRAGWTVSRRRIKRIMAEQGLVSKYTVAQFKPSKSSCNESETGNTLDRKFDQD
FT                   DELSVVVSDLTYVRVNKAWHYICVLVDLYNREIIGFSAGPHKTAELVQTAFASVPYNLN
FT                   RIEIFHTDRGTEFKNHLIDQALDTFGITRSLSDKGTPYDNAVAEATFKTIKIEFVRGAV
FT                   FSSQQELDLELFDYVNWFNNIRIHGSLDYLSPAEYKSTGP"
FT   gene            222025..222408
FT                   /pseudo
FT                   /locus_tag="Bsel_0208"
FT   gene            222721..224013
FT                   /locus_tag="Bsel_0209"
FT   CDS_pept        222721..224013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97755"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97755.1"
FT                   /translation="MVAVIAGMILVAGCNQLDQRVEQVKDAVESGEYGDAAYLAGAFLQ
FT                   DEELTEEDLEQFEAAIQAYLGERLSDLHDQYKAEEIDEAEVNERVDPVLSVLDDPGEEA
FT                   ESYASEINVMKEARHHLHKGETLMEKNWLQAALEEFQKIDDKAEDEFAQAQVLYEEIQP
FT                   NLWDEVKGDVATDVDNGMMQAALRRLDEVSEWFEDHAEWDELHDQIYETEVIKGLSKVE
FT                   DLLADESYRDALEKLEELSAYGMMENELDEMINETEAVIQAQDEETKARLQSAITEYYD
FT                   DVTGDTIYVPEGHSTQYVDIVKNQTSFYPRIVESGSIAYFTIVAGFGQDDWVFFDTLIF
FT                   NADGRRFRWDLPYFDRGSDVGGGVFEWYILSELTVPSIMDDLEVIRSSEEVQVRFQGNG
FT                   FRDYTLTKEDQQKIEDMLDFYYLNEFEGLSF"
FT   gene            224746..227007
FT                   /locus_tag="Bsel_0210"
FT   CDS_pept        224746..227007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_4757 protein of unknown function
FT                   DUF900 hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97756"
FT                   /db_xref="GOA:D6XVY3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97756.1"
FT                   /translation="MNHSREIYQEVIRKVEKVISTLESEGTDSEIIEYQNQARNKLSAL
FT                   YQTLVDNLQSLEKNSEWNVFTIAFYGETNAGKSTLIETLRILLKEKTKLQERMTFDKAL
FT                   HDYKQVQFKINDLNTIIKSLENSYENELMIKQDILNGLLLRKTDLESSLEILESRLNEL
FT                   HYDILHKIVFRSFDFIRSMFNKLDEQTEIDNIVLEINDVGEKMKSLEEEIIKRQDDLDE
FT                   TDEKYDSDKKSRMKEAALLQNTIAELEQILTNNSDAKIVGDGRSDFTRNVTEYRFAFNN
FT                   QTFVISDLPGIEGNEKSVQAEIDGAIEKAHAVFYISGKANPPQKGNDERTGTIAKIKNH
FT                   LEKHSEVYFIYNKRVNNPRQLSKTLITDSESESLNVVDRVMAETLGKQYNHHLSLSGYP
FT                   ALVSIGNYWGGRLEKSKYKFLDTFDSPKVIMTYSGVKTFSDWMTTNLVENINFKIEKAN
FT                   VNKVSFSLNDTINNLGELSDSFNRLEHKLKSTLKGSSDQLEEVEELFYRNVINSMNGAI
FT                   NKFKQSLRKKMYSDIDQDINNDQFSNRLKQRTEEEVERLIKDFEKRIHKNVEDFEGHMS
FT                   AVIEKNQQYVEELLESYSNSVEFTFEFDPEIKMKKSVNPAEVAASAGGLIYGVIFNVMN
FT                   LTNPFGWALLAISVITLIVFASKTIYKVLNSDYRKSQQKKSTDENIQEIANKLRASLEE
FT                   EVDKTVTPVNNAVNRIVKDIETSVSQVEVMRQVFEDVESELRVMARDIEYREELINGNN
FT                   "
FT   gene            226994..228664
FT                   /locus_tag="Bsel_0211"
FT   CDS_pept        226994..228664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0211"
FT                   /product="labile enterotoxin output A"
FT                   /note="KEGG: ppg:PputGB1_4758 labile enterotoxin output A"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97757"
FT                   /db_xref="GOA:D6XVY4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040576"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY4"
FT                   /inference="similar to AA sequence:KEGG:PputGB1_4758"
FT                   /protein_id="ADH97757.1"
FT                   /translation="METIDYFKQRQSKTIEVLKRLMGFLEDGERFGITLDQSVINKIQS
FT                   AINTVETDILKVALIGGFSEGKTSIAAAWSEKYDTSSMIISQSESTDNVNIYKLDDFEL
FT                   IDTPGLFGFKETEDRQRFNDLTKKYVSEANLIIYVMNPNNPIKESHKEDLTWLFKDLNL
FT                   LPRTVFVISRFDEEADLEDEDDFNERFYTKRENILSRLNDFGIIQKNEEISVVAVSANP
FT                   FGEGIDHWLSNLNEYKKISRISQLQEATTEKIKSVGGEHSFVVETQMSILRDVIKREMP
FT                   TAMERVVQASKEVEKLRNTFIDIQKELNKSEKKISDARIDLRTNISSHFKDLILQVKGT
FT                   DLNTIDDFFERNIGDEGIVLETDIQNEFDRQLGKITHEISQAEKSLKSSVGHYNNIVGD
FT                   MALDGMKLGGEFLKKGGFQLNKEAVLATRDLLAPSIKFKPWGAFKLAKNLNKGAAVFGA
FT                   VLGLGLEVWESWSKRKKEQEFQKLIEKTVQHLSDQRKEYLAFVNNDEFEHTFFPQYIQL
FT                   LNDIEQIKTEVSNRETIQKEFEKWQHQGEIIEAEYKLLP"
FT   gene            228895..230199
FT                   /locus_tag="Bsel_0212"
FT   CDS_pept        228895..230199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0212"
FT                   /product="GTP-binding protein HSR1-related protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; Miro domain
FT                   protein; KEGG: hpj:jhp0681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97758"
FT                   /db_xref="GOA:D6XVY5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY5"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ADH97758.1"
FT                   /translation="MGKKKDFENRLERVINLYDNLDEIINTLPLEMPDGARDTVKKMIF
FT                   SNDEINEVITGLKERRPPRILLIGRTGVGKSSLINALFGKYHAKTSPIEIGTQKLERYN
FT                   YESNGEVVFEVIDTRGIGESKTDNATSAEEDLKHAVEDFDPDAILFLSDATQRARMDED
FT                   VNYIKEIYDDIGMEIPLVTVLTHVDNVEPSRIKEPDQYNRSKLRNIESKKSDMEKLLSD
FT                   MNVKNSIVIPVSAYIEWDREDPHLLSPEEQKQLIIEFDGRYNIEELIDFLQKNMDFRAA
FT                   IHLLMNTRLELAVRKISNSMIKGFGLASATVALTPIPFSDIAILVPMQLILVIMIGYLS
FT                   GSNVDKESAKEFLVSLGRVGAAGFGLRVLAQQGSKALNLVAPGAGSAVSSSVAFAGTFA
FT                   IGKAAQAYFIEQVNEEDLPEIMKKAHEEGEALQSQ"
FT   gene            230222..230680
FT                   /locus_tag="Bsel_0213"
FT   CDS_pept        230222..230680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97759"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97759.1"
FT                   /translation="MKDFFNSAKGKWDQVKASTYRLKLDGDKLMRLAINTVPADKNIVI
FT                   ESIDVVSGTIVVTGKTMKYKINHNFSLTVVPDGFNDREISFKLITMKPFNNEWLKSQVF
FT                   TDVSPYVHYDNSRFTLELNKIANVEKSPFGKIKESTIAEDKYVIGFGV"
FT   gene            complement(230905..232395)
FT                   /locus_tag="Bsel_0214"
FT   CDS_pept        complement(230905..232395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: midasin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97760"
FT                   /db_xref="GOA:D6XVY7"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97760.1"
FT                   /translation="MNKRHDKHEQMDTTDKQLTDLMKNASVELPKQTEKASLNAMAKGV
FT                   SEARQDAVKMNKWQERRTLLIGFGGTVSAAALAGLILINTDFVQDAFPGWFGDDAVPAD
FT                   ENNEENEEEPDEHDEQEENDDEESSLDFTKPEFEVLPPEEDGEDDREVTFTYHGDSWNE
FT                   TFEAFSSDHLPIHGFRPEGWALNEETIEDEFVIDRLTIGDYIQLDYYELGATAEDMERS
FT                   VQAYIDEHGFEDDEIETLPEDEIPELGQGLPFSFFKKGYRMLAEGDTYTEIYYGELNGR
FT                   YVRILHESPDQEPELWAHGDVFFHLIAPVLPATVASENDTIDEETGRAQEKTIRFQLDD
FT                   GIGERDFKLFNDDELGFNSYIPEDFAVQEERDGRVKQYILDEQEDPWGQVSIGIFDEDV
FT                   TQDEAWTYILDHFAYGENIRDQGEQSRTPDWAIDTFDNHPGGGADIVGSAKLSERNGRY
FT                   FYIEDHSESFEIAAFDNSITVRIIEHYWQWDDGSSLKE"
FT   gene            complement(232388..232945)
FT                   /locus_tag="Bsel_0215"
FT   CDS_pept        complement(232388..232945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0215"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mxa:MXAN_4309 ECF subfamily RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97761"
FT                   /db_xref="GOA:D6XVY8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97761.1"
FT                   /translation="MTDEELIQEILDGNDEAMKELHGRHVQSVFQYLYIQMSDYHDAQE
FT                   LLQDVMYKAARRLATFKGDSAFKTWLFAIAKHAVIDYYRTRGKRRRTTAVDNTVMDAVG
FT                   DLKESAEQTVIRQMETESVMQTIRQLPQTYRDVLHLRFIEGFSIKETAKVMGKTSMSVK
FT                   ALQKRARAELVNRIGNEVTAYE"
FT   gene            complement(233078..233428)
FT                   /locus_tag="Bsel_0216"
FT   CDS_pept        complement(233078..233428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1781 UspA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97762"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97762.1"
FT                   /translation="MNIVPHYEDAILEVTVDGEFTDEEITRLEAHFKEMKAGHSQVKML
FT                   LVIDNIHVTLKGLIEDLKFDMKYWNDFDKIAVVSDKKSVEIVTRLSSVLPKLEMKHFTL
FT                   SKVTDATSWLKE"
FT   gene            complement(233740..233862)
FT                   /locus_tag="Bsel_0217"
FT   CDS_pept        complement(233740..233862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97763"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97763.1"
FT                   /translation="MNTHFPGKIHKAAKHSPLYILANNKLDSVVLDYSHYLKMY"
FT   gene            234185..234595
FT                   /locus_tag="Bsel_0218"
FT   CDS_pept        234185..234595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97764"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97764.1"
FT                   /translation="MELLFFLVIGVVYYYNHKKIHNYFQREQLFNNEANNLQECATNSV
FT                   VMSKIYENSSAPYFMIKDKNVADFNHDLFTEFHNASQLFHHDQEFQKEMNDSHNPYVNP
FT                   GQDIIVDESYHGIDHGIGIANPSDHHDHNNHN"
FT   gene            234645..235481
FT                   /locus_tag="Bsel_0219"
FT   CDS_pept        234645..235481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0219"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   aha:AHA_0872 PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97765"
FT                   /db_xref="GOA:D6XVZ2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ2"
FT                   /inference="protein motif:SMART:SM00670"
FT                   /protein_id="ADH97765.1"
FT                   /translation="MGIMYLIQDLQEQIVFYVLVLLLMQAAGVYYLLKIHSKIFKPKPN
FT                   GLKAVLFGLLGKGLGQAYNGQLTKAILFISIYPLLLIVGFFSQELFAETNLLAYTFFGG
FT                   YTLSLIDAGRSAKYGKMRFLKLKRQEDVKAKINQLLTYYQSEYKLAVDTNILMHEADLL
FT                   VNLLEQQKKEIHMSKIVFEELDGLKKSHHDTTRKKAQLAFDVIEEYQRRGLLKIMKGAK
FT                   SDEIRKYGLGHSSDERIIGTYLLAQNELESKFVFFSNDKGARIMARDAGLPVVEIS"
FT   gene            235687..235935
FT                   /locus_tag="Bsel_0220"
FT   CDS_pept        235687..235935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97766"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97766.1"
FT                   /translation="MDTYYSEDEYLGERLQGLFIIPKDGPRPLITDEPFTLHVNNKFER
FT                   RVVQESTSELYGDSELTITYRYVNDDWMIEDRGIETE"
FT   gene            complement(235994..236538)
FT                   /pseudo
FT                   /locus_tag="Bsel_0221"
FT   gene            complement(236969..238429)
FT                   /locus_tag="Bsel_0222"
FT   CDS_pept        complement(236969..238429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0222"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sat:SYN_02721 HD domain/HAMP domain-containing
FT                   protein; PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; histidine kinase HAMP region domain protein; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97767"
FT                   /db_xref="GOA:D6XVZ4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ4"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADH97767.1"
FT                   /translation="MDLLNQFHVRMLINYMVGSLIAVFGVGSVFIFHTLTLSSEETLIL
FT                   LGIMVLSGLIMISLELFVYSKHIRPLVHFFKKGMNPQDAYMTAHSFPFMTVRRIMGPHL
FT                   LGLSIPATVMTLFALSLGFLTLPHLYVLYAWIGAILIATLHAMIEFFMTSRAVQPLIAS
FT                   ICARTDENLKLDGVKVISMKWKLLLSMLLIAVFPAALFLLAGQIRESAETTTAYWNWAF
FT                   LVIVVILFVSIAGAVVLYRNMEQPILELRKNLEQVQHGEFHEMPNYYADEFSTLINGFN
FT                   SMVSGIKSRDAENERLLESFFSVFAATLDARDSYTAGHTTRVADYSTQIARRSGLSGDE
FT                   LDLLRKSALLHDIGKIGIPDSVLLKDGKLTDEEFDKIKEHPVIGGDILEKVNLPEHLRP
FT                   LLDGVRHHHERFDGKGYPDGLSGDRIPLYGRIIAVADAFDAMTSNRPYRKAMSYEQARN
FT                   ILQNGRGSQWDPAFIDHFMDFYEERFKT"
FT   gene            complement(238717..238938)
FT                   /locus_tag="Bsel_0223"
FT   CDS_pept        complement(238717..238938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97768"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97768.1"
FT                   /translation="MLLVIDNIHVTLKGLIEDLKFDMKYWNDFDKIAVVSDKTSVEIVM
FT                   RLSSVLPKLDMKHFTLSKVTDATSWLNE"
FT   gene            complement(239117..239515)
FT                   /locus_tag="Bsel_0224"
FT   CDS_pept        complement(239117..239515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97769"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97769.1"
FT                   /translation="MGIYLTEEEDQCVHHGIILDLLKALIEKDQKSFQDRVWAEEMEMV
FT                   FVALNGVVAKKMRENNAQLRSLKVRYTFTGNESEQFANYMVYYRGYEEKKNYFIPHLND
FT                   LVNRTYRKLFTRYVMRPVEDQCQRQPSN"
FT   gene            complement(239885..240562)
FT                   /locus_tag="Bsel_0225"
FT   CDS_pept        complement(239885..240562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0225"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: atc:AGR_L_2094
FT                   two-component sensor KdpD"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97770"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ7"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADH97770.1"
FT                   /translation="MKTDHTRDERILVCVNYGHTGRRLIRRGGQLSNKLGAELIILIFD
FT                   SLPDDEFAYHKEIDIAVFKELAKAYNAKVIIKKEKAIDITNTIVTTAKSEHISQIIIGQ
FT                   MAESIWATVLGRSVIDVLLKQVPSADLHVIPIDRSSAQEEWEYDLGVRAYLAENDDGSY
FT                   DLLYENNSRVKYEGIFLNSIHTEFENGIFSFLSEEHKTMEVRVVNGKVLSFVDIDDVEG
FT                   TDR"
FT   gene            complement(240717..240899)
FT                   /locus_tag="Bsel_0226"
FT   CDS_pept        complement(240717..240899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97771"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97771.1"
FT                   /translation="MATTTRGRVLWDQPNRGRGTCPVCNRTGIKLLYERVVDHDVTKQV
FT                   CKNCRSKKQLKKQGT"
FT   gene            241250..242005
FT                   /locus_tag="Bsel_0227"
FT   CDS_pept        241250..242005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0227"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97772"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ9"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADH97772.1"
FT                   /translation="MQNNSNQLKKLHITQRDMLYFTVLLKLQETSIHAAEIHRFVSESF
FT                   KKDNLSPNRSKAYVYNCMKEMERLGWITHKVEGKKKIFSIRREGEDTLTSFKDMYLPLL
FT                   LHIDKAVSQMMYNVSNKAFHDVDWSLTDKEKQYLSKILNVKAIIQWYILHRLHEQEGLH
FT                   GGELYREMDQRYAWINSHGYFYQVLRDLDHEGFVTSQWANEETRSKRTYHLTDAGKRQY
FT                   VELTEQVRFHLHELRQFLRTMIQRFDHVS"
FT   gene            242313..242984
FT                   /locus_tag="Bsel_0228"
FT   CDS_pept        242313..242984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97773"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97773.1"
FT                   /translation="MKKWMVSLSAATLIMLAACGNDGEDNQEANDNGGNQETQENTAGT
FT                   NEEAETNDSSENGNSDSNDEWETQVGETIENEGGVFTLHARAEPVDPVETGPVVVEIDQ
FT                   LNVQSGDLSGEMAEFMETDRLEMIQLDLSVANTSDEDIAFYADQAEIATSTGEQLQADF
FT                   WLSDSIGGEMMGNTSSQGTLFFVLESTSAEEVEHIRIRWSAPQDDNYDSIGEDVDLTVE
FT                   F"
FT   gene            243091..243483
FT                   /locus_tag="Bsel_0229"
FT   CDS_pept        243091..243483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97774"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97774.1"
FT                   /translation="MGSGMSLHCRVCGYHRMVMSGIGMSHYSFENCLESCVPAVRKKIR
FT                   KIVKHKVHDYTFEFRCYSCQSCGEIMDKPYLYIQYDDDQTYETRFRCTKCRSRRLLPIE
FT                   EEVLSALPCPSCKEITLTEVGMMLWD"
FT   gene            243548..243862
FT                   /locus_tag="Bsel_0230"
FT   CDS_pept        243548..243862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97775"
FT                   /db_xref="GOA:D6XW02"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97775.1"
FT                   /translation="MKEGAYLFYFFSVVSAGFGFYKYWHYDNSEGYAATPVNAYVGGDA
FT                   YNYIINANYMIAFFVLALIFVVIANHLFKMAVLTEKQTSNNQVAKRQLMQKRMRRVNRV
FT                   "
FT   gene            complement(243995..244276)
FT                   /locus_tag="Bsel_0231"
FT   CDS_pept        complement(243995..244276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97776"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97776.1"
FT                   /translation="MNKVQAFFTDLISMLSFSPFITNITEEDIRRNLKLLKQHTWFLHY
FT                   LEDDSYRQLIISDRDVRQTIGSLNPKRISSSPNRKVVRIIERKHSGSD"
FT   gene            244432..244722
FT                   /locus_tag="Bsel_0232"
FT   CDS_pept        244432..244722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97777"
FT                   /db_xref="GOA:D6XW04"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97777.1"
FT                   /translation="MFRHRVSLRVTCFFMMLAYSSAFVYHGYGGLLMSVRVSDPDMFAT
FT                   IVLAVIPIVLLDHFFLITAIFLSLMTPYVVFLKIRTKIDFNRFRRQLSADQ"
FT   gene            complement(244941..245267)
FT                   /locus_tag="Bsel_0233"
FT   CDS_pept        complement(244941..245267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97778"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97778.1"
FT                   /translation="MIINFKRLLFGASTEPLTIKQNRYPAGKMSLEYHLPQDRPATSPV
FT                   YDVHIELTDHTDTYTIIQDSVPVRDGHRWLVTENGTIASTKRLTEKHRISFRSRSLSVP
FT                   LKLP"
FT   gene            245526..246134
FT                   /locus_tag="Bsel_0234"
FT   CDS_pept        245526..246134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_1413 general secretion pathway
FT                   protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97779"
FT                   /db_xref="GOA:D6XW06"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97779.1"
FT                   /translation="MMGLSRNDQRGLTLIELLAVIVIVGILAAIAVPAVNNVIENSRKD
FT                   AHLATAEAIYEASRLAVIDRQINAGDTDTTAYVFYTGTSSKLNEFLGGGENGIRRVNLV
FT                   EDGYLDSHPINPHTREPYQYTVLLRAGNQSYIQLTYGDGNTEKVFRLPEPSSALDVFIH
FT                   VPSETVRYRTATFRHHRAVSIDKLRREGRDNVKSGSEMR"
FT   gene            246642..247127
FT                   /locus_tag="Bsel_0235"
FT   CDS_pept        246642..247127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0235"
FT                   /product="protein of unknown function DUF323"
FT                   /note="KEGG: dal:Dalk_0621 protein of unknown function
FT                   DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97780"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW07"
FT                   /inference="similar to AA sequence:KEGG:Dalk_0621"
FT                   /protein_id="ADH97780.1"
FT                   /translation="MKKMLATAAAILFVFAACSNDGTGTVEEDATNEAVVNDNQNHANA
FT                   NNDETDEEEEVPEAVDDELQAILDHFEGDGFDVGEQAFKAYEMVGAVDGFGVDVNGEEI
FT                   ELYLYDEGSEELEELRSEGQFDMDGFPIPGEVNGNIALMSHEEHPDQSEILSTFHDF"
FT   gene            247190..247555
FT                   /pseudo
FT                   /locus_tag="Bsel_0236"
FT   gene            247859..248092
FT                   /locus_tag="Bsel_0237"
FT   CDS_pept        247859..248092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97781"
FT                   /db_xref="GOA:D6XW08"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97781.1"
FT                   /translation="MHVSLKSTNGVIKQSKVGFSWTVFFFAFFPPLFRCDIKWAAVIFV
FT                   SAILVGLASGGVLAWLPSVVLAFIITRQEDSI"
FT   gene            248286..249626
FT                   /locus_tag="Bsel_0238"
FT   CDS_pept        248286..249626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0238"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: hpa:HPAG1_0201 putative transposase OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97782"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW09"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADH97782.1"
FT                   /translation="MARKKPVKVLRKKKKTANVQRFTQKQNIGRSTLSAREFRLLQRMS
FT                   HSSKALRNVGLYTIKQKYLNENKMATTKEIDSAMKADMNYWGIQSNSVQAVRRTLLSEV
FT                   KSFFEALKKWKENPEGFTGRPKFPNYSCSTAKRVIEIYQVPKVDKDGYWNIPMNADFRK
FT                   RFGPLKLRMPKNLMDKKISYIEIVPKQNGRFFEAHYVYEVPVSQMKKQKTTTKALSCDL
FT                   GVDYLLSCATNQGDTFLVNGKRLKSINQYFNKEISRLKQKNIENGLSKRIVTNQMASLW
FT                   CKRNLQIDGYLSQTVGLLFKQIKQLNIDTVVIGYNAGWKQESHLGKKNNQEFVQIPFRR
FT                   LISAIENKCLKEGIRFVKQEESYTSKSSFLDNDDIPVWIKGDDTRYSFSGKRLYRGFYR
FT                   SENGQCIHADINAALNILRKSQVVEWDEKTQIKTPMIMDVQKRKAVA"
FT   gene            250060..250779
FT                   /locus_tag="Bsel_0239"
FT   CDS_pept        250060..250779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0239"
FT                   /product="protein of unknown function DUF1535"
FT                   /note="PFAM: protein of unknown function DUF1535; KEGG:
FT                   par:Psyc_0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97783"
FT                   /db_xref="GOA:D6XW10"
FT                   /db_xref="InterPro:IPR011434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW10"
FT                   /inference="protein motif:PFAM:PF07553"
FT                   /protein_id="ADH97783.1"
FT                   /translation="MMKDCGFGFKQKGLAGLIVAFMMALIMTGCVNEASEATDGDVNDA
FT                   VNEEENAAEETVGEEPSENETAQEEEAPAEDDGTEEEEADPDVPREYLSALNKANDYLA
FT                   FSAMSESGLYNQLTSEYGEQFSAEAADYAMANIDVDWNEQALKSAESYNSYSPFSKKGL
FT                   FDQLTSEYGEGFTDEQAQYAIDNVDIDYKENALRSAESYQDLMDMSPSAIHDQLTSEYG
FT                   EGYTQEEADYALQNLSN"
FT   gene            250961..251809
FT                   /locus_tag="Bsel_0240"
FT   CDS_pept        250961..251809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0240"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease components-like protein"
FT                   /note="KEGG: pfl:PFL_6025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97784"
FT                   /db_xref="GOA:D6XW11"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW11"
FT                   /inference="protein motif:COG:COG1132"
FT                   /protein_id="ADH97784.1"
FT                   /translation="MSETNESLFRPYMKRLAGTYTLSFGESVLELMYPFAIGLAINGLL
FT                   DGQGVVSLVPLIAIWLSQTVFSAVYEMTSARVVARMYRELADQLIIKPEGTKQDDSQVT
FT                   ARVEMVNEVSESFTDVVPGLINGVVGIVVSAVMLFVYDLYAGLVALGLIGINALIQWRF
FT                   GIRAMDLSEKINTRREGQVNIIKARKPASVRKHFKSLTKLNVRFSDTEAGTWAVADVVS
FT                   LGALAAILMIIAGTGAFDAGTIFAMVTYLMTLTDSLEEGPILIEEGAHFLDVSSRLNEK
FT                   V"
FT   gene            252045..252467
FT                   /locus_tag="Bsel_0241"
FT   CDS_pept        252045..252467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0241"
FT                   /product="Protein of unknown function DUF2500"
FT                   /note="PFAM: Protein of unknown function DUF2500; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97785"
FT                   /db_xref="GOA:D6XWE3"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE3"
FT                   /inference="protein motif:PFAM:PF10694"
FT                   /protein_id="ADH97785.1"
FT                   /translation="MKMLSLSPAVFIPGATFNQFSAMPWFIQLVFLIVIGVLVFRAVRW
FT                   LAEWLSNNRQPVETTIAKVVSKREHQTRQSRGAGNQGIGLSRTRTRYFVTFEMETGERT
FT                   EFKVSGNEYGMLTEGDSGQLTHQGTRYHGFQRAGTT"
FT   gene            252699..253574
FT                   /locus_tag="Bsel_0242"
FT   CDS_pept        252699..253574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97786"
FT                   /db_xref="GOA:D6XWE4"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97786.1"
FT                   /translation="MHLENERLKIEVQPPGTFYSGARFDWTGLISQVTLDGTVQYCVPE
FT                   RLEEGEGTGGHGFCNEFGLDQPVGYEETAPGQRFPKIGTGLLKKEADTAYDIFHPYEVV
FT                   PASMKVIKEDDAVIFEVSQESPGGYAYHLTKTVRLEGTRLIQAYTLLNTGQKPLQTNEY
FT                   SHNFIGMNDTLYNGSYELTIPGLESLDVVVGELSQQGETVTWPVTPTDDVYAGLTLGTG
FT                   VRDRTYHWDLYHRGLKAGVRDLSPFTPSKMALWGRAHVACPEVFIDLRIEPGERASWER
FT                   VYEFYREEAE"
FT   gene            253729..254757
FT                   /locus_tag="Bsel_0243"
FT   CDS_pept        253729..254757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0243"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   scl:sce1111 lipoprotein releasing system transmembrane
FT                   protein LolC"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97787"
FT                   /db_xref="GOA:D6XWE5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH97787.1"
FT                   /translation="MGLAFKEIKRSKMKFTILGSIIFLISFLTFIISGLANGLAYDNVS
FT                   LIKDLPDGTYYMTEEADGNAAMSEIGEDLEASVLADHDGAFTMATQNGALRDEDDVRHN
FT                   VVFASSSDEERFGALEEGDVLLDESMKEDVQAGDSLTVDQLDLTLTVAGFLDETKYNHA
FT                   AVAWVKRADYETITRSEAMQFLLIPGDDAPTISGLDRFTADEFLNAIPSYSAEQLSLTM
FT                   IVWFLVAISGLLFAIFFYMMNVQKIGLYGILKAIGVKTSTLFGMMWLQMLIITLLSLTA
FT                   AALLSQLFQFAVEGLPFLLAVDQILELSVIFLVIGFLGATASGIQIRYIQPLQAIQQGE
FT                   MA"
FT   gene            254757..255428
FT                   /locus_tag="Bsel_0244"
FT   CDS_pept        254757..255428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0244"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: prw:PsycPRwf_0086 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97788"
FT                   /db_xref="GOA:D6XWE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97788.1"
FT                   /translation="MAMFTMEGITKEIQNGEVQESLLKGVSLTLKEGEVTALTGASGSG
FT                   KSTLLTIAAGLQPASEGTIHFNGERVSTMSQEELRALRASSFGFVFQSAHLVPFLNVAD
FT                   QLALMLKVSGTKMKRIERDDRVEELLKAVGMTHRKKAYPASLSGGEKQRVAIARAVIHQ
FT                   PKVLFADEPTASLDSVKSNEVMTLIRNLTKDGQITTLMVTHDQEMLSYADRIVTMKDGI
FT                   I"
FT   gene            255585..257015
FT                   /locus_tag="Bsel_0245"
FT   CDS_pept        255585..257015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0245"
FT                   /product="sodium/glutamate symporter"
FT                   /note="PFAM: sodium/glutamate symporter; KEGG:
FT                   dal:Dalk_2099 sodium/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97789"
FT                   /db_xref="GOA:D6XWE7"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE7"
FT                   /inference="protein motif:PFAM:PF03616"
FT                   /protein_id="ADH97789.1"
FT                   /translation="MELDVVSGVMRAIFFTFILISVFLLIGAYLRAKVKIIQNLFLPAS
FT                   VVGGLLGLILGPIVLRDYAVLPIPDDWLMIASLLPGLLIVPVVASVPLGLKMKQTKSSE
FT                   EGGSGSNGSRAIVIMFLILGIIAYAQTFYSLSVASVFKNVFSMEGIYPTFGTELSAGFT
FT                   GGHGTAGVIGSLLQSMDQPYWNTAQGVTTTVATVGIISGILIGILFINIAVRKGFTTFV
FT                   QSGSDMQGGIRTGLNADEASQESAGHETTNSSSIDSMGFHLALILMVSGLAFGIRYVFD
FT                   VNNVLILNMIPEWAYAILLMYGVWGIMIKMKLDWIVDVKTKTKIASTFTEYAVVAAIIS
FT                   LPIQAVFALILPLSIILIGGLAITVLLAYFLSKRYFKEYWFEKSMAILGTNTGVFLTGL
FT                   LLLKMVDPDLKSPVLRDYSISYSLNSLIGFVLFPLAFGFLIAYGYTSAILLYGSLGMLF
FT                   VIGLIIVGKKDKQEVQSI"
FT   gene            257012..258442
FT                   /locus_tag="Bsel_0246"
FT   CDS_pept        257012..258442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0246"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: plu:plu3725 aminobenzoyl-glutamate utilization
FT                   protein B; TIGRFAM: amidohydrolase; PFAM: peptidase
FT                   dimerisation domain protein; peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97790"
FT                   /db_xref="GOA:D6XWE8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE8"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADH97790.1"
FT                   /translation="MNGYTAWINNHFQEKGERWTEVSDHIWANPETRFRETSSSEYLIA
FT                   QLEKAGFTVDRSVAGMETAFVGETGTGGPVLAFLGEFDALPGLSQRADVAVQEAVDQDG
FT                   NGHGCGHHLLGTSALAAAVAMKEYLEETGQQGTVRYYGCPAEEGGSGKTFMVREGLFDD
FT                   VDAAFTWHPASITGVWSFSTLANVQATFRFKGKSAHAAAAPHLGRSALDAVELMNVGVN
FT                   YLREHIVDDARIHYAITSTGGHSPNVVQAEAEVVHLIRAPLVNDANEIFDRVRDVAKGA
FT                   ALMTGTSVEVLIDKGCSNYIPNHALGQKMGDVIQQFGAPPFSEEEKKQAAVFQEALSPQ
FT                   EIEGERRLLAPFSFALNEPLSTIPIPYTKTDKILPGSTDVGDVSWVTPTVQAVGACFAV
FT                   GTPLHTWQLVAQGKSAYAHKGMIHVAKILAGTAIATLEDPELLLDAQEELRAFKDGKAY
FT                   ESPIPKEVHVGDIVSRLG"
FT   gene            258515..259843
FT                   /locus_tag="Bsel_0247"
FT   CDS_pept        258515..259843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dde:Dde_3030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97791"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97791.1"
FT                   /translation="MVIGVYIPRRNSGKIEEWLSGYHQYTFDFYYYESLDELESYFKDH
FT                   HTRYDGHFFSGYLGYRVIEDRVGAFTEPVTYLTITEADFFKRMFEMVIDHPSMDLKKVL
FT                   IDFHLENEKIAAYLQAMPADIRPELLDEREVTVNDNIYERIFMKHKALHDNGLIDWSFT
FT                   RFANLAARFDQEGYPYVYFDIARERVHEALIDLTTEIRLMKMKENRIVLGCLKLGLQDE
FT                   EKLEMRALHVQSLLLEYAMTMQNRLVIRKNGKVFEITTDYKTLLDVTDHFKGCALIRHL
FT                   SGYIDEQVSLGWGIGSSIIQARANSSEACAFAGNHPASATYIKEHEGQIIGPLLPGSHG
FT                   MDVNQPAYYHPEKVNELQERFEMTRDKVNKVIVAFERIGERQVSSEAFAEALNLTVRSA
FT                   NRILKEAAEKGFVSVVVDTDSGLQGRPKKRYELNREFFKNKGK"
FT   gene            259855..260313
FT                   /locus_tag="Bsel_0248"
FT   CDS_pept        259855..260313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0248"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rlt:Rleg2_0700 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97792"
FT                   /db_xref="GOA:D6XWF0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF0"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADH97792.1"
FT                   /translation="MEKTEAYFMKQAIDLAKRAREEGNEPFGAILVKDGEVVMRGANHI
FT                   HSGSDPTFHAELGLIRAYCSAYQVSDLSEYTLYTSCEPCVMCSGAMVWANLGKVVYSVS
FT                   HDQLAEIAGGNIMIACRDVFQKSPNRPEVEGPICPEEGLQVFEGYRFG"
FT   gene            260582..261214
FT                   /locus_tag="Bsel_0249"
FT   CDS_pept        260582..261214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0249"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: bte:BTH_I2733 helix-turn-helix
FT                   domain-containing protein; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97793"
FT                   /db_xref="GOA:D6XWF1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH97793.1"
FT                   /translation="MALGTTISQRRKELNLSQAFVAEEMGVSRQAVSKWETGQSVPSTA
FT                   HLIRLAEVLGCDVQDLAEPDQEAQPAQPAEESGSKKDIRMQLAAVFGRVLMLVGFLGYM
FT                   GAVSDPGDHGSMPLWFFNSWWLGHFAVGAGLTVIGTRDYYYRKGGPKSVIGWDLLFVGA
FT                   FLFYGFSPFGEGVTTLVTMVMGATALIMMNIRYFIPVWRRDRAPSGS"
FT   gene            261306..261665
FT                   /locus_tag="Bsel_0250"
FT   CDS_pept        261306..261665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97794"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97794.1"
FT                   /translation="MAFSNRVIDGDYLDAKVVRRSGKLILQDARNDDLVLDITTVAQYK
FT                   RFATRQEYKGYNLNGKSLIGGMILGPVGALFGLEREAVHIHQVALQFQDGKKSLLELND
FT                   DTYSELLDELKKMNL"
FT   gene            261721..262044
FT                   /locus_tag="Bsel_0251"
FT   CDS_pept        261721..262044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97795"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97795.1"
FT                   /translation="MGFDLFSKAVNSAAEAVSSEVTLMNILIHFTPVKTYVYVADYYCF
FT                   DSDDGGVEFKNSDGSVEYTVSGNYVSLLIDQKDLTKEEKIRKAIRQYGLTEDGVAVIDC
FT                   CTS"
FT   gene            262518..263651
FT                   /locus_tag="Bsel_0252"
FT   CDS_pept        262518..263651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0252"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: vha:VIBHAR_01199
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97796"
FT                   /db_xref="GOA:D6XWF4"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF4"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADH97796.1"
FT                   /translation="MGSITHTIRKARPLSVAVVLILTVSFIGSMLFVHHNHVLYDRTIA
FT                   EVTDVRLVDESETVDQYGNEDRLFDQELDAVIRNGEHEGSVVRLTNQYAESGASDYRFG
FT                   AGDELFVNLDAEHEDGLSGSVTNVKRDQELMLAAWLFLFSLLVVGRRQGLFSVISLGVN
FT                   AALLVVFLQLSIAYAQFSFVAMASVLAIGFTVISLLFVNGFHPKTYAAIIATLLATLSA
FT                   MLITFLTIWLTSGSGLHYESMAFVTRAPQAVFLAGIIIGSLGAVMDVAITVTSSMFAIY
FT                   EKNPAIGRKALIASGLEIGKDIMGTMTNILLFVYVSGSIPVLILYFSNEALLGYTLSVN
FT                   LSLELTRALAGGIGIVLTIPIGLFVTARFVDRKRWRA"
FT   gene            263648..264430
FT                   /locus_tag="Bsel_0253"
FT   CDS_pept        263648..264430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0253"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: vha:VIBHAR_01199
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97797"
FT                   /db_xref="GOA:D6XWF5"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF5"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADH97797.1"
FT                   /translation="MNTVLVLAILLFILMRAVGGRKGAKSFVALFMNFVVLVVTVLFMS
FT                   HSTFDLLVLTVLACTAISWINLFFVNGVSHKTMTAFLSTWVTIILMIPLILFVTRRAMI
FT                   QGFPEEEMHELNVFSFYVGIDFIEVATAVILMSTIGAIIDIAISISSPMNEIIRQEPSI
FT                   SRKRLFEAGMGIGRDILGTSVNTLLFAFLGSYMALLIWFLDLNYTFGEMVNAKVFSAET
FT                   ITILSAGIGLTVVIPITCAITAVFLDRARNKDGTGMED"
FT   gene            complement(264487..265938)
FT                   /locus_tag="Bsel_0254"
FT   CDS_pept        complement(264487..265938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0254"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: dde:Dde_0152 DEAD/DEAH box helicase-like;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; DbpA RNA-binding domain protein; SMART:
FT                   DEAD-like helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97798"
FT                   /db_xref="GOA:D6XWF6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028619"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF6"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADH97798.1"
FT                   /translation="MTHDSFQAFGLSDEIVRALNELNMTMPTDVQKQVIPLAMENKDVL
FT                   VTSQTGTGKTASYAIPICDTVDWEENRPQALILSPTRELAVQIQEDITNIGRFRRIKAT
FT                   ALYGQEPVNKQKLELKQKTHVVVGTPGRVLDHIKKGTLMLNRIEHLVIDEADQMLDMGF
FT                   IDQVEAILASLPKERTTSLFSATMRNEIRALAGRHMNAPDQIAIKQETVAADTIDQSVI
FT                   HVTNKEKLQLLQDVTVVENPDSCLIFCNTQESVDLLETSLNKEGYRARKIHGGLPQKER
FT                   FSVMEAFKRGSFRYLIATNVAARGIDIDSVSLVINYDVPFEKESYVHRTGRTGRAGKAG
FT                   KAITFVNNREKSAIRELERYTGIIIPLAKAPSPDEVKRARNTFYEKLNTAPVRKEKKSA
FT                   NLNKEIMTLYVNGGKKKKLRAPDFVGTLTSIDGIDADDIGIITIQETSTTIDIFNGKGP
FT                   LALKELKERTVKGKRLKVREARNRS"
FT   gene            266165..269509
FT                   /locus_tag="Bsel_0255"
FT   CDS_pept        266165..269509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0255"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97799"
FT                   /db_xref="GOA:D6XWF7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF7"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADH97799.1"
FT                   /translation="MKKWIESTSLKEWLIYLLPVIWLVLLAVSFVTAPDIDQFVREEGQ
FT                   AEAPEGFPSQIAEELIEEDDGFGGEEILLVYEQEDGFSSEQKEEIKEVLAGLSEEDHNL
FT                   PIHAVTGPFDGDMEEERLISEDGDVLIALVEMDIEAHEYADIRNELQEASQAEGVDHDQ
FT                   TGEAVINEDVVVSTEEGLVTSTYITVSLVFLVLALVFKSLVSPLVPLLLLGTVYLFSIS
FT                   IVSRLIDWVGFPVSNFTQMFVLAVVFGVGTDYCILIMKRFQEEVLKDQTAFQAMLTTMR
FT                   ASKSTVLYSALTGFIGFATIYLADFDLYQSAVGVAVAVLVMMAGIWMVMPAVLALGGVR
FT                   LFWPGKPGSSNPSNPLWGFIGGLTLRSPKLALVAVALLVIPFYLFYDDLRSFDNVQEIR
FT                   GDYDSVKAYELTEEAFGQGDLFFSTLYLKTDEASWDDHGKIAHLEQLAMNIEKVEGIRG
FT                   VRGLNRPDEDVPDEFRIPEQAGILSEGMVEALDGLDELSDGIHEMKDGLDDSEELLDEA
FT                   EAGIGELIAGTEEIMAAVEEAEDQLDEAEAGIRNLMEGTEELGSGAKEIGEGIGEIRQG
FT                   LEDAGRDVSSSREDLGLWQTRAEAVVSEIEAFERRGSELENEVQERAETVNNRYQAARR
FT                   EAEEALANAAEEKEQLRSELQEALNDLEAEAEGDLPSEELGRIRSLLDGHSVVPEDVTL
FT                   PDLDLTALVPDLPIPPFSSYADEIRSALEDGDGQLQELEEGLTEAAEGLEEAEEGAGDL
FT                   QVGLDDVQDGHQELLDGMAEARQGASDLSGGLDELQSGHYALLDGVGEGRNGLENFRKG
FT                   LRDMLEGTEELNEGIGEAEDALRQVSKQEENPLEGLFIPNEAFEEEAFEEAFDQYVTPG
FT                   GQVAGMELLFEEDPYSQEAMMILDEVEEVAAFTLRDTPFEDKEMAFSGITSSNRDLRDV
FT                   SDQDFFVTAAVMLAGIFIALTFLFKSLIMPLYVLVSLVLTYIGSMAVAELIFVTILGYD
FT                   GIMWAVPFFSFVLLMALGVDYSIFLMGRFREILEEGEEITIHDAIHIAMKRIGGTVISA
FT                   ALILGGTFAAMMASGVLTLMQVSTVIMTGLLLYTLVMLPVFVPACMLLLGSWNWWPLGR
FT                   PKSERDS"
FT   gene            complement(269555..270514)
FT                   /locus_tag="Bsel_0256"
FT   CDS_pept        complement(269555..270514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0256"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   vap:Vapar_6338 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97800"
FT                   /db_xref="GOA:D6XWF8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH97800.1"
FT                   /translation="MKRFVKWTLIALPIVLIAIAGIIIGGSYLEHQNAIEEDMAYYPAP
FT                   GERIDIHGDGHAMHVHGEGKGGATVVFLAGFGTPSPFYDFQAIRRALPDGYRTVVVERF
FT                   GYGWSDVTDYDRDIGTVTDETRAALKEAGEEGPFILAGHSMAGIEALHYAQAYPEEVTA
FT                   IIGLDPLVPAYYDEHGEEPEVSGVVTFLARSGLMRQQPDVFNENFHAMAKGLLDDDDAE
FT                   AARSVFNRRVQTANMADEAEKLTANVRTVQDAGTPDAPFFAAISSENHDGQPFIEALAA
FT                   DTGGKSRIFDGGHYIHLDQPEAIAKQIVDWMQAEAGSD"
FT   gene            270686..271606
FT                   /locus_tag="Bsel_0257"
FT   CDS_pept        270686..271606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0257"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: dvl:Dvul_0508
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97801"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF9"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADH97801.1"
FT                   /translation="MNKVDVIILSGFLGAGKTTLLTRLLQADQKHGRKAAVVMNEVGSV
FT                   SVDSDAVGDGTPLKELLGGCVCCSLSDKLEIQLHGLVRDHTLDVIYIETTGVAHPVDVL
FT                   EACMTPLLVDDLRIRSVVTLLDLVAWGERRSLSAAVQQLMREQVRNADLVVMNKADRLS
FT                   EEERSSVEKEIRGINSEGTLLFASFAYVDVRSVMFQESQYSKGRTHAPLHVREDLHIKT
FT                   FTHVFTEPVSQEAFETFVKEMPDSVYRIKGYIRFTGDERTMLLQYSYGMVTYEESDLNR
FT                   TNTLVFIGDGLDHDALRDKLTAIGK"
FT   gene            complement(271783..272336)
FT                   /pseudo
FT                   /locus_tag="Bsel_0258"
FT   gene            complement(272412..272630)
FT                   /locus_tag="Bsel_0259"
FT   CDS_pept        complement(272412..272630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97802"
FT                   /db_xref="GOA:D6XWG0"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97802.1"
FT                   /translation="MYLLIPLGFIAVSFIILIARRKSMQEDLAFVKAHPNSQEAAIRQK
FT                   AMIRWIWGVTIWGVVSMTLVVWLFQTF"
FT   gene            272635..272754
FT                   /pseudo
FT                   /locus_tag="Bsel_0260"
FT   gene            complement(272786..273097)
FT                   /locus_tag="Bsel_0261"
FT   CDS_pept        complement(272786..273097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97803"
FT                   /db_xref="GOA:D6XWG1"
FT                   /db_xref="InterPro:IPR026369"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97803.1"
FT                   /translation="MTPTLPTCASCASALTWKEALFMQRFLQNHNRCPRCGAVQYIKTR
FT                   KPALFVTVIMAVSPLTVNLFTEVTIPLAIVLYTILIPLLVTVSPFTYELSDDDPLMKS"
FT   gene            273219..274169
FT                   /locus_tag="Bsel_0262"
FT   CDS_pept        273219..274169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97804"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97804.1"
FT                   /translation="MTGKRIHLDQAKRWLVRNGRPLEVMRFRYWFEEGSTEDVMDVLTG
FT                   YQNEDGGFGHGIEPDFTCPMSSAIGSWTAARMLFELKTPAAHPVIRKLMDYLIATQNRA
FT                   TGMWQTTFPEISHFPHAPWWSWHEQAQEEWQFNPGVELAAYCLYYGGGDEAATEAGLLT
FT                   MRKALKRLMTVNDMDHHELSNFQYALHILQDQFDAVEADTGFSLRRCEDQLHSLLYQAV
FT                   ETDPLKWGRGYQALPLDVVHSWKDVRNIGFEDGLVEKQIQYWKTTRERDGAWPISWEWG
FT                   QYPEAFAIAKRQWQGILIVERFKKLKQLGMIQEET"
FT   gene            274378..275727
FT                   /locus_tag="Bsel_0263"
FT   CDS_pept        274378..275727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0263"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: ppd:Ppro_2155 amino acid carrier protein;
FT                   TIGRFAM: amino acid carrier protein; PFAM: sodium:alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97805"
FT                   /db_xref="GOA:D6XWG3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG3"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADH97805.1"
FT                   /translation="METVEHLINTASSFVWGLPLIVLLVGTGLYLTVRLAFFSFQQLPY
FT                   ALKLVFTKGDQVSKGDITHFQALMTALAATVGTGNIAGVASAVAVGGPGAVLWMWITAF
FT                   VGMATKYGEAILGVKYRVQNERGEMSGGPMYYIEKGLGMKWLAVIFAAFAAVAAFGIGN
FT                   MVQSHEAAGVANQNFGVPVWVTGLVLSVLVGLVIIGGIRSIGKVVGIVVPVMIVFYVGA
FT                   GLLIVLMNVADVPAAFGLIFTDAFTGQAMAGGAVGAVIQQGVARGIFSNEAGLGTGGIA
FT                   AAAAKTDVPARQALVSMTQVFIDTIIVCTITGLALVMSQMYLRADEFDSSAQLTSAAFE
FT                   QYLPGVGGIIVAVALLFFVFSTIVGWSYFGEKCFTYLLGGKVSMPYRFLFVIMLFVGSV
FT                   VSLDIVWGFADVMNGLMAFPNLVALLLLSGVIVNETKKFKQKRIEEKNAS"
FT   gene            275883..276236
FT                   /locus_tag="Bsel_0264"
FT   CDS_pept        275883..276236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97806"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97806.1"
FT                   /translation="MSSMNKVIAGDYEGWSVRSHAGSIHLVYKRDDRELTPETVAEWRE
FT                   LEPVTWNEQNMFSSKSLLGSLFLGPLDFLFGISSKTVKLYQLAFKCDDGMKGIMTVDID
FT                   VYHTFLKRFQNEG"
FT   gene            276297..276626
FT                   /locus_tag="Bsel_0265"
FT   CDS_pept        276297..276626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97807"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97807.1"
FT                   /translation="MSRVYKTSRARAGILSWTKLFHPDEVRLDERSVKVEKKNMMGLKG
FT                   SSDEVTYDRIASVRLSQGLVSGDIVIETSGGSEADLEIRGFRKEVAEKLKDDLSDRLPR
FT                   KGRRK"
FT   gene            complement(276686..276880)
FT                   /locus_tag="Bsel_0266"
FT   CDS_pept        complement(276686..276880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0266"
FT                   /product="Iron sulfur domain-containing, CDGSH-type"
FT                   /note="KEGG: mlo:mlr4660 hypothetical protein; PFAM: Iron
FT                   sulphur domain-containing, CDGSH-type; SMART: zinc finger
FT                   CDGSH-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97808"
FT                   /db_xref="GOA:D6XWG6"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG6"
FT                   /inference="protein motif:PFAM:PF09360"
FT                   /protein_id="ADH97808.1"
FT                   /translation="MADVKVTVTDNGPLMVKGEIELVDGEGNPVETKKNTALCRCGLSS
FT                   NKPFCDGSHQGNFESEVRG"
FT   gene            complement(277011..277739)
FT                   /locus_tag="Bsel_0267"
FT   CDS_pept        complement(277011..277739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97809"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97809.1"
FT                   /translation="MIKAELTPNHIGIAVSGDFHDFEQLYEAIHELIPDEGSEDIDYHY
FT                   PNLRALGFCYDLRHAMMGHRDIFLVDHGMSEETLRYHEIVTSPRNLYLSFPTLVPEMLF
FT                   VLMVLRHYTNSPRERPSRTMLDYHSAVAIVNHFDNAVMQCFRQVLTERKFINTSRSIQA
FT                   GSHVLARYLTLYLDKINLDYFELEQDERTDKISIYAKRLGERGRDYEKIEREIREAAKQ
FT                   HGVRPEQIRYTQSFPDIIEW"
FT   gene            277951..278571
FT                   /locus_tag="Bsel_0268"
FT   CDS_pept        277951..278571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0268"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: son:SO_1419
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97810"
FT                   /db_xref="GOA:D6XWG8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG8"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ADH97810.1"
FT                   /translation="MKKTWMLSIISATVILGACGNYDSSSEPLPYDNRVDEGESQAADE
FT                   GNENNGNGDEETDFGDLADGVYETTGEGYNDDIVVETTIEGGEIVSVEILSHDETYGIG
FT                   TDATDELPGTIVDANSPDVDGVSGATYSSDGIKEAVRAALEEASGGGSDEDLALTDGVF
FT                   ETSAEGYNDDIVVETTIEGGEIVVSHTMKPTESEPTQQTSCRA"
FT   gene            278568..279251
FT                   /locus_tag="Bsel_0269"
FT   CDS_pept        278568..279251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0269"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   vha:VIBHAR_05539 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97811"
FT                   /db_xref="GOA:D6XWG9"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG9"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ADH97811.1"
FT                   /translation="MIVDANSADIDGVSGATYSSDAIKEAVQKALEESAGGGDVTLTDG
FT                   VFEASGEGYNDDIVVEVTVEDGEIVNIEILSHDETDGIGTDATDELPGIIVEANSADVD
FT                   GISGATYSSDGIKEAVQNALDESAAAGGNGGAAGDLADGVYETAAEGYNDDIVVETTVE
FT                   GGVIVSVEILSHDETDGIGTDATDELPGMIVDANSADIDGVSGATYSSDAIKEAVQAAM
FT                   DEAAE"
FT   gene            complement(279350..280300)
FT                   /locus_tag="Bsel_0270"
FT   CDS_pept        complement(279350..280300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0270"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mxa:MXAN_6482
FT                   aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97812"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH97812.1"
FT                   /translation="MQYRRLGRSGLKISEISLGSWLTYGKSVEDNTAERTIHTAYEAGI
FT                   NSFDSANVYEQGQGERVMAEALKAYPRDSYVISTKAFFPMGEGPNNSGLSRKHITEQLN
FT                   SSLKRMKLDYVDLFYCHRHDPDTPVDETLKAIDDLIRQGKILYAGVSEWSAAQLEEAVS
FT                   IAYRKLLDRIVVNQPQYNMFNRTIEKEIIPVSEKHGIGQVVFSPLAQGVLTGKYKGGQV
FT                   PSDSRAANDDINRFITGMLNEDVMKKVAKLEDVAKELGVSLPELALAWVLRQPNVSSAL
FT                   IGASRPEQVEMNVKASGLVIPDALEETIDTILTEG"
FT   gene            280461..280913
FT                   /locus_tag="Bsel_0271"
FT   CDS_pept        280461..280913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97813"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97813.1"
FT                   /translation="MMKKTMMIGAVLMVLGAGSVSAVGFAEVNGEQTENGAAVGTPCQA
FT                   FSERENAGGWSEEEWEARMSQRDRGGQILFDSLTEEDQDLWLEVKAGIQDGALTKEEGH
FT                   AMLQEAGIDAPVKQQQMRQDGSGGGMQQKGQQNGSGNGNGQQQNRS"
FT   gene            280964..281686
FT                   /locus_tag="Bsel_0272"
FT   CDS_pept        280964..281686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0272"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: sbn:Sbal195_0632 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97814"
FT                   /db_xref="GOA:D6XWH2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97814.1"
FT                   /translation="MIKTEMTADEGEETVTTIMIVEDEWAIARVLDAYCKKRGWHTVMV
FT                   EDGHQVMAVFLDASPDLVLLDVMLPGRDGWSILSEIRERSDCPVVMLTALDELDDRLKG
FT                   FDGGADDYIAKPFHGEEVVARIAAVLKRQPSEEKTDAMEFGDLEIRDGERRVYLSGKQV
FT                   ELTPKDTALLIHLAKHPNRVWSRDELIEHVWGWDYTGSDRAVDLAVKRIRQALRKWDDE
FT                   HGGIRTIRGEGYSFHAYT"
FT   gene            281673..283115
FT                   /locus_tag="Bsel_0273"
FT   CDS_pept        281673..283115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0273"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: psb:Psyr_2867 sensor histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97815"
FT                   /db_xref="GOA:D6XWH3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH97815.1"
FT                   /translation="MPIHKKGVSLSRYWTVRYAVTIVIGVVILSLLAMYVIRQDALNTR
FT                   LDTMTFLAEDLAVGLDEEDLQAFADSRQRGRFRAGNRQLMNLEADVTVVITDEEGRILF
FT                   RNDTGMGRQEGVLEEAILNSLATPVRLGDEGSASYYAVSHPVRDETGGTAGFVVMKEKE
FT                   AVLTEANEQYTLLAIVAGAVILFGVLVTAVMARRLSMPIQEAANAAQRVRGGDYETTVP
FT                   ASTGIEEVDELNRSFSEMTRQLSDAEQLRKELLAGVTHELKTPITAITGLLEAVQEGVV
FT                   EGEEAEEFLAMSLTETAQLKRMITDLLTFNQFSSGHVPIRQEAVELKRFLEGIIRVGQA
FT                   DGAYGRTEIDLICEEAGGSCVAQADPMRLEQVLHNLIRNASEAMDGEGAMTLRCYSDSS
FT                   SCVIEVRDDGPGMPIDDQLHMFERFYRGTRTSGTKTGLGLGLPLSCMMMEAMDGRLAFI
FT                   ESGEQGTVFRLFLCAVNEEGSS"
FT   gene            283096..284982
FT                   /locus_tag="Bsel_0274"
FT   CDS_pept        283096..284982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0274"
FT                   /product="shikimate kinase"
FT                   /note="PFAM: shikimate kinase; KEGG: Os06g0225800;
FT                   hypothetical protein; K00891 shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97816"
FT                   /db_xref="GOA:D6XWH4"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH4"
FT                   /inference="protein motif:PFAM:PF01202"
FT                   /protein_id="ADH97816.1"
FT                   /translation="MRRDHHEIVITGIACVGKSTVGQLLAERMGHVFYDLDLEIEQAFG
FT                   MPISRIKEQITTEREYRKKTAPVLEKLMQGRDWVIASTPSGLKDHYWKLIEKDPEIVTV
FT                   VLRDRAARIVERLTFYDDDSRLIPSPVTAANRHLYERDIQQDMTYYGTSHRKADVKFQI
FT                   KGRPANQAAEALYEEIMAFTPKDKEKEKVAETLVEYDDREPVVCDVPHPLVQDYDRLLR
FT                   FMMEKDVYVTKKKREISSVFLPELNGLLALKRPASVKGKAQAAYPVIHLFFTLAINSGL
FT                   LAIQEGPRGRMYVKADEERLRAYRQLSDLEIYYLLLETLWTDTDWANVTDRGKTEHVYL
FT                   FQKVLIQIVRHARPGEPFPVRRDWVDRFADYFSWFAFWTEAEDEEYRTFEQQEPGFRNV
FT                   FVLVHVHRDAKERIQTLLFDRNLEQWNLPFRKVTGELNPQPGDAAKEWFGLDEEDEFER
FT                   QLQEAIGIDRRHEAFFEAFVSLHSEEVIERTLPRNVVSFEPGLHMLRITYLSVSREMIV
FT                   SQETTLAELHGMILEAFDLTDDHLYAFFLDGILYSEPAVYAPQADEEHRADEVTIGSLG
FT                   LRKGQSFVYVYNFVHEIILDIDVCFVDDRAEVTDVRSFGDAIGHPPWSDEGV"
FT   gene            complement(285052..286134)
FT                   /locus_tag="Bsel_0275"
FT   CDS_pept        complement(285052..286134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0275"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: vfm:VFMJ11_A1186 flavin
FT                   monoamine oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97817"
FT                   /db_xref="GOA:D6XWH5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH5"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADH97817.1"
FT                   /translation="MPETTIIIGAGLSGLYAASLLHKRGLPVCVLETRPRTGGRILSKT
FT                   VPDRPELGRFDLGPTWYWPEHEPLITDVIDTLGLEAFEQYTAGDILLERSENAPLERHT
FT                   LPPGAQPRAMRLAGGIGRLTDALYDSLPDGTVALETAVTDLTLNVDGSIRVGGTGRDNR
FT                   PFYLDGTRVITALPPRLLAERITFDPALPNGLHAALRSTPTWMAGHAKAVAVYDTPFWR
FT                   EDGLSGQAMSWAGPLQEIHDASPNNGSGALFGFFGIDAKARQSPGEPGLKEAVTDQLMR
FT                   LFGKSAGKPIEVLIYDWARDSFTATSLDERLAEPASFPGPVSLWDGRLLFAGTETDPSS
FT                   GGHLEGALQAGKRAADAVTD"
FT   gene            complement(286155..286562)
FT                   /locus_tag="Bsel_0276"
FT   CDS_pept        complement(286155..286562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0276"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ara:Arad_4048 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97818"
FT                   /db_xref="GOA:D6XWH6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH97818.1"
FT                   /translation="MYKGLGHIALTVADMDASISFYCRQLGFEEAFAIHDDEGNPWIEY
FT                   IKIAPGQFIELFHGGRVHVETAPGTIGFNHLCVEVTDMAALVRHLNEQGVPIDVGPLRG
FT                   KDFNEQCWVTDPDGNPIEFMAIDPRSPHVKS"
FT   gene            complement(286555..287619)
FT                   /locus_tag="Bsel_0277"
FT   CDS_pept        complement(286555..287619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0277"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11;
FT                   Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 12; KEGG: abo:ABO_0828 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97819"
FT                   /db_xref="GOA:D6XWH7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH97819.1"
FT                   /translation="MWYEPVLSRNLVPDRTLRIAVRRLLKNRLEDLQFPSVSERQAYVT
FT                   RFIDALEDKPIAVHTDDANEQHYELPAAFFSRVLGDHLKYSSGYWPEGLSLDDRDALTA
FT                   SEEAMLALTCERADLRNGQAILELGCGWGSLSLFMARRYPGSIITVLSNSASQKAYIDH
FT                   QIAKEKLSNLTVITADINDFSTDDRFDRVVSVEMFEHMQNQKRLMNKIKGFLVPGGKLF
FT                   IHIFSHKDTPYLFEVKSSGDWMAKYFFTGGMMPSHHLPLYMAGTLAIEEHWAVSGLHYH
FT                   KTCEAWLREMDRQKDTIMPLFREVYGKREARRWWVYWRIFFIACSELFRYNDGNEWHVS
FT                   HYLFRKETEEDAHV"
FT   gene            complement(287746..288210)
FT                   /locus_tag="Bsel_0278"
FT   CDS_pept        complement(287746..288210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0278"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   rpf:Rpic12D_4528 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97820"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH8"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADH97820.1"
FT                   /translation="MTNLFPRRNRSSNPFFPGNSLFPTLFDSGSLSDFFTGDLLNDSGF
FT                   PRVDIEDKGDYYKIEADLPGFQKDDVVVEFDNGYLTIHGKHETTEETEDKERNFVRKER
FT                   SSGSFHRSFYVGDINGDDINGSFKNGVLTVTVPKTDKETPDTTKRISLDD"
FT   gene            complement(288308..289978)
FT                   /locus_tag="Bsel_0279"
FT   CDS_pept        complement(288308..289978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0279"
FT                   /product="anion transporter"
FT                   /note="KEGG: hha:Hhal_0349 anion transporter; TIGRFAM:
FT                   anion transporter; PFAM: sodium/sulphate symporter; Citrate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97821"
FT                   /db_xref="GOA:D6XWH9"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH9"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ADH97821.1"
FT                   /translation="MTVIKQLWQKSWESHDRIKDLLRLIGGRGTGEPPGSDSGRMEKAS
FT                   GKMTGTYRQPSPDGRDFTRKQVIGLLLGPLLFFAVLFLFPADDLPTAARGVLAATAWIA
FT                   TWWITEAIPIPVTSLLPVLLFPLVADISVGDVTPNYGNDIVFLFLGGFIIALALERWNL
FT                   HKRIAITIIDFIGTSPKRLMLGFMLATAVLSMWISNTATAMMMVPIGTAIIYQLSHLID
FT                   ESPVKDAKKQAEFFAKGLMIAIAYAASIGGLGTIIGTPPNTILAGQLRELFDVDLSFAG
FT                   WMAFGVPLSIVLLILAWLYLVFFAFPMSLKEIPGSKEVIAGEKKALGRISADEKMVLTV
FT                   FSLTALAWILRSFVLQEFVHPNINDAFIAIFGAIVLFMIPSFQYQGVKLMNWDTAKNVP
FT                   WGILILFGGGLAIAGGFSDTGLDVWIGSQLTVLAGVHFILIVLAVTALVVFLTEITSNT
FT                   ASATMLMPVMAGFALAIDVHPLAMMVPAAVAASCAFMLPVATPPNAVVFGSGYLKMGDM
FT                   IKAGVWMNIISIIIIVGFVTVLLPVAFGIDLQNFPSGLE"
FT   gene            290291..291298
FT                   /locus_tag="Bsel_0280"
FT   CDS_pept        290291..291298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0280"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: aeh:Mlg_1052 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97822"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97822.1"
FT                   /translation="MNGQSQTEEALHQALDHYYDVYFRRGDIRETLALVDGDSTGAGTG
FT                   AGEMAYTYDDVVRLYKQDLGQAPNEVHFEELSRTVTALNPDSGLTFSLLNLETEIMHQR
FT                   LKFNQLRLTMVWRRDQKDQVFKIVHLHASFPTNEHEADESYPVKELEERNRVLERLVQD
FT                   RTRELELSLEQQRDAASTDRLTGLRNRASLEDLLEMEINRAVQEEAVFAVILMDMDHFK
FT                   RINDTHGHQAGDSCLKELAELLIRQSRPTDIVGRWGGEEFLIICPNTDERGSKDLAESF
FT                   RLAVSAYRFTKTGAQTASFGVAAFMTGDDGETLIGRADRALYRAKGAGRNRVEV"
FT   gene            complement(291364..292968)
FT                   /locus_tag="Bsel_0281"
FT   CDS_pept        complement(291364..292968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0281"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: tcx:Tcr_1143 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97823"
FT                   /db_xref="GOA:D6XWI1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97823.1"
FT                   /translation="MKQLDTIQANKEGDPIKSPQPFQLNKKRLFLLLALGLLFMSLLGL
FT                   LFNRTYVSTKESYMGAEMDAFESKIYTTLELYENFSDFIFEEHINQDDVLALVEQGVFG
FT                   TEDEQNAARRMLFSELSETYDAVLNYDFRQLHFHTREGDSFLRFHAPELYGDSLMDIRD
FT                   SIRMANTEERFVFGFEEGRIFNGYRFVYPLHRNGRHLGSVEVSISMGSLVQMIGSLYPD
FT                   DVLTFVIREDIVRDTVFESEQTNYSTAPFFPGYALDEGISSQSERCVCDTAFSMNCSVI
FT                   ETIVSDNEELTGEGASFNRLTTQNGQDVLVNFLSVTNLSDQHVAYLIGMHEIEDGSVFG
FT                   HYHLNRDLALLALFFSFYAYSIFMYERKQKQLGILANTDQLTGLFNRHYMMKQLEDNRQ
FT                   KGSGFKQPAILILLDIDRFKRINDEFGHQTGDAVLSETGALLHKLAGSHGTAARWGGEE
FT                   FVLYLPGYAKAEGTAFAEQVRSAIETHAYSKGLSVTASIGVSSTEDPDTPHIDALVQRA
FT                   DHKMYEAKEAGRNLVKA"
FT   gene            complement(293243..293812)
FT                   /locus_tag="Bsel_0282"
FT   CDS_pept        complement(293243..293812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0282"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: eba:ebA6393 putative glutathione peroxidase
FT                   protein; PFAM: glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97824"
FT                   /db_xref="GOA:D6XWI2"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI2"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADH97824.1"
FT                   /translation="MSVYDFKVKTSSGLNAPLNRYQGKVLLIVNTATKCGFTPQLDDLQ
FT                   KLQDQYGEQGLQILGFPSNQFDNQEPLGDGEITEFCSLNYGVNFPLFKKIDVRGEDAHP
FT                   LYQHLTKAKPFNGFDMDHPTAKLMVSIIESKHPEYMLDDGIKWNFTKFLIDRNGEVTAR
FT                   FEPTVEPFDMKADIEALLQSETALNQ"
FT   gene            complement(293982..296676)
FT                   /pseudo
FT                   /locus_tag="Bsel_0283"
FT   gene            296795..297718
FT                   /locus_tag="Bsel_0284"
FT   CDS_pept        296795..297718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0284"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pin:Ping_1426 ABC transporter for copper
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97825"
FT                   /db_xref="GOA:D6XWI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97825.1"
FT                   /translation="MKNMSIIAINQLSKSYGQVKALRDISLHVEEGDCIGFLGPNGAGK
FT                   TTAIRILLGLIKRTAGDVHVFGMDAWKDAVAIHRRLAYVPGDVHLWPNLTGGEVIDVFG
FT                   KLRGSVDRKRRDQLISRFDFDPTKKCGTYSKGNRQKVGLISAFASDVDLYILDEPTSGL
FT                   DPLMTQVFQECVEELKARGKTILMSSHILSDVERLCDDISMIRQGEIVESGKLSDLRHM
FT                   TRLHLKVETALETTGLSRVPGVSNVRREGRITAFEVDHDAMDPVLSQVITYQVKHLESR
FT                   PPSLEDLFMQHYGQREPVQEEGREVL"
FT   gene            297715..299322
FT                   /locus_tag="Bsel_0285"
FT   CDS_pept        297715..299322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0285"
FT                   /product="Putative exporter of polyketide antibiotics-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97826"
FT                   /db_xref="GOA:D6XWI4"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI4"
FT                   /inference="protein motif:COG:COG3559"
FT                   /protein_id="ADH97826.1"
FT                   /translation="MKHTESFAGMRVLLLLALRRDRIKLPVWIASITAFAAWIVHIYGD
FT                   FSPREMTEVTVMASISPGMRVLVAPVTEAGVGELGSFFLLRMSLILALFVALMSVQLVL
FT                   RHTRMNEETGCAELTGSLPVGRYALLGAAMILGAGSNLVLGVALSLSFAVQGLDTFGAW
FT                   LAGMSFAGLGFVMTAVASVAAQLSETQRGASGYATMALAGFAGIASVSNVIGDVHESGF
FT                   GFTSHWLAWLSPIGWLQQVQAFEENRWLPLVLLYGAGLCLMYMATLIAEGRDIGAGVLP
FT                   ARKGPAYGAPRLLSPFGLAWRLQRKTLIAWFLPVAAFAAIFGASSGEYGEIAEGIAAFE
FT                   AVIESEAYFLMSFISIMTAILSIYAMQTIMRMRAEEKSGLVEMLLATAVPRTTWVRSYA
FT                   FLGLAGAFVLILTFTSMLTVSSGAGMDVFSDYLLAGLAQGTALFALSGAVLFFFGWLPR
FT                   FAVTLSWLAVFASILAGPFFGAILELPEWVLNVSPFSHVAIMPEEVSAFSLAMLLVTGL
FT                   ILLILGVTGFQRRSLTLT"
FT   gene            299420..300498
FT                   /pseudo
FT                   /locus_tag="Bsel_0286"
FT   gene            300640..301545
FT                   /locus_tag="Bsel_0287"
FT   CDS_pept        300640..301545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0287"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: dma:DMR_20610 GGDEF domain
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97827"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97827.1"
FT                   /translation="MEMKPEELDVLISQLTASEHLYGHIRVVDPVHKRVVYQNTGHGLE
FT                   PVSDLRACFELFDKKTACRNCISMRAYHENESFIKVETSPDRVHMVTAIPVEIAGRKVV
FT                   VEFFKDVTNSMIMDDASFNQGVEMKRLLDQANLAAVTDELTRVYNKRYILEKLPADLTL
FT                   ALAEQQPFGLIVADIDHFKSVNDTYGHLAGDQILREFAAVLKDTCLDQADWTARFGGEE
FT                   FVVCLPGKDRDTVLAVAERMRARIEEQVFHYDGQAITLTSSFGVYALAPGDVIDYETLL
FT                   KRADQHLYQSKRTGRNRVTG"
FT   gene            complement(301666..301741)
FT                   /locus_tag="Bsel_R0025"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(301666..301741)
FT                   /locus_tag="Bsel_R0025"
FT                   /product="tRNA-Arg"
FT   gene            complement(301885..302994)
FT                   /locus_tag="Bsel_0288"
FT   CDS_pept        complement(301885..302994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0288"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: geo:Geob_1784
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97828"
FT                   /db_xref="GOA:D6XWI6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI6"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADH97828.1"
FT                   /translation="MRAIFQLQIRRLIRSPLMVLSFLGLTLVFVFFLGGGGQQSNIITV
FT                   QVYSDDALTEEDTSFWLDALNEHDSFHFTEGEADDIHESLRSGHLHYALELLEDDYRLW
FT                   VSIMDERYQYVNGHVSEVYFEELRLKAASEQAGTDLSHLMDESENMALTLTTTSLASDE
FT                   DDGDGFIYNNQLHSLFGMTLYFAMFTIFFSLTQVVEEKRMGTWDRIIISPITKSQVYLG
FT                   HLAYTFLVGYAQIMTAFLVFRYLFDYDLGAHFGLVALTAGIYVFTIVCLGLLILGLVPS
FT                   SERLQAVIPIASTAMAMLGGAFWPNEIVSNSIILTLSNLVPVSYAMDALTQISVYQNGI
FT                   TAITEQLGLLFLMGVLAAGIGINLMERRG"
FT   gene            complement(302991..304262)
FT                   /locus_tag="Bsel_0289"
FT   CDS_pept        complement(302991..304262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0289"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: dar:Daro_2372
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97829"
FT                   /db_xref="GOA:D6XWI7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI7"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADH97829.1"
FT                   /translation="MITYILKDMKLILRNRSELLLLFAMPLILIAILGFALRGMLTGGG
FT                   EGLSMDVALLDHDDPDAGEEALFTGFRESGMPEDMADEIQAGITGVSPAFLLNNLFDSD
FT                   ELDGMITIHEPPSRDAALMGLEDGTYNAVLEIPESFTYDSLNRMLTGEGEGGQLHLTVQ
FT                   DEQSIYGRVMHDILRRFTDSFNLETAIARETGAAPDEAPTEAGQVESITAYEPINSQQF
FT                   YTAGMAVMFVLFTAASIAAFANVERKSNVLDRILLSGTHAISYLSGKWLSAMLIAFLQL
FT                   IVLFVMAALMFQAFPQSSVSFWGGIALISLLTAMNVGALAALLTAISIRQKSDAAATVF
FT                   SGGVVAIMAFAGGSFFPAQALPGIVTTLGDMTPNGRAMSLYLRWIQGFELQELLPSIYV
FT                   LLLIAAVLTTAALVLYPKDREVKG"
FT   gene            complement(304275..305207)
FT                   /locus_tag="Bsel_0290"
FT   CDS_pept        complement(304275..305207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0290"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gem:GM21_0012 daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97830"
FT                   /db_xref="GOA:D6XWI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97830.1"
FT                   /translation="MLETHELTKTFKGITAVDQVNMYLGKGESVGLLGPNGAGKSTTIS
FT                   MISTLMKATTGHVLLNGQKIGSETRSIRSILGVVPQEIALYEDLSAYENLQFFGRIYGL
FT                   KGSDLKARIEDRLDLVGLTDRKHDLIKTYSGGMKRRINIACALLHDPEILIMDEPTVGI
FT                   DPQSRTYILDMVRQLNEEKGMTILYTSHYMEEVERLCDRIYIMDHGQIIANGTNDELKR
FT                   ILSNEEAIYIDIDAPNPVFTKQLSVIEGIRQVTDTDDGIKLIVDKGTRKLPDIFQLADA
FT                   LSVNVLNVRVEIPTLEDVFLHLTGRTLRD"
FT   gene            complement(305316..305972)
FT                   /locus_tag="Bsel_0291"
FT   CDS_pept        complement(305316..305972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0291"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: sdn:Sden_3055 response regulator receiver;
FT                   PFAM: response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97831"
FT                   /db_xref="GOA:D6XWI9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97831.1"
FT                   /translation="MTTQILLAEDQSLVRQGLKMMIETAPDLRVTAEANNGEEALRLLA
FT                   AKPAITLAILDIRMPVMNGLELAKAIQEHHPHVMTLMLTTFNDDDYAIEALRHGARGYL
FT                   LKDADPDALIRGIRTCLEGGLALEPHVAANVVPLLMNKPETKPEFPALPEDITERETTV
FT                   IACVGRGLSNKEISEELYLSVGTVKNLISVILHKLELRDRTQLAIYAIRSGFTER"
FT   gene            complement(305969..307162)
FT                   /locus_tag="Bsel_0292"
FT   CDS_pept        complement(305969..307162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0292"
FT                   /product="histidine kinase dimerization and phosphoacceptor
FT                   region"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: xcv:XCV0114 two-component
FT                   system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97832"
FT                   /db_xref="GOA:D6XWJ0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ0"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADH97832.1"
FT                   /translation="MRVSSKQTDTPEYEPVISQRLIHHQYWLWLGLLITAFGGYLILTP
FT                   VTSPVMMIRYIAAGLFFALFFLLPLTHSYRKLSGAAMALFLAVAAYPFEAPALYLFLIA
FT                   MIIYSGTVLYHLPRAGGLLLHTALFAAVSAGSWLTGGVEPLLITAVFGLLLIPVFILAF
FT                   GLIARYEALKEEHQSVISAYRATKRQLVADEERARHDERRTIARELHDSVGHKLTALLM
FT                   QLEVYRMSLPPAGQGDVDSLKELAKDSLSETRQAVKTLKHHEAAGLAAMIQLIRKLEAE
FT                   TMIHVQLTVRQGALTAPLSGDQAAAVYRAVQESLTNSMRHSGGREVSILFEVIGDTVFR
FT                   FHVSNPVTDDAPLKEGFGLTAMRERITACGGQLTISKEADRFAIDGRLPLMKEGDDA"
FT   gene            complement(307197..307823)
FT                   /locus_tag="Bsel_0293"
FT   CDS_pept        complement(307197..307823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0293"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: apj:APJL_0059 nitrate/nitrite response
FT                   regulator protein; PFAM: response regulator receiver;
FT                   regulatory protein LuxR; Sigma-70 region 4 type 2; SMART:
FT                   regulatory protein LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97833"
FT                   /db_xref="GOA:D6XWJ1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97833.1"
FT                   /translation="MERIKLLIVDDHEMVRTGLRTFLELEDDFEIVAEASDGQEAIDKA
FT                   NETRPDIILMDLLMDGMSGIDATAKLAPEGYKIIVLTSFLDDDMLFPVLDAGAFSYLLK
FT                   TSTAADIADAIRKAFRGEPTFQGKVTTKMYRRFQERPKHDVLTKREREVLALLGEGKSN
FT                   QEIADTLFIAVKTVKTHVSHILAKLDLQDRTQAAIYANKHQLTAN"
FT   gene            complement(307810..308925)
FT                   /locus_tag="Bsel_0294"
FT   CDS_pept        complement(307810..308925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0294"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein; KEGG:
FT                   mei:Msip34_0729 histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97834"
FT                   /db_xref="GOA:D6XWJ2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ2"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADH97834.1"
FT                   /translation="MTEKRRKWQIDGIVWDALRTQINAALAAFTVTLFLLLSLYQLGVN
FT                   PPGANGAYTLRFTDVALLLFVFAVIFLSFTAVFNYRQAARVKRGLVGMIYQLKQYQRSG
FT                   TYTPLSVTSKDELARLADELNGLTESVEERMVALRRMVNENSRLVKEAEQGASLEERRK
FT                   LARDLHDAVSQELFSVSMSLSAIPKLMEKDPDKARQLFERIEKMVHHTQQELRALIMHL
FT                   RPVTLEGKPLNLALSHLFDELTAKQPDMQFHCDLEDLPSLEKGVEEHVFRAIQEGISNA
FT                   LRHARASKLSLSVKRAKDLLLVTLSDDGDGFDLDSIDEERTGNVGLSAMKERMTEIGGN
FT                   FTCISIPQKGTRLEFRVPIIHTKEDTEDGED"
FT   gene            complement(308918..309853)
FT                   /locus_tag="Bsel_0295"
FT   CDS_pept        complement(308918..309853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0295"
FT                   /product="Cell wall-active antibiotics response protein"
FT                   /note="PFAM: Cell wall-active antibiotics response protein;
FT                   KEGG: xcb:XC_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97835"
FT                   /db_xref="GOA:D6XWJ3"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ3"
FT                   /inference="protein motif:PFAM:PF09922"
FT                   /protein_id="ADH97835.1"
FT                   /translation="MKNLTALIIILLGTGFLLSNLGIIEGSFSNLIGTYWPAIVIWFGV
FT                   KWFFQGLAVFYHSLKRDRKNIGQIIWGFYVTVIGGVLLGNNTGYFDYTLSDVWNWTWPL
FT                   LIIYIGFKILFDREGDVVIHLGPDDVEKYSRKSKSPYHDEPEPLDDDAISAKAQKKAEK
FT                   AKRKAQAFADGKTGNYQKKSCGGYTTGAKRSLIGDFKLGNKPWEPDGKDLALGIGDVEI
FT                   DFTRAVLKPGLNEMRVDCWIGDISVLIPSHMPVRVEAEVKLGEVTLFNDSHAGTGRSAA
FT                   YTSPDFDTADEQLVILIQLSIGEIEVMTVD"
FT   gene            309971..310117
FT                   /locus_tag="Bsel_0296"
FT   CDS_pept        309971..310117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97836"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97836.1"
FT                   /translation="MDRLTQRGVRTESQRVSDECADLLQAGFHDHHAFLKCFVCDANER
FT                   LIR"
FT   gene            310606..311631
FT                   /locus_tag="Bsel_0297"
FT   CDS_pept        310606..311631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0297"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: pen:PSEEN4329 glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97837"
FT                   /db_xref="GOA:D6XWJ5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ5"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADH97837.1"
FT                   /translation="MTIKHIFSVAALAGLLTACGAGNNEPADMENAENGENEVNQSADE
FT                   AANNDDHENEANQENEADTADREDVKVIAHRGASGHAPESTTHAIDKAIEMDADWIELD
FT                   IQITADGHLVAFHDDEISRTTDGEGEIGDHTLDELKELDQGSWFNEEYPDRADESFEGA
FT                   EILTLEEVFEMYGEDVNYYIETKSTYLNEGMEEPMVQMIEDFGYEENVIIQSFHQDSLQ
FT                   EIAAMNNEITLVQLLWWEVDEETGEMTEWLDIVPAPKDMTDADFEAIADYADGVGPHLT
FT                   YYDGTEVIDEAFVQTLRDHDLMVHVYTVNEEDEMERLIDWGVTGLFTDFPDRLQDVLDN
FT                   R"
FT   gene            311788..312165
FT                   /locus_tag="Bsel_0298"
FT   CDS_pept        311788..312165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97838"
FT                   /db_xref="InterPro:IPR021598"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97838.1"
FT                   /translation="MIGMKQIVMLTALMFLGACGTEETGGAPDEDQGMEYGLIGEVIEL
FT                   ERHERDDQLGSIRVQGNHEDAMYDDGVVTITTDTAFDPDAFGGFEALETGMEVEVVFDG
FT                   AAMESHPVQATAAQINVLDQE"
FT   gene            312282..312530
FT                   /locus_tag="Bsel_0299"
FT   CDS_pept        312282..312530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97839"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97839.1"
FT                   /translation="MTINDVAITYEVCEHEGFKYEMNTYHLNPTIPLDKQLKILARKDV
FT                   APEVAVVMWENGRQVERTYYFPQYQCRCEGNHEGGTT"
FT   gene            312527..313513
FT                   /locus_tag="Bsel_0300"
FT   CDS_pept        312527..313513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0300"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pmy:Pmen_3655
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97840"
FT                   /db_xref="GOA:D6XWJ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH97840.1"
FT                   /translation="MNGVDKQVPRWKTWLIRSGLILAGLLVVFMILPFLIPVSEQDGFA
FT                   QDTPFEDSAFAEVDGVWLHYRISEPEEAEEAETVLFVHGLGGSTYSWRYQVEPFTEAGY
FT                   RVIRVDLPVFGYSDRQRGLEHSMANRSMWLWGLLDELETEEVHLAGHSMGGGVITQMAL
FT                   DEPERIRSLIYVAGAVYNEPRSSFILDFPPVQRGIEVIAPRIAFTEARIRGILDSAYGQ
FT                   PVNDELVHAYLDTFNVQGTPGAWVDLLRSTTSVDTERLHELGHPALLLWGEDDSWVSVQ
FT                   EGEMLRDALPNASMAVLEGSGHMPMETDYPWFNDHVIAFLDELVVDE"
FT   gene            complement(313547..314089)
FT                   /locus_tag="Bsel_0301"
FT   CDS_pept        complement(313547..314089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0301"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: hch:HCH_05422 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97841"
FT                   /db_xref="GOA:D6XWJ9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ9"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADH97841.1"
FT                   /translation="MPQTRNVTLFIAMSLDGCIATSDHSLDWLEQVEGEGDNGYEKFYS
FT                   TVDTVLLGRKTYDWIRQLALPAFPYEGKSAFVFSRDHHPENDDVHWINEDPVSFVRSLK
FT                   ASDGGTIWLVGGGELVKTLYEAGLIDSYIITIAPVLLGNGIPLFLTNSRHQELELLNSE
FT                   RYGQFIQLYYKRKTRPD"
FT   gene            complement(314150..314641)
FT                   /locus_tag="Bsel_0302"
FT   CDS_pept        complement(314150..314641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0302"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: dds:Ddes_1073 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97842"
FT                   /db_xref="GOA:D6XWK0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK0"
FT                   /inference="similar to AA sequence:KEGG:Ddes_1073"
FT                   /protein_id="ADH97842.1"
FT                   /translation="MTTAFVLDIRHDSVVDGPGLRSVVFFAGCPHHCLGCHNPDSWIRE
FT                   NGSEQPVSAIIDTLLQNPLSDVTLSGGEPFEQAQAAGLIAKACQKAGKDVWVFTGWTLE
FT                   ALLDRDDPATDLLLVNTDTLVDGPYEQNNPDTGPAFRGSTNQRILTGPFRKPHVLFPPL
FT                   "
FT   gene            complement(314638..316530)
FT                   /locus_tag="Bsel_0303"
FT   CDS_pept        complement(314638..316530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0303"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="KEGG: cla:Cla_0048 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97843"
FT                   /db_xref="GOA:D6XWK1"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK1"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADH97843.1"
FT                   /translation="MTDLYTSAKAPHQDTHHDPIMTELNRVTRSKDPAVTRENANVDST
FT                   SPSGMMNRFASIAARAYAREHLLSDETLRAIDDNLIHIHDLDYYVTGTTTCCQIPLGKL
FT                   LATGFDTGHGFIRPPQSITTALSLAAIIFQSNQNQQHGGQSYQAFDHDLAPYVTKTNER
FT                   HLNRLRDERPDLTEDERKARAWQQTDRDVYQACEAFIHNLNSLHSRSGGQVPFTSINYG
FT                   TDTSKAGRLLIRNLLHATLRGLGNGETPIFPIQIMKLKAGVNLKPGDPNEDLYQLALKT
FT                   TGKRLFPNFSFLDAPFNASALDEARPETEVAYMGCRTRVMQNRHGDDQSVGRGNLSFTS
FT                   INLVRLALTSPDTTAFFHRLDNTVHLVIRQLLERFRYQCSQPPASFSFLFGEELWHTSG
FT                   TLKNGACLADVLKHGTLSIGFIGLAEALVALTGSHHGEGDKAEALGLSIVRRLRTLCDE
FT                   ASDTHDMNITLIGTPAEGLSGRFVKHDQKQFGTIPGVTDRAYYTNSFHVPVYAQTTIAE
FT                   KIRIEAPYHAFTNAGHISYIEVDGDVSGNLKAMDQIVQHMARSGMGYGSINHPVDRCLT
FT                   CSHTGPIDTECPSCGNDNPDQIERIRRITGYLVGSMSRWNPAKTAEEEDRVKHR"
FT   gene            complement(316546..317022)
FT                   /locus_tag="Bsel_0304"
FT   CDS_pept        complement(316546..317022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0304"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   dma:DMR_03500 putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97844"
FT                   /db_xref="GOA:D6XWK2"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK2"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ADH97844.1"
FT                   /translation="MALTNCNRRPVILCYSQTGNTAALAEQIRELAGHPDPAVHLNPHP
FT                   DDIKTVMNGATSLMIGTYSWGDGQIPERFLPVLEAVITHMKQDVPVGVFGTGDRFYPSF
FT                   CGAVDELSARLSEHVDVLATLKIELMPQAGDTNAIRSFLHQLHTGTDPITDNDS"
FT   gene            complement(317003..318046)
FT                   /locus_tag="Bsel_0305"
FT   CDS_pept        complement(317003..318046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0305"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: smt:Smal_2295 ribonucleotide-diphosphate
FT                   reductase subunit beta; PFAM: ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97845"
FT                   /db_xref="GOA:D6XWK3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK3"
FT                   /inference="protein motif:PRIAM:1.17.4.1"
FT                   /protein_id="ADH97845.1"
FT                   /translation="MIHEPMIRIPLLNPTHPNRSTGLIQGEASGILNWNDIAYPHMYDL
FT                   YQTLLANFWKAQEINMQDDIKQWAELTPAEQDVFLRINTQLASLDSLQTPTMSQVMDYV
FT                   TDPSFKAIFAIVAQQEAVHNESYSYVLSSLVNQQEQTRRFQEAKEDPLIQRRNDVILSA
FT                   YERFRQHPSPQHLFELAVQSLNLEGVYFYAGFAFFYHLARQQKMMKTSTMISYIQRDEM
FT                   QHAYFMSQFVRILLTDHPELNTRENVQYVYDAMASAAGLEQEWAAVILADIDGIDLGEF
FT                   NGYVEYLVNKRLRQLGLSNLFPERDNPMPWIHVFSDTMMNQTKSDFFEQKSRSYTKVTS
FT                   DNGFDEL"
FT   gene            complement(318094..320301)
FT                   /locus_tag="Bsel_0306"
FT   CDS_pept        complement(318094..320301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0306"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase, alpha
FT                   subunit; KEGG: smt:Smal_2296 ribonucleotide-diphosphate
FT                   reductase subunit alpha; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97846"
FT                   /db_xref="GOA:D6XWK4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK4"
FT                   /inference="protein motif:TFAM:TIGR02506"
FT                   /protein_id="ADH97846.1"
FT                   /translation="MYEMERMTMSIRMEQTTRQTQMQDALNRVSMSEPHWTYKAAALFA
FT                   EDLYESAAKTRHLNTGEAYEDFPGLIFEGVRLGLYDNRLTEYYSPAELDEAASMLNPDQ
FT                   DRLFTYPGLFLLADRYLTRTTDGELFELPQERFLVIALVLMMHEPQEKRLALVREAYWA
FT                   MSHLYMTVATPTLANAGKSHGQLSSCFIDTVDDSLDGIYLNNWDIARLSKDGGGIGVYY
FT                   GKVRALGSDIKGFKGNSSGVIPWIRQLNNTAVSVDQLGQRQGAIAVYLDVFHKDIMNGF
FT                   LDLKTNNGDERRKAHDIFTGVCLPDLFMKKLEETDENGRSIGEWHVFCPHEVKQIMGWK
FT                   DKDGNPLGLEDFFDEADRPYFTEKYEEAVHHPLLPRETYRAMDIMARMMVSQLETGTPY
FT                   FFYRDEVNRQNPNKIAGEPGRTTIYSSNLCTEIAQNMSPSVITKEYETEEGDQVIVRKP
FT                   GDFVVCNLSSVNLGNAGDPDILKRLIPIQMRMLDNVIDLNQLPVQQARRTNSRYRAVGL
FT                   GTFGWHHYLAKNQIHWESDEAVQEADRLYETIAYLAIEASAALAREKGAYPAFKGSEWE
FT                   SGRYFERRGYTSANWQTLKKTVSESGVRNGWMMAVAPNSSTAKIGGSTDGIDPLYAVEF
FT                   AEEKKNFKFLVTAPELDHNTYPYYQKTRHTLDQTWSIRQNAARQKHIDQGVSFNLYVHH
FT                   AIRAKELLSLHLEAWKQGLKTTYYIRSTSQEEIESCDVCES"
FT   misc_binding    complement(320456..320635)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 129.27"
FT   gene            complement(320864..320971)
FT                   /locus_tag="Bsel_0307"
FT   CDS_pept        complement(320864..320971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97847"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97847.1"
FT                   /translation="MHPFISNMLMIAVTFALALLFFTVYVGIPIGRFTF"
FT   gene            complement(321025..321315)
FT                   /locus_tag="Bsel_0308"
FT   CDS_pept        complement(321025..321315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97848"
FT                   /db_xref="GOA:D6XWK6"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97848.1"
FT                   /translation="MPESLFSDIIAPLLLLLIVLAPVLTSRRRAPMETALQTRNLFASR
FT                   WFGYPLIALLPIGFFATSQIIWTITLAFTAAFGVSLAAHAFRMVFTKRTFD"
FT   gene            321482..322897
FT                   /locus_tag="Bsel_0309"
FT   CDS_pept        321482..322897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0309"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: prw:PsycPRwf_1468 EmrB/QacA family drug
FT                   resistance transporter; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily; PFAM: major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97849"
FT                   /db_xref="GOA:D6XWK7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK7"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADH97849.1"
FT                   /translation="MPDDVRKFPIVAVLLTGTFVAILNQTLLVTAIPPIMRDLGINANM
FT                   AQWVNTIFMLVNGIMIPITAFLIGKFTTRKLFMTAMSLFALGTLVAGLSPNFETLILGR
FT                   IIQASGAGIMIPLMQTVLFMIFPVEKRGQAMGLVGLVIAFAPAIGPTLSGFIVDQYPWR
FT                   LLFFIVLPIALIDLVVAYFVLKNVTKQTFPTIDIKSIMLSTFGFGGLLFAFSYAGTTGW
FT                   TSWEVLVSTGVGGVTLTWFILRQLRIPEPILEFRVFRYSIFALSNVIGIVVFMSMIGAA
FT                   TILPIYMQDMLGFSAFQSGLMLLPGALLMGLLNPITGRIFDKVGARWLSISGMALLTVM
FT                   TFLFTRLTEDTSFLYMTTVHAFRMMSLAMVMMPITTAGLNQLPERLIPHGTAMNNTLRQ
FT                   VGGSLGTAFLVTVMTVGAAFSSNGRTMNEAMIQGVNFSFWVATFLAFIGFVIAMFVKNP
FT                   PKRQEVEESTNPH"
FT   gene            322966..323160
FT                   /locus_tag="Bsel_0310"
FT   CDS_pept        322966..323160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97850"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97850.1"
FT                   /translation="MILLKSLFLVGTGDVLSFSHLHHPSEEEQFFLSEETTTQYITGVC
FT                   YKPPLQTDREVVKWWVVDA"
FT   gene            323353..323703
FT                   /locus_tag="Bsel_0311"
FT   CDS_pept        323353..323703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0311"
FT                   /product="HicB family protein"
FT                   /note="PFAM: HicB family protein; protein of unknown
FT                   function UPF0150; KEGG: pca:Pcar_0789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97851"
FT                   /db_xref="GOA:D6XWK9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK9"
FT                   /inference="protein motif:PFAM:PF05534"
FT                   /protein_id="ADH97851.1"
FT                   /translation="MKKEVRDILNKPYHIVTNAVRDEVGHYYVARVLEFDGCIATGETQ
FT                   EEAHQMVNEVMESYIEDMLEDGDAIPEPVGDDHFSGNVRLRMPKSLHRDLSRAAKLEGV
FT                   SLNQYLISKLSK"
FT   gene            complement(323767..323961)
FT                   /locus_tag="Bsel_0312"
FT   CDS_pept        complement(323767..323961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97852"
FT                   /db_xref="GOA:D6XWL0"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97852.1"
FT                   /translation="MFRDRLLFLLFFLLYTFLSYQFYVAFLERYLIAYELILLFIVPPL
FT                   LIPVLIVLANVSKNYVLGQ"
FT   gene            324228..324986
FT                   /locus_tag="Bsel_0313"
FT   CDS_pept        324228..324986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0313"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   smd:Smed_2597 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97853"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADH97853.1"
FT                   /translation="MHIQLIRNATVIIQIAGKRLLVDPMLSPKGTMPGFRNSPREEEGN
FT                   PLVELPVPIEEIVEIDAVIVTHLHADHWDQAAVDHLPKDVSLFCQNEEDQRAIKNQGFR
FT                   DVRVLRPETKWAGIQLTVTPAQHGRGEILNHLGHVSGVVLKHPSEPVTYLTGDTVWYEG
FT                   VAETIRRHEPDVIVVNGGDNQFHTGGSLVMGKKDILDVHKASPASDLVAVHMEAVNHWT
FT                   LSRMELRRFSEEEGMAERLWIPDDGESRSY"
FT   gene            325080..325580
FT                   /locus_tag="Bsel_0314"
FT   CDS_pept        325080..325580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Os11g0689400; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97854"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97854.1"
FT                   /translation="MKKRNTWLTVTGVLALGILIGTIMTGPAGAFGPGGGPSGQPGMGG
FT                   FQSEEEWEAFHEELGFDGEAGPGRMMGLSEEELEAFYEERGSEGTRFHRGGGMMRGFDS
FT                   EEDWEAFHENRGFGRGMMNGWSEEQRDEMIQFMEENEGTMPCGRSFEEGAFWDDRDTED
FT                   EAS"
FT   gene            325580..325822
FT                   /locus_tag="Bsel_0315"
FT   CDS_pept        325580..325822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0315"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: tbd:Tbd_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97855"
FT                   /db_xref="GOA:D6XWL3"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL3"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADH97855.1"
FT                   /translation="MHGYNTGNFLMGGGWIWGLFQLALVILIVYVVWQLIQNRRGSSSQ
FT                   EDARQDALSILDSRFASGEIDDDEYNRKKRAILDR"
FT   gene            325898..326143
FT                   /locus_tag="Bsel_0316"
FT   CDS_pept        325898..326143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0316"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: tbd:Tbd_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97856"
FT                   /db_xref="GOA:D6XWL4"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL4"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADH97856.1"
FT                   /translation="MHMMGGGGPGGFWWMPVMMGVYVLILIILAVVLIRSFTKGSGKGK
FT                   SAIDILNEQLARGEISEEDYDRLKAKILDSERRDRQ"
FT   gene            326140..327549
FT                   /locus_tag="Bsel_0317"
FT   CDS_pept        326140..327549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0317"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bph:Bphy_3928 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97857"
FT                   /db_xref="GOA:D6XWL5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH97857.1"
FT                   /translation="MRQLSVKIGLLFLVFILLIQSVLFFALYWTIAGDRVDEVFEGMLA
FT                   QGRSHAEALSMDFTDETMAHVVMMEQGNEQDVLITGTDGEILKQGGDFPEEITVDGWLD
FT                   GLPETGPDSVMLEENWQGATHVLSASRVTIDGTVAGYVVMAAPSGMILGTVSQLTNQFV
FT                   IGGLLSVVLTMVTVFFLSRVVSLPLRQMTEATRDLAKGEMHVTLGYDRNDELGELELAI
FT                   RQLAQDLEKVKQERNEFLAGIAHELKTPLTYVKGYADMAKRADTGEADRARYLAIIEEE
FT                   AASLTRLVGDLFDLAKLDSNSFAIEKGTVDLSDVLRGFCRDLAPVAKERNRLLAGDIED
FT                   RIRVKADECRLIQVLRNLTDNAIRYSDEDSAVTVSLTRAGDGRILLAVADEGAGIAKHH
FT                   LPYLFDRLYRADPSRSRETGGSGIGLSIVKAIVDQHGWAIEAKSEVNKGTVMTVTIPKG
FT                   DVLDGDDPDCG"
FT   gene            327524..328210
FT                   /locus_tag="Bsel_0318"
FT   CDS_pept        327524..328210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0318"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: dal:Dalk_0879 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97858"
FT                   /db_xref="GOA:D6XWL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97858.1"
FT                   /translation="MATILIVDDETRMLDLVALYVAPYGHRVLKESDGEAAVNRVADEP
FT                   VDLVILDVMMPKMNGWEVCQDIRSFSDVPIIMLTARDGKEDVVKGLRYGADDYVTKPFD
FT                   EGELMARVDALLRRTKRQDEAACGGLVWNGRERALSFEGEAIHLTPKEFDTIGLFLRNP
FT                   GRAFSREEIIETAWGLGSGTEGRTVDTHIRNMREKIKKSGFPVEDHLKTVWGKGYKWES
FT                   ERDGSH"
FT   gene            328321..328821
FT                   /locus_tag="Bsel_0319"
FT   CDS_pept        328321..328821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0319"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: afw:Anae109_0489 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
FT                   type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97859"
FT                   /db_xref="GOA:D6XWL7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL7"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97859.1"
FT                   /translation="MSDIETLFEDHADDVYHFLVYYTRRDDVEDLVQETFIRALRSIDG
FT                   FEGRSAAKTWLITIARRLTVDGGRKKRDVPVGDEHLEYRQNETGTDASEAVIRQETADE
FT                   LLDQIHRLPDRQRDVMLLRGISELDATETAAVLNMSRTGVYVTYHRALRTLRSRMDRGG
FT                   DRL"
FT   gene            328818..329744
FT                   /locus_tag="Bsel_0320"
FT   CDS_pept        328818..329744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97860"
FT                   /db_xref="GOA:D6XWL8"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97860.1"
FT                   /translation="MKRDPVIEELKNKPKRRLSGVSRRGILHELKQEEARLDAKSTRRK
FT                   GRWLPPGKGMTYAATVLLFPVIAVVMWLLLEGSSDMEETMFFQGEQVNITAPKEPDETA
FT                   LVFHFEQHEAGDVILDGSPDPDVARRIAANHEIDGIERFGRIEGAKYDFYGYYYVDDHR
FT                   RLHLAGAVTIDSGAEDEQYLLEVFSIQIDESTLRAFHDGEENMMTMLNDARHGQSEQYY
FT                   LFGLGFSPEANVADVTVEGFDELETLIADGQLIMFGFGDTLERHLDVVVDGAGLDMFID
FT                   RLETELCLEDGSCYERPFLRHPLLPDY"
FT   gene            330092..331120
FT                   /locus_tag="Bsel_0321"
FT   CDS_pept        330092..331120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0321"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: asu:Asuc_1193 DNA-binding transcriptional
FT                   repressor PurR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97861"
FT                   /db_xref="GOA:D6XWL9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL9"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH97861.1"
FT                   /translation="MKMTIKEIAKLAGVSQATVSKIINNYDDVGQKTKERVLAIMDEYG
FT                   YRPSYAAQSLVKKVTKVVGVIYAGHINANFNHPFFVEVVDMFKKTLGGEGYDLLFFSNE
FT                   KFHKADENYLQRCQHYNVDGCIIIGGEQVEPSIYELDQSTIPCIGVDIELTGPHSGYIM
FT                   TDNIQVSSMAVEHFYLTGRREVAFIGGEKESFVSRQREAGFRERIKAYGLQAPEEWFVY
FT                   GDFFEESGYACMKELLRSERTPQAIFAISDLMAFGAMKAIKDQGLDIHDFAIIGCDDIT
FT                   AAKHVEPPLTTIKQDKQKIGRMAAFILKDLITGHIEQTSLKVDPELVVRESCGSKKPGV
FT                   MR"
FT   gene            331117..331737
FT                   /locus_tag="Bsel_0322"
FT   CDS_pept        331117..331737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0322"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97862"
FT                   /db_xref="GOA:D6XWM0"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM0"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97862.1"
FT                   /translation="MNKIQQLSEGIFRYALLNLMWVGYSLLGFIVFGILPATIALFKVH
FT                   FHQHRNRLEPERESDVRVFHEAYKSSFIRGNLLMLILTAAGVFLYADLYIVLRMDHALM
FT                   PILLGLIVALTVLYLLFLFFVPASFAYENRPFFETIRAGFYMAVLSPIYSISLVIAFGI
FT                   IIYAGQIVPAIHLFFTASVMTYLVTAVFLLKADRLRRMAGKNN"
FT   gene            331955..333301
FT                   /locus_tag="Bsel_0323"
FT   CDS_pept        331955..333301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0323"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: vsp:VS_II1391 ABC transporter: substrate-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97863"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97863.1"
FT                   /translation="MKKYLYLTSIIGMSAMLAACGGNDEGNNGNADPDPDNANSPSADN
FT                   ENDDTEVSDVGSDDADVELSVWLFGATGYPELAEEYAEENPNVSISFQEIEMGDHHNNL
FT                   FTALSAGSGAPDLALIEVSEMDGYKSAEDRFVNLFDMGAGDLEDDYLDWAWENAQNVDG
FT                   DFLFGLPTDVGPTAMFYRADVFEEAGLPSDPEELEAMLQTWEDYEEAAATIMEETGKPI
FT                   SGNPETLYNALRDQAPQSYFNEDNELILETTDYVRNAFMRTSDMINNDFVENLGMWTPE
FT                   WGSGMADGSFAAMMAPAWMQGVIQDNAPDATEWRIIQVPEGGGNWGGSYMTMPDQTEHP
FT                   EEAYAFMEWLLAPEQQLKAFENMGLFPSAPSVYEMDEFQNFTSDYFGGQATAQVFAQSA
FT                   LDGEHVYQGPSYGDVNSEILSGLDNVYDGIDPEEEWEDVLNRVNQRINR"
FT   gene            333466..334443
FT                   /locus_tag="Bsel_0324"
FT   CDS_pept        333466..334443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0324"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hch:HCH_06909 ABC-type
FT                   sugar transport system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97864"
FT                   /db_xref="GOA:D6XWM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97864.1"
FT                   /translation="MSDSNETSNKLNQTEPAAPKEPKRRKFSQRQKNMASGYLFISPFY
FT                   FLFAVFGLFPILFSFYLAFFRWDGLGPMEYVGFRNFEIIFNDPLFWKSLYNTIIIGLMG
FT                   TAPQLIAALLLAFALNSVLVKAKSAFRLAIFLPYVTSIVAVAIVFSVIFSNQASGLVNS
FT                   FIGLFGADPVTWSRSEWGTKFAIATMIFWRWVGYNMIIYLAGMQSIPNDLYEAAKIDGA
FT                   TVRQQIWYVTIPMLKPFIIFTVFTATIGALQVFAEPHIFQGRAGRTEGITVVLYLYRDA
FT                   FVSNFFGTASATAIVLFFIIIVMSISNMYFANRIGQSKKVGVKQ"
FT   gene            334440..335279
FT                   /locus_tag="Bsel_0325"
FT   CDS_pept        334440..335279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0325"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rfr:Rfer_1101
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97865"
FT                   /db_xref="GOA:D6XWM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97865.1"
FT                   /translation="MKSEKQKTLISKILLYIGLSIVSLASLFPFYWMFVMATNSNEMIN
FT                   RTPPVMVPGDRLVDNFQNVLNSIPFFQTMLNSLIAATSITLGVLLLTSIAGFAFAKLEF
FT                   PARNILFFFILGTMMIPPQLGLIPTYFIITELGWLSDLRAVIVPGLMNAFGIFWMRQYV
FT                   ASAVPDEIIEAARIDGCSNFRIYWNIVVPVILPAFATLGIIVFMFVWGDYLWPLVVLQD
FT                   QSSQTIQVALRSLMDDRSRDYGMILSGTFWATVPLVVVFLFFNKLFIRSIADGAVKS"
FT   gene            335429..338569
FT                   /locus_tag="Bsel_0326"
FT   CDS_pept        335429..338569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97866"
FT                   /db_xref="GOA:D6XWM4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM4"
FT                   /inference="similar to AA sequence:KEGG:PHATRDRAFT_54686"
FT                   /protein_id="ADH97866.1"
FT                   /translation="MNQLNNDGSFQMDDFQNKAPFSSFLPGIAGARGIPAWAFYVNRGQ
FT                   GIASFGVQDKDHAIMEFHPADKSYQHVYQQGFRTFLNVHDEDGDVFVEPFAIEGAVSEQ
FT                   VKESMQIHDNALKLTYSHETVGLEMTVTYTALPESKVGALMRHVDLTNKTDRPVHVELL
FT                   DGMPRVMPSGVSNAAYKELGNTLKSWFDVEEASWSVPFYTLRGSMDDSAEVREIPAGNF
FT                   YSTLVKTETGIHQPVPVVDPGLVFGTDTSLTLPKGFLGGFQAPETIEEQTVTNKVACGF
FT                   THLDISLEPGSSVSWISVTGSGKNKETVAGFISETFNFDELLAKEARAMALVKEMTDTV
FT                   SAKTAHPVFDSYARQNYLDNGLRGGFPVAYGSEPGQIFYLFSRKHGDLERDYNFFSISP
FT                   TYYSQGNGNYRDVNQNRRLDLFFEPRVHDRSVRQFMSLIQLDGYNPLVVKGTTFSAGET
FT                   VDGVITNHVGADDREKVLTFFDTPFTPGELLHFVEDEGIMLMASFEEFLESVLKESLES
FT                   VDADHGEGFWVDHWTYNLDLIDSFLGVYPDQREQFFTDKVYPFFDTPVSIMPRSSTYRI
FT                   LEGKGLRQYDAIKEDEEKLHGQKDGEISSWVARKEGGRYETDLYSKLVLLAASKTAAIA
FT                   PYGLGVEMEAGKPGWNDSLNGLPGLVGTSTSELMELKRLVDLLVDEGPYDVTLPSPSVA
FT                   FIHQLADLAGEPSGDAMTDWDQRATLRETYRSQVTGKPVQSETVVDQATVKERLIALKR
FT                   LVDESVEAVNGYGELIPTYFYFEAEGELHEDLSKLQLKPVAVTPFLEGIVKKMKVSDRS
FT                   GAKALYDKVKDSDIYDRKLGMYKTSMSIQGETNEIGRAKAFTPGWLENESIFLHMAYKY
FT                   HLETLRSGLYTDYYEDIKHALIPFLDADVYGRSTLENSSFIASSANPDESLHGRGYVAR
FT                   LSGSTVEFLHMWLVMMGAERPFTAEDGLTFALSPKLAGSFFTEEGEVSFRLFNQCEVTY
FT                   SNPSRKDTFGENAVKPVQYTLTYRDGKEELLNAGDVTGPSAEAVRNGSVSAIHVTLA"
FT   gene            338726..339541
FT                   /locus_tag="Bsel_0327"
FT   CDS_pept        338726..339541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0327"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rlt:Rleg2_6440 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97867"
FT                   /db_xref="GOA:D6XWM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH97867.1"
FT                   /translation="MDPFEQYYIQIEGREDATHTLVFAHGFGCDQQVWNLVSPAFEDEY
FT                   LIVRFDYTGAGRSAKSAYSSEKYRTLDGYAEDLKAVIHAAGGERITVVAHSVSGMIAAQ
FT                   AIIDEPGLFDDLIMIGPSAHYLNHPDYHGGFDREDIDGLLHMMEQNYKEWARYLAPIVM
FT                   KNEDRPELAEDFSNQLCSNDAAIIREFAEATFLSDHRDILEAVNVPVLVIQPADDTIVP
FT                   VEATTYLVRELPDARIVWMNGRGHNPHLSHPEELIPLIEEWTGRDGVRE"
FT   gene            339538..340506
FT                   /locus_tag="Bsel_0328"
FT   CDS_pept        339538..340506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0328"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: tdn:Suden_1036 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97868"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97868.1"
FT                   /translation="MNEQLNRAPCGYFVMNDAFRMIEANESFASLVKREHFELLDLNFQ
FT                   QLLTVASRVYFQTYFEPIMNIQGKVRELYLTLKVDGKSLPVLMSANAYGNTYECVVMEM
FT                   SVRSEYETEMITARKNAEKVLQDTDEAYTSLLGVMNEHEQRKQELIRLNAELNELAITD
FT                   NLTHLKNRRFFEDRLSYLLDLYEKEGVPFSICLIDVDEFKRFNDTFGHLAGDFVLKELA
FT                   KIMESHIRNDDLVSRFGGEEFIILLPSVGVDVAIDVIERLRMAVEDHDWIDRQVTISCG
FT                   LTECIIGDDHESILRRVDDALYRSKENGRNRVTLHRDDEQP"
FT   gene            complement(340584..342737)
FT                   /locus_tag="Bsel_0329"
FT                   /note="Contains selenocysteine"
FT   CDS_pept        complement(340584..342737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:342660..342662,aa:Sec)
FT                   /locus_tag="Bsel_0329"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: gsu:GSU2147 cadmium-translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; Contains
FT                   selenocysteine; PFAM: E1-E2 ATPase-associated domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97869"
FT                   /db_xref="GOA:D6XWM7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM7"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADH97869.1"
FT                   /translation="MGERKLDDQQSVADSTATYRIDGLSUADCAKTFESNVKRLDGVED
FT                   ANLNFGAAKITVSGHTTIKELEKAGAFEGLKLRPERASSSKQVSFWKLPTTRKVYVATL
FT                   LLLVALAATVQYGESHPVTGIAYLATVITGGYSLFNKGFRNLIRLNFDMNTLMTIAVTG
FT                   AAIIGEWMEGAIVVILFAISEALERYSMDKARQSIASLMDIAPNEALIRRNGEERMLLV
FT                   EDIQVGDIMIVKPGEKLAMDGRVVSGTSSINQAAITGESVPVMKDSGDDVFAGTLNEEG
FT                   LLEIEVTRLVEDTTLAKIIHLVEEAQNEQAPSQQFVDRFAYYYTPAIIVLAALVMTVPP
FT                   LVTGAPWETWIYLGLATLVVGCPCALVISTPVAVVTAIGNAARNGVLIKGGIHLEEAGG
FT                   LKAMAFDKTGTLTKGTPVVTDVIPFAYGKEEALHLAAAVEDGSKHPLATAIIRAAEASG
FT                   FDRSAYVMSGFRSLTSLGVEASVNGETILTGSPRVFQDRGLLHDERIQETIASLEASGK
FT                   TVMAVGHSTALIALIAVADEVRETAKSVIKDLNRMAIETVMLTGDNERTANAIAHDTGV
FT                   TRVYAGLMPEDKLDRIRNLRHSHGHVAMVGDGVNDAPALAASNLGVAMGGAGTDTALET
FT                   ADIALMADDLNKLPFTIRLSQKALSIIKQNITFALGLKALALLLVIPGWLTLWIAIIAD
FT                   MGATLLVTANSLRLMRMKEKVYK"
FT   gene            complement(342740..343102)
FT                   /locus_tag="Bsel_0330"
FT   CDS_pept        complement(342740..343102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0330"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: dde:Dde_0747 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97870"
FT                   /db_xref="GOA:D6XWM8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADH97870.1"
FT                   /translation="MKTTDTCDIFTYDSERVESTSAMIQNRDLDGAARIFKVLGDRNRT
FT                   AITYALCENDTLCVCDIATIIDASVATTSHHLRTLYKEGVVTYEKKGKLAMYALDDNHI
FT                   RQLMMTTLEHAEERKD"
FT   gene            complement(343321..344370)
FT                   /locus_tag="Bsel_0331"
FT   CDS_pept        complement(343321..344370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0331"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: shw:Sputw3181_3443 sulfate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97871"
FT                   /db_xref="GOA:D6XWM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97871.1"
FT                   /translation="MLDVAIQKSYPDFTLDIAFQAKPGLTGILGPSGCGKSLTLQALAG
FT                   ILKPDNGSIRMDGQTWFDSERRIHVKPRDRKTGYVFQSYALFPHLTVAENIAYGLKGLP
FT                   KTEIREKVANWLDLIKLKGFGQRYPSQLSGGQKQRVALARSMITEPKLLLLDEPFSALD
FT                   EHIKRQLEEDMLRLLGEHYNGIALLVTHNIEEAYRLGEDGMLFHEGRVLQQGPRDEVLR
FT                   SPSSIPAAEIIGTENIFSAPAPLTVKEEHIQIGNARFPLPPSSDSDTVHGMAVHAHDIR
FT                   LASQEEDSGGPHHYQGELIRTIPGVRQAMLIVNIGGVHWRLSAQESRGLKAGDTLTVSI
FT                   PPKAIHILR"
FT   gene            complement(344376..345047)
FT                   /locus_tag="Bsel_0332"
FT   CDS_pept        complement(344376..345047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0332"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rso:RS05467 hypothetical protein; TIGRFAM:
FT                   molybdate ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97872"
FT                   /db_xref="GOA:D6XWN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN0"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ADH97872.1"
FT                   /translation="MIDISLFPLFLSLRVALTATVLAILIGIPIAYFLHKSQNRFSTLL
FT                   DTLITLPIVLPPTVLGYYLLVLLGRNSSIGRFLEDSFGITIVFTPTGAVIAALVVSIPF
FT                   MIKSAKTAFSSVEDDILHSAEILGRSKLNIFLTVTIPLAWRGIVAGISMTFARALGDFG
FT                   ATLMVAGSIPNETMTMPIAIYDALLAGDRVMANTLVAIMTIVAVTILYTINRLEKRVIQ
FT                   G"
FT   gene            complement(345053..345835)
FT                   /locus_tag="Bsel_0333"
FT   CDS_pept        complement(345053..345835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0333"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="KEGG: mca:MCA1378 molybdenum ABC transporter,
FT                   periplasmic molybdate-binding protein; TIGRFAM: molybdenum
FT                   ABC transporter, periplasmic molybdate-binding protein;
FT                   PFAM: extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97873"
FT                   /db_xref="GOA:D6XWN1"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN1"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ADH97873.1"
FT                   /translation="MNMSNKGAFIILAFGSMLVAACGNDNDIEKHTLSVAAASDLGPAF
FT                   RELAENFEADHGISLSFSFGSTGQLADQIENGAPFDVFASANVSFIERLVESGDIIEES
FT                   TTPYAFGRIGLMMQATDEGIADDLYDLTSPDINRISIANPAHAPYGMAAEDALITSGML
FT                   DEVEDKLIYGRNITDAFVQIETGNAEVGIIAYSLGRANEDNFHFILLDEDLHEPIEQVI
FT                   GVVSYSEHQDAGQAFIDYIIHGEGKETMEHFGFYVPEE"
FT   gene            complement(346091..347128)
FT                   /locus_tag="Bsel_0334"
FT   CDS_pept        complement(346091..347128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0334"
FT                   /product="Arabinan endo-1,5-alpha-L-arabinosidase"
FT                   /EC_number="3.2.1.99"
FT                   /note="KEGG: scl:sce1485 putative Beta-xylosidase; PFAM:
FT                   glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97874"
FT                   /db_xref="GOA:D6XWN2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN2"
FT                   /inference="protein motif:PRIAM:3.2.1.99"
FT                   /protein_id="ADH97874.1"
FT                   /translation="MGIYQLSFRGFTVALLSATWLLAACTTDTPGGDVAGGIEMSGDIG
FT                   DYNPEEGVDDPVHDPAVLKSEDEYVLFSTGIERDPSDPGGIFMRKSADNLGGPWESIGE
FT                   IPVPEWIDPFEPNHLWAPMAIKQDERCFLYFSVSSFGSNRSAIGVASSSSPLDPASWED
FT                   HGILIESGAGTSFNAIDPHVFEYEGQLWLTFGSHFSGIHIIEMESPTQINSAMNPQLLQ
FT                   SRPGVPHNPVEAPSIIERNGYFYLFTSWDQCCSGLDSTYKIAVGRSDKPEGPYFDQEGE
FT                   PLVQGGGTILLEEEGNQIGPGGQDVYSEDGTDYLIHHYYDADADGVIRFQIRELSWEDD
FT                   WPTLE"
FT   gene            347751..349142
FT                   /locus_tag="Bsel_0335"
FT   CDS_pept        347751..349142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0335"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rlg:Rleg_6112 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97875"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97875.1"
FT                   /translation="MMKKAMWLLGASALVLAGCGGNGNDDGGNDAAANDGNNNAATEGD
FT                   GGELEEQVVIGDDVEGATELTFWNFQELHTRLFEDAVERWNEEFPDRAIQLTAETYPYD
FT                   QMHNNLLLSLQSGSGAPDIADIELNQYPNFMRGEPQLEIMNDIVELELENFVASRFEIY
FT                   GKDGNYYGIPYHVGATVMYYNEEIMNEAGVDIDSIVTWDDYIEAGKQVVENTDAVMTTV
FT                   ESDETWSFYPLISQRESDYFDENGELILDNEINVDTLQFLHDLVYEHEIAQLTPGGFHH
FT                   AEEYYGFMNDGGAASLVMPMWYMGRFTDYMEDLSGKMQIRPLPLWEEGGNRTAGMGGTG
FT                   TVVTNQTEHAELAKDFLAYAKMSPESSIKLWEILGFDPPRHDVWDSEEIREPNHFYEYF
FT                   HDDIFDILLSLRDEVNDLNITEYNPDVTQELESSVFHSVLREQSQSPQDALEQAAEAVR
FT                   SRMID"
FT   gene            349258..350181
FT                   /locus_tag="Bsel_0336"
FT   CDS_pept        349258..350181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0336"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_0127 sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97876"
FT                   /db_xref="GOA:D6XWN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97876.1"
FT                   /translation="MASVDQNQQKQTNGFFKFLYSKKAAPYIFVSPFIISFLLLFLYPM
FT                   ISAVNMSFQRVLPGQIDYIGLHNYSRVFNPTFYTALQNTTIYVVWTVILLTFIPLIFAV
FT                   FLNHRLMKFTNFFRAAIFIPALTSVIVAGTIFRMIFGDSDSAFANQVLQLIGLDTVEWR
FT                   YGAGSGMFLMVALASWRWMGVNILYYLAALQNVNYDLYEAADIDGAGVWQKFRHVTFPA
FT                   IKPVVIFLSTITMINGFRMFEESFVFWETSSPGNIGLTVVGYIYVEGIQRNDMGFGAAV
FT                   GVVLLIIILVVSIIQLILTGAFKKDD"
FT   gene            350181..351032
FT                   /locus_tag="Bsel_0337"
FT   CDS_pept        350181..351032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0337"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xfm:Xfasm12_1605 ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97877"
FT                   /db_xref="GOA:D6XWN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97877.1"
FT                   /translation="MMKQKNRNDKLISISLFVFFTIVAIVALFPVASLVVAAFSPASDL
FT                   MRFGLTAELFFSAWDFTNMNAIFSGEGGNYWQWYLNSLIISGGLIIVSLFFSSMVGYAL
FT                   ALYEFKGQRFVFVLVLLIVMIPFEILMLPLFRLMTSLQLVDTYIAVMLPLIVAPIAVFF
FT                   FRQYAIGLPKELMESARVDGCTEYGIFFKIMAPLMLPSFAAMAILQGLTSWNNFLWPLL
FT                   VLRSNDMFTLPVGLATLLTPYGNNYEVLFSGAVLSIIPIIILFLFFQKFFIAGLTSGGV
FT                   KG"
FT   gene            351064..351729
FT                   /locus_tag="Bsel_0338"
FT   CDS_pept        351064..351729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0338"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   GPT1; GABA/polyamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97878"
FT                   /db_xref="GOA:D6XWN6"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN6"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97878.1"
FT                   /translation="MTVKLDAFFRLITRFSLLNVNWIAGIVAGLLVLGLFPATVATFII
FT                   TRRWIREGESFSVTKAYWQAYKQVFVKANLFGIGLSAIGLLLYVNYRVIQTGGIEIPLV
FT                   VTVSFITIVFLYLLFAAAVIPVSIHFTGTPLKLIQKTIWFIFAKPHLAVLLVLLMWGIA
FT                   HVSLLVPAAILFFTGSVGAYTVMWIFLSSLDKISGIEEVQSETDQPETLSLSNRRILT"
FT   gene            351726..353234
FT                   /locus_tag="Bsel_0339"
FT   CDS_pept        351726..353234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0339"
FT                   /product="alpha-L-arabinofuranosidase domain protein"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: rlt:Rleg2_5890 alpha-N-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97879"
FT                   /db_xref="GOA:D6XWN7"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN7"
FT                   /inference="protein motif:PFAM:PF06964"
FT                   /protein_id="ADH97879.1"
FT                   /translation="MTKAKMIVDKSYKIADIDERIYGSFIEHLGRAVYGGIFEPDHPDA
FT                   DEDGFRKDVLELVKELQVPIVRYPGGNMVSAYNWEDGIGPREDRPKRLELAWRVIETNA
FT                   FGTNEFADWAKKANSEVMMAINLGTRGIDAARNFIEYTNHPGGTYWSDLRRKHGYEEPH
FT                   KIKTWCLGNEMDGPWQVGQKTAYEYGRLASEAGKAMRLVDPDIELVSCGSSHTQMPTFP
FT                   DWEAETLTHTYDVADYVSLHQYFGNRDNDSQNYLANGMELEHFISTVISVADYIKAKKR
FT                   SKKTLMLSFDEWNVWYHSNDADKEIEPWTVALPQLEDHYNFEDALLVGSILITFLKHAD
FT                   RVKMACMAQLVNVIAPIMTDNLGASWKQTIFYPYMHASVFGRGVSLKPVVNSPKFDTKD
FT                   FTDVDYLDTAVVFNEENEELTVFALNRHIKEDLVMEAQLGDFEGYRIQEHIVLEHDDLK
FT                   AVNTATNHPVKPYRNGDAVYKDGVIETKLKKASWNVIRLKLINE"
FT   gene            353264..354226
FT                   /locus_tag="Bsel_0340"
FT   CDS_pept        353264..354226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0340"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="KEGG: eca:ECA3793 putatuve glycosysl hydrolase;
FT                   PFAM: glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97880"
FT                   /db_xref="GOA:D6XWN8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN8"
FT                   /inference="protein motif:PRIAM:3.2.1.55"
FT                   /protein_id="ADH97880.1"
FT                   /translation="MTQSYDYKNPVIEQRADPWMYKHTDGYYYFTASVPEYDRIEVRRA
FT                   KTIEGLKGATPAVVWRKYDEGPLSANIWAPEIHYIDGAWYIYFAAARTTETDNGLFDHR
FT                   MYALACQSNNPVEGTWEEKGQVKSKWESFCLDATVFEHKGDHYYVWAQKDPDIEGNSNM
FT                   YIDKMVNPWTLKGDQVMISQPEYEWEKVGFYVNEGAAVIKRNGKIFMTFSGSATDHNYR
FT                   MGLLYADEESDLLNPSSWHKLDKPVFATSEENGQYGPGHNSFTTSEDGEKDLLVYHARN
FT                   YKEIDGDPLYDPNRHTRVQAFEWDENGFPVFEKPVPDAD"
FT   gene            354278..354973
FT                   /locus_tag="Bsel_0341"
FT   CDS_pept        354278..354973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0341"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="KEGG: pmu:PM1244 L-ribulose-5-phosphate 4-epimerase;
FT                   TIGRFAM: L-ribulose-5-phosphate 4-epimerase; PFAM: class II
FT                   aldolase/adducin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97881"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN9"
FT                   /inference="protein motif:TFAM:TIGR00760"
FT                   /protein_id="ADH97881.1"
FT                   /translation="MTLSKLKQEVCEANKALPKHGLVTFTWGNVSGIDREQGLVVIKPS
FT                   GVAYEDLTPESMVVVNLDGEVVEGELKQSSDTPTHVCLYNHFESIGGIVHTHSPNATSW
FT                   AQAGKELIALGTTQADYFYGDVPCTRAMTNEEIETAYERETGLVIVETFTKRNLDPVAM
FT                   PGVLVHSHAPFAWGTSPEDAVHNAVVLEECAKMAMQSLQLNAGAPRMNQALLDKHYLRK
FT                   HGKNAYYGQ"
FT   gene            354999..356657
FT                   /locus_tag="Bsel_0342"
FT   CDS_pept        354999..356657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0342"
FT                   /product="L-ribulokinase"
FT                   /note="KEGG: scl:sce3311 ribulokinase; TIGRFAM:
FT                   L-ribulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97882"
FT                   /db_xref="GOA:D6XWP0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP0"
FT                   /inference="protein motif:TFAM:TIGR01234"
FT                   /protein_id="ADH97882.1"
FT                   /translation="MTKYAIGIDYGTQSGRAVLVSLADGTEVADHVTDYPHGVMDETLP
FT                   DPTVKLGYEWALQHPKDYLAVIEQSVPAVMKASGIDPADVVGIGIDFTACTMLPVNEEG
FT                   TPLCLMDQWKQNPHSWVKLWKHHASQPHANRINEVADKRGEAFLPRYGGKLSSEWMLAK
FT                   SYQILEEAPEIYEEADRFVEATDWVIWQLSGAFLRNSCTAGYKSAWHKKDGYPSEGFFE
FT                   AVDPGLKDLASTKLKGDVVPLGTKAGGLTKEMAAITGLPEGLAIAVGNVDAHAAVPAVG
FT                   VVDDGKMVMAMGTSICHMVLGKEEVQVEGMAGVVEDGIIPGYFGYEAGQSAVGDIFGWF
FT                   TDRSVPGYVEEEAKRQGMNVHQYLEKKASAYQPGETGLLALDWWNGNRSVLVDTELGGM
FT                   MLGMTLQTKPEEMYRALLEATAFGTRIIIDAFHENGVPVDELYACGGLPQKNPLLMQIY
FT                   ADVTNRTIKVADSTQTPALGAAMFAAVAAGKEAGGFDTILDAAGKMGRVKEEQYDPNPE
FT                   AVVVYDKLYQEYKRLHDYFGRGGNDVMKRLKAWRT"
FT   gene            356694..358172
FT                   /locus_tag="Bsel_0343"
FT   CDS_pept        356694..358172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0343"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="KEGG: spe:Spro_2243 L-arabinose isomerase; PFAM:
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97883"
FT                   /db_xref="GOA:D6XWP1"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP1"
FT                   /inference="protein motif:PRIAM:5.3.1.4"
FT                   /protein_id="ADH97883.1"
FT                   /translation="MINRPYSFWFLTGSQHLYGPETLDQVAAQSEEIIDGLNEAGLPFP
FT                   IEAKQVLTNSDDIRDVIIAANADPSCAGVITWMHTFSPSKIWIRGLQLLQKPMLHLNTQ
FT                   HNRDIPWDQIDMDFMNLNQSAHGDREFGSVVTRLGIDRKVVVGHWQHPDVQADISSWMV
FT                   TAMGHQESYHVKVARFGDNMRRVAVTDGDKVEAQNVFGWTVDGFGVGDLVAYIDKVTDE
FT                   ETESLFDEYDKLYRISDEIKQTPALKQSVLEQARIELGMKAFLDTEGYNAFTTTFEDLH
FT                   GMKQLPGLAAQRLMAQGYGFAGEGDWKTAALLRLMKVMAGHEQTTFMEDYTYHFEPDNE
FT                   MVLGSHMLEVCPTVAEDKPEIKVHPLGIGGKDDPARLVFNGQGGKGVNVSLVDIGTRFR
FT                   LIISEVEAQVPDKETPELPVAKLLWKPEPSLSTATAAWVHAGGAHHTVLTFSLTVDQML
FT                   DWAEMHGIEAAVINGETDIHQFKKELKWNELVWK"
FT   gene            358331..359449
FT                   /locus_tag="Bsel_0344"
FT   CDS_pept        358331..359449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0344"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="KEGG: vpa:VP1030 LacI family transcription
FT                   regulator; PFAM: regulatory protein GntR HTH; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97884"
FT                   /db_xref="GOA:D6XWP2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033532"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH97884.1"
FT                   /translation="MEPKYNQVKNSIRSKILQGYFKPHEKIGSESELMQSYEVSRHTVR
FT                   KAIDDLVNEGWIYKKQGAGTFCAERSVSSDAVSNGTKNIAVITTYFSDYIFPTIIRGIE
FT                   GYLSANGYQMTVFSTNNDPDLERKYLETVLSGQFDGLIIEPTKSALPNPNINYYLNIER
FT                   LGIPYVMINAYYEELEPVHLIMNDAEGGRIATRQVIDEGHKQILGFFKNDDIQGIKRMK
FT                   GFIKAHRESGLQITPQNIVTYTTETRKKDPVERLKEKMKVRHERPTAIVCYNDQLAVIL
FT                   LDVLRDLNLSIPGDVSVIGFDDSFLSVASEVKLTTVKHPKERMGVDAAKLIDQLIREKE
FT                   DPTVSKKASSIVYEPELVVRNSTKDLKIKEVN"
FT   gene            359452..360618
FT                   /locus_tag="Bsel_0345"
FT   CDS_pept        359452..360618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0345"
FT                   /product="Glycerol-1-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.261"
FT                   /note="KEGG: aph:APH_1193 AraM domain-containing protein;
FT                   PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97885"
FT                   /db_xref="GOA:D6XWP3"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP3"
FT                   /inference="protein motif:PRIAM:1.1.1.261"
FT                   /protein_id="ADH97885.1"
FT                   /translation="MSLDVTDWYNRSSSGCSCGHTHYGLTVDTFSIRNGALYELRSYLL
FT                   DKGWRDVHLVSDAQTNEAAGEKLVRYLSEEINVERTTVLPDRNGDVIADEQAIMQVITE
FT                   ASREADVFIAVGAGTVHDITRFASHTVGKPFIAVPTAPSVDGFNSMGAPIVLRKKKITY
FT                   QTQAPVALFADLDVLREAPRAMTAAGFADILGKYTSLTDWSFGAVMAGEPYCPAAARMT
FT                   QEALDQAVSAKDEIRMGTSFGMEQLFEALLKSGMAMSLFGRSHPASGGEHHLSHYWEMA
FT                   FLEEGRKQLLHGEKVGVATGLIADLYHGEVLEKVFRDPALDAGQRKGIEALIGQLPTGE
FT                   EIRMMLKAAGGKTSLAELNIEPALYEKSKAHAHTLRDRKTMLHYLNTV"
FT   gene            complement(360759..361724)
FT                   /locus_tag="Bsel_0346"
FT   CDS_pept        complement(360759..361724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0346"
FT                   /product="selenide, water dikinase"
FT                   /note="KEGG: sfu:Sfum_3401 selenide, water dikinase;
FT                   TIGRFAM: selenide, water dikinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97886"
FT                   /db_xref="GOA:D6XWP4"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP4"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ADH97886.1"
FT                   /translation="MRHLPEGTKNENLLVGLDTSDDGGVFKLTDDLAIVQSIDYFTPIC
FT                   DDPYMFGQIAAANALSDIYAMGGKPVTALNIVGYPIKKMPPETLAEILRGGADKIQESG
FT                   AVLAGGHSIDDQEPKYGLSVTGTVHPDAIFKNVGAKTGDKLVLTKPLGAGIITTAIKFG
FT                   KASEQEQKDVMTAMATLNKTAAETLADFHPHAVTDVTGFGLTGHGFEMASGSNVTLHIS
FT                   YKDVPVINGTLSHARNKVIPGGGRENRDYLLEHVEHAPHIELADQLILSDSITSGGLLV
FT                   SLPADEADAYVEAYNRAQDTFKAAVIGHVTDFEGHAIKIR"
FT   gene            complement(361861..362247)
FT                   /locus_tag="Bsel_0347"
FT   CDS_pept        complement(361861..362247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0347"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97887"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP5"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADH97887.1"
FT                   /translation="MKQLLIVLSGLFLLGACGGTADLDGLNTMTATDLEAQTEQGLEDD
FT                   VQYIDVRETDEFDEESIPGFENMPMALVMDNPSLLNEEEDVVILCNTQNRSKEVAEALI
FT                   DAGFDHDRVIVVEGGISDYNGTVN"
FT   gene            complement(362323..363195)
FT                   /locus_tag="Bsel_0348"
FT   CDS_pept        complement(362323..363195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0348"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gem:GM21_2178 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97888"
FT                   /db_xref="GOA:D6XWP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH97888.1"
FT                   /translation="MNLNRLHTFIVLAEERSFSQTAQKLKISQPAITKQIKALEKEAGF
FT                   PLLNRETMTLTTSGAILFNEGQKLLQDWEVIYNKAALSHAGEQGSLHVGASSIPGTYLL
FT                   PQALSLLEDSAYPTDLCITLDSSAKMIEQLRHFELDLAFTGSKPDDNRLVSTEIAQDQL
FT                   VLVGTPEKSAIHSADDLMNERFISYREGSGTLRATKKAITDFGGSFDDLPVIAVVPNTA
FT                   GALALAASGIGITAVSSFALDTVMTQHVKILCELPTDRSFYAVRHANSQHPHTDALIQA
FT                   MIQSATRQM"
FT   gene            363335..364210
FT                   /locus_tag="Bsel_0349"
FT   CDS_pept        363335..364210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0349"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: afw:Anae109_3021
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97889"
FT                   /db_xref="GOA:D6XWP7"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP7"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADH97889.1"
FT                   /translation="MNVKRSLFILSGLFLLGACGNEQEEPFEVAVIPSQSIGEMQEGLD
FT                   LLEAELEAALGRVVKVEHYPNYNAVVEAINHSHIDLAYVGPVTYLIARNQSGAEAVLTQ
FT                   SINGSPYYHSYIKAHVDAPWDTLDELLADVGDVSFAFGSHSSTSGFTVPGYELMNQGVY
FT                   RDENDHDFIDVRFTGSHDITAQALLSQDVDAGAIDSAIYHALVEEGSVDDSRLKTIWES
FT                   EPLYQYPWIVPSDKDEDEIEAIQEAFLAIEEPEILRIFGGADAFVLADVANYEGIEDAA
FT                   RAVGLLDDEE"
FT   gene            364217..364873
FT                   /locus_tag="Bsel_0350"
FT   CDS_pept        364217..364873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0350"
FT                   /product="membrane channel protein component of Pn
FT                   transporter"
FT                   /note="KEGG: sbo:SBO_4129 membrane channel protein
FT                   component of Pn transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97890"
FT                   /db_xref="GOA:D6XWP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP8"
FT                   /inference="similar to AA sequence:KEGG:SBO_4129"
FT                   /protein_id="ADH97890.1"
FT                   /translation="MVWFKRRHLVYVVLLAVLTVISMQVTNVEITRLVDLIYIGDFIRE
FT                   RFLPVRWELWPVLLQASGVTLAMAFLGTLVALFVALPVSFLVARPTSSYWVRTPLKLVL
FT                   NFLRSVPEIVFGLILVVILGLGTFPAVIAIVLHNIGVLGKLIAELIEASDRGPQEAMRA
FT                   VGAGWHSGNVLAILPQIWPNVLSQYFYRFEVAIRTSLILGFIGGGGAGPAAVQSF"
FT   gene            364989..365729
FT                   /locus_tag="Bsel_0351"
FT   CDS_pept        364989..365729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0351"
FT                   /product="phosphonate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; KEGG: bba:Bd3104
FT                   phosphonate ABC transporter ATP-binding protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97891"
FT                   /db_xref="GOA:D6XWP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP9"
FT                   /inference="protein motif:TFAM:TIGR02315"
FT                   /protein_id="ADH97891.1"
FT                   /translation="MIQVEGLSVTFGGNVQALSGIDFTVGDGEFICVLGRSGAGKSTLI
FT                   RCLNGLQRPSAGIVTVNGETLTSKTEQDLRRIRADIGMIFQHFQLIPRLTVAMNVYLGM
FT                   AGKRPWWKTVMGFQTDSEKARVDTALREVEIGDYAHRRVEELSGGQKQRVAVARALVQE
FT                   PFLLLGDEPVASLDPGTSERLFQKLKDLHDNRGITMFINVHDVTLAKRYANRILALKDG
FT                   ALIFDGPPEAFDEEAYRETYATTT"
FT   gene            complement(365811..366773)
FT                   /locus_tag="Bsel_0352"
FT   CDS_pept        complement(365811..366773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0352"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: aeh:Mlg_0734 response
FT                   regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97892"
FT                   /db_xref="GOA:D6XWQ0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ0"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADH97892.1"
FT                   /translation="MFKGNKKLVAAAAGLSLTLVATACGNDGNNEENTGNNNDDANVNE
FT                   NAGDDNAANDGAMVGEGKEIELVYVEWDSEIASTHVVANVLESQGYDVTITPIDNAIMW
FT                   QSVANGEADGMVAAWLPATHGDLFAEYEDDLVDLGVNLEGALVGLVVPEYMTIDSIADL
FT                   DQYEDELGGTITGIEPGAGVVQAAEASVEDYGLDGFSVETSSSGAMATALGEAVGNEEP
FT                   IVVTGWTPHWKFSAYDLKYLEDPEGSFGEAEVIQTMVRQGLEEDMPNAFRILDQFFWTT
FT                   EDMESIMLEIQEGTDPEDAAADWVEANQDVVDGWLEGVE"
FT   gene            complement(366856..367710)
FT                   /locus_tag="Bsel_0353"
FT   CDS_pept        complement(366856..367710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0353"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dol:Dole_2764
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97893"
FT                   /db_xref="GOA:D6XWQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97893.1"
FT                   /translation="MLNDLLENLPQIPISEAVSNAVAWITDVFSFIFGPIRSGFGDFMT
FT                   WFADLLYAVPALIIIVLVAVIAYFLNGRKLGLPIFTIFGLLLIFNQGLWEELMYTFTLV
FT                   LLASVLSVIIGVPFGILMSKSDTAEAIMKPVLDFMQTMPAFVYLIPAVAFFGIGMVPGV
FT                   FASLIFATPPTVRLTNLGIRQVPTEMVEASDAFGSTPAQKLFKVELPMAKVTIMAGINQ
FT                   TVMLALSMVVIASMIGAPGLGREVLSALQRAQVGPGFTAGIAIVILAIIIDRFTQTANM
FT                   KKN"
FT   gene            complement(367700..368899)
FT                   /locus_tag="Bsel_0354"
FT   CDS_pept        complement(367700..368899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0354"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; CBS domain
FT                   containing protein; KEGG: aeh:Mlg_0732 glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; SMART:
FT                   AAA ATPase; CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97894"
FT                   /db_xref="GOA:D6XWQ2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ2"
FT                   /inference="protein motif:TFAM:TIGR01186"
FT                   /protein_id="ADH97894.1"
FT                   /translation="MATIKVDKLTKIFGKKTKQAQQLLDQGLSKDEILEKTGATVGVNQ
FT                   ASFEVQDGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGSVIINGDDLSNISDDKLRDVRR
FT                   KMMSMVFQKFGLFPFRTIMENVEYGLEVQGIEREERRKKAQASLELVGLKGYEEQYPDQ
FT                   LSGGMQQRVGLARALANDPEVLLMDEAFSALDPLIRKDMQDELLDLQTSMKKTIIFITH
FT                   DLDEALRLGDRIALMKDGYIVQIGTPEEILIHPADDYVERFVEDIDRSKILTAQHIMKT
FT                   PETINIDKNGPRVALERMRKYGLSSLYVTDSNRRLKGYITADDASDAQKRDSRELTDIL
FT                   KTDMPTVGKETPLHDLFDLIHDSPVPVAVVEDEKLEGIIVRGAVIAALSGENEVNLDVE
FT                   "
FT   gene            369169..369720
FT                   /locus_tag="Bsel_0355"
FT   CDS_pept        369169..369720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0355"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: bja:bll3994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97895"
FT                   /db_xref="GOA:D6XWQ3"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ3"
FT                   /inference="protein motif:COG:COG1510"
FT                   /protein_id="ADH97895.1"
FT                   /translation="MSSEEKLLSEQEQLDAARGRFISEIAKNIHLYDLPPSIGRLYGTV
FT                   FFSKDPMTLDEMSEEMGMSKTSMSTGIRSLVEADMVERVWEKGVRKDLYKTEEDWYKSF
FT                   STVFIKRWRNATETNLEAIGETEEMLNALKERADHDEVIDEVNIDLEKLHRARKYYEWL
FT                   NEVIALFETGEIFEIVPKKE"
FT   gene            369813..370409
FT                   /locus_tag="Bsel_0356"
FT   CDS_pept        369813..370409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0356"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97896"
FT                   /db_xref="GOA:D6XWQ4"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ4"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ADH97896.1"
FT                   /translation="MADDRKSMEQLQDKVNGKLADEEKTRQRPKNVATWRTEKPAVMNN
FT                   GPADFQPKKEKPKKNKPLMILAVLLVAFGGMMLLAFNEDRVMSAYQYITGDYSWQRAHH
FT                   ADEDMFRLSDGNYVQASVTIEVEERGQVRRLNSQDDSVDHIIEEAFMTVNTAEIRSNPG
FT                   KDQVVDEISAMINRDIEGVEVKQVYFRSILSPLAN"
FT   gene            370511..371143
FT                   /locus_tag="Bsel_0357"
FT   CDS_pept        370511..371143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97897"
FT                   /db_xref="GOA:D6XWQ5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97897.1"
FT                   /translation="MHILLILLVGIVTLFVAAALIQTIRRRRPDEAVVLDGLKLNIVSR
FT                   GMKLSPAQVKKDGRLKVGFLGAGLVILTGTLVATLITGMTLTLSSIFLLIWLPVYSLLV
FT                   IKVPMLLLTREAWVVDERRFPFEAIKCIEAEPVSVGHEMRGMFDESWAYVAVTIHPRKK
FT                   WSKKALFCVHQDDYEQLKDIARSQSRDYPWEETGTWQKTDGANGSLT"
FT   gene            371104..371739
FT                   /locus_tag="Bsel_0358"
FT   CDS_pept        371104..371739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97898"
FT                   /db_xref="GOA:D6XWQ6"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97898.1"
FT                   /translation="MAKNRRRKRQFDIEDYHPTILLVAGASGLLSFFAPVVIIPIAQEM
FT                   LHFDGGILEILTPTMSYRMMMAALLWIPFVTGLYFFTRKLAEQRRVPYRGGPLMAVLVL
FT                   LALPLMAFSIQHVVVLEEEGFHYNRWYEWSGTWYDWDDVNAVQPVRESMGGVLHITYRF
FT                   QMNDGREIVFESDDDFRRVRGYIFETVEAGGGEMLPTVDEDDYEPSNE"
FT   gene            372084..372239
FT                   /locus_tag="Bsel_0359"
FT   CDS_pept        372084..372239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97899"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97899.1"
FT                   /translation="MKQNDEDDLLEKSTGNRKRVEGWRLVVQMIGVCGKEVTDHVRSIK
FT                   EIIMVF"
FT   gene            372202..373974
FT                   /locus_tag="Bsel_0360"
FT   CDS_pept        372202..373974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0360"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ppr:PBPRA0971 putative transport ATP-binding
FT                   protein MsbA; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97900"
FT                   /db_xref="GOA:D6XWQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97900.1"
FT                   /translation="MFAALKKLSWFFKQEKKRYIIAILILTVASVLEIIPPRLIGFVVD
FT                   DVHQGRMTEERLFGFVSFFIVLMLVVYVMTYVWMRKLFGGSLLLERTMRSRLMNHLMTM
FT                   TPSFYNRNKTGDLMAKGTNDLKAISQTAGFGILTLVDATVFLVVILVMMTVFISWELTL
FT                   AAFLPFPLMAYLMKVYGKRIHERFMAAQRAFGDLNDQVLESISGVRVIRAFVKEQADRT
FT                   SFSKQTDHVLRQNIRVARVDALFEPTIKILVGMSYMIGLGFGAYLVFQGRITLGQLVTF
FT                   NIYLGMLIWPMFALGELMNIMQRGNASLDRLNHTFEAEPDVKDPDKPLRDLVPNEIVFD
FT                   GLNFSYPKAKEPALSDVSVTIRKGMHIGVAGKTGSGKSTFLRQLLRAYPLHKGALKVNS
FT                   VPFEQVSLSTVKGWIGYVPQESFLFSKSIEANIRFGAGDKVSDDRLRQVMEQAAITKDL
FT                   HTFQDGLETLVGEKGISLSGGQKQRIAIARALMKDPEILILDDAMSAVDAKTEQFIISN
FT                   IREERSGKTTFIAAHRMSAISHADVILVFDGGRIVEQGTHDELMQNGAWYKEQFDKQQM
FT                   EQQSQEQARQGVSS"
FT   gene            373971..376016
FT                   /locus_tag="Bsel_0361"
FT   CDS_pept        373971..376016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0361"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vfm:VFMJ11_1029 multidrug resistance ABC
FT                   transporter ATP-binding and permease protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97901"
FT                   /db_xref="GOA:D6XWQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97901.1"
FT                   /translation="MNKVKQEATPEPKETGKRLFQYAWPFRKTIFLSLFFLALAAAAEL
FT                   TGPFIAKTMIDEHIVGIEQTWVEVPDGDVTFEGRSFTREDRYAGDGTVDGVSIVQVGLD
FT                   YYLVEAREVTAGEETYENGVLTVVRDGETSVYPAVSMTTDDVFLFYAQEVPYIIGWMAL
FT                   YLVLIGISSFFHYYQSLWLQTSANRIIKQMREDVFRKVHELPVRYFDQMPTGKIVSRIT
FT                   NDTEAIRELYVRVLATFFTGIVYMIGIFFAIFLLDVRLALATLIIIPVLIVWMIVYRSF
FT                   AGRYNRVIREKLSDLNGRMNENIQGMSIIQAFGQEKKVADEFETHNDEHYRFNRKMLTL
FT                   NSLTSFNLIGLLRNVAFVTLIWYFAGGSMGVGMIFSLGVVYAFVDYINRLFEPINGIVG
FT                   QLAQLEEARIAGERVFHLMDQEGEPLPEAQTPRFHGDVTFDGVWLSYDEGHPVLRDISF
FT                   EAKKGETVAFVGHTGSGKSSIMNVLFRYYDHNQGRVLIDGQDTLALSRQDIRSHMAIVL
FT                   QDPFLFTGTIYSNVSMGDPAISRDQVMEALEQVGAGDFIRSLEAGIDEEVKEKGATFSA
FT                   GQRQLISFARALVVDPAILILDEATANIDTETEAVIQHALDVVKAGRTTFVIAHRLSTI
FT                   RDADQILVLSEGEIVEQGDHDELMAQRGRYHHMYQLQKGAGSGKVS"
FT   gene            376156..377235
FT                   /locus_tag="Bsel_0362"
FT   CDS_pept        376156..377235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0362"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   Polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97902"
FT                   /db_xref="GOA:D6XWR0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR0"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADH97902.1"
FT                   /translation="MNKQLTMRASISFAVFVLLIAAFLGGRWSVSSDDQTLLEARLADA
FT                   KLEIEMRREAVEELRADLEDQDDVEEELVAAEEEIEELEGMIEELEAELLAFEEEEGTA
FT                   EEANGGGEEGESASDGAAIGGGGSSGEGRPDPGERAVYLTFDDGPTTMTPEILSILDEY
FT                   DVPASFFVIGQRMEQRPELARETRDRGHGVYSHTYTHDYAIYRSFDAYYEDLALMERAY
FT                   ERVLGEEAPSLVRFPGGSSNHSSIEYSGESFMVELTEDILDRGYDYIDWNVSSGDASAI
FT                   YDDPDAMFEQIVNQSQGHDVIVPLFHDTPRNEATAEILPDVITYFQEQGYSFYTLDNLE
FT                   VHEIRQMEENRIMNRDVVR"
FT   gene            complement(377276..377851)
FT                   /locus_tag="Bsel_0363"
FT   CDS_pept        complement(377276..377851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0363"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: scl:sce3690
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97903"
FT                   /db_xref="GOA:D6XWR1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH97903.1"
FT                   /translation="MPALETKAKELIFNTLSQSWAKSKHRRVVYHLKANDKILDIGAGK
FT                   GALSWMLLEQGFDVTPVDVQNISFTEKVKPVIYDGETLPFPDNSRDVGLFLTVLHHTPD
FT                   PEALIREALRVCDRLIIIEDVYHGKAQKYATWFTDSLFNLEFKGHPHTNKNNFGWLKTF
FT                   ADLDLRVLHIEKEPVLGLFEQVTYYVTK"
FT   gene            complement(377944..378927)
FT                   /locus_tag="Bsel_0364"
FT   CDS_pept        complement(377944..378927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0364"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: Os07g0143000;
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97904"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR2"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH97904.1"
FT                   /translation="MTAIRKRTLGNTEIRISPIGLGCWQFSNGNGLVGKFWPDMEQSAI
FT                   NKVVRESLDGGINWFDTAEVYGKGNSERALNDALDAVQKEDEEALIATKWWPAFRRSSS
FT                   IINTFEERRIALGGRHVDLHQVHQPFSFSSPADEMHAMADLMDEGKIGSAGVSNFNLKQ
FT                   MKEAHETLQERGYGLASNQVKYSLLDRRIEENGILDYAKEQNITIIAYSPLEQGILSGK
FT                   YHRNPDLVKKIQGPRKLAPNFRPKGMKRTEPLITLMRRLAEDYDVSPTQIALNWLIHQH
FT                   GDTVVAIPGASKTHHATENIRTMQFELSSTDLFALDQMAKRVVEKQ"
FT   gene            379087..379863
FT                   /locus_tag="Bsel_0365"
FT   CDS_pept        379087..379863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97905"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97905.1"
FT                   /translation="MFWNDPRRVVKRKGRRYKRPFEKMYLYPLPVDIHGRDYYLMDYVR
FT                   MRRPVASAVFSDEEEAPNDVKRAHKFLYTFYRLVEHIQEDNQMKAKVDLAFFRVPLKKM
FT                   DEAPHESLDEGYAYIDRLLTFQLKFRKIYEDFSGHYTAVQEKDRALTEEDLEIAVEAAS
FT                   DLDATQKVMLHELADGTGVLRTWRSAMEEQGLWTALTTNQQVFFQAFMENEAAMQEEAK
FT                   KTKHLTYEQLLKKNRQDFRQFRRQDQLNDFDVLRYP"
FT   gene            complement(379933..381363)
FT                   /locus_tag="Bsel_0366"
FT   CDS_pept        complement(379933..381363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0366"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: vpa:VP0503 sodium/alanine symporter; TIGRFAM:
FT                   amino acid carrier protein; PFAM: sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97906"
FT                   /db_xref="GOA:D6XWR4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR4"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADH97906.1"
FT                   /translation="MEATLIHTIILDGVNSLVDWGNNLLWTYILIGLLIGLGVYFTFAT
FT                   KFVQFRLFKEMFRVITEKKDGTNGISPFQAFTISTASRVGTGNLTGVALAISIGGPGAV
FT                   FWMWMVAIIGMATAFIESTLAQVYKVRDGDQFRGGPAYYMEKAIGSRALGVVFAILLTL
FT                   CFGLVFNAVQANTIADAFDGAFGFNPLYMGIVIAAVAGIVIFGGVRRIARVTQIVVPFM
FT                   AVAYLLIATYVVITNFALIPDVFMLIVSNAFGVGEIIGGGVGAAIMQGVRRGLFSNEAG
FT                   MGSVPNAAATANVSHPAKQGLVQSLGVFFDTIIICSATAFLILLTDVYTVDGAEGIQLT
FT                   QDAMSAHVGEWAVYFVAIAILFFAFISIIGNYYYGETNIEFIRSNSNWLYAYRFAVIGM
FT                   VIFGSVAQVGLVWNLADLFMGLMAVLNLIAIFLIGKVALAVLNDYTTQLDSGKNPVFKA
FT                   SHIPDLKHAECWEDEQSS"
FT   gene            complement(381567..383396)
FT                   /locus_tag="Bsel_0367"
FT   CDS_pept        complement(381567..383396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0367"
FT                   /product="UbiD family decarboxylase"
FT                   /note="KEGG: gme:Gmet_0993 carboxylyase-like protein;
FT                   TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97907"
FT                   /db_xref="GOA:D6XWR5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR5"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADH97907.1"
FT                   /translation="MFENMKACIEDLEKHGHLLRIKEEVDPHLEMASIHLKTYAAGGPA
FT                   LYFENVKGSKYPAVSNLFGTLERSKFIFRHTLEGVQKVIALRDDPMYALKHPLQNVSSG
FT                   FSAVKALPMKKPAHAIHDTHDEIQIEDLPQIKSWPKDGGAFVTLPQVYSEDPDKPGPMN
FT                   ANLGMYRVQLSGNDYKMNEEVGIHYQIHRGIGIHQSKAAQRGEPLKVSIFVGGPPAHTI
FT                   ASVMPLPEGLSEILFAGLLSGRRFRHTYIDGYCVSLDADFVITGEIYPDETKPEGPFGD
FT                   HLGYYSLTHEFPVMRVHKVFARRDAVWPFTVVGRPPQEDTSFGDLIHELTGEAIKSEIP
FT                   GVQEVHAIDAAGVHPLLFVIGSERYTPFDEVDRPQELLTIANRVLGTNQLSLAKYLWIT
FT                   AEKDQPLDTHDEAGFMQYILERLELRRDLHFQTKTTIDTLDYSGEGLNEGSKVVLAAYG
FT                   KQRRELAKVIPDSLKDVTAPFTNANLVMPGIVAVEGPAYGHADKAKTDMETLSKSLSAA
FT                   RDLDGVPMIVVVDDASFTSATLNNFVWVTFTRSNPSHDMYGVNEAIVNKHWGCDAMIID
FT                   ARRKPHHAPPLIADPETEQNVAAFFDRMAKGEY"
FT   gene            383591..384643
FT                   /locus_tag="Bsel_0368"
FT   CDS_pept        383591..384643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0368"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; protein of unknown
FT                   function DUF59; KEGG: mca:MCA0052 mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97908"
FT                   /db_xref="GOA:D6XWR6"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR6"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADH97908.1"
FT                   /translation="MLTEQQVLDALKPIKDPHLGVGLLDLDSVKDLKIKENLVSLKLAI
FT                   AEPGTAEQMQLQQEVVNAVKTAGAESVGLRFEKLPDEVLAEHGGQSEEAASESLLDRTD
FT                   RTTFIAVTSGKGGVGKSTVSVNLATSLARQGKKVGIIDADIYGFSVPDMMGIEERPKVV
FT                   GQRIYPVTRFDVQVISMGFFVEDNSPIIWRGPMLGKMLNNFFSEVEWDDLDYLILDLPP
FT                   GTGDVALDVHSMLPTSKEIVVTTPHATAAFVAARAGAMALKTDHEILGVVENMAYFESK
FT                   VTGEKEYVFGTGGGQKLAEELHSEVLAQIPLGQPDFDEEVFAPSVYDQEHPIGKIYMDM
FT                   AKQVIEKTAK"
FT   gene            384774..385445
FT                   /locus_tag="Bsel_0369"
FT   CDS_pept        384774..385445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97909"
FT                   /db_xref="GOA:D6XWR7"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97909.1"
FT                   /translation="MAVNARKVVFLFWSTLLIGTVAGTIIGLIQGIGGYFMVIVTAALW
FT                   TVIAQMGFFAYLTIHRFGLGMFKSVSLWNKVQLVIIAFAFFDLMFFRHYFFATDDETML
FT                   GYAIMPTLLLVYALIVAYLKAKDTNRHAFIPALFFMYVVTMIEWIPAFTGNDLNFIINA
FT                   VVPLLVANTWQLLVLHRLHEMPNGRQPTVEQWSKWEKEGFEERKREKETKKNRKKARKN
FT                   A"
FT   gene            385515..385630
FT                   /locus_tag="Bsel_R0026"
FT   rRNA            385515..385630
FT                   /locus_tag="Bsel_R0026"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            385639..385713
FT                   /locus_tag="Bsel_R0027"
FT                   /note="tRNA-Asn1"
FT   tRNA            385639..385713
FT                   /locus_tag="Bsel_R0027"
FT                   /product="tRNA-Asn"
FT   gene            385715..385790
FT                   /locus_tag="Bsel_R0028"
FT                   /note="tRNA-Thr2"
FT   tRNA            385715..385790
FT                   /locus_tag="Bsel_R0028"
FT                   /product="tRNA-Thr"
FT   gene            385816..385890
FT                   /locus_tag="Bsel_R0029"
FT                   /note="tRNA-Glu1"
FT   tRNA            385816..385890
FT                   /locus_tag="Bsel_R0029"
FT                   /product="tRNA-Glu"
FT   gene            385895..385969
FT                   /locus_tag="Bsel_R0030"
FT                   /note="tRNA-Gln1"
FT   tRNA            385895..385969
FT                   /locus_tag="Bsel_R0030"
FT                   /product="tRNA-Gln"
FT   gene            386181..386744
FT                   /locus_tag="Bsel_0370"
FT   CDS_pept        386181..386744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0370"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: ank:AnaeK_2178 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-W
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2;
FT                   sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97910"
FT                   /db_xref="GOA:D6XWR8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR8"
FT                   /inference="protein motif:TFAM:TIGR02948"
FT                   /protein_id="ADH97910.1"
FT                   /translation="MDMLVKKLVLEVRKGNQEAYAELVDLYKDQVYHIAYRMLGNMHES
FT                   QDIAQEAFLRAYMNLDSYDINRKFSTWLFRITTNLTIDRIRKRKPDFHLEDPLAGTDGM
FT                   DHHAHFAAEMPLPEEQVVQLEQQEWIQKEIMALPPKYRSAIILKYLEDKSLKEISEILN
FT                   LPVGTVKTRIHRGREALKKRLGSS"
FT   gene            386760..387416
FT                   /locus_tag="Bsel_0371"
FT   CDS_pept        386760..387416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0371"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: plu:plu3506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97911"
FT                   /db_xref="GOA:D6XWR9"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR9"
FT                   /inference="protein motif:COG:COG5662"
FT                   /protein_id="ADH97911.1"
FT                   /translation="MACSKEKTACIHKYLDEEMDLLEQRQFEEHVRSCEACDAHLSDLR
FT                   RTVAIVQSASHFQAPAQLTDAVMASLPKQKPAAKWKNWVRQHPFVITAATFFLVFMISL
FT                   SAGFGGDDQQIAVTGDGQFYIDDERRVVVVPEGEVIRGDLEIRNGDVEVLGEVSGNITV
FT                   INGEHLFASAGHVSGEIQEVNRFYNWLWHELKDLFRQVIPGGQDGEHEENAAPLL"
FT   gene            387688..388506
FT                   /locus_tag="Bsel_0372"
FT   CDS_pept        387688..388506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0372"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   pca:Pcar_0999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97912"
FT                   /db_xref="GOA:D6XWS0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWS0"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADH97912.1"
FT                   /translation="MFEDLTFWRLVAIVVDITLVAFVIYKLIMVIRGTRAVQLVKGITV
FT                   ILTVWFLSGYFGLHTLQWLMQQAVIYGVLAIIIIFQPELRRALEHLGRGKLFQSSSTAN
FT                   AEEIEEMIEHLIKSTNYMGKRRIGALISIERETGMNDYIETGVKLNANLTTELMTNIFI
FT                   PNAPLHDGAVVLQNGSIAAAGCYLPLSENPFISKELGTRHRAALGVSEVTDALTLVVSE
FT                   ETGAISMTKNGELHRNLDQDHLRKMLEKELMNKEEDKGTSRWQWGGRNNG"
FT   gene            388499..389803
FT                   /locus_tag="Bsel_0373"
FT   CDS_pept        388499..389803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0373"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: fimbriae-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97913"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX56"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADH97913.1"
FT                   /translation="MDKLFEKKWFIKVGSVAIAILLFLMVNSDGTTTTTGGLPGITDGS
FT                   RVIEEAQLNVYYDDENYVLTEAPETVQATLRGPQNVLTFSQVTQGQQEFFVDLTDKEPG
FT                   VHYERVQHRGFPADLSISIVPMTVRVVIQEQQTVSFPVEVDIENEGMIAEGYQVGEPVV
FT                   DPSTVDVRAGIGIVEQIAGARASVNVEGADNDVSGSFPVVFVDGNGTELELTANPAAVD
FT                   ITVPITAPNKTVPVRIGREGELDEGLAIDDISFDPSEVTIYGPVDVINDISFIDLDPLD
FT                   LSGLDGSVVTEKDVIVPQGVESVDPETVDVSVDVVEESERVFQDYEIIVENESDEQNVT
FT                   FVEPDGGMFDLTVSGSDELLQRLERSDIQASIDVEDLEAGEHEVTVTFDGPQHLRFVDE
FT                   GLTVVIEIGNGDITASNSETNDEEEEDETPESDSS"
FT   gene            389901..391262
FT                   /locus_tag="Bsel_0374"
FT   CDS_pept        389901..391262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0374"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: pca:Pcar_1001 phosphohexomutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97914"
FT                   /db_xref="GOA:D6XX57"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX57"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADH97914.1"
FT                   /translation="MGKFFGTDGVRGIANKELTPELAFKLGRFGGYVLTKETEKPKILI
FT                   GRDPRISGPMLESALIAGLLSMGAEVMRLGVITTPGVAYLTKALSADAGVMISASHNPV
FT                   EDNGIKFFGPDGFKLVDEQEEEIERLLHQEDDMEDDLPRPVGGEIGTVSDYFEGGQKYL
FT                   RFLKQTLSEDFSGLKIAIDCAHGAASSLANHLFADLEAEDIFCIGSSPNGVNINAGVGS
FT                   THPEGLVDLVKEKGADIGLAFDGDADRLIAVDEKGNIVDGDQIMYITAKYLRDNGRLVD
FT                   DTVVSTVMSNLGFYKALEEAGIQTKQTAVGDRYVMEEMRKGNYSLGGEQSGHIIFLEHS
FT                   TTGDGLLSGIQLVQIMKATGKTLSELASEWSHYPQKLVNVRVADKHALHNNDVIADEIR
FT                   AVEQGMNGEGRILVRPSGTEPLVRVMAEAPSREKCEEIVDGIVGVVKRELGSIE"
FT   gene            391399..391773
FT                   /locus_tag="Bsel_0375"
FT   CDS_pept        391399..391773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0375"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: vha:VIBHAR_07005 hypothetical protein; PFAM:
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97915"
FT                   /db_xref="GOA:D6XX58"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX58"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH97915.1"
FT                   /translation="MVNFHDKKPIYLQIKEKIETLIVHDQLRPGERIPSTNELVQLYKV
FT                   NHLTVAKGINLLVEEGLVYKKRGVGMFVEEGAKETVQGTRKEAFKEDYLLPMLEEAEKI
FT                   GMSEEEIIHMIRIWKERDGQ"
FT   gene            391770..392636
FT                   /locus_tag="Bsel_0376"
FT   CDS_pept        391770..392636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0376"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sde:Sde_3524 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97916"
FT                   /db_xref="GOA:D6XX59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX59"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97916.1"
FT                   /translation="MIEVEGLTHRFKKESALQDISFAMEKGRTYGLIGRNGAGKTTLLS
FT                   ILASFLPKQEGTYRYKGEDPFEQQALMREIQFVYQRDYSDETDKVTDYVKLYGRYLPRF
FT                   DEERALSLLKGFGVPLDKAIHSLSTGKQSAFTICLGLASQSEVLIFDEAYQGLDAPGRE
FT                   RFYQLLVEEQERDPKLIILSTHLVSEMDYLFDHVLILDRGELVVNEPAEAFRDRGVTVT
FT                   GHKDTIAAFVEGKQVIQRRELGPTVACTLFDRPDEEELREMKEAGIEISAVSLQDLFIF
FT                   MTEEEEV"
FT   gene            392633..393361
FT                   /locus_tag="Bsel_0377"
FT   CDS_pept        392633..393361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97917"
FT                   /db_xref="GOA:D6XX60"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97917.1"
FT                   /translation="MSSVNTAIQKKVGVDLFSMQMRWAYWLIGVVWFLYLTGSFFSGTL
FT                   QDFILLHFMDSLFQPAKIFMFVIGIISGVYLMPLFVQLGVTRRNYFIGATVATFLVSGV
FT                   IMLFGMLLHTVTMGLTAVTPLTAGGGVVDFLPDELFLGWRFVIFTLIAAVYYGTGWLIA
FT                   IGFYRFKTWVGMLTIPAAIFFNVITELFWDSGLNIWLFFWIEADFSGSLPVSFVATVLI
FT                   LGVLYGIIRKLTADVAIKVK"
FT   gene            393868..395673
FT                   /locus_tag="Bsel_0378"
FT   CDS_pept        393868..395673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0378"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: gbm:Gbem_0090
FT                   glucosamine--fructose-6-phosphate aminotransferase,
FT                   isomerizing; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97918"
FT                   /db_xref="GOA:D6XX61"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX61"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADH97918.1"
FT                   /translation="MCGIVGYAGTAAANEILLKGLERLEYRGYDSAGIALVNGDGVHVY
FT                   KEKGRIAILRDSMDQAQPGPVGIGHTRWATHGAPSQVNAHPHQSRSGRFTLVHNGVIEN
FT                   YEYVQREYLADVEMVSDTDTEIIVQLIEKFANEDGMQTEEAFRKTLSLLKGSYATALLD
FT                   ELNPETIYVGKNKSPLLVGLADGVNVVASDAMAMLQVTNEFVEIMDGEMVIVTRDDVQI
FT                   KSVDGDTVTRDSYIAEIDSTDIEKGTYPHFMLKEIEEQPFTMRNIITKYKDENENIKLD
FT                   EHIRQAVLDADRIYIIAAGTSFNAGLVGKEMIEKIAQIPVETHIASEFLYNMPILSQNP
FT                   LFIFISQSGETADCRGVLVNVKELGHKTLTITNVPGSTLSREADYTLHTYAGPEIAVAS
FT                   TKAYTAQMAVLAILSVDTARAKGIEIDFDPMQQLGIVANAMDIFMEKKDELEQMARDYL
FT                   SVTRNCFYIGRGMDYHVCMEASLKLKEISYIQAEGFAGGELKHGTIALIEEGTPVVGLA
FT                   TQESVHLNLRGNMKEVVARGANPLMISMEGFEEADDKIVIPRVHELFTPLVSVIPMQFI
FT                   AYYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            395830..396801
FT                   /locus_tag="Bsel_0379"
FT   CDS_pept        395830..396801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0379"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01961 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97919"
FT                   /db_xref="GOA:D6XX62"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX62"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH97919.1"
FT                   /translation="MNEDTKEEINMHRIAGHHHISMITKRAIPNNRFYQEVLGLRRVKV
FT                   TVNQDEPSMYHLFYGDKTGSPGTELSFFEIPKVGRTYRGTNAITRIGLLVPSEASLRYW
FT                   EARFDTHGVTHDGITTYAGHRALPFEDPEGLRLVLLLSNGQKVDHWETWSESDLPDRHQ
FT                   IQGMGSVEMTVRDLDALADTLTGLFGYTEVSRTDQEAVFQSVEGEVFGEIVGVEQDGPA
FT                   EKPGRGSVHHLAIRVQDDEALAYWEEKVREWGFQTAGIVDRYYFKSLYFKETNGIVFEI
FT                   ATDGSGFAIDGNGATLGEQLDLPPFLEGRRKEIERKLTPFFE"
FT   gene            396964..397491
FT                   /locus_tag="Bsel_0380"
FT   CDS_pept        396964..397491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97920"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97920.1"
FT                   /translation="MKRWTLGLFLIALTGCAANAEDPSYVIATLDGETITMEDYFFRYT
FT                   DPSMIEEYLKERVMIKEAEDLGITVSEDEVNASRQMLFPDSDAEERLAFWEDRAFIDEQ
FT                   AERLDMDELAYFKEWEEKMYRSQLFVDAYVEEVFGGFPEDTDEMQALGEEIDAHIDTLF
FT                   DTYQEEYRLEME"
FT   gene            397517..397741
FT                   /locus_tag="Bsel_0381"
FT   CDS_pept        397517..397741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97921"
FT                   /db_xref="GOA:D6XX64"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97921.1"
FT                   /translation="MKKPVFLPIVAAVSTAAVLFGVGNATGIPYLTLEWGPGNLEITFI
FT                   PIIAGVAAGFLTERLIMKWRKVTVPGNGV"
FT   gene            complement(397808..399322)
FT                   /locus_tag="Bsel_0382"
FT   CDS_pept        complement(397808..399322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0382"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; short chain fatty
FT                   acid transporter; KEGG: ppr:PBPRA0142 putative efflux pump
FT                   component MtrF"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97922"
FT                   /db_xref="GOA:D6XX65"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX65"
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /protein_id="ADH97922.1"
FT                   /translation="MPQQKRGLFQRFLDMIEVAGNKLPHPVTLFAILTFIVIALSGILS
FT                   GISVEHPGEEGEMVQITNLMNAEGLQYMLSSMVDNFIGFAPLGVVLATMLGIGLAERTG
FT                   LISACLRGFVLSIPNVLITAGLVFAGIMSSVASDAGYVVLPPLGAVIFAALGRHPLAGL
FT                   AAAFAGVSAGFSANLLLSATDPMLGEMTIEAAAIVDPAYAEGMNIAMNYYFIAASVFML
FT                   TIVGAWVTEKIVEPRLGKYEGDYREELKGLDPIEKKGLRWAGLSLLIGIVLVLLTIVPA
FT                   NGPLRADDGQIIQSPFMDALVPIIAILFFIPGLFYGMATKNIKNDKDVANQLSDTMAAM
FT                   GMFIVLAFTAGQFVAYFGETNMGLVLGVYGAELLEAANLTGIPLILGFIFVAGFINLFI
FT                   GSASAKWAMMAPVFVPIMMHLGYSPEMTQMAYRIADSTTNIITPLMTYFAIIIAFAQKY
FT                   DKKMGIGTMISVMFPYSIIFMITWTIMLIVWMLLGIDLGPGSPITY"
FT   gene            complement(399484..400329)
FT                   /locus_tag="Bsel_0383"
FT   CDS_pept        complement(399484..400329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0383"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: dal:Dalk_5022 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97923"
FT                   /db_xref="GOA:D6XX66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX66"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH97923.1"
FT                   /translation="MALFLGLITAMAFGIGDFLAGQVTRRVPTLIVVLYAQLFGTVMML
FT                   IVASLTGFHMSLSSFWWGGLGGIAIGFGFLFYFKALAMGKMGVVSSVTGTLSAVVPVLT
FT                   GLFLGERPGTFALVAVGIIMIAIVLISKKEVEGDAEDGDGQKVLSFAAMAGFLIGLYFV
FT                   FLHIPPETESMWTVFFTMAGSFLAVSSVLLFRRADFLTLNRTGLGYIFGNGFLQAFGTI
FT                   TYILGVSIGLLSIVALAGALSPLFTVLCAWLFIKEMLTVPQKWGITLALTGVVLLVLST
FT                   "
FT   gene            401001..401483
FT                   /locus_tag="Bsel_0384"
FT   CDS_pept        401001..401483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97924"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97924.1"
FT                   /translation="MSIFTRAEQKIMMRNMKKGYRAKQIGEKERAFEPWLLVWLMLKNR
FT                   LRERGKTLTSFNEEWEEEGELAQWLEDALDLFDRTDPEVAKQIAREAAELGIQEDSRLG
FT                   ERIRELLSSDEADPPESKGQAQQNPDHEAKNEIFDLQRKLAEAINTDVDHNHKKDR"
FT   gene            401488..401643
FT                   /locus_tag="Bsel_0385"
FT   CDS_pept        401488..401643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97925"
FT                   /db_xref="GOA:D6XX68"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97925.1"
FT                   /translation="MTANRGRFLIVAGVLAGLSAGYLTGNMAEGVLIGTGLGLFMLAVA
FT                   KKNRQA"
FT   gene            complement(401794..403983)
FT                   /locus_tag="Bsel_0386"
FT   CDS_pept        complement(401794..403983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0386"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="KEGG: aeh:Mlg_1522 catalase/peroxidase HPI; TIGRFAM:
FT                   catalase/peroxidase HPI; PFAM: Haem peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97926"
FT                   /db_xref="GOA:D6XX69"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX69"
FT                   /inference="protein motif:TFAM:TIGR00198"
FT                   /protein_id="ADH97926.1"
FT                   /translation="MDEQKKMNSQGMCPVMHGGATSPTRGGTANQEWWPNQLNLDILHQ
FT                   HDKKTNPFDEDFDYKEEFKKMDYFAMKEDLKKLMRTSQDWWPADYGHYGPLFIRMSWHA
FT                   AGTYRTGDGRGGGGTGTQRFAPLNSWPDNANLDKARRLLWPIKQKYGNKISWADLLVLA
FT                   GNVAIEDMGLPTYGFGAGREDVWHPEEDIYWGSEDEWLGDNRYEGTRQDLENPLAAVQM
FT                   GLIYVNPEGPNGEPDPLKSGEDIRETFKRMGMNDEETVALTAGGHTFGKSHGAGDAAHV
FT                   GPEPEAAPVEEMGLGWKSAHGSGKGSDTITSGIEGAWTPTPTTWDNTYFELLLGYEWEL
FT                   VKSPAGAYQWQAIDVKDEHLAPDAEDPSKKVKTMMTTADMAMKMDPEYRKISERFYNNP
FT                   KEFGEVFAKAWYKLLHRDMGPKSRYQGPEVPEEDLIWQDPVPAGNYDLTEADIKELKDA
FT                   ILNAGLSTSELVKTAWGSAVTFRGSDYRGGANGARIRLEPQKNWEVNEPEQLDKVLKVL
FT                   EDVKAKSSKDVSLADLIVLGGTAAVEKAAKEAGVDLTVPFTPGRGDASEEQTDAESFDV
FT                   LEPIADGFRNYLKKEYAVSAEELLVDKAQLLGLSATEMTALMGGMRSLGANYQGSDLGI
FT                   FTDKTEELNTDWFRNLVDMNIEWKPVDHYVYEGHDRKTGDVVRKASRVDLAFGSNSMLR
FT                   AIVEVYAQDDNKEKFVKDFANAWVKIMDNDRFDVK"
FT   gene            404378..405109
FT                   /locus_tag="Bsel_0387"
FT   CDS_pept        404378..405109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97927"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97927.1"
FT                   /translation="MAVIWEHKWKILLGVALAITAIIWLLLRSYPAGSLADDAMAGEWS
FT                   DVKDENGAIRFIAEGEPLGHVMYYPGGLVRPESYSYLASQLAEAGVETWVIPMPLNLAV
FT                   LGISRGEQALGLIGGSPVVIGGHSLGGAMAARFAKDHEDQLDGVFFHGAYPDEGGRLDG
FT                   TSLSVLSIQMEEDRVLNSESYEEGLGYMPDAFFEEWIEGGNHASFGDYGPQRGDGEATI
FT                   SHEEAVEQIVDLTVDWLESLQ"
FT   gene            complement(405189..406739)
FT                   /locus_tag="Bsel_0388"
FT   CDS_pept        complement(405189..406739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0388"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="KEGG: azo:azo0770 alkyl hydroperoxide reductase
FT                   subunit F; TIGRFAM: alkyl hydroperoxide reductase, F
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97928"
FT                   /db_xref="GOA:D6XX71"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX71"
FT                   /inference="protein motif:TFAM:TIGR03140"
FT                   /protein_id="ADH97928.1"
FT                   /translation="MVLDNAITQQLKQYLDLLEGDLTFKLDAGSDANSDKLAGFVREVA
FT                   SMSPRITVEEASLARTPSFTVTRTGENTGVTFAGVPLGHEFTSFVLAILQVSGRPPKVE
FT                   EETLNQMKQLEGDFTFETYVSLSCQNCPEVVQALNMLSAVNPGVTNTMIDGAAFKDEVE
FT                   ARDVMAVPAVYLNGEFLGGGRMTIEDILEKLGQGTDASELDAKDPFDVLVVGGGPAGAS
FT                   AAVYASRKGIRTGVVAERFGGQVQDTMSIENFISVKKTEGPKLVASLEEHVRDYSVDIM
FT                   KSQRVKAVDKKDLFEVTLENGAVLKSKSVILSTGARWRNVGVPGEEAFKNNGVAYCPHC
FT                   DGPLFEGKDVSVIGGGNSGVEAAIDLAGIVNHVYLLEFMPELKADEVLQKKLHSLPNVT
FT                   VITNAQTTEITGDKKVNGISYKDRVTEEDRHIPLQGVFVQIGLVPNTEFLDDSIETTRM
FT                   GEIVVDQHGATNVPGLFAAGDCTNTPYKQIIISMGSGATASLGAFDYLIRSEEPVVSV"
FT   gene            complement(406758..407321)
FT                   /locus_tag="Bsel_0389"
FT   CDS_pept        complement(406758..407321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0389"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="TIGRFAM: peroxiredoxin; KEGG: ara:Arad_8451
FT                   anti-oxidant protein; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97929"
FT                   /db_xref="GOA:D6XX72"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX72"
FT                   /inference="protein motif:TFAM:TIGR03137"
FT                   /protein_id="ADH97929.1"
FT                   /translation="MSIIGTEVQPFTAQAYKNGDFVEVTEENFKGQWTILCFYPADFTF
FT                   VCPTELEDLQNEYETLKNLGVEVYSASTDTHFTHKGWHDSSETIGKIEYGMIGDPSQTL
FT                   SRQFDVLNEESGLADRGTFIIDPDGVVQAAEINAEGIGRDASTLVNKIKAAQYVRNNPG
FT                   EVCPAKWEEGDETLTPSLDLVGKI"
FT   gene            complement(407692..408138)
FT                   /locus_tag="Bsel_0390"
FT   CDS_pept        complement(407692..408138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0390"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: dno:DNO_1109
FT                   OsmC-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97930"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX73"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADH97930.1"
FT                   /translation="MMAKATFKATTQLHEGTKVTAKTRNFTLTIDEPESLGGTDTGMNP
FT                   VEAVLCALGACQAIVARVYAPKFDISFTDLWLDVEGDLDPDGFMNKADVRPGYSEIRYT
FT                   MHIKTDAPKDKVDEFVRFVESKCPVGDSLENNVSMKLADVVIES"
FT   gene            complement(408205..409398)
FT                   /locus_tag="Bsel_0391"
FT   CDS_pept        complement(408205..409398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97931"
FT                   /db_xref="InterPro:IPR025466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97931.1"
FT                   /translation="MNKKDIAHIKKQFKPNNDLMTISDIFNVYIMKDTSEIYHYEAMPF
FT                   DLLEDEQKELFLANFKKVLTGQADEKLFELKFRRDVSNSTQMILHQGLLSAETESWTDE
FT                   MLKIVAKMLHEKTYEMDLVITFIRGTYMKPVKQSADITSEESDRDSVYAHGFILCSINK
FT                   TEDPKKELLFDYVEKEFKYNILVDPVINLKAPISGFLFPCFNDGAADVNHVLYAAGKAH
FT                   EPNYPFIEDVLNAEEVTTAQEDKIIFEEIVKSAVGKPMSTSTLSNVYEEINRVVEENED
FT                   DEPPRLDSKDVEDVLRISGVEDVDTEKVEAAFEEIVDDRQYAFKATSVMPKYQSKSIKI
FT                   KTKAADLSVSPEDLRFLRQVEIDGRIYLMLEVPEAARIEGFDMIPEALFTKVESEED"
FT   gene            complement(409509..409907)
FT                   /locus_tag="Bsel_0392"
FT   CDS_pept        complement(409509..409907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0392"
FT                   /product="cytidine deaminase"
FT                   /note="KEGG: bch:Bcen2424_6241 cytidine deaminase; TIGRFAM:
FT                   cytidine deaminase; PFAM: CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97932"
FT                   /db_xref="GOA:D6XX75"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX75"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ADH97932.1"
FT                   /translation="MDKEQLMQQARSIKQHAYVPYSKFPVGAAFLMTDDRVITGVNVEN
FT                   VSFGATNCAERTAMFTAMAEGYQKGDFKAVAVAGDTEDFLPPCAICRQVMAELCPPDMP
FT                   IYLTNAKGEISTHTLREILPLAFTDLDM"
FT   gene            complement(410001..410582)
FT                   /locus_tag="Bsel_0393"
FT   CDS_pept        complement(410001..410582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0393"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: apa:APP7_0893
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97933"
FT                   /db_xref="GOA:D6XX76"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX76"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH97933.1"
FT                   /translation="MSRRTDRRVQYTRSVIEESFLTLLEQKPLHSITVKALCSEADINR
FT                   STFYSHYKDIHDLLEGIQKRIMEDVEAMLNAFDYTKDDEALAMTTSLMRYLKENRRNSR
FT                   IIFSDHGDPDFQRRVIYRVHRHLLQSFFRDHVKDTPINPDHLSTFVIHGSIAVVHSWVR
FT                   NNMEESPEVIAWMIANFTNHGISAVGLQTP"
FT   gene            410721..412781
FT                   /locus_tag="Bsel_0394"
FT   CDS_pept        410721..412781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0394"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: cja:CJA_3753 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97934"
FT                   /db_xref="GOA:D6XX77"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX77"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ADH97934.1"
FT                   /translation="MQKFTEIITHYHKSVVLVFMALTILSAVMIPFVTVNYNINDYLPE
FT                   DSPSMVAVDVLEEEFGSPMQNARVMIEDVSVQEALTYKDRLEAIEGVSDVTWLDDVVDL
FT                   RTPLELVDEGMLETYYQDRYAIIEMTIQEGEELAITDEIYELIGEENALVGDAIDTAVS
FT                   QQMAFTETLFAALLLVPIIIIILILSTTSWVEPLFFLTAIGVSVLINLGTNIFIGEVSF
FT                   VTNSVAPILQLAVALDYAIFLLHSFSDQRKTDSNPVTAMQKAVRQSFPAIAASAATTFF
FT                   GFMALAVMEFEIGADLGLNLVKGIALSFISVVVFLPALTVWLFKWIDKTQHKPMFPQFR
FT                   NVGKRVVKVRYFSIVLVALIIFPAYLAQQETSFIYGIGEQPEDTRLGADEVKVNEVFGQ
FT                   STPIVLLVPRGDVPRELSLEQDLLAIPEVDSIMSYNELIGSMIPQEHLDESMTEAFLSE
FT                   NYSQLILYTETESEGDEAFAVVEEVKSYAGAYYGDGFHALGESVSLYDIKDIVLDDNRA
FT                   VNIMTVIAIGAVIMVTFRSLLLPVILLVTIQSSVWINLAVPYVTDTPLVYIGYLVVGTV
FT                   QLAATVDYAILFTENFMENRKRMPARAAIIDTVNNKTFSISISAAILSSVGFILFLTST
FT                   NPIIGSIGLLIGRGALLAFLMVLFLLPAILLVGDRLVEKLTYKTDFYKERD"
FT   gene            412784..414625
FT                   /locus_tag="Bsel_0395"
FT   CDS_pept        412784..414625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0395"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: Axoneme-associated protein GASP-180"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97935"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX78"
FT                   /inference="protein motif:COG:COG1511"
FT                   /protein_id="ADH97935.1"
FT                   /translation="MNKWTAGLLAALILPPVYIGFADDTAHDNETPETSGTDGEVASKE
FT                   EVIYGNLNHDGSVTDLYVVNMLDVTSAGRIVDYGNYDSVQNLTSLAEIQIDGDEISAEA
FT                   EEGWFYYQGNKDGATLPWAMDITYTLDGEEVDAGDLAGADGHLHLSLTTEANDGVNPSF
FT                   YENYTLQVSVSFDASVAGNIHAPDATVANAGKERQLSYTVMPETDGDIEFFADVTDFEM
FT                   NGIEIAAIPMTLAMEDPDTGEMVSELRDLSDGIAEIHDGVGELNDGVFELVDGLWTLTD
FT                   GSSDFLSGLREVDGSSGDLVHGSREIRDGLAQLDRELDVSEFDMDVDLNGFDELTKGLH
FT                   ELSGGLEELSGGLGLLGDQYEEARKALDEAVKAIPEEVPSEEAIKALYMTTEDHETLDS
FT                   LVDQYAAAQRVKQTYDAVSGAFDAVTGTLGEAVKGLDESVTGLRTMASELEASLASFED
FT                   LEDPEALEGLRELERGIGELSSNYHAFHDGLVSYTGGVGELAGNYRDLDDGVSEAADGT
FT                   RELGDGTDELYDGTGELEENTRDLPDQIQDEVDELMAEYDKSDYEPVSFVSERNEQVSV
FT                   VQFVLRTDAIELPDDEDGELAEEDEENWFDRIMNLFS"
FT   gene            complement(414718..415263)
FT                   /locus_tag="Bsel_0396"
FT   CDS_pept        complement(414718..415263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0396"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   asa:ASA_3441 ribosomal-protein-serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97936"
FT                   /db_xref="GOA:D6XX79"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX79"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97936.1"
FT                   /translation="MFYHQLDEDTELRILELRHAEPLYLITEHSRRHLRTWLPWVDDIY
FT                   QPGDSRKFIEMGLKQFVSQDGFHAGIWYKGQLAGVIGLHGIHWGNRSTSIGYWLGDGFE
FT                   GKGIMTKACKALIHHCFHDLNLERIEIRAASRNTKSRAIPERLGFQEEGRLRHAEFLYD
FT                   HFVDHIVYARLKSDEADI"
FT   gene            complement(415281..416096)
FT                   /locus_tag="Bsel_0397"
FT   CDS_pept        complement(415281..416096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0397"
FT                   /product="Aminoglycoside N(3')-acetyltransferase"
FT                   /EC_number="2.3.1.81"
FT                   /note="KEGG: hypothetical protein; PFAM: aminoglycoside
FT                   3-N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97937"
FT                   /db_xref="GOA:D6XX80"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX80"
FT                   /inference="protein motif:PRIAM:2.3.1.81"
FT                   /protein_id="ADH97937.1"
FT                   /translation="MTNEIHASTVLNTVDTLTRDLKINGIEEGDLLLVHASLSALGWVN
FT                   GGSAAVIGALITAIGPDGTIVMPAQSGDLSDPSEWEAPAVPQAWWQTIRDTMPAYDPAI
FT                   TQTRGIGTIAEHFRTWPGTDRSLHPALSFSARGPLARTVLHPHPLACGLGEDSPLGRLY
FT                   EHGAKVLFIGNGYDANTCFHLGEYIAPSPPMIEKGAPVLTDGVRQWITYEEVDLDEEVF
FT                   EEIGRTFEETYPVHTGKIGDATAKVFALRDAVDASTTWFTAHRQTQTAD"
FT   gene            complement(416103..416786)
FT                   /locus_tag="Bsel_0398"
FT   CDS_pept        complement(416103..416786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0398"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   ppd:Ppro_0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97938"
FT                   /db_xref="GOA:D6XX81"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX81"
FT                   /inference="protein motif:PFAM:PF02586"
FT                   /protein_id="ADH97938.1"
FT                   /translation="MCGRFSLYHQPNLIARRFELDNLEAIALDPRYNIAPSQDILAIVH
FT                   DGKTNRAGFLRWGLIPSFAKDPKIGSKMINARAETLYEKPSFAKLLTRRRCIIPANGFF
FT                   EWQKTETGKVPMHIQLRDGEPFAMAGLWDRWQDEGGETITSCTIITTEPNTLMAPIHNR
FT                   MPAILTRDQEAIWLDRRETGTDRLKSLLTPFDSRQMTATAVSSLVNSPKHDSPTCIAPI
FT                   PNETE"
FT   gene            416939..417958
FT                   /locus_tag="Bsel_0399"
FT   CDS_pept        416939..417958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97939"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX82"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_4664"
FT                   /protein_id="ADH97939.1"
FT                   /translation="MQAMELTKPVRLSLNDGTLNPESAGWARHPIVTSNLSGASMRKKK
FT                   WNYWCITSDDILFSATISHIDYAASLFVYLYDRHTGEFVEKTVTVPFGIGVRMPEEVRA
FT                   PLFVDRSGFTIRFLEKPDATELFVNIRDFGGKPLDAYVEIARPKGYESLNVVIPWSESH
FT                   YQYTSKQPALPAFGTVEWGGYRHHLDKRNQSFACLDFGRGKWPYRSSWNWGSASGRDKD
FT                   GRVIGLNLGGKWTDGTGQNENGIVVDGVLCKIHEDLDWDYDPSDLMRPWTIRDKGNETV
FT                   TLTFYPSFERLAETNLGVIQSKVHQMFGHYEGTVMTDGAGTVQISDLFGWAEDHHAKW"
FT   gene            complement(418008..420221)
FT                   /locus_tag="Bsel_0400"
FT   CDS_pept        complement(418008..420221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97940"
FT                   /db_xref="GOA:D6XX83"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97940.1"
FT                   /translation="MTIRLKVKHLVYSLLAFLALFAVVLLVFEPKLHEWQIDRQIASGQ
FT                   EDGAREQILDRIVRNQTASTGLIETYMITPLSEDASSLTISPASTSWSTSDTPVLFTLE
FT                   EAAPYLKTYLEEGEDTIHLLSAADLLMRHDQTNGDPEGVLETMETASERQTAYPAHQTD
FT                   LTFDAIGILIEMNEHELARSILNACEDTFDSGDAALRSAILHARMDLYEEDYEEAHALL
FT                   QDAMERYEAHHDEQETAHAESQNGYEPFNLDQAVYFQEAKRLHERLEPLEEGRHNGTVE
FT                   GRVTGADGEPLAHTRVFLQEDAQRDRSLNRESALATKTDGDGYYRFDGVIPDDYLPFVM
FT                   LSMDEVSGSAWPVDANEVIRVEDGDTATYDITFTPLIEQHEPINHDEITDDTITFSWED
FT                   VDGAAFYSLELTVHHDGGSMTQSVETDITSNRHTIETDALYDRTFGVMSDPEDDELIQP
FT                   ETILAFSYPDGEFSWNVRAFDEDRSPIAQSNGYRLDEDAMGQLPFFRLDTRTLTNADRR
FT                   LLDEDVPGALEAYRNAYADDPEDAHSLRMLTRLNGFSESRAEETMMYRRQLHDVAPSIA
FT                   NVSELLRHTMREGDLTEASRWKEAYLDLLEEDEPNELENGRFALINAFEGEFDQAQERL
FT                   AQSVDADSYNRFSGARAVVALASGQGLDEALAIVRQNPERTRSNLAAENWERHLEHLEG
FT                   MEEDFLQEAAQAMLTRDQDAIDVLTDEHPSLSSLTDAWQDRDW"
FT   gene            complement(420218..420523)
FT                   /locus_tag="Bsel_0401"
FT   CDS_pept        complement(420218..420523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97941"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97941.1"
FT                   /translation="MMNDDQKPAVRQALDRELQHETFHGHDAVLKRTHPVTWKDRLANV
FT                   WNKEVRIPVVPLGAALFLLITSGTTIAVPGDEPERELIERGGSYYWHDLFEEEDSS"
FT   gene            complement(420520..421065)
FT                   /locus_tag="Bsel_0402"
FT   CDS_pept        complement(420520..421065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0402"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: bbt:BBta_3011 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: Sigma-70 region 4 type 2; sigma-70 region 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97942"
FT                   /db_xref="GOA:D6XX85"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX85"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97942.1"
FT                   /translation="MDYKTQLQQGDESALKALMDAYGPLLKRTAVLLVKDRQLAEEVVQ
FT                   DTFITAFRKSHQLSSNDKIKGWLVTITLNGCRSRMRTWNWRHLFPAKDETAFDQLEETA
FT                   LLPEAQLLAAIEEQRVHKAVQALPYSYREPITLYYFHDMTVDELAGVMNTKQNTVKTRL
FT                   ARGRALLKNELSKGGDDR"
FT   gene            421405..421974
FT                   /locus_tag="Bsel_0403"
FT   CDS_pept        421405..421974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0403"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="KEGG: eba:p2A138 UbiX related subunit of putative
FT                   (de) carboxylase; TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97943"
FT                   /db_xref="GOA:D6XX86"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX86"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ADH97943.1"
FT                   /translation="MTKRIIIGMSGSTGPIYGIRLLEVLRDLGVETHLILSQWGEKTIT
FT                   IETDYTVDEVKKLASYVHPATNQAAAISSGSFKTDGMVIVPCSMKTLSAVAHGYADNLV
FT                   SRAADVVLKERRKLIMVPRETPLNDIHLENMLKLSRMGVVMMPPMPAFYNKPESIGDMV
FT                   DHTVSRLLDQLDIDNSLTRRWLEKED"
FT   gene            422534..423802
FT                   /locus_tag="Bsel_0404"
FT   CDS_pept        422534..423802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0404"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: neu:NE2190 integron/retron-type RNA-directed
FT                   DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97944"
FT                   /db_xref="GOA:D6XX87"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX87"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADH97944.1"
FT                   /translation="MQLIDRVVCPDNLNLAMNRVISNKGNPGVDGMTVDQLEAHVRQYA
FT                   KPLIAKIQKGTYQPLPVKRVEIPKENGKKRKLGIPAVRDRMVQQAIFQVIEPIIDPHFS
FT                   PNSYGFRPGKNAKQAIKQAAKYYDEGFKMVVDIDLKSYFDTIPHQKLMNYLEQYIQDPI
FT                   ILKLIWKFLKSGIMIGDNWESSRNGAPQGGNLSPILSNVYLHELDKELERRGHRFVRYA
FT                   DDFCIYVKSRRAAERVLLNTTTFLEGTLKLSVNQEKSAIGSPTKRKFLGFCIHKSNNET
FT                   RCRPHHAFKAKFKAKLKYLTRRNQANSFDYIILKINQVTTGWINYYGISYMKSFINSIK
FT                   QWLHHRLRQLIWKQWKKIKTRYKNLMKYGIETEEAWKMANTRKGYWRASKNETLHKAIK
FT                   IEKLAGWGLKDMSQLYERAYSTY"
FT   gene            423910..425313
FT                   /locus_tag="Bsel_0405"
FT   CDS_pept        423910..425313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0405"
FT                   /product="Glutamate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.4.1.3"
FT                   /note="KEGG: bov:BOV_0218 putative glutamate dehydrogenase;
FT                   PFAM: Glu/Leu/Phe/Val dehydrogenase dimerisation region;
FT                   Glu/Leu/Phe/Val dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97945"
FT                   /db_xref="GOA:D6XX88"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX88"
FT                   /inference="protein motif:PRIAM:1.4.1.3"
FT                   /protein_id="ADH97945.1"
FT                   /translation="MTVTDTQNMIRDIMDQLYDDESFLPEETGEIRKRLFESGKEILTT
FT                   TDKVIKSYIRVTRDDRSIERIPAFRVQHNNIAGFYKGGIRYNEVVNEQEVENLAVLMTL
FT                   KNALHELPYGGGKGGVVISPDQYSRRELYMIAKKYVQRFVRDIGPTHDIPAPDMGTDAE
FT                   TMDWMVGEYKTINPGENYLGSFTGKSVENGGARGRRESTGKGTYRSYLWLLDTWVRQTN
FT                   RNSVAEGLHRDQYDRMKRLIEKHDEGKAITLAVQGFGNVGAVAAEMAATCDRLNHRVTA
FT                   VSDQYVTLYHENGLDVRALAGYQRRMRHLPQTAEALEEAGIQAEVRDRDELIYLDVDVL
FT                   ILAAVEDVIHGGNVERIHADIIVEGANAPVDGTADRVLHEQGKVVIPDVLANAGGVMVS
FT                   YVEWKQDRVTELFSEEQVIREMYEQMEASCEKVFDSYFTDGLPGIRNSCYVQALKRLFI
FT                   LHYRHGKLY"
FT   gene            425476..426381
FT                   /locus_tag="Bsel_0406"
FT   CDS_pept        425476..426381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0406"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ppu:PP_1524
FT                   rRNA (guanine-N(1)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97946"
FT                   /db_xref="GOA:D6XX89"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX89"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH97946.1"
FT                   /translation="MMKGQWRRWGDHVNKKERGIRNLYAWNRLLSCPVCQGSVSVVPEG
FT                   RLVCGDGHSFDVARQGYVNVLTGAVNSAYSKELFHARAKVIQETPLYRALHKNVGKLMD
FT                   REAKKQDGVYRIGDFGCGEGSHLALLLEGRSNWMGAGLDLSKEGIQAATDHEDTPAVWL
FT                   AADLVNVPLKTGSLDVALTILSPSNYKEMKRVLKPGGLAVKVIPGPGYMKEIRDFFQQN
FT                   RRDAKENEALISRFEEAFDDVKAVSVKTAPAVTAPLRKELCRMSPLAWHAEEGEKERYE
FT                   KEGAARLTMDLVVLTGRLPQ"
FT   gene            complement(426338..426862)
FT                   /locus_tag="Bsel_0407"
FT   CDS_pept        complement(426338..426862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0407"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   kpn:KPN_pKPN3p05928 N-acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97947"
FT                   /db_xref="GOA:D6XX90"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX90"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97947.1"
FT                   /translation="MTDILIRPMTVQEWPAVSAIYQAGLDTELATFETVVPSWDSWNQA
FT                   HHETCRLIAEYGGTIAGWAALAPTSPRYAYRGVAEISIYIAPGASGLGVGRTLLNALIE
FT                   DSEKAGFWTIQSAIFRENQASIHLHKKCGFRQIGYREQVAERHGVWHDIILMERRSPIV
FT                   AASPSARPDPS"
FT   gene            426985..427734
FT                   /pseudo
FT                   /locus_tag="Bsel_0408"
FT   gene            427935..429953
FT                   /locus_tag="Bsel_0409"
FT   CDS_pept        427935..429953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0409"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: hha:Hhal_0549 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97948"
FT                   /db_xref="GOA:D6XX91"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX91"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH97948.1"
FT                   /translation="MKSIRMRLILYFSAIMIVATGILGIVITNGAGDALIDEAETGLET
FT                   LALEGAKVTDSRLDSEYLYLEGLTNLPEITGDDPDLDAAMDVLLDEVENTDYLRIGITD
FT                   LDGNLYLSDSYGIDGEIVDVTEREYYHDSLAGERGLMPPSLSVNPDDGDRLIMVTSVPI
FT                   EEDGAITGVLVAVGDADYLNTIVDDIQYGEGGYAYMIDDEGTVVAHRDRDMVRDAFNPL
FT                   RLVEEDPGLETLANQFSRMLSEPAGIGNYAFQGNDLYVGFSDIGETGWTLVITANENEV
FT                   LAAIPSLRNTALIMTFLVVVGGIALTYVVGTRISRPIQAVSRTAAEIGQLDMRHDMDLK
FT                   LLSRHDEVGELAKSLQSVTENVRKIIVDINASAGEVSAASEELTATSGESSRASEEVAS
FT                   TVQDIAEGASSQAQNTEAGSEKAARLGEIVDEEKEVVQRLNEAFVNVNHAIQEGLEEIG
FT                   RLSEISDQTAEATQEVEKGIVKTNDSSRRIGEASTVIANIAEQTNLLALNAAIEAARAG
FT                   EAGKGFSVVADEIRKLAEQSTTSTATIDEIVRELQVNAEQSVKVMADVSQILDEQLKSV
FT                   QGTRDKYEQIEGAMSISDEAVHRLNGTGKDMATIKEDIVSSLESLSAIAEENSAATEEV
FT                   SAAMQEQTASMEEIAGSSESLAHLATELKQLVEKFKI"
FT   gene            complement(430045..430923)
FT                   /locus_tag="Bsel_0410"
FT   CDS_pept        complement(430045..430923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0410"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: geo:Geob_1777
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97949"
FT                   /db_xref="GOA:D6XX92"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX92"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADH97949.1"
FT                   /translation="MLLYEQIQKNKRKTVLIVFVFILFLLAVGAAFSYINSGEPFSGMI
FT                   ITVIIAAIYVTIVLSSSTSMVMRMNHAKEIKSVEENRFLWHTVENMAMVARIPMPRVFI
FT                   VNDPSPNAFATGISPKNGAVAVTTGLMNELNREEMEGVIAHEVAHIKNYDVRLSTIALA
FT                   LVSVIAIISDLGMRMMFFSRGGRNNKQSPVILIIALVLVILAPIIAMMINMAISRNREY
FT                   LADASAADLTRNPNALATALEKITGVSTPVREASGSSAPLYFADPLKKKMSGLMSTHPD
FT                   PQERIRRLREM"
FT   gene            complement(430946..431500)
FT                   /locus_tag="Bsel_0411"
FT   CDS_pept        complement(430946..431500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0411"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: gbm:Gbem_2479 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97950"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX93"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ADH97950.1"
FT                   /translation="MIGLLIILAIVVIFVLAWVSAYNGLIKMRNWVEESWAQIDVQLKR
FT                   RYDLIPNLVETVKGYAKHEEETLTKVVELRNKMGDSTLSRQDTMEVNDQLSGALKSMFA
FT                   LREAYPDLKANENFKMLQEELTQTENKIAYSRQLYNNTVMKYNTKIESIPTNIIAGIHN
FT                   FEKRDMLEAKAEERENVRVSF"
FT   gene            431665..432879
FT                   /locus_tag="Bsel_0412"
FT   CDS_pept        431665..432879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0412"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: vha:VIBHAR_02870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97951"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX94"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADH97951.1"
FT                   /translation="MVQGMTGSFRLMKSLNRSLVINIIRRKGPISRTDISKQANLTPPT
FT                   VTNIVNDLLKEGLVKEGRTGASKGGRRPVLLSINYNNHYVIGVDVGTGQIRVGLSNLNA
FT                   ELLNRKKETLPAGIKAGEFMTILYRLVDDMITNSDVSRDKIVGIGIGMHGIVDEEKGIS
FT                   IYAPHFDFGELPLKERLEARYEIPVKVENDARCSAIAEMWFGDTRANPNLVFINVGDGI
FT                   GAGVILNGQIHRGHHHIAGELGHMIVDLNGRQCTCGSYGCLHTVASGIHIRERAIHEIT
FT                   LGRSTALREMRENKEDIDGEVIYEAALHGDEFAEELFAQAGRFLGLAVTNVINFLNPDQ
FT                   IVLGGGVMKAGAFVMKPLVETVNRRALTDDARKTEITVSSLGSHSALLGAVSLILHDVF
FT                   EVQDR"
FT   gene            433055..434440
FT                   /locus_tag="Bsel_0413"
FT   CDS_pept        433055..434440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0413"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mlo:mlr6435 ABC transporter sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97952"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX95"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97952.1"
FT                   /translation="MKAWKVLSVSALSVGLLAACGGNDEGDAGANNGENDSANNGSASA
FT                   NNDDANENNNAGDGDEDISGEVTAWGWNVAAAAMEQAIEGFNELYPNVTVNIEDIGRED
FT                   VYDRLTVGLAAGGSGLPDISMVETDRLDNYFAEFPQGFVNLDEYGFNEHEDKFADSKVE
FT                   AVKGPDGNNLAAPWDIGPAGVFYYVPHFEEAGVDPDDIETWDDFIAAGEDILDATGAAM
FT                   VPVDIANDDAIFRMMMNQLGVYYFDADGAIEIASDDAALAMSKIQEMHEKDLVANVDGW
FT                   DGTVTSTVNHTVATIPFGVWYAGTITDQAPDQSGDWGVFKLPAFEEGGNRDANLGGSDL
FT                   TILSSTEYPEAAYAFVEYFTTEIEPQIEGMTEYGLFPSLLATYDEPYFQENNEFFNDEP
FT                   IWSLFADVVEGTLPANYTNDYARAFRYASDAQANALLSGEDVQVALQEAAERIANETGR
FT                   DIQ"
FT   gene            434561..435463
FT                   /locus_tag="Bsel_0414"
FT   CDS_pept        434561..435463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0414"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0737
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97953"
FT                   /db_xref="GOA:D6XX96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX96"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97953.1"
FT                   /translation="MAKLQDGTPVGSKRKIVTPKTAPYFFIAPAVLLFLAFTLYPVIQS
FT                   LILSFQTSSAGVTSFAGLDNYRRLFNDPLFFTALGNTFTILIIQVPIMLSIAVVLAVLM
FT                   NSALLKMRAFFRIAFFMPAITALVAYAIVFMILLDQNYGLVNYVLGLIGIDNVPWLNDP
FT                   FWAKVALIVAITWRWTGYNMVIFLAGLQNISSDLYEAASIDGAGKIRQFFSITLPQLKP
FT                   IFLFTAVLSTIGTLQLFDEPFILTNGGPNNATLTISLYLYLNGFRYFDFNYASAIAYVL
FT                   VIIIAALSYLQMKVAGDDE"
FT   gene            435460..436293
FT                   /locus_tag="Bsel_0415"
FT   CDS_pept        435460..436293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0415"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sml:Smlt3250 putative sugar
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97954"
FT                   /db_xref="GOA:D6XX97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX97"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97954.1"
FT                   /translation="MKKRLITILKKIGLYTALMIGVILSTFPFYWMFIGATNPSGAIFS
FT                   VPPNLLPGDHFMENFRNLNEGVGIIRVMMNSLIIALTFTFFSVMISASAGYAFAKYKFK
FT                   GRDPIFFMLLLAIMIPYHVTLIPLFQLMADLGWLNTYRAVILPHLAYPFAIFLMRQNMR
FT                   SVPDALIEAARVDGAGEFKIFFRVILPTMRPALAAVAIFLFMFQWNNFLWPLVALGDSS
FT                   MHTLPVALSGLVGMSRIDYGQIMLGTTLSTLPIMIFFLLLQKQFISGILGGSVKE"
FT   gene            436324..439407
FT                   /locus_tag="Bsel_0416"
FT   CDS_pept        436324..439407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0416"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel;
FT                   glycoside hydrolase family 42 domain 5 loop region;
FT                   glycoside hydrolase family 2 sugar binding; glycoside
FT                   hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; KEGG: avi:Avi_5411 beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97955"
FT                   /db_xref="GOA:D6XX98"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX98"
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /protein_id="ADH97955.1"
FT                   /translation="MAMHEQTARRTYHPPENGYPEWNNNPELFQINREAPHADPRLYDT
FT                   KEKAVAGDPDQVAWRRSLNGTWSFLYADTPKERVEDFYTWDAGDERFTTVQVPGHLQLQ
FT                   GFDYPHYTNTRYPWEEREDIKPPFAPVNYNPVGQYMRTFTMTGEPGDRPVYLRFEGVEA
FT                   AFYLWINGTFAGYSEDSFTPSEFEISDLVHAGENTVAVEVYHWCDSSWLEDQDFWRFSG
FT                   IFRDVWLYETPAEQIRDYTVKTSFHGTDGLLDLDVLIRRFKTKEVRELTVKADVYTYPD
FT                   QKPVAEGAVTGSGDRMTLQITVPDVLRWSAETPNLYIVVLTLQDEAGEAILYVHQKTGF
FT                   QEFGLKDGLMTLNGAPLLFRGVNRHEFMPDKGRAGITREEMEADLILMKQHNINAVRTS
FT                   HYPNHPAFYELCDIYGLYVIDEVNMETHGTWVYGQEGIGETIPGNRPEWTENVLDRCRS
FT                   LYERDKNATSVIIWSLGNESFGGSNLKEMYDYFKEKDETRLVHYEGIFHYREYDASDME
FT                   STMYIPPHKVEDYAKEAEGNPDAKPYILCEYSHAMGNSLGNFHKYTDLFLKYPILQGGF
FT                   IWDWRDQALWSTRPDGTAFLAYGGDFGDTPTDGNFSGNGLIFADGTATPKLLEAKKGYE
FT                   PARIRFEGNHIHVTNDYAFLDLDGFRCQWELLSDGKTVREGTLSLKGAPGSTHSYAVDL
FT                   PETEGERILEVRLVLGEDTLWAEAGHEMTFEQFILNDNGAPRSETPRGQANVSHDDGEW
FT                   LSVAAGGVTYTFARDTGDLTEVTKDGKQHLTAPVAPNFHRAMTDNDRGSGLPKRSAVWR
FT                   KAGKNRRLNAFGVEESGESVHVTVDYAFPDAGSSSMRVMYTLNGSGKAAVSFRFTPDNA
FT                   MPEIPEVGLMMQLAPSLTELQWYGRGPHETYQDRFRSARIGIHESTVNERLTPYLKPQE
FT                   CGNMTGVRWLTLTNPDGSGIRITGSGDLEANALPYSPEELELATHQDRLPQPRHTVLRL
FT                   NAAQMGVGGDDSWGQKTHDEYTLFTDRTFEASFDLTLI"
FT   gene            439554..440594
FT                   /locus_tag="Bsel_0417"
FT   CDS_pept        439554..440594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0417"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: vfm:VFMJ11_A0386 DNA-binding transcriptional
FT                   repressor EbgR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97956"
FT                   /db_xref="GOA:D6XX99"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX99"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH97956.1"
FT                   /translation="MATMKDIAEKSGYSIATVSRVLNQDASLAVTDATKEKIFQVAQSL
FT                   GYKTLRDKRSEKEAQDPSRLTMGLVYYRTEEQELSDPYFLSIRLGVENKCARMGVTLEK
FT                   IYRENDNAALQIPSDVDGLIVVGRVSEGEIARLREVTGSLTFVDYPADSRQYDAVVIDF
FT                   AEAMEVVLAELTGLGHRSIGFIGGHRHFPPDEIVRDEREHAFRYYLDRRGLLDEALIYT
FT                   GDFNTSEGYRLMTEALQAQNRPTAFFIASDSMAIGAYRAAFEAGVRIPEDLSVVGFNDI
FT                   SASSYLQPSLSTVKVYTEFMGETAVDLAIERIRTKREIPKKVVLPTEFIRRESLKERTQ
FT                   SSRNKT"
FT   gene            complement(440627..442846)
FT                   /locus_tag="Bsel_0418"
FT   CDS_pept        complement(440627..442846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0418"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97957"
FT                   /db_xref="GOA:D6XXA0"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA0"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ADH97957.1"
FT                   /translation="MIHVNEPALEFHLQNSEVSYLFSVMKNRQLAHLYFGKRIHHEADF
FT                   SHLFRTQARAGMACVYEGDLTFSLDVIRQEYPSYGTSDFREPAFLLEEPKGSRITDFVF
FT                   DSWERLPGKPAIQGLPHVYADHDSEAETLVITLKDPVLNARLRLFWTIYADRPVITRHA
FT                   EFINDSKDTYRLHRAMSMNLDLFDSDYEMVQLSGSWARERHQHTMPLRPGVQSISSTRG
FT                   TSSAQQNPFLALKRPDTNEHHGDVYGFNLVYSGNFLARAEVDQFDVTRVSMGINPFDFS
FT                   WKLEGGETFTTPEAVLVHVTDGLNGMSRAFHALYRERLARGTWRDRDRPVLINNWEATY
FT                   FDFDEEKLLTIAKSAKELGVELFVLDDGWFGKRNDDTTSLGDWHANTAKLPEGVKGIAE
FT                   KINALGLSFGLWFEPEMVNKDSDLYRNHPDWVIHVPGRAMSHGRNQFVLDCSRQDVVDY
FT                   LFRRMAAVLDSAPVDYVKWDMNRYMTEIGSAKLPADRQQELPHRYILGVYELYERLTSA
FT                   FPHILFESCASGGARFDPGMLYYAPQAWTSDNTDAVERLKIQYGTSLAYPLSSMGAHVS
FT                   AVPNHQVHRHTSLEMRGDVSLFGMFGYELDLSLFTDKEKAAIKEQISRYKQHRALIRTG
FT                   TFYRLKSPFGPDGNETAWMVVSADQTEALVGWYRELARPHPGFKRLHLQGLNEDVAYRI
FT                   NDRVIHGSQLMHAGLMLPDEASGSVPPTTEKTGDFVSYVFHLSAE"
FT   gene            443096..444262
FT                   /locus_tag="Bsel_0419"
FT   CDS_pept        443096..444262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0419"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="TIGRFAM: galactokinase; KEGG: sse:Ssed_4020
FT                   galactokinase; PFAM: Galactokinase galactose-binding
FT                   domain; GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97958"
FT                   /db_xref="GOA:D6XXA1"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA1"
FT                   /inference="protein motif:TFAM:TIGR00131"
FT                   /protein_id="ADH97958.1"
FT                   /translation="MIDHLKQEFDKIFHESGELRYFFAPGRVNLIGEHIDYNGGYVFPT
FT                   ALDVGTYLAVRKRSDRKLRFYSENFPQMGIVEGDLDDLAYSQADDWVSYAKGVLYMFME
FT                   EGMTGDKGFDVYVFGNIPNGAGLSSSASIELAFAVMWDAVNGFSMDRVTMVKLCQRAEN
FT                   EYIGVNCGIMDQFAIGFGKKEHAVLLDCDTLDYEYARLKLDGYKILIANTNKRRGLADS
FT                   KYNERRQECETALSELQEKEVVSHLCELDEAAFNEASHLIKGADRLKRARHAVTENERT
FT                   KKAFRALEDGDLPAFGQLMNDSHVSLRDDYEVTGKELDAMVEAAWQEETVIGARMTGAG
FT                   FGGCTVNIVKEDGLDETVKRISQRYTDQTGIEPKFYVVTTGDGAKELT"
FT   gene            444291..445292
FT                   /locus_tag="Bsel_0420"
FT   CDS_pept        444291..445292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0420"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="KEGG: dds:Ddes_1950 UDP-glucose 4-epimerase;
FT                   TIGRFAM: UDP-glucose 4-epimerase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; Male sterility domain; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97959"
FT                   /db_xref="GOA:D6XXA2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA2"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ADH97959.1"
FT                   /translation="MAVLVCGGAGYIGSHAVADLLASGEQVVVVDNLQTGHRGAVDDGA
FT                   VFYQADLRDEEALERVFNSHNIESVMHFAADSLVGVSMNEPLAYYDNNVYGALCLLKKM
FT                   KKHGVKRIVFSSTAATYGEPDEVPITEEMATNPTNPYGETKLAIERMMKWADEAHEIRY
FT                   VVLRYFNVAGAHPEKDIGEDHRPETHLIPIILQVALGQREKIMVFGDDYDTPDGTCIRD
FT                   YIHVTDLIQAHILALRYLRKGGTSDVFNLGNGSGFSVQEVIDTVETVTGKTIPRELAPR
FT                   RAGDPAQLIASSGKAKQVLGWAPERADLATIIATAWDWHQRHPDGYGEGSEA"
FT   gene            445292..446806
FT                   /locus_tag="Bsel_0421"
FT   CDS_pept        445292..446806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0421"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: hypothetical protein; K00964 galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97960"
FT                   /db_xref="GOA:D6XXA3"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA3"
FT                   /inference="protein motif:TFAM:TIGR01239"
FT                   /protein_id="ADH97960.1"
FT                   /translation="MEQTLNELISYALERELIEEADTVYVKNRLLDAMGLTEGETDAFQ
FT                   RSEEIRPLYTILDELTDDALKRGLIEDDTVTMRDLFDTELMGILTDRPAHVIRTFRDIE
FT                   REQGIEAATAWFYEFSQDVHYIRRERIAKNRSWQTETDYGALDITINLSKPEKDPKEIA
FT                   KAKEAGEANYPLCLLCKENEGYSGRVNHPARQNLRVIPVTLAGDPWFVQFSPYVYYHEH
FT                   AIVLSSAHEPMSIRRKTFERLLDFVEQYPHYFIGSNADLPIVGGSILSHDHYQAGKYEF
FT                   PMARAEMEEERSLERFADVTVGRVKWPMSVVRVKGESKAAVIMASEHILQGWRHYTDES
FT                   VDVRAFTGDTPHHTITPIARKRDGQFELDLVLRDNQTSSEHPSGIYHPHEDVHHIKKEN
FT                   IGLIEVMGLAVLPGRLDSELKALQEALAAEDPSGAIQSDEAIQKHHDWAMAILSRYGDV
FT                   AGDQGTRILQEEVGQVFHEILHHSGVFKRDDEGQAAFTRFLETLTR"
FT   gene            446944..447594
FT                   /locus_tag="Bsel_0422"
FT   CDS_pept        446944..447594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97961"
FT                   /db_xref="GOA:D6XXA4"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97961.1"
FT                   /translation="MLNLALILFGSGVYSLAEALKINMQRGVYEKHGRMARLIIALMTT
FT                   VVAVWTLGAPLFVQILIVIMLFAIAGEWLLPWRNGTFLLRNARPEDDLTALEALLEERR
FT                   ICYERSLNEDRHLVLLFPAYPKTKMVVKEKDSFVNDVYPTRTELTVRIRGMGNPLRETV
FT                   DDYLIDRREAREAGGFTKTALLYLVLAVIAVLAGVAMFYAAWQSPHEIPNMQR"
FT   gene            447608..448273
FT                   /locus_tag="Bsel_0423"
FT   CDS_pept        447608..448273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97962"
FT                   /db_xref="GOA:D6XXA5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97962.1"
FT                   /translation="MLNLSMTLMLMGVTSAVEAANVKMKRGVYIRGSKVGFRVVMLGIV
FT                   AFLALFFREDPYVQGLMAFLLVLVAAEMLIPYERMVIQIRNGTHRESYEELVRVLREAG
FT                   YGYEVETDRFDNAVYRIPSLGKAQIIVKEKEAYIREAFSDRTEVVAVSTGYGNPLNEVM
FT                   ETYIHRMREKRADRSFTRTIQVFLGVAAIFAILAGLFFFQAWQSPWEYPNQRIDELFD"
FT   gene            complement(448337..448975)
FT                   /locus_tag="Bsel_0424"
FT   CDS_pept        complement(448337..448975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0424"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97963"
FT                   /db_xref="GOA:D6XXA6"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA6"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH97963.1"
FT                   /translation="MYRKLFVLASSALIILILVLYHEAFLAWVQNHDGDYVVGTMIIAT
FT                   FMSLFPVIPYPLVGGVIGAAFGPLTGAWIIWFGSTMASAIFFLLVRYGGFHEMGTKILL
FT                   KYNVTKKITLLFERNAFLSITILRMIPVIPSIVINAYAALSRIRFPVYAVASGLGKIPA
FT                   MALFALVGHTIVTNPIDILYMILIYGTFLFFVYLGYRSWTRRIEAAKAS"
FT   gene            449168..452089
FT                   /locus_tag="Bsel_0425"
FT   CDS_pept        449168..452089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0425"
FT                   /product="MCP methyltransferase/methylesterase, CheR/CheB
FT                   with PAS/PAC sensor"
FT                   /EC_number="2.1.1.80"
FT                   /EC_number="3.1.1.61"
FT                   /note="SMART: MCP methyltransferase CheR-type; PAC
FT                   repeat-containing protein; TIGRFAM: PAS sensor protein;
FT                   KEGG: dma:DMR_11050 putative chemotaxis CheB/CheR fusion
FT                   protein; PFAM: MCP methyltransferase CheR-type; PAS fold-3
FT                   domain protein; CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97964"
FT                   /db_xref="GOA:D6XXA7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH97964.1"
FT                   /translation="MTREMYYVGVGASAGGLEALESFFNPMPDDTGLVFIVVQHLSPDF
FT                   KSLMNELLARYTNMKIHVAEDGMVTEPDHVYLIPPGYNLSIFHGRLLLDRQDERNHLNL
FT                   PIDIFFRSLALDQEKQAIGVILSGTGSDGTLGVRAIKESGGMIMVQSEASAKFDGMPRS
FT                   SIATGLVDAILHPEQMAEELMNYVKSPSLQEKWSRNGTNDHQGGLDGLTRIGQIMRSHG
FT                   GIDFSSYKDTTIIRRIDRRIKINRLHDLDDYIRFLKESGEERDVLQREFLIGVTAFFRD
FT                   QDAFDVLLEKVIPKLDYKKGLIRVWSAACSTGEEVYSLAMLFHEYIQQHNLDCQVKLFA
FT                   TDVDERALELAGTGYYPDSLIADIDPDLVSRYFIKKEGGYQVTEAIRKMVVFAKHNILR
FT                   DPPFSKLDLLVCRNLFIYLKSEHQRTILNSFYYSLKPNGYLFLGSSETLGELSEGFAAV
FT                   DAKWKIYQYKAGYKPDIETGTLLPGYRAEAREVRQERDTDMRGSMKMESLLSEAMASIS
FT                   PPSLIIDRQDEIVHVVNDVSRFIRTQPGRFSNSYHTNMNKEQSLFVSNILRRLKHERQD
FT                   VTITNVSNFTESDATLTLAGRIFQVRGEDYFLISFMEQKGAAHKGKTVDIDMSEEARER
FT                   VEELEGELQLAREGLQATIEELETSNEELQSSNEELIASNEELQSTNEELQSVNEELYT
FT                   VNAEHQMKIDELVKLNNDLNNLIRNTEVGALYLDQSLRIRKLTPVISEVTNILDSDIGR
FT                   PISHISFIDGYPELIKNIEEVQDTLSPVERQLKLKNDLWYIIRIRPYRTEYNAAEGIII
FT                   TLVNITGLKDEERKVRLAHDRLTHAMATGDMAWWEFHVPTGHIRYSERLATMMGYEPEE
FT                   FPNDIQVWMRLIHPDDRAMVRSKMKAFQEGDDPILDRIYRIQRKDQSYAWFHDKADVIE
FT                   WKKDGTPARIAGTAIDISRYKYLESELREMQEKDRSSQKGDGI"
FT   gene            452086..453648
FT                   /pseudo
FT                   /locus_tag="Bsel_0426"
FT   gene            453888..454871
FT                   /locus_tag="Bsel_0427"
FT   CDS_pept        453888..454871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0427"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01961 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97965"
FT                   /db_xref="GOA:D6XXA8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH97965.1"
FT                   /translation="MHTLKGLHHVTAITSSAEKNYEFFTYVLGMRLVKKTVNQDDIQTY
FT                   HLFFADDEGNAGTDMTFFDFPGIPKGSHGTNEFYRTSFRIPTDAALDYWVKRFERLQVK
FT                   HEGIQTVLGKKVLPFEDFDEQKYQLVSDEGQPGVASGIPWKKGPVPDEFAITGLGPMVT
FT                   RVKDIELFDKMITEVMGFTKEKEEGERRLYSVGEGGNGAQVITEHRPDLPNVQQGYGTV
FT                   HHTAFRVEDKEALDHWTETLNSFRFPNSGFVDRFYFKSLYARLAPNLLFEFATDGPGFM
FT                   GDEPYETLGEKLALPPAFESKREEIEKLVRPIDTVRSTRAIEKEYE"
FT   gene            454874..455314
FT                   /locus_tag="Bsel_0428"
FT   CDS_pept        454874..455314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0428"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: gem:GM21_3065 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97966"
FT                   /db_xref="GOA:D6XXA9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADH97966.1"
FT                   /translation="MSTSKEERALKLFIVLTRSMQAVKKKVEEDIRSHGLNTTEFAVLE
FT                   LIFHKGQQPIQRIGEKVLIASSSITYVVDKLVKKGYLTRETCSKDRRVSYAVLTEDGKA
FT                   LMDQIFPMHEQAIRRITAGLTEEEKDQATELLKKLGHHATKA"
FT   gene            455442..456059
FT                   /locus_tag="Bsel_0429"
FT   CDS_pept        455442..456059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0429"
FT                   /product="flavoprotein WrbA"
FT                   /note="KEGG: net:Neut_0876 flavodoxin/nitric oxide
FT                   synthase; TIGRFAM: flavoprotein WrbA; PFAM:
FT                   flavodoxin/nitric oxide synthase; NADPH-dependent FMN
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97967"
FT                   /db_xref="GOA:D6XXB0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB0"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ADH97967.1"
FT                   /translation="MTDVNVAVVYYSSTGTNHQLAKWAEEGAKAAGAANVKFLRIPELA
FT                   PEAAIASNPAWEAHYNETKDIPEATPDDLDWADAVIFSIPSRFGTVPGQVKQFIDTTGG
FT                   LWAQGKLVNKVVSAMSSASNAHGGQEATIQSLYTNMHHWGAIIASPGYADPVQFASGGN
FT                   PYGVSVTVDQEGKMVEDVKDAVHFQAKRTVTIASYIKKGMQG"
FT   gene            complement(456118..456318)
FT                   /locus_tag="Bsel_0430"
FT   CDS_pept        complement(456118..456318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97968"
FT                   /db_xref="GOA:D6XXB1"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB1"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_1015"
FT                   /protein_id="ADH97968.1"
FT                   /translation="MKANIGSTDRAIRIVIGITLLSLYFFLEGGARWIGLVGFVPILTS
FT                   FISFCPLYTLIGVNTCKVNTQ"
FT   gene            456494..457408
FT                   /locus_tag="Bsel_0431"
FT   CDS_pept        456494..457408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0431"
FT                   /product="HtpX domain protein"
FT                   /note="PFAM: HtpX domain protein; peptidase M48 Ste24p;
FT                   KEGG: bba:Bd1287 heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97969"
FT                   /db_xref="GOA:D6XXB2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB2"
FT                   /inference="protein motif:PFAM:PF06509"
FT                   /protein_id="ADH97969.1"
FT                   /translation="MGKRFFFFLLTNIMVMVTILIVWSLITEFTDLGRTFDTGGPGLGI
FT                   DLVSLAVFSILIGFMGSFISLAMSRFVAKKMMKVKVIDPDGPMSQEERIVVEKVHRLSR
FT                   AAGLMHMPEVGIYQSQEVNAFATGPSKKKSLVAVSSGLLHVMDDDAVEGVIAHEVAHVA
FT                   NGDMVTMTLLQGVINTFVVFFSRIIAIVASRLVPEQYQFIVQLASIIIFQILLSILGSI
FT                   VVMAYSRYREFHADRGGADLAGKDKMAHALRSLQSYVDRASVNRGRDDSAVQTMKISGK
FT                   RGMSLMFSSHPDLGERIARLEGK"
FT   gene            457564..459603
FT                   /locus_tag="Bsel_0432"
FT   CDS_pept        457564..459603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0432"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; extracellular solute-binding
FT                   protein family 3; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   dde:Dde_1684 PAS/PAC sensor signal transduction histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   extracellular solute-binding protein family 3; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97970"
FT                   /db_xref="GOA:D6XXB3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH97970.1"
FT                   /translation="MRVTGLLAMMVLVLSVWLTEPAQAEVNRHGESPALRVAFDPELIP
FT                   FHDRSNGEQGFSLALMEQIAEGMEREADYVEMSQARAVEAIQNQEVDIILTIPFSEQFS
FT                   TRMEFTDSIFSTSIGMVTRVHDDEISVITDLSESLVAIQQQTIEYEFLRNIRRIQFQVT
FT                   TDQRRAFELFLDGRADTFVGNMTTTGALIERLGMEEDVNVADSFLMPVDYSIAVQRENY
FT                   TLLNAVNTEIRRMRASGAYGELYEQYFQEEGADGWLLMTVQAAAGVIVIFTIVLFLGIR
FT                   WNRQLQYEVSKKTGDLNQLNESLLEQIELKRDNNEFLNQILDSSPRGIVTLDSNGRITK
FT                   FNPKANLLTGLSEAPLQRDYRDVSLLNRLLEGKAVEILAGEERRYLGEYQTWTRDDGEK
FT                   FQFRYFVYPLFNYSREVAGLILTFEDVTSEMELRNKVFEQEKNQALSRVVAGIAHEIRN
FT                   PLSSIKTFVELIPRKINNQKFQEEIATYVPKEIVRVSELIEGLINYARPRHQEPEAVDA
FT                   GILMHESFILFERTGKNKGMTLELNQEEGLWIEVDPQQVKQAVINLIINGLDAMEARKN
FT                   TEGGGTMTLTLAVFEQDGCVHLSVTDEGIGMADDELAKVLEPFYTTKDKGSGLGLAISS
FT                   QLVKDNGGELLIVSEKGTGTTMTLVFPKKPDQTDPQARKGGRRS"
FT   gene            459600..460961
FT                   /locus_tag="Bsel_0433"
FT   CDS_pept        459600..460961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0433"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: dal:Dalk_0661 two component, sigma54 specific,
FT                   transcriptional regulator, Fis family; PFAM: sigma-54
FT                   factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; response regulator receiver;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97971"
FT                   /db_xref="GOA:D6XXB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB4"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH97971.1"
FT                   /translation="MTKIIIIDDEEGICSSLVFALEDDYDTEAFTNPAEGLKSVIADQP
FT                   AVVLLDLKIGSVNGIDVLKEIRKQAPGTEVIMITAYGTISSSVEALQNGAYSYVTKPLN
FT                   MDELFANISRVMEYKALNRQVQALSDQLERKYRYEEMVGKSDAMQKLYRLIDKVKEVDT
FT                   NVLITGESGTGKELVARAIHYAGKRRSGPLEVVNCAAIPETLLESELFGYEKGAFTGAT
FT                   QRKAGKFELAHGGTLFLDEIGDMPVQLQAKLLRVLQKREVTRLGGTEAKLFDVRVIAAT
FT                   NVSLEKETEEGHFREDLYFRLNVIQLQLPPLRERTADLPILLKHFIDKYNREMNKSIQG
FT                   FSKEAEQRIFNHHFPGNIRELANIIESSMVITDGEIIEPEDLPAYLNRGTKRQESEEAS
FT                   LKPFVRLGYTLKALEKAFILETLEAENGHRKHTATKLGISERSLRDKIKQYEQG"
FT   gene            461157..462191
FT                   /locus_tag="Bsel_0434"
FT   CDS_pept        461157..462191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0434"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: par:Psyc_0746 TRAP-T family transporter
FT                   periplasmic substrate binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97972"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB5"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ADH97972.1"
FT                   /translation="MKKAMLSAMGLLLIGTAAACGNDNEAADAGNNDGGADNNGNTEAN
FT                   AGGADMDDLFITVATGGTSGVYYPIGGAISNILDQDLGVDTSVQSTGASVENVNLIDSN
FT                   RAELAITMADAVAQAYEGSGAFDGEEPIESLRGLTALYPNFVQVVTTADTGIESIYDLE
FT                   GRDVGVGAPGSGVELNARMILDAHGMDYDDINEDFLSYSEAIDQIKNGMVDAAFVTSGV
FT                   PNATIIDLSTTHDAVVLPIEGEPMDNLMDEYAFFSTGVIPGGTYDQEEDVNTATITNVL
FT                   LVNSELSDDVVYEITRSLFEHIDDLHASHNAATDISLDSVMEGMPVPLHPGAERYFEEQ
FT                   GVLD"
FT   gene            462246..462722
FT                   /locus_tag="Bsel_0435"
FT   CDS_pept        462246..462722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0435"
FT                   /product="Domain of unknown function DUF1850"
FT                   /note="PFAM: Domain of unknown function DUF1850; KEGG:
FT                   csa:Csal_0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97973"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB6"
FT                   /inference="protein motif:PFAM:PF08905"
FT                   /protein_id="ADH97973.1"
FT                   /translation="MKRLMGLLIIMVMGTGLYYTSANETGEVMVVLESEREGQVFFERP
FT                   VSAGDIYELSWIHSVEKTPWAERYAVTDGDAFLLERTEFASYGAGVPHEANEVRTENGM
FT                   IIYDGINTLHDDLRWIHSHQAEHALYINGEQAFPPSAIPHQTAVRLYIEWRSSE"
FT   gene            462719..464719
FT                   /locus_tag="Bsel_0436"
FT   CDS_pept        462719..464719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0436"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="KEGG: pcr:Pcryo_0743 TRAP transporter, 4TM/12TM
FT                   fusion protein; TIGRFAM: TRAP transporter, 4TM/12TM fusion
FT                   protein; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97974"
FT                   /db_xref="GOA:D6XXB7"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB7"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ADH97974.1"
FT                   /translation="MSKEAVPNEQTKEVLEKYDNESRVRSYRKYYVGLIVSIIAISLSV
FT                   YHLYTSYFGTPVTLQHRSIHVAVVLALIFLIYPAYKKLDRRKLHWYDVILAMMAISTTV
FT                   YIYIDYDGIVRRGGMPNEWDLVFGLILVALVLEGARRVTGWALPLLATLFIAYGLYGNH
FT                   LSGLFRHRGYEWSDIVNFMYVTTEGVYGTAISVSATYIFLFILFGAFLQKSGMGQFFND
FT                   LALAIAGQTKGGPAKVSVIASGFLGSINGAAVANVVTTGSFTIPLMKKIGYKKDFAGAV
FT                   EASASVGGQILPPIMGAAAFIMAEILGIAYRDIALAALLPALLFYLGVIIQIHLRATKE
FT                   GLQGISKENLPLVKNVMMERGHLLIPLLFLMYMLFLSGRTIIFSAFLTILVTVAVSMIR
FT                   KTTRMSVKDIIGALDNGARTALAVAIACASVGIIVGIATLTGFGLKLANGIVILGGESL
FT                   FLTLMFTMVASIVLGMGLPSIPTYIITATMAAPALVQLGIEPLVAHLFVFYFGIFANIT
FT                   PPVALAAFAAAGISGGRQMRTGGISMKLALAGFIVPYIFVYNSNLLLINTTIMQGIVVV
FT                   ITSVIGVTMLSFAAEGYFFTKMNWLFRAVLFGGALLFMNPNGYQDLIAILILVAVGILQ
FT                   YMKAKKEGGINLPLEGYRDRYDQEEPAIVTT"
FT   gene            464765..465682
FT                   /locus_tag="Bsel_0437"
FT   CDS_pept        464765..465682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0437"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pct:PC1_2358
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97975"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH97975.1"
FT                   /translation="MKQIQLGTSPLFSGRLSLGCMRMADKTVKEAAGVIEAASESGINL
FT                   FDHADIYGKGTSEEIFRDALKETSLKREEILLQSKCGIRDGYFDFSKDHILSSVDGILK
FT                   RLGTDYLDTLLLHRPDTLMEPEEVAEAFDTLAESGKVRVFGVSNQNQMQIELLKRYVKQ
FT                   PLQINQLQLSLAHTPLIDAGLNVNMGNDAAVVRDGYLLEYSRLHDMTVQPWSPFQHGMI
FT                   EGVFIDHPEFPELNAALKETAEAKGVSKSAIAIAWLLHHPAKMQPVIGSMNPERIREIA
FT                   KADGVTLTRPEWYALYRAAGNDLP"
FT   gene            465830..465979
FT                   /locus_tag="Bsel_0438"
FT   CDS_pept        465830..465979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97976"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97976.1"
FT                   /translation="MKRRERENMIHFLMQVRNTSQERLMVMTDEDIEYLYSREYDEQEA
FT                   YEYL"
FT   gene            466127..467068
FT                   /locus_tag="Bsel_0439"
FT   CDS_pept        466127..467068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bpt:Bpet3357 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97977"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC0"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH97977.1"
FT                   /translation="MRGMLAVLVLLMMSSCANDDEVVRDSFPEEAVTIIVPYSPGGSSD
FT                   QMARLTAEGLSDYWGIEVIVDNHDGRQSGSGLLAIAEADADGYTLGMFGNPDELVHARL
FT                   YDTELAMTDYDYLMGFDQMPHALLAGPGFEGEDFEDWIDIANRQPGRLTVGHSGSLGEL
FT                   MIFLLENETGVDVTPVRYDGGGELIQALSEDQIDTALSSCEAADDVARSGGRKLGCTGS
FT                   PDGDGTTFSEQGYEILLNVMRVLVAPQGIPADHRDEIISALETVFETEAWQEAVADAEI
FT                   AFVQTGPDDLMELVREMDEKIERRIEEAELSR"
FT   gene            467376..468518
FT                   /locus_tag="Bsel_0440"
FT   CDS_pept        467376..468518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0440"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: hha:Hhal_1932 beta-lactamase domain-containing
FT                   protein; PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97978"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADH97978.1"
FT                   /translation="MSLKVMTANELGQKIIAREDLFILDVRNEDAYQDWKIEGDSITSI
FT                   NKPYFDLIDGVDEILGELPKDKEILVACAKEGSSQFVAEQIVEATGQDVYYLEGGMKNY
FT                   SEDLQPVKLGDLSNGGELYQFVRLGKGCLSYIAVAKNGDAAIVDTTRMVDQYQAFLDDK
FT                   KATLKHAIDTHLHADHISGARTMRERTGAKYWLPSKDADEVQFNYEAFEDGQELTIGAA
FT                   GEEIQLKAVYSPGHTIGSTSVIIDDQYLVTGDILFVESIGRPDLAGKAEDWVGDLRNSL
FT                   YVTFKNLDQNLKVLPAHFAKFAEVDEHGRVFETLEELFKTNEGLQFEDEAEFRSYVTGN
FT                   LPPQPNSYQEIRQTNMGKIDPEPEEKTEMEIGPNRCAVTE"
FT   gene            468626..470296
FT                   /locus_tag="Bsel_0441"
FT   CDS_pept        468626..470296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0441"
FT                   /product="sulfate transporter"
FT                   /note="KEGG: gsu:GSU2312 sulfate transporter family
FT                   protein; TIGRFAM: sulfate transporter; PFAM: sulphate
FT                   transporter; Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97979"
FT                   /db_xref="GOA:D6XXC2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC2"
FT                   /inference="protein motif:TFAM:TIGR00815"
FT                   /protein_id="ADH97979.1"
FT                   /translation="MQQWFPLWQQLQHYDLKSDLKGDLNAALIVAIMLIPQGMAYAMLA
FT                   GLPPVMGLYASTVPLFIYALMGTSRQLAVGPVAMVSLLIFTGVSGLAEPGSAEYISYVI
FT                   LLALMTGVIQLLLGVLKLGVITKFISHAVISGFTSAAAIVIGFSQLNHLLGMDLGDSKN
FT                   VFVIAGTVVARFTEIDPLTLSLGVGGMLILIVAKKKIPKIPAPLFVVVLAIGLVQVFNL
FT                   HDQGVRIVGDIPGGLPGITVPDVSVDTMLILIPTALTIAIIGFVESYAMAKVISTKEKY
FT                   PISADAELRALGAANVGAGFFSGFPVTGGFSRSAVNYESGARTGMASVFTGLFIVLTLL
FT                   FFTSWFYYLPRAILAAIILVAVYGLIDFKEAKHLFQVKKVDGITLIVTFMATLVIGIEM
FT                   GILIGILFSLGVFIYRSAKPHMAELGYVKGMDDYLNIERFPEAETFDDVLMIRIDAPIY
FT                   FANMAYIEEHLRERMIEHSHLKHVVIDFSGVNDMDAVALDEFDEWLDYHRSEGVHFYFV
FT                   LVRGPVRDLFARYGWTDAHHDEFCYHSVQEALTDLKKIG"
FT   gene            470447..471376
FT                   /locus_tag="Bsel_0442"
FT   CDS_pept        470447..471376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0442"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="TIGRFAM: ribonuclease Z; KEGG: pmr:PMI0252
FT                   ribonuclease Z; PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97980"
FT                   /db_xref="GOA:D6XXC3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC3"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ADH97980.1"
FT                   /translation="MELHMLGTGAGVPTKERNVTAMVMKGVDGKKACWMIDCGEGTQHQ
FT                   ILHAPIKAGAITKVFITHLHGDHLYGLPGFLGSRSFQGADQPLTVYGPSGLRPYIEQSL
FT                   AVSGTHLTYPLTVHEVEEGEIVDDGNWRISCLALDHRMPSFGYRFDEKEQPGRLDRERL
FT                   LKDDIPSGPWLGDLKEQKTVTLPDGRVVDGRDYVTEPVKGRRIVILGDTRPMPAVADFA
FT                   KEADLLVHEATFMAGERETADRFAHSTTLDAAEIARQADVSRLLLTHISARYKAADMAG
FT                   YTEEARSRFPNTKTAADFGVYSLERGDR"
FT   gene            complement(471349..472911)
FT                   /locus_tag="Bsel_0443"
FT   CDS_pept        complement(471349..472911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0443"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: tcx:Tcr_1143 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97981"
FT                   /db_xref="GOA:D6XXC4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97981.1"
FT                   /translation="MRLLSKNKGLITVLAFVALTWAYANWFVSDNFQKERQRDVQAQMA
FT                   IFQSELESITGTYQEFATYIYHSLINQPEILDIMREAENADDARLDRLRSDAYTLLLNP
FT                   YLQIRQYNFRQLHLHLPDGSSFLRMHAPDEYGDPLYDVRETIAETHRTRNSVSGFEEGK
FT                   IFNGYRYVFPLLADGELIGSGEVSLSLQAAIQILNDIYPTDNTLFILHHDVVDRNIFDD
FT                   YRDNYVSSFISDDYYFDRDAILASPNRDRHDIYANYAVQHQIRTRAEDHLPNHAPFYFT
FT                   IDVDGDDYLVQFVPITNFEETSVGYFITAMHDEGLQALTAQRNREFIYVNGFFGILTVF
FT                   FTTLYYERRKIRHLAHTDQLTGQMNRNAFINHANRLIRLSVKNKTPLSVALLDIDHFKK
FT                   INDTYGHKTGDQALQEIATSIREALDESDLFARWGGEEFVIMMPETREKEAEIRLDAIR
FT                   ATIAGKAFTQVGTITISIGITGARPDRDSLEQLIASADEALYEAKNKGRNRVVLYRSPR
FT                   SNE"
FT   gene            complement(472941..473675)
FT                   /locus_tag="Bsel_0444"
FT   CDS_pept        complement(472941..473675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0444"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pat:Patl_2981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97982"
FT                   /db_xref="GOA:D6XXC5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC5"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADH97982.1"
FT                   /translation="MDLELIQWLVIVATGVMIGLAKTGIPALGILVVTLMATVFPARES
FT                   IGIVLPILIVGDIVAVTYYRRSVDWPILTRLIPWVSGGLILGFILLFTVTESRPIEIGI
FT                   GLIVIGMILLQSFKGLQRNTQGTKPLWFVIGMGTLGGFTTMIGNAAGPVMTLFFLSYGL
FT                   SKLQFVGTGAWFFLTVNLIKVPLFMYLGLITLHTLTINALMIPMILAGTWLGIRLLPWI
FT                   PQALFNRIVLILSFIGAVMLLV"
FT   gene            473809..474984
FT                   /locus_tag="Bsel_0445"
FT   CDS_pept        473809..474984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0445"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ypg:YpAngola_A2760 aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97983"
FT                   /db_xref="GOA:D6XXC6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH97983.1"
FT                   /translation="MRFDEQIARDRTYSVKWDRTEAVFQTKEEILPMWVADMDFKPPEG
FT                   VLGVMNERLQHGIFGYTFVDDEVTDTVRNWMKTRHGWDVDRAWISYSTGVVPSLAKTVQ
FT                   AFTEPGERVLIQSPVYPPFFSMVTENGREVENCQLVETDGEYRIDFTAFEEAAAKPDVK
FT                   LFFLCSPHNPVGRVWTKEELTALADICLAHGVVIVADEIHSDLIMAGQTHVPIASLSED
FT                   ISHQTVTLSAPSKTFNLAGLQASFVIAENEEYRKKLAGVDRSQGNFTLNTFGILAMKTA
FT                   YETGGEWLSELNAYIEENARTVQTFLEKEVPEIRMVTPEATYLLWLDCREVGLDDKALE
FT                   KLFVEDGKIGFNWGHTFGAGGEGFVRMNVACPRKTVEEGLERMKAAIKKHG"
FT   gene            475156..476139
FT                   /locus_tag="Bsel_0446"
FT   CDS_pept        475156..476139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0446"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120664 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97984"
FT                   /db_xref="GOA:D6XXC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97984.1"
FT                   /translation="MGLKENAAVKFQDEEMEQNFQQEAPPPKKASRSRMKRHEAMMGWL
FT                   FLLPEMIGLAFLYVFPLGFSLFLSFSEWNLIGGFSEIRFIGLDNFVQMFQDPRVWGALR
FT                   NNIFYTFMVVPISMMIALLLAVLIHNKVYLRDYFKVAFFIPYISSIIAVGAVWRALYHP
FT                   TQGPINQFLMSIGIENPPGWLADTSTSLIAIIIITIWTLIGYVVIIYIAGLSNIPDSLY
FT                   EAADVDGAKPYQKFIHITMPLLGPTHMFLAITLLIGSFKVFDLIAFLTQGGPINSSQVL
FT                   VYLIYEEGFQRFNMGYASAISWLLFAVVGILTFLTWQVQNAKQFKS"
FT   gene            476157..476984
FT                   /locus_tag="Bsel_0447"
FT   CDS_pept        476157..476984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0447"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_7346 ABC
FT                   transporter membrane spanning protein (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97985"
FT                   /db_xref="GOA:D6XXC8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97985.1"
FT                   /translation="MKLNKMKLINTIVLGVLSVFFLAPLIWMLSASFKFESDVLVFPIE
FT                   WIPRNINVVNNFKAVWMENIPFYLFYWNSIKLASIMTLGTLLISSMAAFSLTKLHFKGQ
FT                   NIIFFAMITLMIIPEQSTLVPRFIMIRWMGLYNTHEALIIMGIFSIYFTFLMRQYMLSI
FT                   ENDYIEAAKIDGANYFTIYWRIILPLARPILATVGIIKFIWVWNDYQNPLIFLFSKELY
FT                   PITMGMQLFQDDFSNNYAILMMASVSAIIPLVIVFIILQKHVIAGISLGGVKG"
FT   gene            477088..478470
FT                   /locus_tag="Bsel_0448"
FT   CDS_pept        477088..478470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0448"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97986"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXC9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97986.1"
FT                   /translation="MKKQRMVQAAMAGTLVVLAACGNENVDEAGAENQSQNENDVNNAA
FT                   EEMNEADQEPVTIKWYNWDNDVMAQTSEQYIADFEEEYPHITVESISMVPGDSLGTLQN
FT                   LDILLSSGEKVDVISFPNVDSLYQRAEMGALAPLDEFYDNEGITPNDEYFINPMVNDDY
FT                   YGIQYNATLNFMMLNKDAFDEAGLDIPDASWTWADFEEYAGQLVNKEGDNQRYGAYFHT
FT                   WPLYMNPPAQTLMKHPFLYEDGTTNFADESFPEMFAMRERLETEGITKTYAESLGADLG
FT                   YRTEYFNENASMLLTGSWMIGEAGDTDLNPHDFTTAFAPVPVLNEGDPSEYYMGGNFFG
FT                   IGNTSEYKDEAYLFARHVSTNLSDSRSELPGWKKGDPQPVVERMIDGNEDQIDVDSLMY
FT                   TLFGDDISYLDASQISITYAGELDSILVDGFGMYMLDNEPLDEVQAWMVEEATKVIDSY
FT                   NE"
FT   gene            478584..480290
FT                   /locus_tag="Bsel_0449"
FT   CDS_pept        478584..480290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0449"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: hypothetical protein; PFAM: histidine kinase
FT                   internal region; ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97987"
FT                   /db_xref="GOA:D6XXD0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADH97987.1"
FT                   /translation="MNRLRRQIFSKSYSRRIQFMFALFILLPTITLSIITYQSDKQNIA
FT                   EKMDFYNETIIDVIANDIDKLTNDLIFSSHFLIQDKGFKSAIAEISDRDGIQSLTAFQQ
FT                   FEYIRERFLSMETRTLNQNISMFYLNDAGLIVTSRSMPLSQEDIQRQWLSVSENLNLQT
FT                   EMIIQYLGKSYDGSQHYFTRVIPRDLSTGNQGLLTIIVSDDYFQQLFEPVSSGAIRLND
FT                   DKGNMIAGSEIDTAARDSLLERTVSPFGWSLYYETPSQQINEELNQSFYSSLMIIFFLF
FT                   VVFIMLSMKSARQLSRPVEELKLVADQFSQGNRGARFQVTGEDEIQSLGVSVNHMLDEI
FT                   NDLIERIEKKETQKRELELHALYEQIRPHFLMNTLNSIRCSLEMEDDEFHSKKLYSLTM
FT                   LLRKYLKINEPSTLRNEVELLTHYIDIMEMRKGRSYWLKAWLSEETHEVEIPFLTLQPI
FT                   IENAILHAFEDPEHHPIMEIRAEIKDEWFHVTVWDNGSGISQSKVDQLNRSLKDTRLEY
FT                   SKQQGDSLGLVNIAERLKLTFSERATLVINSERGKGTTVQILIPVSDMKGE"
FT   gene            480296..481870
FT                   /locus_tag="Bsel_0450"
FT   CDS_pept        480296..481870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0450"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: avi:Avi_7634 transcriptional regulator AraC
FT                   family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97988"
FT                   /db_xref="GOA:D6XXD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97988.1"
FT                   /translation="MANKLKVMLIDDDLPMLNYLKKMVDWTDLGCEEVRSYSSGSQALT
FT                   DFRVWEPDLVISDIGMPQIDGITLAGKMKELNPEFMLVFLTCHEEFDFARKAIGLQAER
FT                   YIIKDELSKSELGAVFEEVCRKASDMQLVSQEKAKQGFEQQKAAFVKWLISPIDQEEPK
FT                   QHIWYESSYRIAYMHVKSEYDPEANTRTSLKKLYLSVSEQISDKESVDVFLVDEGLLFI
FT                   MNYKDSIKQNYAGRFQRLLGDICDDIKNRDYSVSAKVYTQAMTFSELSESVRSLLFKKQ
FT                   NGYFTRGSLLILLQTLQPEVCHPVNHVIQDSLNLASQAVMDDDTDRINQAMALLLDQVY
FT                   DMRVHPEEIEERLIKMVYQLEIKKGTEHSDVHFAKRLKQSVTFEEAWIMTRQKLHSLQT
FT                   VPESSQVLPVDTSKLKRIDEYISSHLHESITSTDVAKALYLNSSYFSRYFRKATGKRFT
FT                   DYVYEYKIKIARDYLKYSNESIEEIGAELGFTERTYFSKVFKKYTGMTPSEFRTKTQSN
FT                   EKEGVSK"
FT   gene            481867..483009
FT                   /locus_tag="Bsel_0451"
FT   CDS_pept        481867..483009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0451"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   rlg:Rleg_5051 glycosyl hydrolase family 88"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97989"
FT                   /db_xref="GOA:D6XXD2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD2"
FT                   /inference="protein motif:PFAM:PF07470"
FT                   /protein_id="ADH97989.1"
FT                   /translation="MTPSDIKKLIIKRTSRNLKKTGGLYPHVGDDGIYRLIKNEDWTNG
FT                   FWSGVLWECYEGSGDSVFLNAAKEETKSFEKRMTDNVVLDHHDLGFLYSLSSKADWIIT
FT                   GDESARLLSIQAADRLLQRWRSVGGYIQAWGNKGDKTEGGRMIIDCLLNLPLLFWATKT
FT                   TGNSKYEVVARQQAEQTLRYLVRGDGSSYHTFIFNQKTGEPVGGTTHQGSSNGSTWSRG
FT                   QAWGVYGFALLYRFTKEERYLVKAKEMLDYFLRHQPEQGLISWDFNASQKEEHYTDSSA
FT                   MAIALCGMLELREWTDPSESERLDTCINLFIQNLADYALIKEDDPEKVTGLLHHASYYV
FT                   RGGDVPDGSVIWGDYFFTEAIMRMTDQRTGYWYERSSFHE"
FT   gene            483002..483652
FT                   /locus_tag="Bsel_0452"
FT   CDS_pept        483002..483652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0452"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97990"
FT                   /db_xref="GOA:D6XXD3"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD3"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97990.1"
FT                   /translation="MNNWIMNRLEAMGNWVFALAYVNVLWLLFTLAGAVVFTITPATVA
FT                   MMTCIRRWKEDPSYTIRFDEYRKLFKSEFREASRLNLFLLPVLIMLILNTGLLLHSQME
FT                   IPLILMVMYIISVVFSAVMFMHIFTVYALLNKRSLQAVTASVVFGFSHPFHSMMSFLLI
FT                   VLVFLLIFSTSGLAMFFGISLISYVLFRRNCMLYEKDLSDDEEPRPHTEAVSL"
FT   gene            483649..483828
FT                   /locus_tag="Bsel_0453"
FT   CDS_pept        483649..483828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97991"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97991.1"
FT                   /translation="MNVDSGRYFFSASQVQNIMNLCSVHDHQAVDSVLCRADAAMDNRF
FT                   FSIGYSIWSHALTL"
FT   gene            483804..485270
FT                   /locus_tag="Bsel_0454"
FT   CDS_pept        483804..485270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0454"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   sat:SYN_02676 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97992"
FT                   /db_xref="GOA:D6XXD5"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD5"
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /protein_id="ADH97992.1"
FT                   /translation="MEPCSDVVTLPLPIDWTYCHNDDLEWTYMLNRMKFMEDLAFASLY
FT                   KGDNRYRDSFEFYLEDWMRQHGDGETAVVWRKIDCALRIVHLIRAKAFLCACQSWNNRC
FT                   ESLFSRLAGQTSEYLLRSFTSVDAQSNWGFIETNALIQLAIMQTGKAGFAETVKEAMRR
FT                   LELMVTLQIGGDGVHLEQSPGYHHEVLRNLFECVHLSELNGICVPADVKEGLKKMFKAS
FT                   SRMIRPDGSQPQFGDSDILDIRPFMALAAYRYHDESFVPPLLGTVTFDTLWYTAGDLFC
FT                   HQERYIKDSNDPLRDWLEDSGLQIARSGWERHSDYVCMNAGEMGLSAHGHDDLTHFEWL
FT                   VDGVPFVISTGRGTYRESSLRKQLKTAKGHNMVLIDDKMPSTYGDTWSWLQEAAPVNAK
FT                   MTSAKGYTYMRAAHDGYLSLQSGGLITRELILTPRGSLVVIDSILGGGSHHYQQAFHVS
FT                   ERFTVWKPNKQTLRFNYASLSIKMQQCTPG"
FT   gene            485332..485592
FT                   /locus_tag="Bsel_0455"
FT   CDS_pept        485332..485592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97993"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97993.1"
FT                   /translation="MIVSNVKTEGHFRFVTVFGKEHKGFLEAEWVELYDKAGKLADRGD
FT                   HTSLRLHYGEAAETIVISHKGKRYVEFEGEQLTDCMWFGSS"
FT   gene            485748..487922
FT                   /locus_tag="Bsel_0456"
FT   CDS_pept        485748..487922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvu:VV2_1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97994"
FT                   /db_xref="GOA:D6XXD7"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD7"
FT                   /inference="similar to AA sequence:KEGG:VV2_1091"
FT                   /protein_id="ADH97994.1"
FT                   /translation="MKRPVKKGRVTIPGQEGMDDVIAKLIERWGADAIRDSDGTKLTEY
FT                   AKSLTDKVYSKYFFSRGDQNYARKNQNRSQHFYLMSERYTAKEEPLSIRMMDTYYDRQV
FT                   EPEIRYHPSEWWEVIDRTTGCVLGTDQWEYDEERMEVVIHSPSPWHEYTVSFLARQLWD
FT                   PVHMYNSLTNGWDVEPHMPYNPFFPETRDYLLSRLEEWLDDHPDTDVVRITTFFYNFTL
FT                   VFNEEAKEKYVDWFGYGATVNPEAIDAFEKEYGYRLRPEDFVDEGYYNSPFRNPSKAFR
FT                   DWISFIQDFVAELARECVSRIHDRGKEAIMFLGDHWAGTEPYGSRFKSIGLDGVVGSVG
FT                   DGTTLRMIADIPHVSYTEGRFLPYFFPDVFCPGGDPVAEANDNWLKARRALLRNPLDRI
FT                   GYGGYLDLAVEFPDFVDRVEEITDEFREIHDRSKGERPRHLSCKVAILNSWGSLRTWMS
FT                   HQVAHGLWHKHAYSYSGILESLSGLPVDVTFISFEDVIETGIPKDVDVIINAGSAGTSW
FT                   SGGDWWENEVLVSRLRSFVHRGGGFIGVGDPSAVQYQGAYFQLADVLGVQKEVGFSVNT
FT                   DKYTDAICRSHFILEDIHEKLDYGEGTSGIFQLHSKVQILDESDGEVKLSANEYGRGRS
FT                   TYVAGLPYSPQNARLLLRMIVWSSHKERELDNFLPTDPEVECAVYDRERKLIVINNAWS
FT                   RKAGAISLPNGKEVRYDLFPGGYEWYELIP"
FT   gene            488066..488698
FT                   /locus_tag="Bsel_0457"
FT   CDS_pept        488066..488698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0457"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: scl:sce5154 KDPG and KHG aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97995"
FT                   /db_xref="GOA:D6XXD8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD8"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADH97995.1"
FT                   /translation="MKTITQDLMKHKLVAIIRGTGREEGYPTASAMIRGGFRFLEVTLN
FT                   TEGAMTVIEEVNDVHGGDVYVGAGTVMNRNMAEDAVSAGARFLVSPHFDHDVMAFAYEA
FT                   EIPYWPGSLTPTEIISAFESGADVVKVFPAGVMGSDYLKALSGPFPDIPLMVTGGVHPG
FT                   NIRNYFEAGATAAGIGGDLCHLPSIRAGQYESIEAKAKTYVNAMKER"
FT   gene            488704..489678
FT                   /locus_tag="Bsel_0458"
FT   CDS_pept        488704..489678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0458"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: pol:Bpro_1737 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97996"
FT                   /db_xref="GOA:D6XXD9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXD9"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADH97996.1"
FT                   /translation="MADKPYDIVTLGESMVLLQPLTERIGPSAHFVPSVGGAESNVAAA
FT                   LARLDLRVRWISRLGNDPFAKIIMSALAGEGVDLSCVEKINGERTAVYFKEDSLFEDPR
FT                   VYYYRKESAASKWRKEHVRDVWFEDVKHLHITGITLALGEGTREFVVSAMKKASERGLT
FT                   VSFDPNVRTTLKDPVFWKEAIEDVLPYVDVFMPGRSEAVLLFGNQSDEALIQAGLDHGA
FT                   TIVTMKLGEEGSLTGSKSMLHREKGYPIRTTVDTVGAGDAYAAGFLSVMTAHKINVDDW
FT                   IPNAAKRANVMGAIATTYKGDWEGSPLLHELNDLLEGRVMELR"
FT   gene            complement(489759..490514)
FT                   /locus_tag="Bsel_0459"
FT   CDS_pept        complement(489759..490514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0459"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="KEGG: xcv:XCV0153 short chain dehydrogenase;
FT                   TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97997"
FT                   /db_xref="GOA:D6XXE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE0"
FT                   /inference="protein motif:TFAM:TIGR01832"
FT                   /protein_id="ADH97997.1"
FT                   /translation="MQRLFSLEGKTAVVTGSARGLGQGMAVGLAEAGADIIGISFSEQQ
FT                   ETKKLVENLGRRFFDIEKDLSIQSDIQGIVEEAINKTGSVDILVNNAGTIKRAEAEHFS
FT                   DEDWDSVIDLNLNSVFRLSKGFGQHMIARGSGKIINIASMLSFQGGLRVPSYTASKHAV
FT                   AGITKSLANEWAAKGVQVNAIAPGYFATDNTAQIRSDESRNAFITSRIPKAEWGTPADL
FT                   QGPVVFLASDASNYMTGHIMAVDGGWLSS"
FT   gene            complement(490525..491355)
FT                   /locus_tag="Bsel_0460"
FT   CDS_pept        complement(490525..491355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0460"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="KEGG: rlt:Rleg2_5662
FT                   4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase; PFAM:
FT                   5-keto 4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97998"
FT                   /db_xref="GOA:D6XXE1"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE1"
FT                   /inference="protein motif:PRIAM:5.3.1.17"
FT                   /protein_id="ADH97998.1"
FT                   /translation="MEIRHATNPTDFKLYTTDRLRSDFLMENLFIEGELNLVYSHYDRV
FT                   ITGGVVPKEEEIKLPIIEQMKTEYFLERREMGIVNIGEPALVNVEGETYELNKRDCLYI
FT                   GKGNQHVSFKSKNPDNPSKLYFVSVNAHTPYPVTLMPIKDATPVKLGSNAESNSRTIYK
FT                   YIHSDGIQSCQLMMGMTLLEPNNMWNTMPAHLHDRRMEVYLYFDMDASSRVFHFMGQPH
FT                   ETRHLVVQNEQVVLSPPWSIHSGVGTNNYTFIWAMAGDNYTFTDMDFIPMEDLR"
FT   gene            complement(491579..492229)
FT                   /locus_tag="Bsel_0461"
FT   CDS_pept        complement(491579..492229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0461"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="KEGG: dvl:Dvul_0099 hemolysin III family channel
FT                   protein; TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97999"
FT                   /db_xref="GOA:D6XXE2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE2"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADH97999.1"
FT                   /translation="MHTFIREPVNSLTHWAGAVLSLIGLVAMLFRSSEAGFGTLEIAAV
FT                   TVFGLSLILLYTASATYHMIIASDSVIAFFRRLDHSMIYILIAGTYTPFCLIAMQGPAG
FT                   WALFGIVTAMAIAGVTFKLIWFHSPRWLSTGIYIGMGWLIVFFVVPLTSVIDPTGLVLL
FT                   VAGGVLYTIGGVLYAIKPDWSILNSIGFHEVFHLFILFGSLAHYFSVYFFVIG"
FT   gene            492353..492913
FT                   /locus_tag="Bsel_0462"
FT   CDS_pept        492353..492913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0462"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98000"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE3"
FT                   /inference="protein motif:PFAM:PF08876"
FT                   /protein_id="ADH98000.1"
FT                   /translation="MTKEPSDSLGRMIRTEDIPTIDLYMDQIIQLFEQTFADTKRDKSD
FT                   KIMTKTMINNYAKGGLLFPIQKKRYSREHIMLIALIYELKGILSVHDIKTALRRISREG
FT                   SPKEMNDVYSRYLKLADENLQLFKDEISKHKKRVESHILEMETDEEVQDVLMILACVNM
FT                   SNLYRRMAEELIDDLADPDEDSL"
FT   gene            493037..493381
FT                   /locus_tag="Bsel_0463"
FT   CDS_pept        493037..493381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98001"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98001.1"
FT                   /translation="MGQFFIQQNPYDKRLNIKLEGMFSDRDWHGLMESYRKQVEMIEPE
FT                   EYQIELDCTAFPLAAASQWQWLEEGYQLFDAQAFRRISLIIRESADRLDHSFHEAVMNV
FT                   RLPKLELRVV"
FT   gene            complement(493432..494040)
FT                   /locus_tag="Bsel_0464"
FT   CDS_pept        complement(493432..494040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0464"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   ppd:Ppro_2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98002"
FT                   /db_xref="GOA:D6XXE5"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE5"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ADH98002.1"
FT                   /translation="MWEILNIIGTIAFALSGVLVALEERYDLMGVYILGFITAFGGGAI
FT                   RNLLIGIPVTELWNQGALFTLAFLVMTLAFFFPNILNWTLQKRGVFFDAIGLGTFSAQG
FT                   ALFAASMGLPISAAIAAAALTGAGGGMVRDVLAGRKPMFLHKEIYIAWTLIPGLLIGSG
FT                   LVTSDIGAFLIVSAVVLLRLGSVQKQWHLPYQSFQPLTK"
FT   gene            494091..495158
FT                   /locus_tag="Bsel_0465"
FT   CDS_pept        494091..495158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0465"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="KEGG: eba:ebA7223 zinc-containing alcohol
FT                   dehydrogenase; TIGRFAM: quinone oxidoreductase, YhdH/YhfP
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98003"
FT                   /db_xref="GOA:D6XXE6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE6"
FT                   /inference="protein motif:TFAM:TIGR02823"
FT                   /protein_id="ADH98003.1"
FT                   /translation="MNLQGNETGGEKDSVKGEWTMTNETFQAFLAKGDGTGEVVNRTLE
FT                   ELPAGEVTIRVSYSDVNYKDALAMHPKTKVVRDYPTVPGIDLAGTVMASDDKRFKPGDR
FT                   VICTSYTLGVGHDGGYSEVARVPGDWVVPMPDGLTEREAMLMGTAGFTAALSIERMEEV
FT                   GVSPDKGPILVTGATGGVGSMAIAMLKKRGYTVTASTGKLASEDYLRKLGADEVIHRDS
FT                   LIPEQPAPLQKTVWAGVVDATGGAPLAAILPAVKQGGAVALSGMTAGVEFTTTVMPFIL
FT                   RGVSILGVDSGFCPMDLRGKVWTRAAGDLYPENLEHTLEEEVTIGELPRIFNRLLEGQA
FT                   VGRTLVRLGQDKGDA"
FT   gene            495158..495565
FT                   /locus_tag="Bsel_0466"
FT   CDS_pept        495158..495565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0466"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ara:Arad_4048 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98004"
FT                   /db_xref="GOA:D6XXE7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH98004.1"
FT                   /translation="MTIRGIAHMAITVRDMEKSLAFYCDQLGFDHAFQVKDEKGNPWIE
FT                   YVKVAPKQYIELFHGGNERPEEPDKAIGFHHVCLLVESVADTAKALEDQGVPLTVQPKR
FT                   GLGKNWQCWVNDPDGNRIEFLEPDGDSPHNQ"
FT   gene            complement(495626..497056)
FT                   /locus_tag="Bsel_0467"
FT   CDS_pept        complement(495626..497056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0467"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; glucose-inhibited
FT                   division protein A; KEGG: gbm:Gbem_0457 pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98005"
FT                   /db_xref="GOA:D6XXE8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE8"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ADH98005.1"
FT                   /translation="MKKYDVIVIGGGSGGLTVAAGAASFGAKTALIEGKALGGDCLNVG
FT                   CVPSKALIAAAKTVHQARQAGAFGLSVTGDVDIKAVMQQVQDAITDIQGHDSKERFENM
FT                   GVDVYDGYASFLERDVIAIEGTGSIRGEKIVISTGSSPVIPPVPGLKEAGPLTNETIFS
FT                   LETLPRRLAVIGAGAIGSEMAQAFARLGSEVTLIDMADTPLFREDGEVRETMTKVLSEE
FT                   LTFIGSAMVKEVTVNEQNEKQLLLEQNGKQVTVKADEILVAAGRRPNTGRLNLSFAGIE
FT                   TESTGAVKVDGSLRTTADGVYAVGDVNGGLQFTHVAGVEGKHVVQQLITGLHTKVSYNA
FT                   IPWVTFTDPEVFHLGQTEEELQEQGTEYRILKQPLNSTDRFVAERASVGFVKLLTDKKG
FT                   RLLGAHAVGHGAGDFMQEAVGVMKRGDAAHTLSTVVHPYPTHVEALKGASDQYWRSRMA
FT                   HGLIPYASEKWMQLKRKR"
FT   gene            complement(497053..497715)
FT                   /locus_tag="Bsel_0468"
FT   CDS_pept        complement(497053..497715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0468"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   wsu:WS0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98006"
FT                   /db_xref="GOA:D6XXE9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXE9"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH98006.1"
FT                   /translation="MNRWLTIALVTAVIGGLLWFSRSYLDVSPEEIRNWILGFGTLAPI
FT                   LFITLYALRPIILFPASVMSLAGGLAFGALWGTVIIVIGATLSAAIAYLIGGKLGSRLI
FT                   KVKEGGKTATIQKQMAHNGFVYVLIFRFIPVINFDAISYIAATAGVKFRAFITATFIGI
FT                   IPGTFAYAFLGSSFVTLNPWQIAAAVAIFLVFMIVPILLRKKTVRQNRPGRRRRECA"
FT   gene            complement(497746..498000)
FT                   /locus_tag="Bsel_0469"
FT   CDS_pept        complement(497746..498000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98007"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98007.1"
FT                   /translation="MGLIQQAAEQAGIATASVTHLPDLTEKVSVPRALHIKFPLGRTFG
FT                   QAGRSDLQEKITVDLLEAVQNRTEDDEKIQKLPYRWRRD"
FT   gene            complement(498019..498486)
FT                   /locus_tag="Bsel_0470"
FT   CDS_pept        complement(498019..498486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98008"
FT                   /db_xref="GOA:D6XXF1"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF1"
FT                   /inference="similar to AA sequence:KEGG:Gura_0093"
FT                   /protein_id="ADH98008.1"
FT                   /translation="MLKQIKHWLFKLSANRTINNRDRTNAFTTPVKPMTNWNVAFLTTA
FT                   GVHLKSQEGFDVDAGDPSVRLIPSDTDPDQLMITHTHYDTEEADKDTGAVFPLEALKKL
FT                   AEEGRIGSVAKTHYGMMGYIPETDRLDQESIPVILKQLKKEHVDVLLLSPG"
FT   gene            498629..499012
FT                   /locus_tag="Bsel_0471"
FT   CDS_pept        498629..499012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0471"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: cbc:CbuK_0645 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98009"
FT                   /db_xref="GOA:D6XXF2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH98009.1"
FT                   /translation="MLSSDDTRPIYKQLAEWLETEILSGQFQEGDKVYSQYQLADLYTI
FT                   NPATAAKGLTILLDEGILYKKRGLGMFVAEGARETILTKRRATTVRQSARSFVKEATYV
FT                   GMTDEEMLALLKEMQKEASRDED"
FT   gene            499002..499904
FT                   /locus_tag="Bsel_0472"
FT   CDS_pept        499002..499904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0472"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vpa:VPA0033 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98010"
FT                   /db_xref="GOA:D6XXF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH98010.1"
FT                   /translation="MKIECKQATKRFGRRTEAVKDVSLTLDQPSITGLVGRNGAGKTTL
FT                   LQLMAGYLKPTEGKVLIGGEAPFNHEALAANVSLIDDRMAFPEGLSLGMVMKLAEKMYP
FT                   NWNKVIGDGLFAYFGFDHKARHEDLSKGKKSLFNAVFGLAARTDVTFFDEPTTGMDEET
FT                   RRDFYRALLKDYLEEPRIILVSSHHIGELEDLLESVIVMEEGRIFLHEDMADLDDYAFS
FT                   VTGSNEAVTAAVAGKHVLDEEAVGPNLKRVLLKRDMTTIPEPFTDAGFKVGRVSATEVC
FT                   HALTKSRKGAIDDVYSRQH"
FT   gene            499879..500613
FT                   /locus_tag="Bsel_0473"
FT   CDS_pept        499879..500613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98011"
FT                   /db_xref="GOA:D6XXF4"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98011.1"
FT                   /translation="MMSTAANTNTMTWNLVRMKLASSGYVLWQLMFLQGLGFLFSLNPN
FT                   AGGGGGMQFMSYSFSSYSGTIVFFFTVIWMMIVTGGLTLKRVQTGVFSFPATRDTEAWS
FT                   NGIIMLIYSFIGALTAILIQFPLILIHRFVMATDGIVIVEEATLAAYLSGFIGTWLYLL
FT                   LTGSLAYLIWTLFQQHVFIRIGTVAALAILLFTPVNSVTGSVFLWIAEENVLTVFAVKA
FT                   LLVSVVFYVSGFLLMRRMEVIR"
FT   gene            500613..501338
FT                   /locus_tag="Bsel_0474"
FT   CDS_pept        500613..501338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98012"
FT                   /db_xref="GOA:D6XXF5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98012.1"
FT                   /translation="MSLVLFSLLNIGIMVVVFYVLYRVFFSRLQNRSQSLSFRAFGVYL
FT                   ALLLLAVPFVLIVDGDETEPMQEAEPGMLETVREDVMALIEAGDREGLMTDHRTEILTL
FT                   SASEWPGGISATENLNGIHLIRDTDPAYGDDITVTFVYPHSEFNERVVTEELPEVGLEE
FT                   TDDGISLNFSDQELVFSFITPMITVEQFSDGEEGDHPFMSTSFTSSQSQPIVWIQSAEW
FT                   LPVDGYFSETTRIERQEEE"
FT   gene            501335..501685
FT                   /locus_tag="Bsel_0475"
FT   CDS_pept        501335..501685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98013"
FT                   /db_xref="GOA:D6XXF6"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98013.1"
FT                   /translation="MKDTVLFTVELLRIILILFAALVGYSLLNTFVMDFFGGLDVFEGN
FT                   DFFRTWFFLLQTLGILGLVTVLYRNKLKKSGWMAKYQGPLQARTVWWIVRISLAAIVAS
FT                   YGIFFGLVVFSG"
FT   gene            501752..502738
FT                   /locus_tag="Bsel_0476"
FT   CDS_pept        501752..502738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0476"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; KEGG: gme:Gmet_3086
FT                   transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98014"
FT                   /db_xref="GOA:D6XXF7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF7"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADH98014.1"
FT                   /translation="MSTSKFSRPERLFYIMQFLSNHDTVNAGELADHCQATKRTIYRDI
FT                   HFLQSQGHEIQTQGREGYKLLIPNMQVRSKLTEDEWLSLTLYPLLSSGIASSDHPYHRH
FT                   YKTGLEKVMRLASGGAPNPAFAERIRLHARTQDTFQAKVMPAIITAISDNRCIDVRYYA
FT                   MHRSEWSERRLEPYYLVPREGHLYLVAFCRLRNDIRVFRLNRFEDVHVTDAPFTIPQDF
FT                   SIDAFLKKRWSIMEEEEPVDITVRFSPDAARYVDEEDFYVETKKYNETDGTLTLTVTVG
FT                   SRKEFLRWMRSFGPDAEVLSPASLRQALAAEYRHMLGMYEGDDERLW"
FT   gene            502732..503475
FT                   /locus_tag="Bsel_0477"
FT   CDS_pept        502732..503475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98015"
FT                   /db_xref="GOA:D6XXF8"
FT                   /db_xref="InterPro:IPR017259"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98015.1"
FT                   /translation="MVVLHVIQLVMGLTLSGIGYLLLQGKMHSLVSGFASRSEQEQKDM
FT                   LEAGYMTVTGRGLFLSGAVLLIGLVFGLMGLFQANFFMWGVFLLVLFVTAYRGIAREPE
FT                   RTRKRNRIVMHVTVVFTAGVLIFVTIAGFSDNDLIVRDDSFEVSGLYGDTWSLDDVEAV
FT                   SLETDGPSITMRTNGFSFGSTVKGRFRLSDGGRALLFLELDEQPFLRIELDDDTVWIHD
FT                   GDRDVTESWYDELTERLADREGEVR"
FT   gene            503472..504113
FT                   /locus_tag="Bsel_0478"
FT   CDS_pept        503472..504113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0478"
FT                   /product="futalosine nucleosidase"
FT                   /note="KEGG: dde:Dde_3188 hypothetical protein; TIGRFAM:
FT                   futalosine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98016"
FT                   /db_xref="GOA:D6XXF9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXF9"
FT                   /inference="protein motif:TFAM:TIGR03664"
FT                   /protein_id="ADH98016.1"
FT                   /translation="MKQILIVTSVDKERQAVEAGLKGDPRFLTGLCGVGPVEAAVRTMK
FT                   LLSTCSSSVEAVLNLGVAGGIPGKAAVGEAVLGTKTVQADLGFEQADGSFEAIEALGFT
FT                   VSERDANSDLISRVREALRENVHEGPIVTQSTVTGTKASLETLLQRVPDAMAEGMEGFA
FT                   VHSAAEAYGIPALELRAISNPVGPRKRGEWQLEDALHTLTGLTVQLKGGM"
FT   gene            504114..504959
FT                   /locus_tag="Bsel_0479"
FT   CDS_pept        504114..504959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0479"
FT                   /product="protein of unknown function DUF191"
FT                   /note="PFAM: protein of unknown function DUF191; KEGG:
FT                   gur:Gura_0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98017"
FT                   /db_xref="GOA:D6XXG0"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG0"
FT                   /inference="protein motif:PFAM:PF02642"
FT                   /protein_id="ADH98017.1"
FT                   /translation="MQRIAFSPCPNDTFIFHALVKGLIKGAPPLDVTYADIDKTNYWAQ
FT                   DREGPGIMKISYAALPYVVDDYQLIPCGGALGRGVGPLVLTKEPADGISFLKGKTVAVP
FT                   SDRSTAYMLFRLWVAQRLPEGVGKIVILPFQDIMPAVRDGKVDAGLVIHEARFTYPLYG
FT                   LNLLQDLGDWWEQDTGAPIPLGAIIARKGQVDAGQWTDWIRSSVQYAFDHPDASAAYVM
FT                   EHAQEMEKDVQKQHIDLYVNEFSLDLGKDGFHAVDSLLGRAAKEGLVPEIDLKRLRLGE
FT                   "
FT   gene            complement(505054..506451)
FT                   /locus_tag="Bsel_0480"
FT   CDS_pept        complement(505054..506451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0480"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rlt:Rleg2_0160 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98018"
FT                   /db_xref="GOA:D6XXG1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH98018.1"
FT                   /translation="MDTYQKKIIVALLIATFLAAVEVTVISTAMPSITSDLGGMDKISW
FT                   VFAAYLLTYAVMTPIFGKLADLFGRKRVFIGGVSVFLLGSVLCGFSQSMEQLIFFRAIQ
FT                   GIGAGALTPMTFTIVGDVFQYEQRAKAQAIIGSIWGVAGIFGPLVGGFFVDFLTWHWIF
FT                   FINVPFGLVAMHLVGRHLQEQIEKKKRRIDYKGALTFIIGTGALLYALLSGGTDIAWTD
FT                   PLMYSLFLIAGLFLVLFVRIQIRTAEPMVPLHLLKNQHLLTANLASLMLGMILIGLTAY
FT                   LPLWVQGVLGLAAIFSGLTLIPMSLGWPIAAFMSSRLLKQFGAKPVCIGGTGLIMLSTL
FT                   AMTFVTAATPNWLLVIIMFFVGAGFGLAMTMFTVIVQSSVDWTNRGAASSSNAFLRTLG
FT                   QTLGITILGATLNQYIGGYGGEASAPADVLASGLSTVFLLLFIIATVAFLITFRLPSEE
FT                   PEHARSS"
FT   gene            complement(506537..507274)
FT                   /locus_tag="Bsel_0481"
FT   CDS_pept        complement(506537..507274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0481"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   shn:Shewana3_2409 sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98019"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG2"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ADH98019.1"
FT                   /translation="MRLNNKILPAFVLVLILTAAGCSQVSDNEDTLSEPSENNTVEGNS
FT                   QTGVNDVLADGESETEEPIESAGSETDSKENSQVVQTTEPVQPVSSGPRGIDPSVISIP
FT                   AIDVRADIEDVGILENGQMGVPDDGDTVGWFHRGPKPGAAGNSVMAGHVDDRSGPAIFF
FT                   DLDQLTLGDRIYIEDVEGTELAFEVTRMEVYPYDDAPMDLIFGPSATQRLNLITCTGEF
FT                   DRNAGTHRERLVVFTELVTDQEL"
FT   gene            complement(507258..508145)
FT                   /locus_tag="Bsel_0482"
FT   CDS_pept        complement(507258..508145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98020"
FT                   /db_xref="GOA:D6XXG3"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98020.1"
FT                   /translation="MQLIISICCTKTNLHAKNQIEEMIQLQLKKWLLSSLAMVLMLSLF
FT                   AGTAFADNHGDDNAMVRVFHASPDAPAVDIYVNGDLAVEGAAFEDITGYLELPAGDHDV
FT                   AIHAAGEDEAVYEQTLTVEGGTHYTVAAVDFLDGGDFRLEAFVDDNTVAEGMTKVRVGH
FT                   LSPDAPAVDVGLVGGDSLFEGAEFFAVTDYLELDPDTYDLEIRAAGTEDQVLDLSGTTL
FT                   EADTVYSVYAVGALEDLGVVVVADDAYAMPGDMPQTGMGGASQSSTMLPLYLSLLAGAG
FT                   AMFVIVRRRYAFEQ"
FT   gene            508600..509721
FT                   /locus_tag="Bsel_0483"
FT   CDS_pept        508600..509721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0483"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: pmu:PM0995 cystathionine gamma-synthase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein;
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98021"
FT                   /db_xref="GOA:D6XXG4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG4"
FT                   /inference="protein motif:PRIAM:2.5.1.48"
FT                   /protein_id="ADH98021.1"
FT                   /translation="MGKKQRLLDTSVVQIGNRSDERTGTVSPAIYPSTAYRHEGIGKST
FT                   GYDYSRTGNPTREVLEEGIAQLEGGHGGFACSSGMAAIQVVMSLFEQGDHILATSDLYG
FT                   GTYRLFEEGWRKWGLSFSYGDAEDLAFFENAITEQTKALFIETPTNPMMHVADLSAFSA
FT                   LAKKHGLLLIVDNTFYTPYLQRPIESGADIVIHSASKYLAGHNDVIAGLVVTAEASLSE
FT                   RVGYYLNSIGAILSPMDAWLVMRGMKTLALRMERHRENARRIATFLKDHPLVTDVLYPG
FT                   DGGMMSFRVKEEAMVNPLLQHLELITFAESLGGVESLMTYPATQTHADVPEEVRARLGV
FT                   CNRLLRFSVGIEGADDLIDDLDQALNQAGGNVS"
FT   gene            509718..510878
FT                   /locus_tag="Bsel_0484"
FT   CDS_pept        509718..510878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0484"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="KEGG: gsu:GSU0945 cystathionine beta-lyase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98022"
FT                   /db_xref="GOA:D6XXG5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG5"
FT                   /inference="protein motif:PRIAM:4.4.1.1"
FT                   /protein_id="ADH98022.1"
FT                   /translation="MTESLDIQTRLLHHRHKTDPHNGAVSVGVQHASTFHQNSLEQFGA
FT                   YDYARSGNPTREALEEIFAGLENGTDAFAFASGMAAISTTFMLLSSGDHLVITEDVYGG
FT                   TFRMTTEVLTRLGIEHTFVDMTRVDEVKATLQDNTKMIFMETPSNPTMKITPIRDIVAL
FT                   AEAHDCLTVLDNTFMTPVLQRPLDLGVDIVVHSATKFIGGHSDVVSGLAVVKRPDLAGR
FT                   LGFLQNSFGAIPGPDDCWLIMRGLKTLHTRMMVSQEVASNLAHWLDVQPEVKRVYYPGF
FT                   SDQLGNAIHAGQSDGPGAVLSFELADREAVSRFSQAVEIPVFAVSLGAVESILSYPAKM
FT                   SHAAMPDHERVARGITDGLLRLSVGLESEADLKRDFRQAFDSLARM"
FT   gene            510889..512743
FT                   /pseudo
FT                   /locus_tag="Bsel_0485"
FT   gene            512740..516216
FT                   /locus_tag="Bsel_0486"
FT   CDS_pept        512740..516216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0486"
FT                   /product="methionine synthase"
FT                   /note="KEGG: glo:Glov_2133 methionine synthase; TIGRFAM:
FT                   methionine synthase; PFAM: homocysteine
FT                   S-methyltransferase; Methionine synthase B12-binding module
FT                   cap domain protein; cobalamin B12-binding domain protein;
FT                   dihydropteroate synthase DHPS; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98023"
FT                   /db_xref="GOA:D6XXG6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG6"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADH98023.1"
FT                   /translation="MTVTTKQASAFRDALKERILVLDGAMGTMLQNANLTPEQFGGEAY
FT                   EGCNEYLNITAPEVIRTIYHDYLEAGADIIETNTFGATDLVLDDYDLGHLAYELNKAAA
FT                   SIAVEEARAFSTDSEPRFVAGAMGPTTKSLSVTGGTTFEELSSAYKEQVEGLLDGGVDL
FT                   LLLETSQDMRNVKAAYTAIEEVLSERDLDVPLIISGTIEPMGTTLAGQTIESFYISLEH
FT                   MKPTVVGLNCATGPEFMQDHLRSLSELSTGFVHCYPNAGLPDEEGHYHETPSSLASKLR
FT                   DFAEKGWLNVVGGCCGTTPEHIRAMKEAVRGFAPRQPAQETHHSISGIEPLIYDESLRP
FT                   ILVGERTNVIGSKKFKRLIADGKFEEASEIARAQVKRGAMVVDVCLADPDRDEMADMEQ
FT                   FLHYVINKVKVPLMIDSTDEHVIEKALTYSQGKAIINSINLEDGEERFEAVCPLIRRYG
FT                   AAVVVGTIDEEGMGVSAERKLAIAKRSYELLTGKYGIAPEDIIFDPLVFPVGTGDEQYI
FT                   GSAEATVEGIRLIKKAFPRTMTILGVSNVSFGLPPLGREVLNAAFVYHCTKAGLDYAIV
FT                   NTEKLERYGSVSEDEKKLADELLFRTSDETLAEFTAFYRAKKPQQKVEASKRTLEERLA
FT                   NYIIEGTKEGLYTDLDEALAKYPDPLDIINGPLMDGMDEVGKLFNNNELIVAEVLQSAE
FT                   AMKAAVAHLEPHMEKKESDDRGKGKILLATVKGDVHDIGKNLVEIILSNNGFQVVNLGI
FT                   KVASHELIEAVEREDPDYIGLSGLLVKSTQQMVITANDLRERGIDIPILVGGAALTRKF
FT                   TETKITRQYNGLVLYAKDAMNGLSLANKLAKPETRDELVAVQHEKQLKLNEAEAAGDGM
FT                   ASKGKTNTATADPAQSEVSRDHKVYQPEDFEPHILRDFRLTHLQPYLNLQTLLGSHLGV
FT                   NGNVRRKLESGDERTKELLDKVNALIQKGEQEKLLRADGMYQFFPAQSNGNDILIYDPN
FT                   DESSVIERFTFPRQTQAPYMCLSDFLKSVDSGEMDRVGFLAVTAGKGIRKLAEAAKESG
FT                   DYLDSYLVQAVALELAEGFAERVHQQMRDKWGFSDPVDLTMQDRFSARYQGVRVSYGYP
FT                   ACPNLEDQKKLFGLLKPEKIGIELTDEYMMEPEASVTAMVFSHPEGRYFNV"
FT   gene            516341..517273
FT                   /locus_tag="Bsel_0487"
FT   CDS_pept        516341..517273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0487"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: sun:SUN_1298 putative manganese-dependent
FT                   inorganic pyrophosphatase; PFAM: DHHA2 domain protein;
FT                   phosphoesterase RecJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98024"
FT                   /db_xref="GOA:D6XXG7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG7"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADH98024.1"
FT                   /translation="MSEEKVLIFGHRNPDTDTICSALVYADLKTKLGENVEAVRLGEVG
FT                   AETQCALDTFGVTAPRMMEHVSDEASKVILVDHNERQQSAEDIDQVQVTEVIDHHRIAN
FT                   FETDSPLYYRAEPVGCTATILNKMYKEHGVEVSKEMAGLMVSAIISDSLLFKSPTCTDE
FT                   DLAAAKELAPVAGIDLDEYGLEMLKAGANMAEKTPEQLITLDSKEFAMGDVKAVIGQVN
FT                   VVDAGDVLDRQAAVEEAMQKEVESRGLGLYMLAVTDILNSNSIALAVGDKKEAIEQAFD
FT                   VRFENGQATLEGVVSRKKQIVPPLQKLLG"
FT   gene            complement(517331..518209)
FT                   /pseudo
FT                   /locus_tag="Bsel_0488"
FT   gene            complement(518352..518780)
FT                   /locus_tag="Bsel_0489"
FT   CDS_pept        complement(518352..518780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amf:AMF_069 thioredoxin (TrxA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98025"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98025.1"
FT                   /translation="MKRILFPAIIMILSAVLFACGSNSSASTDQYYSDLDESAKAFYQK
FT                   NEVLYNGIDDIDDERFLLYVHSPECKFCIQYMPEIQTYEARSEGTYPLYKINASLNENA
FT                   NVWETYGIEGVPTTLLMENGEEIDRIVGYVPAGDIFTP"
FT   gene            complement(518948..519631)
FT                   /locus_tag="Bsel_0490"
FT   CDS_pept        complement(518948..519631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0490"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: ent:Ent638_2505 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98026"
FT                   /db_xref="GOA:D6XXG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXG9"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH98026.1"
FT                   /translation="MSQIEWQYIFDPALAWRALPTVLEGLTLTLYISLISMVLGLVMSL
FT                   FLALARQSGHLYLQIPARMYISFMRGVPILIILFMLYFGFPYIGIEFTAVNAAIIGFSF
FT                   NSAAYMAEINRSAIDAVPKGQWEAARSLGLSYTKMMRQVVLPQASRIAVPPLTNVLLDL
FT                   IKASSLAAMITVPEIFQMSRIVAGREMDYMTMFILVAMIYWVICTLMTQLQNYLEKRFA
FT                   RYGEL"
FT   gene            complement(519719..520591)
FT                   /locus_tag="Bsel_0491"
FT   CDS_pept        complement(519719..520591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0491"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: ccv:CCV52592_2239 flagellar hook protein FlgE;
FT                   PFAM: extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98027"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH0"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH98027.1"
FT                   /translation="MENETMPFFKTAAAVLTTGLLLTACGNGDGNETASDNDTGGEPSS
FT                   WDEIEESGVLTVATSGTLYPTSFHDEDEGLTGFEVEVTREAAERLGLEVEFTEMGFDGM
FT                   LTSINSGQVDLAVNDIDINEDREERFLFTDPYKFSYGAMIVRPDDFSGIETLEDLEGKK
FT                   HGGAATTIYMQIAESYGAEGVTYENVTNDTYLRDIENGRLDVVMNDFYLQSLAIEALPE
FT                   IDVVIHPDLFYHPNNQAMIMKEDSHELQEQLNRVIAEMMEDGTITALSEQFFGGQDVSQ
FT                   EPDVDFDDE"
FT   gene            520805..521380
FT                   /locus_tag="Bsel_0492"
FT   CDS_pept        520805..521380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0492"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dol:Dole_1242
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98028"
FT                   /db_xref="GOA:D6XXH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH98028.1"
FT                   /translation="MSRKKTIDRVDLYTATEELILEEGYSSFHFKALAERLGVARSTIY
FT                   NYYDKKEELITDYMIHLLARSVERIDDTAHDPEPVKGLIRLWSRYAHIHQMLQIMPYID
FT                   QEASDKVKENVRRMFQLFMEMKEKIGVILTTGEEATKIRQDVSLSTRIGFIMATVQIPI
FT                   QGMTEEEWVDEVYTILRDGLYTKPTDTR"
FT   gene            521459..524539
FT                   /locus_tag="Bsel_0493"
FT   CDS_pept        521459..524539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0493"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   hch:HCH_06591 cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98029"
FT                   /db_xref="GOA:D6XXH2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH2"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADH98029.1"
FT                   /translation="MFEKIIERSKITLMFLLIAVIIGALTLVTLPQREVPEFAFDIGNI
FT                   STVYPGATPEEVEQQVTIPLEDAVESIEGIDSKSSVSTSGFSNITVELVDGVNQTEVFT
FT                   DIQQAINGALGDLPDEAQDPDFTQAQTIGALSSYHLLADSREDLYEVRDIVHDWQREIE
FT                   RMMDINRTDVKGFPDQQFRVNIDSEEMFERGLQFPDVIDAIESELNTSPLGIEERNGEN
FT                   VQLSLTTLDELDDIAGIFVANDFEGDAVYLEDIAEVGLMHETPSDLITYEETPALSFTV
FT                   FSEGGVNIPQIHDQVDERMMELKEELPDEVSLELFYTQKTIVDEIFGDLSLSFSLAVLS
FT                   VILVTLLGLNVSSAVIVALAIPTSVLIGLIPLPFFQVDLNQISIIGIIIALGILVDDGI
FT                   VVGDNIRNKYKAGMAPVEGALKGSKEVRTSIITSTLTVVFTFLPLVFIQGGNGDFIRAL
FT                   PTVLITTIIASTIVALTLVPIFLIWRQKKQYRAKKKRISQRDGLLGKQFDKLADWYSDT
FT                   LLTRVVRHPWKVSIVGFVITTAFYGLIPFIPVEFFPSTDRDEVTLDVRMPAGTTIEETQ
FT                   STLNEIRERILEEDEHVYETAVYAGGGLPPLFGDGISNSGEETGNLLLRVNREEQSANE
FT                   TIDRWTPILQEEFGFAEPELTTIEAGPPVGAPIAITLQGPDVNTLIDLSNELQERVNEI
FT                   PESGTVRDDMGPLRPTVVYEPVREELEENSIRMRDISEQISLRTDGLPLLTFRTAEESV
FT                   GIQLLLDAVEDGEGVDLSEIVLPAENGGGEDGGAPELIGLDELLTEAGSEEIPQIIRDD
FT                   STRTITVRVFPSSEDDNGLEDQIETITEELQADAGSDYTVSLGGETEARTDFIIELFTL
FT                   FILVLFLIYIVMAIQFYSLTMPLLVMSTVHIAGAGAVIGLFLTQTGLGFMALMGIVSLA
FT                   GIVVRNSIVLLEFIKQRRAEGMGIKESVIEAGRVRLRPILLTAFTAIGALTPVALSGDV
FT                   LFVPLAISIISGLLFSAMITVIIVPAVYTAFATKFGK"
FT   gene            complement(524610..525974)
FT                   /locus_tag="Bsel_0494"
FT   CDS_pept        complement(524610..525974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0494"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE integral
FT                   membrane region; CBS domain containing protein; MgtE
FT                   intracellular region; KEGG: pca:Pcar_0596 magnesium
FT                   transporter; SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98030"
FT                   /db_xref="GOA:D6XXH3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH3"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADH98030.1"
FT                   /translation="MSFNRSDIQTIYENELKAMIQDRDKAGFKEVVTSLHPQDQMDLYV
FT                   HLREQERRFLYETMPPQAFALVFQELDVLDQTRYIHELEEDYARAVIRHMASDEAADFL
FT                   LQTRQDKVSRLLEESDDAFSRNIKELLTYEEETAGSIMTKEFISLRTTDRISDVIAMLR
FT                   VEGPKAETIYYLYVIDDRHKLVGVASLRDLIVAEPDAFVQDVMSTRLISVKALDDQEDV
FT                   AHLFKKYDFLAIPVVTEKRKLIGIITVDDILDVMEAEQTEDLGEFAASRGATDVSLSPV
FT                   TAAKKRAPWIILLMFFGMITAGVIGQFEETLEAIVLLAGFIPLIMDSAGNTGTQSLAVA
FT                   VRSLALGTVEKKGVRNMIAREFRTGVMLGLMCAVTLIVIVPVIYPGEFLLAGIVAVSIL
FT                   FSLSLATVIGTVVPLIIHKLNLDPAIASGPFITTVNDIIGLMIYFTFATSLLQYL"
FT   gene            complement(526035..527399)
FT                   /locus_tag="Bsel_0495"
FT   CDS_pept        complement(526035..527399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0495"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE integral
FT                   membrane region; MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: dat:HRM2_28170 MgtE2; SMART: CBS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98031"
FT                   /db_xref="GOA:D6XXH4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH4"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADH98031.1"
FT                   /translation="MVKLTEQNREEYELAVVRTLQDEDLESFRELFFDLHIMDQLDIYI
FT                   NIGKDQRKILYHFISPEEFAEIFEELEFEQQKLYMKELSTDYARDVINNMSDDDIADFL
FT                   GEMDESESNKIIETLDKEDQADIKELLSYEEETAGGIMTKEFISLHANDRIEDVINLLR
FT                   EEGPDAETIYYLYVANEKDQLVGVVSLRDLITADAHRKVEEVMSTRVLSVKTSDDQEDV
FT                   ARLFQKYDFLAVPVITDDGLLVGIITFDDILDVIEEEASEDLDEFAASRGSTDMKITPF
FT                   AAAKLRAPWIILLMFIGMVSANIIGQFEETLEAAVLLAGFIPMIMGSAGNAGTQSLAVA
FT                   VRSIAVGTSEKKGLGKLVFRELSTGFLLGIICAVVLIIIIPIMYSGNFMLAVVVGTSLT
FT                   LSLTLATIIGTLIPMFIHKLNLDPAIASGPFITTINDIVGLLIYFSVATSLLAYL"
FT   gene            528014..528784
FT                   /locus_tag="Bsel_0496"
FT   CDS_pept        528014..528784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0496"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   rlt:Rleg2_5263 signal transduction histidine kinase; SMART:
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98032"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH98032.1"
FT                   /translation="MTNLQELKNKVLEKTQLVFIISDPDLPDNPIIYANRGFMELTGYS
FT                   TDEVIGYNCRFLQGDDTSPQTVSILREAIRLMEPVSVEILNYKKSGEPFWNLLHIDPIY
FT                   LEEEDKYYFVGIQKDITEIKQAEQKIASYHKEIERLSTPIVPIKEGISVLPLIGSIDEE
FT                   RLNAIIERTLPALEADEVEILILDLSGFSQLDQEATVGIFQLNDLMKLKGVELILTGIT
FT                   PKIAMRTRGLGMDLSGLKTFASVKQAIEQIEKRM"
FT   gene            528920..529366
FT                   /locus_tag="Bsel_0497"
FT   CDS_pept        528920..529366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0497"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: glo:Glov_1634 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98033"
FT                   /db_xref="GOA:D6XXH6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH6"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADH98033.1"
FT                   /translation="MDDEIKQLAGYHITLTAHLLQNEHNRALGDLDVTPAQSKALYLLN
FT                   RFGSQSQTELQDRMYIKGSTMNGIIDSLQKKHLIHKEDSKTDRRVKVIWLTEEGERLER
FT                   EIWEMLGALEARLMAGISPKRKQELIRTIEQLQDNLKTNHADIG"
FT   gene            529381..530799
FT                   /locus_tag="Bsel_0498"
FT   CDS_pept        529381..530799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0498"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: dal:Dalk_2553 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98034"
FT                   /db_xref="GOA:D6XXH7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH7"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADH98034.1"
FT                   /translation="MNRQKEQSRQLGEESVPKLLLRLSIPAVIGMLVMSLYNVVDTIFI
FT                   SYFVGVDGVAGVTFAFPLMIIMMAVAAALGIGGASVISRRLGEGREKEANLVFGNILSL
FT                   VLITGVIGVIAAFTVLEPTLRLFGATEGIMGHALDYIFPITLATVFFTYGFATNSIIRA
FT                   EGNARFAMMTMIIPSVLNILLDPVFIIWLDMGVQGAAIATVISQAVTAAVTLGYFLRGH
FT                   SSLVMTKAYMTLQFKTVKEIFVIGMPGFARQVAGSVMMVAINAMLIRYGGDFYVGVFGI
FT                   VQRVSMFALMPMMGILQGMQPIIGYNYGARQMVRFRETIKLGLKVVTIFSAGVFVVMML
FT                   LPEWLMQIFSQDPAVIATGSEGMRIVFAMAILIGAQVVSGGIYQAIGHARPALILSLAR
FT                   QVLFLIPLVLILPPFIGVTGVWLAFPIADILAFALSAYLLYKDRQLFFYGDPPGGTNEQ
FT                   PGKVQKQVTEEYQT"
FT   gene            complement(530869..531498)
FT                   /locus_tag="Bsel_0499"
FT   CDS_pept        complement(530869..531498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0499"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bgl:bglu_1g07350 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98035"
FT                   /db_xref="GOA:D6XXH8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH98035.1"
FT                   /translation="MVDYTGERVIPKLMKPSDQLLLEHIARYDFAKPYVSGRVLDIACG
FT                   SGYGTARLAKGRNKALETIIGADVDPEIIEFAHKEYYHPKMSFIVADGRAADLPDRLGT
FT                   FDTVISFETIEHVSDDRQFFHNLISLLKPGGTLVLSTPIGRGRSIPSKSPFHYFELTEE
FT                   EIRQLVSDGSPDIASSLLYFQNSVALEREKRPDVHYPIAVAVIQKK"
FT   gene            complement(531511..531936)
FT                   /locus_tag="Bsel_0500"
FT   CDS_pept        complement(531511..531936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0500"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dvm:DvMF_1529 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98036"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXH9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADH98036.1"
FT                   /translation="MFSNIILAADGSEHSLRAAEKAIALGKLSKKPQIELLHVVSGATS
FT                   KTDVLHHGDSDAASRKRRKQLDPIVERIERANIPVTVTTITASNSVPESIIKHVNEQNP
FT                   DVLVLGSRGLSSVQTMVLGSVSHKVMKYVKAPVMMVK"
FT   gene            complement(532019..533482)
FT                   /locus_tag="Bsel_0501"
FT   CDS_pept        complement(532019..533482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0501"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS;
FT                   Xanthine/uracil/vitamin C permease; KEGG: avi:Avi_5067
FT                   sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98037"
FT                   /db_xref="GOA:D6XXI0"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI0"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ADH98037.1"
FT                   /translation="MNLIQNFKQTWLFNVRGDILAGIVVALALIPEAIAFSIIAGVDPM
FT                   VGLYASFSIALVIAIVGGRPGMISGATGAMALLMITLVADHGLEYLLAATILTGIIQIL
FT                   FGVFKLSSIMKFVPRSVMIGFVNALAILIFTSQLQHFVGETWIMYALVALTLAIIYILP
FT                   RFTTAVPSTLVAIIVVTAIAIVMNMGVRTVGDMGSLSSTLPIFALPNIPLTFETFMIIL
FT                   PYSLALAIVGILESLLTASIVDDMTDTDSNKNKESRGQGIANVVSGCFGGMAGCAMIGQ
FT                   SVINVKSGGRGRLSSLTSAVTLMFLIIVLGSVVVQIPMAALAGVMIMVSIGTFDWSSLR
FT                   NIHRIPRSDAAVMVVTVGTVVYTHDLSLGVLAGVLLSAVFFAWKVSKVNVHKIYHDKDR
FT                   SVTYHVEGQLFFASVTDFLEKVDFFEDVDTVTFDISNSHLWDDSAIGAFDKIESKFEKR
FT                   DIPVYYTGMNRESTQLYDRITGLSKASGH"
FT   gene            533747..534163
FT                   /locus_tag="Bsel_0502"
FT   CDS_pept        533747..534163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98038"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98038.1"
FT                   /translation="MRILMIVLLFVITACAPPTNQEGITLEIDATYTSGTLYLVPMIVH
FT                   EGNEAVSVSLYDAELRIVEVTREDATVYDSSPGSTGDEPVILEQGEVYEGSPVRFTAEA
FT                   GEYEVRAVAEITVTDDELAEDLSLSTEVTVQVQG"
FT   gene            534331..534531
FT                   /locus_tag="Bsel_0503"
FT   CDS_pept        534331..534531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0503"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: pca:Pcar_2370 cold shock proteins; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98039"
FT                   /db_xref="GOA:D6XXI2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI2"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADH98039.1"
FT                   /translation="MMTGKVKWFNAEKGFGFIEREDGDDVFVHFSAIQAEGFKTLDEGQ
FT                   DVEFEIVEGNRGPQAANVVKL"
FT   gene            534716..535711
FT                   /locus_tag="Bsel_0504"
FT   CDS_pept        534716..535711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0504"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: rso:RSp1286 putative DNA-binding sucrose
FT                   operon transcriptional repressor transcription regulator
FT                   protein; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98040"
FT                   /db_xref="GOA:D6XXI3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI3"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH98040.1"
FT                   /translation="MVTINDIARQAGVSRTTVSRVLNQNGYVSDRAKTKVLEVIEETGY
FT                   VPSEQAKSLRTKKTNVIGVILPRLSSETVSRVVDGMDRELAKAGYQILLSSTSLETEKE
FT                   ADHIRLLESRRVDGIVLFGTHKDEAILNAIKQAKVPVVVLGQDFTPHVSSVVYNDYEAS
FT                   RAAVAALADVGHEKIGFIGVDEADIAVGQERRRGYLDEMKSRGFAVLPEWMQTAGFDMA
FT                   SGSEAFQKMLEYSQTRPTAVFAVTDRLAIGAMQRAKDAGMSVPGEMAFISIGASEASQV
FT                   VTPKLATVDYYNEDAGMSIASLILEEIDEDMKDAKKIVMNYGLLLRDSLC"
FT   gene            535829..537241
FT                   /locus_tag="Bsel_0505"
FT   CDS_pept        535829..537241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0505"
FT                   /product="PTS system, sucrose-specific IIBC subunit"
FT                   /note="KEGG: asa:ASA_2992 PTS system, sucrose-specific IIBC
FT                   component; TIGRFAM: PTS system, sucrose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system EIIC; Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98041"
FT                   /db_xref="GOA:D6XXI4"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI4"
FT                   /inference="protein motif:TFAM:TIGR01996"
FT                   /protein_id="ADH98041.1"
FT                   /translation="MSEENKQIAEQLIEAVGGLENIESVAHCATRLRIMVSDKEKIDQE
FT                   KVEELGKVKGAFYNAGQFQVIFGTGTVNKIHEQVVALGAPESSSSDQKKNAAQKGNKVQ
FT                   RLLRTFGDIFVPIIPVLVATGLFMGLRGLLTQEEILAIFGMTPADISDNFLLYTQVLTD
FT                   TAFAFLPALIAWSAFRVFGGSPVIGIVLGLMLVNPALPNAYDVGSGDVDPLYMLGFIPV
FT                   IGYQGSVLPAFIAGFLGAKLEKWLRQRIPEALDLILTPFLTLLIMITAALFVLGPVFTI
FT                   VENGIMAGMSFVLELPLGLSGLIIGGLHQVIVITGVHHIFNLFEIQLLADDGFNPFNAL
FT                   ITAGIAAQGGAALAVAVKTSSKKLKALAFPSSISAFLGITEPAIFGVNLRYIKPFLMGL
FT                   IGGAAGGFFAALFNLQGNGMAVTVIPGMLLYIYDFMPLLLYILTNLIALSVAFILTWMF
FT                   GFNDEMLNEVNG"
FT   gene            537350..537757
FT                   /locus_tag="Bsel_0506"
FT   CDS_pept        537350..537757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0506"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   pmy:Pmen_2385 camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98042"
FT                   /db_xref="GOA:D6XXI5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI5"
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /protein_id="ADH98042.1"
FT                   /translation="MEKQMFYITIAVFVGGAAGTLLRFFINEWSSMALFPLGTVIENIS
FT                   GSLLLGLLTGWAAYRYMNPFFKEGLGAGFCGGFTTMSTLMADVTLLATAGGEAVLMTGL
FT                   YVFVSLAGGLIAAFTGIVLGERFAGKEGDGA"
FT   gene            537775..538140
FT                   /locus_tag="Bsel_0507"
FT   CDS_pept        537775..538140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0507"
FT                   /product="CrcB protein"
FT                   /note="KEGG: ftm:FTM_1582 CrcB family protein; TIGRFAM:
FT                   CrcB protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98043"
FT                   /db_xref="GOA:D6XXI6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI6"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADH98043.1"
FT                   /translation="MASLGGGLGAVARYHLGRLIKARLDQTWLPNAMLIVNIIGSFGLG
FT                   VTLGGLFGSVTETDPLPNLYFFLATGFMAAFTTFSTFSTEAVGLIRTRKFYPACLYISV
FT                   TLVASFLVFLAGMWLTV"
FT   gene            complement(538195..540144)
FT                   /locus_tag="Bsel_0508"
FT   CDS_pept        complement(538195..540144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0508"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="KEGG: rhi:NGR_c26260 putative BCCT family
FT                   transporter; TIGRFAM: choline/carnitine/betaine
FT                   transporter; PFAM: BCCT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98044"
FT                   /db_xref="GOA:D6XXI7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI7"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ADH98044.1"
FT                   /translation="MEKYSYETKNPNIVFYISAPIVLAFVLWGLFFPENLANVSSVALA
FT                   FTLDNFGWFYMLVTAFFIAFVLFLAISPFGKLKLGKPDEKPEFRFFSWLGMLFAAGIGV
FT                   GFVFWGVAEPILYYYDPHPDYIGQSDAVRAEAGLRYGVFHWALHPWAIFSLVALTLAYV
FT                   QFRKDQPALISSAFQPILGDRAYGGFGKAIDVLAVLATSTGVATTFGLSALQITGGLSY
FT                   LVDWIPNNATVNFIIIAIVTFLFIFSAATGVDKGIKILSTTNLILAGLLLFFVIIVGPT
FT                   LFIAQNFVSVLGNYMSNVVQMSFDLNPFGDGEWLGNNTIFFWAWHISWAPFMGIFIARI
FT                   SRGRTIREFVAGVLIVPSLLGALWFTTFGGTGLSLIMGGNDEIGDLVMNEVELALFATL
FT                   GELPISMITSVIAVILILIFFITSADSASYVLGAMTSQGSLSPKLTIKVIWGFLIAGTA
FT                   SVLLISGGLEGLQTASIVAALPFAMIMVVMVFSLLIMMTKDMKKDKIKTQRKQTKRVKD
FT                   EVYGGMKDEFYDEFREEAYDEMKEEVYGQMKEEVYDDFKDEVYDEFKDETYDRVKDEVY
FT                   EQMKEEAYEDFKGEAYDKVKEEVYEQVKDEVYDDIKEEVYEEFKEKIYEDLRDDLGEQL
FT                   NGELESPDDEKKDK"
FT   gene            complement(540282..541139)
FT                   /locus_tag="Bsel_0509"
FT   CDS_pept        complement(540282..541139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98045"
FT                   /db_xref="GOA:D6XXI8"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98045.1"
FT                   /translation="MTDPINGTADTIPLIGQNHTYYSSKWQDHQKPSVYCGFNLAALLV
FT                   TPFWLAYRHLYDWLIFYVLLQSVFVAGASFLPWLFYAAGLGADLVSSQLLFILTGFTLL
FT                   HLGFGLKANALYYRRIQHLKNHGNASPLFYRSGASVKSGIITGLSALLFAVLVNVPLAN
FT                   WTYNPALEPGIYVFSDDNPVPEGVLDVRDEPDFVKYEARINLLFIHDEPIGDRSFRLLL
FT                   ERETDSGNGMAITRDRSFGIFSSSEVTLDLLDSEDPLTDTGTYHLTIFLDEEEIADTVF
FT                   SISL"
FT   gene            541312..541908
FT                   /locus_tag="Bsel_0510"
FT   CDS_pept        541312..541908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98046"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98046.1"
FT                   /translation="MKWIVGVWMLILLAGCGGEEAVEEQDDFPHSLVHEGFSYTPFTYP
FT                   ADWDVTAVSSNVRLAFRNEDNPEENQFAQVPFRYTFTFGERAPENEVSEDELDAFNEEN
FT                   RRNEETFRQNYYHTSFEQYARLDISKNGFLRLLTEYEGVEEKEIAGREVLVLRSENQWA
FT                   ANWFAGRNYYDLLIYNEAMIASDEAFEGILEMLMP"
FT   gene            542035..544062
FT                   /locus_tag="Bsel_0511"
FT   CDS_pept        542035..544062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0511"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   sme:SMa1548 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98047"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH98047.1"
FT                   /translation="MKHIDISTALNANPDHAAIISLEGEILLTNLSWQAFSRDNTGDPD
FT                   YTDVGVNYLDVLKKAGVTAVYEGIVSVLEGRQDFYHNKYPCHSPDENRWFIMTVTPLNE
FT                   GGDIQGALIVHRNITEVEWAKNQTVDILESMTDAFFAVDQNWRFTFLNQEAEKLLQVSR
FT                   SGLIGQNIWTVFPDALGTTIQFHYETVVDMKLAKQFETYFEPLDKWFEVHAYPRHQGGL
FT                   AVFFKDISEKKASEQQIWEMANLDELTGLANRRFIYEKMNGIIQKRIPFSLFFMDLNDF
FT                   KDINDVYGHDAGDQVLQKIGERLQALQEESGGVAARLGGDEFVFMIAELDHEVTGHFAE
FT                   RLLNLIRKRMSVSGYYAFSMVGSIGIAMYPETGMNVNEIMSAADAAMYEAKKSKSVTGT
FT                   YRFYEISMREVIKRRIVMGDDMLTAIDRGDFYYVYQPQINMKTGLVDGVEVLSRWKHPQ
FT                   LGMIPPPEFIELAEETGKIRPLTERTIRDVLKTVDGWRRDWGYDGRVAFNVSSSLIESP
FT                   SFFTFIKEQMTYFKIGRDQLELEITETVNLAASEALAYHLDQFRHIGVSLAIDDFGTGF
FT                   SKISHLSRLPVDRIKVDRTFINEIGSGSKGEAILYAVIDLMNQLEVDVVAEGVEEEEQV
FT                   RVLMGRNCSHIQGYYYARPTEEEEAVSYIWSFVQTKNSER"
FT   gene            complement(544082..544645)
FT                   /locus_tag="Bsel_0512"
FT   CDS_pept        complement(544082..544645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0512"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: ppw:PputW619_3128 flavin reductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98048"
FT                   /db_xref="GOA:D6XXX5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX5"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADH98048.1"
FT                   /translation="MLEIKDNTILHCYPGLIAIVTVKDGDEVNMMAAGWHSFMSYAPPI
FT                   YGVAIAKERHTYQLVKNSQSFVINFVPAEHAHLIEGAGKISGRDNDKFNRLEARWSPGK
FT                   KTGSPVLDDAYVAYECTVKGMHEYGDHDWIAGDIVTFYQDSDRFEPETGFPDFHKLQLP
FT                   LFLGQSHYLIQDKTTTRKSIDINK"
FT   gene            complement(544797..545465)
FT                   /locus_tag="Bsel_0513"
FT   CDS_pept        complement(544797..545465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0513"
FT                   /product="Lipoprotein LpqB, GerMN domain protein"
FT                   /note="PFAM: Lipoprotein LpqB, GerMN domain; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98049"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX6"
FT                   /inference="protein motif:PFAM:PF10646"
FT                   /protein_id="ADH98049.1"
FT                   /translation="MKKTKLTALALASVFFLAACGEGNDNEAVSGSAVDNGNDNADMNN
FT                   EPENVNNEADNEGNEEPEENNEENHNEEEANEEEDVAMIDQVTLYFSDDQLLETYRYVT
FT                   DESVTMDEDGAMDAFGLWLEGAPSEDLLLLAPEGTTVQSISFDDETAVISFSPELNDAN
FT                   LGSSGAMMLTEHIAMMFEQFGIAEVFVEIDGEQVENFLGHMSLEDPLRPGDPDEYPLYE
FT                   "
FT   gene            545613..545708
FT                   /locus_tag="Bsel_0514"
FT   CDS_pept        545613..545708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98050"
FT                   /db_xref="GOA:D6XXX7"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98050.1"
FT                   /translation="MKVKNWQWAVLLLAIGFIAGALIWARAFMTM"
FT   gene            545764..546300
FT                   /locus_tag="Bsel_0515"
FT   CDS_pept        545764..546300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0515"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: pca:Pcar_3124 RNA polymerase, sigma-E factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
FT                   type 2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98051"
FT                   /db_xref="GOA:D6XXX8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH98051.1"
FT                   /translation="MREEFDRLYHQYHHQLFQYLFYLVRHRETAEELVQEVYIKVLNSF
FT                   ETFEGKSTEKTWLYSVAKHVAIDHIRKQSRKKRRAEGKEYEWSEREFEIQDKDPLPDEI
FT                   VVQKEEVQEVYQMLARCTPDQQQVMILRFVQSLSIAETAEILGWTESKVKTTQHRAIKA
FT                   LKGHLEQREEEEVHP"
FT   gene            546297..547499
FT                   /locus_tag="Bsel_0516"
FT   CDS_pept        546297..547499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: antigen 332"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98052"
FT                   /db_xref="GOA:D6XXX9"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98052.1"
FT                   /translation="MTKRWSDEDIEKTLTKMPAVEDSRSKNDLMEAIEAKSGGQLQMRS
FT                   SKKKKRAFVVPSIATAAAILLIAILLPSLFNQGLPISSDENAATDDMAVTSDDGDEEMT
FT                   DNAGNTAEDTPLNEPESEDAGVATDNGDDGEAAIMESLPSAYPVFSVEVITRESDFVVG
FT                   VSPYIQDSEEVLGDAVLSTFHTNDPTSNGAFAALESVTVDEGEAALMFSEESLVSLTSS
FT                   EHQIIESFFDEIFTLYGISTYRFETPEGPGIQFGQVGEVIEADVTEENRGYYLAEEEGQ
FT                   TLLLSARAAGADMTGGNGELLDLETLISRMTDEEIEDDFFHPVTDTGLTILSVSMSADE
FT                   VTLTYEAGPEVTPEDRELFYQAFRYAVNTYGIDELTLIDDESGETIVFTFEGGTMLVED
FT                   K"
FT   gene            547689..548552
FT                   /locus_tag="Bsel_0517"
FT   CDS_pept        547689..548552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0517"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98053"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY0"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADH98053.1"
FT                   /translation="MLQAELVLDIKATLGEGPCWDEDSQKLIWVDIEGCTVNHFDPSTG
FT                   MNASTHVGKRVGAAVQRDQGGLILALDDGFYAFDPDSGELVHLHDPEPGVQTNRFNDGK
FT                   CDPSGRFWAGSMVLKGRKERAALYRMDPDGSLHIMETGVTISNGLEFDEARGLMYYIDS
FT                   VTKQIARYDYDGESGEIRNKTAAFSVADQPGVPDGMTIDDEGMLWVAFFNGGKVVRFAP
FT                   DSGAVLEEVAVASLKVTSCTFGGRDYHELYITTARADEGQHEPHSGGLFKVRLPVSGVK
FT                   SYRFKG"
FT   gene            548693..549403
FT                   /locus_tag="Bsel_0518"
FT   CDS_pept        548693..549403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98054"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98054.1"
FT                   /translation="MMKATVKMMSVAAFVPLALAACAPDNDGNDGLNGEDPESGNGNAN
FT                   SQNEGPDSGADAGEVEEMADEYGLDVSVSGDTDGEAPDVTLEELEEAFASFVIATEAEV
FT                   LEFLSSPNEGEGEQSGEGTADYAIPGVEAEQVDTTVEVSFSYELDGDLDDASRFPTFAD
FT                   VMDIQSEMPDAGILSWEESAVDSEIEGAGTIAEFHSEGEWSLHATYDGLSVEASETDEW
FT                   IAEFSTSTLAGIEE"
FT   gene            complement(549469..550869)
FT                   /locus_tag="Bsel_0519"
FT   CDS_pept        complement(549469..550869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0519"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; PAS fold-4 domain protein; ATPase associated with
FT                   various cellular activities AAA_5; KEGG: dat:HRM2_07500
FT                   RocR; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98055"
FT                   /db_xref="GOA:D6XXY2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH98055.1"
FT                   /translation="MQPEKLTDTAFIHPVYRKLLDYLDIGIHMINTEGRSVIYNRKMSE
FT                   MEDMNPKEVLNKRIMEIFLFDSEEESRLLQALNNNVVHKDAKQVYFNFKGQEITTVNNT
FT                   FPLTVDGEKIGAVEIARDITKLERLSRETSRGASDARFTFDQIIGNSPAIEDVVENARR
FT                   ATRTTSSVLIYGETGTGKELFAQSIHNGSSRASKPFISQNCAALPDTLIEGILFGSVKG
FT                   AFTGATDHPGLFEQANGGTLMLDEINSLSASLQAKLLRAIQEKTIRRIGDTKSRSVDVR
FT                   IIATMNEDPVDALSKNKLREDLYYRLSVVSIVIPPLRHRKEDLTVLIAHFIRKYNRLFQ
FT                   MNIQEVTDDVFNLFSEYDWPGNVRELEHTIEGAMNLIYDDEPIGFQHLPLHLKHKFTQP
FT                   PATSEGTERLFTQQPEPGLPLETYMDTVEKAYIQKSLTEAGGNISQAARTLGLKRQSLQ
FT                   YRMRKFNL"
FT   gene            551107..552657
FT                   /locus_tag="Bsel_0520"
FT   CDS_pept        551107..552657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0520"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="KEGG: geo:Geob_2608 delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98056"
FT                   /db_xref="GOA:D6XXY3"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY3"
FT                   /inference="protein motif:TFAM:TIGR01237"
FT                   /protein_id="ADH98056.1"
FT                   /translation="MVVPYRHEPFTDFTVEENRKDYQEALDYVKSQLGKEYPLIINGEK
FT                   VFTEKKSVSENPANHKEVVGYVSQCSQDLAKQAMEAADEAFTSWKKWDPAARANILFRA
FT                   SAMIRRRKHEFSAWLTYEAGKPWKEADADTAEAIDFLEYYARQILRLKDGIPINSRDGE
FT                   NNTFNYIPLGIGITISPWNFAFAIMAGTTVGPMVAGNTILLKPARTTPVIAYKFMEVLL
FT                   EAGLPKGVVNYVPGSSREIGDYLVDHPRTRFINFTGSKEVGLHIAERAAKVNEGQIWMK
FT                   RMISEMGGKDTIIVDSDADLELAAEAITYSAFGFSGQKCSACSRVIAHKDVYDDVLNRV
FT                   VERTKKLTVGPTFKDNSNFMGPVNDQDAFDKILDYIEVGKKEGRLMVGGTGDNSEGYFI
FT                   HPTVFADVDSKARVMQEEIFGPVVAFDKAEDFDELIEKANNTEYGLTGAVISNNRDHLE
FT                   QARQDFHVGNLYFNRGCTAAIVGYHPFGGFNMSGTDSKAGGPDYLLHFLQPKTVSDMF"
FT   gene            552739..553932
FT                   /locus_tag="Bsel_0521"
FT   CDS_pept        552739..553932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0521"
FT                   /product="ornithine aminotransferase"
FT                   /note="KEGG: dat:HRM2_23580 RocD1; TIGRFAM: ornithine
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98057"
FT                   /db_xref="GOA:D6XXY4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY4"
FT                   /inference="protein motif:TFAM:TIGR01885"
FT                   /protein_id="ADH98057.1"
FT                   /translation="MTKTMDIIEVTEKYGARNYHPLPIVIAKAEGVWVEDPEGNRYIDM
FT                   LSAYSAVNQGHRHPKIIQALKDQADRITLTSRAFHNDQLGAFYEKVSKMTNKDMVLPMN
FT                   TGAEAVETAVKAVRRWAYRVKGVPENQAEIIVCEENFHGRTMTAVSLSSNEAYKKDFGP
FT                   MLPGIKVIPYGDLNALKEAITPNTAAFLFEPIQGEAGINMPPEGFLKEAYELCRENRVL
FT                   YVADEIQCGLARSGKLFACDWEEVEPDMYILGKALGGGVMPISCVAANEEILGVFEPGS
FT                   HGSTFGGNPLSCAVSVAALDVIESEQLAERSLRLGTYFKEQLETLDNPKIREVRGRGLF
FT                   IGVEMTEAARPYCEALKEKGLLCKETHENVIRFAPPLVISEEDLDWAIGQIKDVLKG"
FT   gene            554004..554945
FT                   /locus_tag="Bsel_0522"
FT   CDS_pept        554004..554945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0522"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: mxa:MXAN_7405
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98058"
FT                   /db_xref="GOA:D6XXY5"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY5"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ADH98058.1"
FT                   /translation="MCLTQKEGLTAMITRNLFLFLSQNKYVKGKARKWGPKLGAHSLIA
FT                   GETIQEAMDTVRELNAKGLSATVDHLGEFVYTREEAEESANYCMRTLDAIAESGVDCNL
FT                   SLKLTSLGLDVDRNLCRDNMMAILETAEKHGGIFVRIDMEDYSHLDATLELLHELRQTY
FT                   TNVGTAVQGYLFRAEKDVDRLKGTNIRLIKGAYKESPEVVYQKQEDVDANYVKIIKRHM
FT                   LNGSYAAVATHDHNVIAEIKQFAEDNGIPREQFEFQMLYGFRTDMQEEIVKEGYKMRIY
FT                   VPFGEDWYGYYMRRMAERPQNIVFGVRGLLSK"
FT   gene            555042..555944
FT                   /locus_tag="Bsel_0523"
FT   CDS_pept        555042..555944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0523"
FT                   /product="arginase"
FT                   /note="KEGG: hypothetical protein; TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98059"
FT                   /db_xref="GOA:D6XXY6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY6"
FT                   /inference="protein motif:TFAM:TIGR01229"
FT                   /protein_id="ADH98059.1"
FT                   /translation="MNRQLSIIGVPMDLGQNRRGVDMGPSAMRYAGVVDRLTALGYEVE
FT                   DRGDVRIGRSSEEEESQSNLKDLHEVVDANKALAKEVKSVVEAERFPLVLGGDHSIAIG
FT                   TLAGVSEPFENMGVIWYDAHGDLNTGETSPSGNIHGMPLAVSLGIGHPSLTEIGGYAPK
FT                   VKPENIVIIGARSLDEGERKLIREKGIQVYTMHEVDRYGMSHVMQEALSYLKDRQTDGV
FT                   HLSLDLDALDPQDAPGVGTPVLGGTSYRETHLAMEILADADILTSAEFVEVNPILDVKN
FT                   KTAEAGVGLIGSLFGEKLL"
FT   gene            556194..557255
FT                   /locus_tag="Bsel_0524"
FT   CDS_pept        556194..557255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0524"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: avi:Avi_8306 ABC transporter nucleotide
FT                   binding/ATPase protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98060"
FT                   /db_xref="GOA:D6XXY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH98060.1"
FT                   /translation="MSFIRMEKITKRFTKSGDPAVQGLDLSINKGEIITLLGPSGCGKT
FT                   TTLRMIAGFEHPSGGRITIDGTDVFTDSHSLPPEKRGIGMVFQDYALFPHMTILKNVMF
FT                   GLNKWNSRAKKKRAFEVLELVGLEEYADRYPTQLSGGQQQRVALARALAPKPHVVLMDE
FT                   PFSNLDAGLREKMRYDVTTILRKAETTAIMVTHDQKDAFAVSDRVVVMKDGIVQQIAEP
FT                   KEMYRCPKNCFVAEFVGKTNLLSGKVDADGQHIHTNIGKVLLPQQFNRHNLDDVKLSIR
FT                   PEGCRLSDQGAYCGAVERVTYSGDYQELHVRLHNEPDLRKEPMLIYAPVEQEVEVGTTV
FT                   SFDIKSELVALVE"
FT   gene            557523..558599
FT                   /locus_tag="Bsel_0525"
FT   CDS_pept        557523..558599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0525"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mxa:MXAN_0770 iron ABC transporter, periplasmic
FT                   iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98061"
FT                   /db_xref="GOA:D6XXY8"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH98061.1"
FT                   /translation="MKKGFLLSAAILPGFMLAACGNDGNNETGSNEANDNEVVEAGGEL
FT                   VVYSARNETFVQALLDKFEEDTGIEVLALHGAEPLQIQEEAGNVQADIFISNDLGGLEY
FT                   LNQQDLLEGGDYENVDSIDEQYRAENNEWIALSSRARGFIYNKDMIAEEDVPQSMEDLF
FT                   DPSYADVENGYAITRGGNGGMIGNVSALRYEWGDERTQEWIETIQENASGIMQGHGDIR
FT                   RAVGAGEHSFGLVNNYYYHQQLEEPDNNNVGFVYPDQEDGQMGAITNAAGLGKVAGGPN
FT                   GDNGDRFMNWILEEENQLAFVGESLEVPINPDLEPPFEGAVRIADLNLQDMPLRELGNF
FT                   FEDTRSLIEDAGLDLELR"
FT   gene            558630..560324
FT                   /locus_tag="Bsel_0526"
FT   CDS_pept        558630..560324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0526"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_0771 iron ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98062"
FT                   /db_xref="GOA:D6XXY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXY9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH98062.1"
FT                   /translation="MTTNHHDKNHDQTNKEMHTEEQKVEGKKPSTILRFMNRRWMDHWS
FT                   GNPPGPILLLIGIVTAILMSVPILYVIWRAVFAGADSWARLLGNRIPGLIWDTLSLVVA
FT                   VTAAAITIGVSVAWLVVRTDLPGRKWLQWMMALPLVIPPYVGAVTYIIVFGPSGWARDL
FT                   WEQSFLDSIIAYPINIYSFWGVFITLTLFTYPYVFLIASASLRKMNKSFEEVARSQGMS
FT                   TAQIFFKVNLPLLRPAIGAGAILISLYVLSDFGAIAMLRYVTFTAAIYYQRAGFDIPAA
FT                   SVLSLVLIVITVLILWLESYTRRKNKYYQTTNSYKEPDILSLGKWKPIATLYIGTVFSL
FT                   AVVLPISVLVYWTVIGAGAGAIDSRFFGFAWNSIKVSGLAAVISMLLATPIIYLKSRHP
FT                   SLTSSTIDKLSYGGYALPGVIVALGLVFIFNNHIPMLYNTFYMIAVAFVVRFLPQAMQA
FT                   GDASLSLVSPRMDEAARSLGYPAWKVMFKVVLPTIMPGVLAGGALVFVSSIKELPATLM
FT                   LRPPGFDTLAVRVYYEASEAIYHQAAPGALLIVLVSIIPLHYLLKKY"
FT   gene            complement(560368..561135)
FT                   /locus_tag="Bsel_0527"
FT   CDS_pept        complement(560368..561135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0527"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98063"
FT                   /db_xref="GOA:D6XXZ0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ0"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADH98063.1"
FT                   /translation="MFLRNESFSEYISTYKAVSVLISICLFFYIWVYWFGFLGGNEIFA
FT                   LGVGWNFAIAMGEYWRLVTPIFLHGGLMHVMFNSFALFLFGPWLEAKLGISRFVMLFLG
FT                   TAVIANIVTFLLQGPNYSHVGASGAIYGLFGVYLYIVLLRKDLMDQVSSQMIVTIIIIG
FT                   VIMTFVNPGINILAHLFGLIAGAALAPLFLTGVSRWSNQLGSSNVHDPDDIGFDPKRWE
FT                   KKRRIKEQLWFYIAGGAVAMIGFFWLIDTLFFS"
FT   gene            561239..561634
FT                   /locus_tag="Bsel_0528"
FT   CDS_pept        561239..561634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0528"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="KEGG: bpe:BP2079 4'-phosphopantetheinyl transferase;
FT                   TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98064"
FT                   /db_xref="GOA:D6XXZ1"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ1"
FT                   /inference="protein motif:TFAM:TIGR00516"
FT                   /protein_id="ADH98064.1"
FT                   /translation="MIQGIGLDIIELERIRRLTVRQPRFSARILTERELTKMASFTDAN
FT                   RKIEYLAGRYAAKEAFSKALGCGIGGELSFQDIDIINREDGRPELFCQALDQDTRALVS
FT                   ITHTRDMAAAQVILERSPGPLNDKSGV"
FT   gene            561637..563208
FT                   /locus_tag="Bsel_0529"
FT   CDS_pept        561637..563208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0529"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: ppd:Ppro_2259 carbohydrate kinase, YjeF
FT                   related protein; TIGRFAM: carbohydrate kinase, YjeF related
FT                   protein; PFAM: YjeF-family domain protein; protein of
FT                   unknown function UPF0031"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98065"
FT                   /db_xref="GOA:D6XXZ2"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ2"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ADH98065.1"
FT                   /translation="MRIVSGTEMRAIDHCTIHEMGFDEFALMESAGRAFTEALIKRLSK
FT                   DDEILVLAGGGNNGGDAIIAARHLLERGYRVRLFTVSEKAQTKGAARRHLDMFERMGHS
FT                   FRSLGQAPDDDVHEAIRRSGVIVDGLLGTGVRGAVRNPYQGLIEAVNEASAMTVALDVP
FT                   SGMPSNEEDDGSGGVVADLTITLACPKETFYLPAFRDFCGTIITVDIGIPKAAFKSGGQ
FT                   QRSLIDPESVRRTLPVRQPGMHKGVAGRGLLIAGSRSMPGAAALAAEAAIRSGAGLFTL
FT                   ASGESVLERLPEAVREAMYLPIEEADGQVTLHGEMSFAGFDGIAAGPGLGREETGSVRA
FT                   FFRAVTCPLILDADALYRARADLDGLLMDAGGPVILTPHPGEMAAIMDVSVQDVEQNRF
FT                   SISRKLANKGCFVVLKGRHTIITAPDGTQWVNTSGTPALAKGGTGDVLTGMILAFVMQI
FT                   NEVADALKAAVYLHGAAGEMAEAGQDALSVTAGDVIGKIGPAIHACRTQTGPIQLDTDW
FT                   KSVIIK"
FT   gene            563205..564422
FT                   /locus_tag="Bsel_0530"
FT   CDS_pept        563205..564422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0530"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: dds:Ddes_0171
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98066"
FT                   /db_xref="GOA:D6XXZ3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ3"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADH98066.1"
FT                   /translation="MKQIQEIYRKAGDQAVDVTHPFYRDTWAEIDLNAIHDNVTAIKAS
FT                   LPAHTEMMAVVKANAYGHGAVDVAREALDAGATYLGVAILDEAIALRKAGIGAPILVLG
FT                   YIRAEDILIASELDIAVTVFQKDWLEKAESLLRAAGRKAVCHVKLDSGMGRIGLRKEEE
FT                   IRELAEVLKASLHIHVEGAYTHMAAADEPGNDYYHVQKERFLDMMDWLESSLGEKVKIR
FT                   HCANSASALRFHEESCNLVRVGISMYGMAPSVEMKPDMKVPLKQAMSLKSRITQVKLLE
FT                   PGEGISYGSTYRTSGHEWIGTVPIGYADGWIRAHQSGDVLVKGKRAKIVGRICMDQMMI
FT                   LLDGPVETGTEVTLIGEDGGSFLSMDEVAGRIDTISYEIPCTLSYRVPRAVRKDGRVLY
FT                   VHNDIF"
FT   gene            564592..564870
FT                   /locus_tag="Bsel_0531"
FT   CDS_pept        564592..564870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0531"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98067"
FT                   /db_xref="GOA:D6XXZ4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98067.1"
FT                   /translation="MSADCTKKISVNLPQHLVHEIDALTEGEGCNRDELIHRELMRFVE
FT                   IQRTKQIREEMERGYMEMAKINLNIASESFLVEEEAESALDRLVSGV"
FT   gene            564877..565224
FT                   /locus_tag="Bsel_0532"
FT   CDS_pept        564877..565224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0532"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: neu:NE1579
FT                   PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98068"
FT                   /db_xref="GOA:D6XXZ5"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ5"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADH98068.1"
FT                   /translation="MVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAA
FT                   ITAQIQKAKLPTHVEIDAKKNGFDRDSVILLEQIRTIDKQRLTDKITHLDEKTMAKVDE
FT                   ALRVSIGLIHL"
FT   gene            565403..566263
FT                   /locus_tag="Bsel_0533"
FT   CDS_pept        565403..566263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0533"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Rsbr domain protein; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bxe:Bxe_B2486 anti-sigma-factor antagonist
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98069"
FT                   /db_xref="GOA:D6XXZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ6"
FT                   /inference="protein motif:PFAM:PF08678"
FT                   /protein_id="ADH98069.1"
FT                   /translation="MNTFVKESILEQRSAIMNRWIEEIESFRTDDSLQNISNTVYENTN
FT                   REFIDKLFGAIEEGHTKVDRPLDDFAERLIQLGWPLHYLTRGLQEFRKVTIEILSETDS
FT                   DYCQSIEFFQDIESWIDDMVNMLVNQYSGSWENTVFLQKMALKELSAPLIPVFDRISVM
FT                   PLIGTIDTERAKLIMENLLDGVIEHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVG
FT                   AKCILVGIRPEIAQTIVNLGIDLGKFPTKSTLKKGIEAALEMTQREIIEFDSVKGGEII
FT                   ADSNT"
FT   gene            566244..566600
FT                   /locus_tag="Bsel_0534"
FT   CDS_pept        566244..566600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0534"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: pfo:Pfl01_3134 anti-sigma-factor
FT                   antagonist (STAS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98070"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ7"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADH98070.1"
FT                   /translation="MRIPILKLHDYLLISVQVELDDQTALQFQEDVLEKIHQEGSRGVV
FT                   IDLTSVDMIDSFIAKVLGDVVDMSNLMGAKVVMTGIQPAVAITLIDMGIVLDDVPTALD
FT                   LEQGLERLQLELEG"
FT   gene            566605..567006
FT                   /locus_tag="Bsel_0535"
FT   CDS_pept        566605..567006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0535"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: aav:Aave_2972 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98071"
FT                   /db_xref="GOA:D6XXZ8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH98071.1"
FT                   /translation="MAEETNVDIHSEWGIVAARQAGRTMAKEIGFGSVDQARITTAISE
FT                   LARNIYLYAEKGKIRIQAAQGANRRGIRIVASDEGPGIPDLRRVMEDGFTTSGGLGAGL
FT                   PGVKRLMDEFDIDSKVGEGTTITAIKWIR"
FT   gene            567033..568046
FT                   /locus_tag="Bsel_0536"
FT   CDS_pept        567033..568046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0536"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="PFAM: Stage II sporulation E family protein;
FT                   Phosphoserine phosphatase RsbU; KEGG: geo:Geob_2606 protein
FT                   serine phosphatase with GAF(s) sensor(s); SMART: protein
FT                   phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98072"
FT                   /db_xref="GOA:D6XXZ9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXZ9"
FT                   /inference="protein motif:PRIAM:3.1.3.3"
FT                   /protein_id="ADH98072.1"
FT                   /translation="MRDTKYSLYQMYKEMLTSYLDTKNEQALYHAQQFSKEMMEKDMSP
FT                   EETVSLHLSVFQELATELPEEVVDSFDLLLEVMVGYGLAYREHQSLRDRQRELDSELNV
FT                   ASRMQQSLLPHQEIGLDTIDLGVVSVPAGKMSGDYYHYMTDERDNVAIAVADVIGKGIP
FT                   AAMSMSMIKYAMDTLTEQSLRPRSILEKLNRVVERNIESDMFITMMYGFYDTNIHRFSM
FT                   ASAGHEPGFLYRSESDSFEDLEAKGLVLGVSPKVSYEEIIYDIQVGDFIVLLSDGVTEC
FT                   RIDGEFIRRDQVMDMIRERKDLEAQEIVDSIYYELERAQGFQLRDDFTLLILKRKV"
FT   gene            568111..568440
FT                   /locus_tag="Bsel_0537"
FT   CDS_pept        568111..568440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0537"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: geo:Geob_3040 anti-sigma-factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98073"
FT                   /db_xref="GOA:D6XY00"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY00"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADH98073.1"
FT                   /translation="MNLSVSVKEGETSNVAYVSGEVDVYTASKLKETLNPLAEQENKDL
FT                   YVDLSNVEYIDSTGLGIFIGTLKLTEKSGSNLKLRGLNDRVLRLFEITGLNEVIEIDAD
FT                   KREEA"
FT   gene            568440..568937
FT                   /locus_tag="Bsel_0538"
FT   CDS_pept        568440..568937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0538"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="TIGRFAM: anti-sigma B factor; KEGG: sfu:Sfum_2452
FT                   putative anti-sigma regulatory factor, serine/threonine
FT                   protein kinase; PFAM: ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98074"
FT                   /db_xref="GOA:D6XY01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY01"
FT                   /inference="protein motif:TFAM:TIGR01924"
FT                   /protein_id="ADH98074.1"
FT                   /translation="MSKVADRIEMNVPAKAEYVGVVRLTASGVANRLGYSYDDIEDIKL
FT                   AVAEACTNVVNHAYEKADDEVSHDIHLKFSVYEDRMEFVIADQGGAVDLDVLKKKRGPL
FT                   NASQAIEDMKEGGLGLFLIETLMDEVDIQGDTGVIITMTKFLKRDEVEPGDERTSEELP
FT                   KQ"
FT   gene            568900..569706
FT                   /locus_tag="Bsel_0539"
FT   CDS_pept        568900..569706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0539"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: mmw:Mmwyl1_3428 RNA polymerase, sigma 28
FT                   subunit, FliA/WhiG; TIGRFAM: RNA polymerase sigma-B factor;
FT                   RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 4 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98075"
FT                   /db_xref="GOA:D6XY02"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY02"
FT                   /inference="protein motif:TFAM:TIGR02941"
FT                   /protein_id="ADH98075.1"
FT                   /translation="MTREPRKNSRSSKQKEEDKERQLKMIAEFQETGDDEIQTQLVLEY
FT                   ENLVHALARKFSRGQRHDEDLVQVGMIGLLAALRRFDPSFGRSFESFAVPTIVGEIKRF
FT                   IRDKTWSVHVPRRIKELGPKIKSAVENLTTELQRSPQVEEIADYLEVSEEEILETMEMG
FT                   KSYQALSVDRSIEADDEGSAVTLLDLVGSVESGYEQTDQQLLLEKAFQVLTDREKQILQ
FT                   LTYFENMSQKETGEQLGISQMHVSRLQRRALQKLKDSIRIEATEAF"
FT   gene            569706..570317
FT                   /locus_tag="Bsel_0540"
FT   CDS_pept        569706..570317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0540"
FT                   /product="Stage II sporulation E family protein"
FT                   /note="KEGG: scl:sce3610 phosphoserine phosphatase; PFAM:
FT                   Stage II sporulation E family protein; SMART: protein
FT                   phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98076"
FT                   /db_xref="GOA:D6XY03"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY03"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADH98076.1"
FT                   /translation="MIEHQLMDEMDISVYQNAKKGNWCSGDAVYIVRTSDYILVAVTDG
FT                   LGSGHEAQEASESVMAIIRADHDLPFRALLDRCNNAVWGTRGVVLSILKFDFHSQQVEY
FT                   INVGNITCTFYYPDGKMYRPIPSRGYLSGRKHKAKPSNIPFEPGMGFIVYSDGLTFNPA
FT                   YHALFDRHLTAQETLEMIVDLKVDSNDDVAIVLGHVHQPD"
FT   gene            570493..572667
FT                   /locus_tag="Bsel_0541"
FT   CDS_pept        570493..572667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0541"
FT                   /product="Tex-like protein protein-like protein"
FT                   /note="KEGG: gem:GM21_1223 RNA binding S1 domain protein;
FT                   PFAM: Tex-like protein-like; RNA binding S1 domain protein;
FT                   SMART: Resolvase RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98077"
FT                   /db_xref="GOA:D6XY04"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY04"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ADH98077.1"
FT                   /translation="MEWTEQTMRILKDVVKLVSLREDQVKKVIELHEEKNTVPFIARYR
FT                   KEMTGGLDEDQIRGILDTWGYANQLADRKEEVVRLIGEQGKLTEELEGKILQAVKLQEV
FT                   EDLYRPYKQKRRTRATMAKEKGLEPLAEWLLSFPSSGDPLAEAAAYVSEELEVASAEEA
FT                   LQGAQDIVSETFADDPDIRQRVRDMTFKNGKMTSSKKPKAEDDKGIFEMYYEYEEPVKS
FT                   LAHHRVLAMNRGEKEDVLKVKIVTAEEPITGWMKRHILKGKSTAVESVITDSILDSYSR
FT                   LIEPAVEREIRREVSEKAEEQAIHIFGENLRSLLLQPPLKDRVVLGMDPAYRTGCKLAV
FT                   VDATGKLLDVAVIYPVKPWNKVTESRRTVQELIERHGVELIAIGNGTASRETEQFTADF
FT                   LREKALEVPFLIVNEAGASVYSASKLAKEEFPDLQVEERSAASIARRVQDPLAELVKID
FT                   PKSVGVGQYQHDVTQSKLNESLSFVVETVVNRVGVNVNTASSSLLQHVSGLSKAVATNI
FT                   VKQRDDEGKFTSRTQLKKVPRLGAKTYEQSIGFMRIPDGKEPLDATGIHPESYAVAKQL
FT                   MKDYGIQKSELGSSATADILKDLSPERLAETYGTGVPTIRDILSALVEPGRDPRDELSK
FT                   PLLKTDVLQMEDLEKGMELEGTVRNVVDFGAFVDIGVKQDGLVHVSKLRKGFVKNPMDV
FT                   VNVGDVVTVWVDSVDVHKGRIALTMVKSDS"
FT   gene            572759..573241
FT                   /locus_tag="Bsel_0542"
FT   CDS_pept        572759..573241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0542"
FT                   /product="protein of unknown function DUF335 SprT"
FT                   /note="KEGG: SPRT-like metalloprotease; PFAM: protein of
FT                   unknown function DUF335 SprT; SMART: protein of unknown
FT                   function SprT"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98078"
FT                   /db_xref="GOA:D6XY05"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY05"
FT                   /inference="protein motif:PFAM:PF03926"
FT                   /protein_id="ADH98078.1"
FT                   /translation="MTENELQRLTEQLSAEFFGKPFRHRITFNKRLRTTGGRYLLKSHH
FT                   IEINPGHYETFGKNELIGIIKHELCHYHLHIEGRGYRHQDAEFKRLLKETGASRHCRLI
FT                   PGARLRSTKLHIYHCGACRQVYERKRRMDVKKFACGRCGGKLKFIKTLSAETIDGI"
FT   gene            573362..573436
FT                   /locus_tag="Bsel_R0031"
FT                   /note="tRNA-Asn2"
FT   tRNA            573362..573436
FT                   /locus_tag="Bsel_R0031"
FT                   /product="tRNA-Asn"
FT   gene            573440..573530
FT                   /locus_tag="Bsel_R0032"
FT                   /note="tRNA-Ser1"
FT   tRNA            573440..573530
FT                   /locus_tag="Bsel_R0032"
FT                   /product="tRNA-Ser"
FT   gene            573536..573610
FT                   /locus_tag="Bsel_R0033"
FT                   /note="tRNA-Glu2"
FT   tRNA            573536..573610
FT                   /locus_tag="Bsel_R0033"
FT                   /product="tRNA-Glu"
FT   gene            573634..573709
FT                   /locus_tag="Bsel_R0034"
FT                   /note="tRNA-Val2"
FT   tRNA            573634..573709
FT                   /locus_tag="Bsel_R0034"
FT                   /product="tRNA-Val"
FT   gene            573738..573813
FT                   /locus_tag="Bsel_R0035"
FT                   /note="tRNA-Asp1"
FT   tRNA            573738..573813
FT                   /locus_tag="Bsel_R0035"
FT                   /product="tRNA-Asp"
FT   gene            573821..573905
FT                   /locus_tag="Bsel_R0036"
FT                   /note="tRNA-Leu3"
FT   tRNA            573821..573905
FT                   /locus_tag="Bsel_R0036"
FT                   /product="tRNA-Leu"
FT   gene            573927..574012
FT                   /locus_tag="Bsel_R0037"
FT                   /note="tRNA-Leu4"
FT   tRNA            573927..574012
FT                   /locus_tag="Bsel_R0037"
FT                   /product="tRNA-Leu"
FT   gene            574031..574107
FT                   /locus_tag="Bsel_R0038"
FT                   /note="tRNA-Pro2"
FT   tRNA            574031..574107
FT                   /locus_tag="Bsel_R0038"
FT                   /product="tRNA-Pro"
FT   gene            574138..574211
FT                   /locus_tag="Bsel_R0039"
FT                   /note="tRNA-Gly2"
FT   tRNA            574138..574211
FT                   /locus_tag="Bsel_R0039"
FT                   /product="tRNA-Gly"
FT   gene            574349..575903
FT                   /locus_tag="Bsel_R0040"
FT   rRNA            574349..575903
FT                   /locus_tag="Bsel_R0040"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            576178..579112
FT                   /locus_tag="Bsel_R0041"
FT   rRNA            576178..579112
FT                   /locus_tag="Bsel_R0041"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            579214..579329
FT                   /locus_tag="Bsel_R0042"
FT   rRNA            579214..579329
FT                   /locus_tag="Bsel_R0042"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            579601..580959
FT                   /locus_tag="Bsel_0543"
FT   CDS_pept        579601..580959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0543"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: dde:Dde_3204 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98079"
FT                   /db_xref="GOA:D6XY06"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY06"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADH98079.1"
FT                   /translation="MLDVLLLSRLQFTFTAVVHYIFIPLTIGLAVFIAYMEFRYWRTKD
FT                   PLYDKMARFWTKLFLINFGVGVATGITMEFQFGTNWAAYSRFVGDVFGAPLAAEGVFAF
FT                   FLESTFIGLLVFGRDKISRGMRFFAALMVAVGTSLSGFWIIAANSWQQTPQGHIINEEL
FT                   NRAEMVSFAEVIFNPSTMVRYLHVMEGAFITAAMFIVAISAYFIIKKKNLPLAKRSMKM
FT                   GIVVGLVFSVLQAFSGHSHAQLVGETQPEKLAAYEAHWETEANAPLLLFAIPDHENERN
FT                   RFEIGIPGMLSFLTYDDVNAEVTGLKEFAAEDRPPVLGNFIAFRVMVTAGIILIGFFMV
FT                   MAWQWRKGNLFEKEKLMKTAFWMLPLPYIANTAGWIVAEWGRQPWAVFGVLRTEDAVSH
FT                   LTAVEVMISLGLFIAIYSFLVWLMVYLMKKEVRKFDMETSMKHLDHPKEGESA"
FT   gene            580959..581978
FT                   /locus_tag="Bsel_0544"
FT   CDS_pept        580959..581978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0544"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="KEGG: acp:A2cp1_3872 cytochrome d ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98080"
FT                   /db_xref="GOA:D6XY07"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY07"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ADH98080.1"
FT                   /translation="MDLQLIWFILLAVLIIGYAVLDGFDLGIGTLFYQLGKTEEEKRTL
FT                   INSIGPVWDGNEVWLLTGGGALFAAFPFVYATVFSGFYLAMMVVLFGLIFRAVAVEYYF
FT                   KCSDDPPMQRLMGKLFMIGSLLPALLFGVAMGNLVIGIPMDQNMNYTATFFHLLHPYAL
FT                   LIGVIGLVGFLLQGTTYTILKTENALQRRAIKFSKLFVMVLGVLWILGTVATVIFAPHM
FT                   FTNFTNQPLLFVFPLLTVVAIVLIPFFMYQKKYMAVFLSSSVIITSKLLTLAGGLFPNL
FT                   VTGADPATSLTIYNASSSEYTLTVMLIIALIGMPVVIGYTAFIYWHFRGKASHERAGY"
FT   gene            581983..583707
FT                   /locus_tag="Bsel_0545"
FT   CDS_pept        581983..583707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0545"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; KEGG: pat:Patl_1455 ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98081"
FT                   /db_xref="GOA:D6XY08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY08"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ADH98081.1"
FT                   /translation="MMKKELNREAFAHKRRMFLLVLFTVLSGAVIIGQAFTIATFVDAV
FT                   FLQGEAVRDAAWLLALLFALFVARVLLSDLPFRIGIRIAKDVKDGYRKRLAEGMRTSEE
FT                   AGDVTGKRVSLYMDVVDEMDSYFSTYLPQLVQTMIVPVMILVTVFTQNIYSGIIMLVTA
FT                   PLIPVFMILIGGHSEKKAGVQMAKLQSFSGHFLDTLRGVMTLKLFGRTNVQRGVIKEKS
FT                   IAFREATMDVLKIAFLSALMLEILATIATAMIAVEVGLRLVFGHLAFQTGFFVLLMAPE
FT                   LYLPLKNLGASFHSGRNSIAAAEKLHGQFEEEGSNVSWGERTFQPVRPPAVDIRHLTYM
FT                   YPGGHQGIRQISTAIEGPGLFAIAGKSGAGKSTLVNLLAGLMDSQDGDILIDGHKRESY
FT                   TEVSWFNAVGYVSQKPYLFAGTMRSNIVMGRTDKTEEEILEAVHAAGLSEVVSQLPKGL
FT                   DTATGEQGEGFSGGERQRMALARVLLHRPKLIFFDEPTSGLDVGTERRMNDTIVRLSKE
FT                   ATVITIAHRTSTLQEAGRILLLENGSLIAQGSFDDLVAKSEVFRGIVGISGGGERDA"
FT   gene            583700..585412
FT                   /locus_tag="Bsel_0546"
FT   CDS_pept        583700..585412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0546"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC; PFAM:
FT                   ABC transporter related; KEGG: ses:SARI_02008
FT                   cysteine/glutathione ABC transporter membrane/ATP-binding
FT                   component; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98082"
FT                   /db_xref="GOA:D6XY09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY09"
FT                   /inference="protein motif:TFAM:TIGR02868"
FT                   /protein_id="ADH98082.1"
FT                   /translation="MRDIKPVLKLMLLEKKEVLLAALLGFLAAGASVGLLASSGFLISS
FT                   AALQPPLYTLTASIVLVRFFGLLRAGSRYGERYFSHKATFTILSHIRTHYFDQVVARIP
FT                   GLFRSKRSGDLLSRITGDVENLQFFFLRVVYPPVVMVLVFLATIFFASLYSFYAAVLLF
FT                   TGFILTGGVIPAWFAWKTRQKAGRVRETRGALSTEVTEFMTGYRELKIHGQTKVKSEDV
FT                   QSLAKAYTSLQQDEQHQLAGSESVNIFAGLMITWLIAFLAALEVQNGSLDGVWLAAMIL
FT                   VSLSVFESANPMASFPKNYESGRQSAERLSLSEGDATDQNGQQGQALSDAIDTIAFKDV
FT                   SFSHEGSERFALSEVSALFKRGQRTAIVGASGSGKTTLMEVLLGIHMADRGDVLVNGQR
FT                   LGDLDLDSCWSQFSFSLQDNHFFYGSIRENLEVPGTGAADQEMTDILERLSLSHLTLDD
FT                   QLEEGAGNLSGGERQRLALARAWLRNGAVWLLDEPLSALDANTYDKVIKEVFDVSAKSM
FT                   MILITHQLRGLEQMDQILVMDQGRIVERGSYHDLMAQKGWFYALHEVDKQMIG"
FT   gene            585684..586817
FT                   /locus_tag="Bsel_0547"
FT   CDS_pept        585684..586817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0547"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: avn:Avin_43850 cystathionine gamma-synthase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98083"
FT                   /db_xref="GOA:D6XY10"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY10"
FT                   /inference="protein motif:PRIAM:2.5.1.48"
FT                   /protein_id="ADH98083.1"
FT                   /translation="MKFRTDNVHLKKAQTSGEYSKTTPIYQTSAFAFKDIDDMEQYFNG
FT                   DKSYLYTRMGNPNTDELGQAVAALEGAEAGVASSSGLSAILAGFLSVAKPGDHVIVAED
FT                   LYGGTFQLINDEIQGLGIRVTFMDMTNVKDVEAAITADTVMIYTESITNPLLRVEDLEG
FT                   ISALAKAHDLKLMVDNTFATPYLIRPLENGADLVVHSATKYIGGHSDVTAGVIVGGEAL
FT                   ISEARKKIVTLGSNLGPFDSWLAVRGLKTLSLRMRAQCENAQKLSDALRQTQGIKKVYY
FT                   PEHASDSGNGAVVTIDLEDGLDVNAFTRALDWVKVVPTLAGVETTVSYPEGTSHRALTP
FT                   EMRTRLGVTPQMIRISVGIEDPDDIVGVFVNAVAAIR"
FT   gene            586887..587885
FT                   /locus_tag="Bsel_0548"
FT   CDS_pept        586887..587885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0548"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   dal:Dalk_0686 thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98084"
FT                   /db_xref="GOA:D6XY11"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY11"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ADH98084.1"
FT                   /translation="MDKEFAWIASIRQKRMLSEDVELGIGDDAAIVRVPDGYDQVLAVD
FT                   TMVEDVHFSRATMAPEDIGYKALAVNISDLAAMGAVPKQYLVSLAVPKQGWPDEETRRI
FT                   YAGLEEAAALYGMDLIGGDTVSTADKLVISVTVTGIVETSVRLLRANARPGDVIAVTGP
FT                   LGASLAGLDLLLDQTNGVPVPEMDQDQLIRSHQRPVPQVKAGRLFAELGIRAALNDISD
FT                   GISREAKEIAEASGVRMVLDWKRIPKPDILALFDEEKQKDWVLHGGEEFQLVCVFSGKH
FT                   WRDVCLLAEQHGITISPVGMVEAGEPAVILIDGQESETLTKSGYDHFRDRE"
FT   gene            587901..588362
FT                   /locus_tag="Bsel_0549"
FT   CDS_pept        587901..588362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0549"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   gme:Gmet_1881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98085"
FT                   /db_xref="GOA:D6XY12"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY12"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADH98085.1"
FT                   /translation="MALQRKFMVHSVDETRELAEKLAGKLTPDTVLTLEGDLGAGKTTF
FT                   TKALAKALGVEGTVNSPTFTIMKEYVGTMPFYHMDAYRIEDEGEDFGLDEYFNGGGVTV
FT                   IEWPSMIQSQLPSSRIDMTIIYRGPDTREIVLVGNGRDYIQVVKELSGK"
FT   gene            588359..589075
FT                   /locus_tag="Bsel_0550"
FT   CDS_pept        588359..589075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0550"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   sat:SYN_00914 M22 family non-proteolytic peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98086"
FT                   /db_xref="GOA:D6XY13"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY13"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADH98086.1"
FT                   /translation="MNVLAIDTASYVLGVGLLKDGKPLGSIVTHEKKNHSLRLMPAIRS
FT                   LFEEVDMTPKDLDRIVVDHGPGSYTGVRIGVTTAKTMAYSLNIPVVGVSSLEALAANGS
FT                   LFTGETVPFFDARRGQVFTGLYEQGTSILEDRIIMLDEWLQILSERDTPKYLFISPDAM
FT                   QHRTLIESALGERAVMAPAPSEIVRPEALALIGMTKEADESVHGFTPNYLRLAEAESKW
FT                   REANPGKVKTYGGSGN"
FT   gene            589056..589526
FT                   /locus_tag="Bsel_0551"
FT   CDS_pept        589056..589526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0551"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: ppd:Ppro_2631 ribosomal-protein-alanine
FT                   acetyltransferase; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98087"
FT                   /db_xref="GOA:D6XY14"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY14"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADH98087.1"
FT                   /translation="MADQETEKAGVRIRFMDVTDLDGVLELENRTFSTPWSRDAFYNEI
FT                   VKNQFAYYTVAESAEGAIVGYCGLWVIIDDAHITNIAVDPEWRREGIGERMMSEAMAFA
FT                   KKRGAERLSLEVRVSNTAAQAMYRKYGLQDGGIRKQYYTDNQEDALVMWVRL"
FT   gene            589757..592072
FT                   /locus_tag="Bsel_0552"
FT   CDS_pept        589757..592072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0552"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="SMART: HNH nuclease; TIGRFAM: metalloendopeptidase,
FT                   glycoprotease family; KEGG: gur:Gura_2310
FT                   metalloendopeptidase glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease; HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98088"
FT                   /db_xref="GOA:D6XY15"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY15"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADH98088.1"
FT                   /translation="MFVYVLNKNGEPLMPCKPRKARLLLNEKKAKVVKQTPFTIQLLYG
FT                   SSGYKQPVSLGVDAGTKHIGFSATTEKDVLFEGDVQLRTDIQDKLATRRQYRRSRRSRK
FT                   TRYRQPRFDNRKKEKGWLAPSVQHKVDSHIRFVEKVHALLPITTITVEVAQFDIQKIKK
FT                   PEIEGEGYQQGDQFGFWNVREYVFFRDNHRCQHCKGKSKDKILNVHHIESRKTGGDSPD
FT                   NLLTLCETCHKKIHREGLEHLFQRKRTPLRDASQMAVMRWFIYNGLKARYPDAKLTYGY
FT                   LTKNTRIEHSLEKSHAVDARCISGHPTAKPSEATYQYKQVRKNNRQLHKTTILKGGIRK
FT                   ANKAERFVKGFQLFDKVLCEGQPCFIFGRRKTGSFDLRLLDGTVISRGKSYKKIALKEK
FT                   ATSWLVERSETVHRKPPNSFGGFLWTYLMKNQTEGLILAIETSCDETAAAVIKNGNAIL
FT                   SNVVASQIDSHKRFGGVVPEIASRHHVDQMTLTIDEAIHQAGVTLEDLDAIAVTEGPGL
FT                   IGALLVGVHAAKALSFTLGIPLIGVHHIAGHIYANHLTEPLTYPLVSLVVSGGHTELIY
FT                   MEADGTYELMGETRDDAVGEAYDKVARTLGLPYPGGPQIDRLAKEGEATIDLPRAWLEE
FT                   GSFDFSFSGLKSAVINTLHNAKQKGQTIPMADLAASFQASVIDVLVDKTIRAVKERGVD
FT                   RLVIAGGVAANSGLREALMAASEEAGIRLTIPPIHLCTDNAAMIGAAAFVQYRRGVFSD
FT                   DRMNGNPGLELKTVTKAE"
FT   gene            complement(592710..594638)
FT                   /locus_tag="Bsel_0553"
FT   CDS_pept        complement(592710..594638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0553"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pca:Pcar_2038 ABC-type transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98089"
FT                   /db_xref="GOA:D6XY16"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY16"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH98089.1"
FT                   /translation="MIVLQCSQLNKSFGTDTILNQVKLEVKSNERVALVGRNGAGKSTL
FT                   LKIIAGELTHDDGTLMIPKEVNVGYLAQDSGLNTDRSIWDEMMTVFSALRQMERKLRSL
FT                   EEEMSDPSNPRYEKILQDYDQLSQDFRDRGGFQYEADIRSILSGLNFSSFDYSTPIRSL
FT                   SGGQKTRLALGKLLLSKPELLILDEPTNHLDIDTMTWLESYLSGYSGALLIVSHDRYFL
FT                   DRIVNTVYELTFHQTYKYTGNYSHYLDEKAARLELEMKEFDKQQSEIKKLEDFVARNLA
FT                   RASTSNRAKSRRKKLEKMERLDRPVSEDESAKFRFDIERQTGNDVLMVDGLAIGYGDTP
FT                   LVSDVSFTITRGESVALIGPNGIGKTTLLKTIAGSLEALRGGVRYGSNVKIGYYDQEQT
FT                   GLNPKKTVLHELWDDYPLFPEKQIRTVLGNFLFTGDEVLKSVMDLSGGEKARLSLAKLM
FT                   MEKPNVLILDEPTNHLDLDSKEVLEDALIDYPGTLMFVSHDRYFINRMATKIIELSSDA
FT                   MTTYLGDYDYYQEKKEEQAAFLQLEEDQRNEARPDMDSHAADAQGKSGFMQQKEAQKAE
FT                   RQRLRRIEEIESTVEGHESRVEEIESELIKPEVFQDHEESARLQTELESLQDALETLMD
FT                   EWEALQD"
FT   gene            594789..595277
FT                   /locus_tag="Bsel_0554"
FT   CDS_pept        594789..595277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0554"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="KEGG: hap:HAPS_0437 molybdenum cofactor biosynthesis
FT                   protein C; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein C; PFAM: molybdopterin cofactor biosynthesis MoaC
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98090"
FT                   /db_xref="GOA:D6XY17"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY17"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADH98090.1"
FT                   /translation="MESFTHFNEQGRAKMVDISDKEETVRTAVAKSSVLVNKQIYEGIQ
FT                   SGHMKKGDVLAVAQVAGVMAAKNTAQLIPMCHPLSLSGVDIAFDWKEEGSSHRLHIRVA
FT                   VKTKGSTGVEMEALTSASATALTVYDMCKAVDKGMVIGETYLEEKTGGKSGDFKRASE"
FT   gene            595299..595934
FT                   /locus_tag="Bsel_0555"
FT   CDS_pept        595299..595934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0555"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: dde:Dde_2702 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98091"
FT                   /db_xref="GOA:D6XY18"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY18"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADH98091.1"
FT                   /translation="MEIDQAKIPQATAKRLPLYYRFLEGLQASGKHRVSSSELSEAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVNYLLSFFRKTLDQDELTKVALVGVGNLGTAFLNYN
FT                   FSKSNNTRIEMAFDVDRSKVDQVYGDVPVYHFDDIEEKIGDIEVVILTVPSQAAQGITD
FT                   QLLECGIKGILNFTPARLTVPDDIRVHHIDLSVELQSLIYFLKHYPLK"
FT   gene            596123..597529
FT                   /locus_tag="Bsel_0556"
FT   CDS_pept        596123..597529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0556"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: dze:Dd1591_2675 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98092"
FT                   /db_xref="GOA:D6XY19"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY19"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADH98092.1"
FT                   /translation="MFTNIPLKWLVVITVLTGTFTVILNNSMLNPAVPYFMQVFDADAV
FT                   SAGWVITIFMVAMGMSMPLTGYLADKFGKKQVYIAGLLLFVTGSVLGSMAWDISAIILF
FT                   RALQGVGGGMIMPLSMVLIFDAFPREERGLATGVWGVAAMLAPTIGPTLGGVIVELGSW
FT                   QWLFLVNIPTGLLAVFFSLKFLPKAVKVTDIRLDKSGFVTVTIGVGAILFALGRMNELS
FT                   HLYNPVNLGLIAVGSLSLWLFVKIEAKQDQPLLDLSIFKIKAFTYSVIIAMVGSISLFG
FT                   GIFLIPLLVQNVYGYGAIVTGLSFLPSALMMGLFMNIGGRMLDVRGPTLAAAGGLIILS
FT                   VSTGAMGFLTMGTSLWLVFLLNGLRGVGLGLSNMPSTTAGMNSIPEKFVSRGSAMGNVI
FT                   RQMSSALGIVFVSIYFEVRRAQIMVNGGMDIESASLSAINEAFVALALITLITVPLGFK
FT                   LGREYQQKAG"
FT   gene            597552..598544
FT                   /locus_tag="Bsel_0557"
FT   CDS_pept        597552..598544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0557"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   rle:pRL110111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98093"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY20"
FT                   /inference="protein motif:PFAM:PF04392"
FT                   /protein_id="ADH98093.1"
FT                   /translation="MRTVFVITGLMLLAAGLFWYTESLQADEPAHLGVLLTESSRLDKL
FT                   EGIENGLRDLGFHVEDDLVFHVYEEEEDTDALMAMAREMLEADYDLIAAFGGIEAQVLD
FT                   VAMEETGLSTPVVFVGMAAPLDTGLIESYERPGTMFTGVANHHLNLSAKRLELFTDALP
FT                   EMDEVIVLYNKEIDISNRSCDVTREAVETLGIEVVPFDVGTELDLTALADLAGENTGLL
FT                   TLPSFIIEGMTGELADFSRAHDLPVMGIYDDEVAEGFLMAYGSSFYDQGYQAARQISLI
FT                   LGGNEASTIPVELPDRLLFQVNRDTAAHIGVSLDRDVMRLADEVKGGGD"
FT   gene            598544..600625
FT                   /locus_tag="Bsel_0558"
FT   CDS_pept        598544..600625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0558"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gur:Gura_3573 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98094"
FT                   /db_xref="GOA:D6XY21"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY21"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH98094.1"
FT                   /translation="MRKKMQSIRNKVLFFGLLMTIIPLALISVYYIQNMADYVGETGEE
FT                   MQKMRLEHLATDIRSEIRQVMDQLDVLASLERPAEMKGPFYEVLSSQDAIDTLVVIDRD
FT                   GVLLSQVARHTLNHADTGDTWPVQADSGVTPDAGEPVISDVLVNEYGQPYMQMIAETGT
FT                   DGLRIGATVQLQKLIGNVSSYQLDDEAVIYLEDPSNQVIAHQDYSKLWQPSTEETAQGI
FT                   EIRTEIDEVQWELVMEQPRREALSPVFDMMRRGGFTATVMILFGSVISVFAGLYFVKPI
FT                   ETLQQGMRRMKTGYWPEAMPVERQDEFGELTRAFNEMNETIQEKEQRLRQEKERLDIVV
FT                   NSMDAGLAVVRKDYSIAWMNPKLEGWIGERREVPCFQLFHDQDDACYACPLRDEVTYDK
FT                   MDEIMTRKDRSGAERIYRHRVFPLNYTLEQDEEALIVMEDITEEKQMEEKIIQTDKLSA
FT                   LGLMASSFAHEVNNPLASVQIYAEDLSDRLTEDEAELLESGDMAHYLQVIRKNIDRCKT
FT                   ITGNLLNFSRKENWEERDIRVRQVVEESLVLMNHSLNKQGVDVTVTEEEGLPAIRGDAL
FT                   KLSQVFVNFIQNAIDAMAGKTAPALSIRLYQEGQDLLVDVADNGSGIRPEDLDKLFDPF
FT                   FTSKPTGKGTGLGLSVCYGIIKQMNGVLEVESEPGEGAVFRVRLPVPQKETNPEHGEV"
FT   gene            600629..601888
FT                   /locus_tag="Bsel_0559"
FT   CDS_pept        600629..601888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0559"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /note="KEGG: gme:Gmet_1397 two component, sigma54 specific,
FT                   Fis family transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; response regulator
FT                   receiver; SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98095"
FT                   /db_xref="GOA:D6XY22"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY22"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH98095.1"
FT                   /translation="MERILVADDEQDLRELLVSRLKRKGFEVFGAADGEEALALLQKER
FT                   YDLGIFDIRMEPMDGLTLLEEVKSRPDTLEMEVVMLTGHGTMETAIEAMKRGAYDYLTK
FT                   PYNLSELEVVISKALEKKKLTEDNQTMRNLMHARDNDFDIVGKSSAVEQVKHLIRRVAD
FT                   ADASILIEGESGTGKELVAKGLHYWSKRAAEPFVAVNAGAIPDQLIESELFGHVKGAFT
FT                   GAQKDKKGLVEVADQGTLFLDEIGEMPLDMQVKLLRFLETGSFRRVGETKERHVQVRTV
FT                   AATNRSLIEEAREGRFREDLFYRLQVMTIEVPPLRDRKEDIPLLADYFLSKQGKAKRLT
FT                   DTAMKQLMSYDFPGNIRELMHILERGCLLCPGAEIEGGDLMLPGTFQDPQDRDSVSPVQ
FT                   TLEEVERDSHRPGAHLYRLE"
FT   gene            602232..602414
FT                   /locus_tag="Bsel_0560"
FT   CDS_pept        602232..602414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0560"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="KEGG: dat:HRM2_06850 TatA; TIGRFAM: twin-arginine
FT                   translocation protein, TatA/E family subunit; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98096"
FT                   /db_xref="GOA:D6XY23"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY23"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ADH98096.1"
FT                   /translation="MLSNIGIPGLILILIIALIIFGPKKLPEMGRAVGDTLKEFKKSTR
FT                   ELTSDSNDDKDETKS"
FT   gene            602429..603289
FT                   /locus_tag="Bsel_0561"
FT   CDS_pept        602429..603289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0561"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dma:DMR_37360 molybdopterin oxidoreductase
FT                   iron-sulfur binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98097"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR031604"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY24"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADH98097.1"
FT                   /translation="MAMKHDLLINKSLLSGRDILSKSAYSTDLGLNMAEDARRLSDGLM
FT                   SEEEFVNKYQESVGKEFNQKLEVRAAAGQDHANVKWGMVIDLRKCVGCETCTVSCKAEN
FT                   RTPPGVSYNQVFVEEEGTFPNVSRTNIARPCMHCDKPPCASVCPVRATYKADNGIVVQD
FT                   NDRCIGCRYCMVACPYGARSFDFGEEYEEILDANMIQAPEHGMERGERGNGEAPIGTVR
FT                   KCNFCFHRLERGEEPACVETCIGDARYFGDLNNPESTVSKLAASSRAFRLKEEYGTEPR
FT                   VYYLR"
FT   gene            603304..604590
FT                   /locus_tag="Bsel_0562"
FT   CDS_pept        603304..604590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0562"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   afw:Anae109_3085 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98098"
FT                   /db_xref="GOA:D6XY25"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY25"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ADH98098.1"
FT                   /translation="MSELTQTTAEHQQDLDPGIVAKRFKLWMASLFIALIAGGGAILYR
FT                   LIEGLSVTNLTTFVPWGAWVAFYIFFVGLSAGAFLLSTLIFVFGMEQYERVGRYALFTA
FT                   LVSMVVALTFIALDLGRIDRAFNAMTYWNALSILSYEVRFYLIYMALLAVELWFAMRID
FT                   LVRVAKSDDGIKGKVANFLRLGSDDESDISKKKDHRWMKILGIIGIPIAIIGVHGGTGT
FT                   LFAAVAAQPYWNSPLFPVIFVVSALVSGTALLIAMYVIQRKASGKSVDFGMVKSLSLLM
FT                   IGFLIIDLGLEFYEFLVAGLTMKPEKMAILNVMFTGPMSWSFWGVQLFIGAVIPIFIVF
FT                   SKRFNQSIGWLTAAAIMVVIGIIGVRFNIVVPTQIVQSMKALPEAFYFPNWVEWLSSIG
FT                   VVAMGLIIYSIGAKLLPLELNEDEVKSHE"
FT   gene            604583..607711
FT                   /locus_tag="Bsel_0563"
FT   CDS_pept        604583..607711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0563"
FT                   /product="molybdopterin dinucleotide-binding region"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: dma:DMR_37340 molybdopterin
FT                   oxidoreductase molybdopterin binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98099"
FT                   /db_xref="GOA:D6XY26"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY26"
FT                   /inference="protein motif:PFAM:PF01568"
FT                   /protein_id="ADH98099.1"
FT                   /translation="MSKSVFDKKVNRRSFVKGAGILSAIAVASPFFGSPIRQITGGNVW
FT                   ADDEHGIGTFTEDYTAENVIYTTCEQCNTHCTIKAYVKEGKIEGGCTSLVRKIAGNPYS
FT                   PLTMKPIGQIDYAKPAAAAALGGGSVAVAGRGLRGGRTCLKGQAGIQTAYDAYRLKKPM
FT                   KRVGPRGSGQWKTISWEEAYNEIIEGSNDLGTPGLKDLVAYEEQDVVMADWDQVKEGTM
FT                   SQEDFDAKYKDVLIDTKHPDFGPKVNQVACLGGDRRHFTNQRIWTQGLGSNNFDDHGGV
FT                   CGVSSVIGNNRSFEHGKRRTYTDIDYIEYMIAFGTNPVVANKGPTWMAPQITNAIERGM
FT                   KMAVVDSRMSKSAEKAHHWIPVIPGTDGAFALAMGRWIIEHERYDMTYLVNPNKAAAEA
FT                   DDEPTWSDATHLVKTGEPTRQKLKASELGLREEGDDDDYVVLKNGVPYASTDVDEADLE
FT                   VDTTIEGIEVKSSFLLYKEEVMKHTMDEYAAITGIGKDMIEEVSREFTSHGKRAAAFGY
FT                   RGNAMHTNGYYSVRAMNVLNHLIGNYDWKGGSISSGANFGPWDGAYDLDTVPNGRTPWG
FT                   IPITRKQSQYEQSTLFERDGGYPALRPWFGATGNSSHELIPSAAEGYPYGLKALFVYRI
FT                   DPILSFAAGYRNREVLQDESKIPLLVSLDITVGEAAQVSDFVLPDLTYLERYGQETIYP
FT                   NQLHRLSSIMQPVTRVVPEAKAVEDVFIELAKRLDLPGVGENAFVNGDKLDSYEEYYAK
FT                   MAANIAMKDEPVPDADAEEMAIFESARKKALGEFFDIERLKQAVTPEEWPKVVYMLNRG
FT                   GRFEAPGSEYVNDGKHVKYQYGGQANFYDEVTARNKHSFSGEFYSGVPIYEAIKEYDET
FT                   VYERDLPLVMTNWKAKHIGTHRQISNVWLREIREDNPLWMNSIDAKKRGLKNGDTVKIK
FT                   GSDYEAEGRVMVTEGIRPGVVGSSYNFGHTAFRSQPIKIDGKWTGAGAEYGHTSYEFAA
FT                   PKKESGLYAKGRDTGFSANNLLSIDGTLGNNGMFDPIGGASAQLYAKVEVEKG"
FT   gene            607711..608322
FT                   /locus_tag="Bsel_0564"
FT   CDS_pept        607711..608322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0564"
FT                   /product="Uncharacterized component of anaerobic
FT                   dehydrogenase-like protein"
FT                   /note="KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98100"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY27"
FT                   /inference="protein motif:COG:COG3381"
FT                   /protein_id="ADH98100.1"
FT                   /translation="MQPAFETETHEQQLKLSLTYLIYARCFYGQVDVIKAMVDTGEATG
FT                   EVDEDVRHLLHQLRETPEEELTLQYENLFFIPGPYYVPPYVSVYLDDEEANGSMVHQLS
FT                   GYYARFGFLDYAKTTNLRHDHIGTVLMFAHYLIQMQLEQHEDAEDAKKMYLILLHEVIR
FT                   PMYGVFEKKVSDQLVKGFYLDLVQGAHRFLSDTSEIIEKD"
FT   gene            complement(608391..608594)
FT                   /locus_tag="Bsel_0565"
FT   CDS_pept        complement(608391..608594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98101"
FT                   /db_xref="GOA:D6XY28"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98101.1"
FT                   /translation="MKQRPPKFYGYLYFTFGVILTLFAIQAMNQSEGWDFWTILLVSFA
FT                   ALDFFIAFKHFNLQKRLKKEEQ"
FT   gene            complement(608591..609325)
FT                   /locus_tag="Bsel_0566"
FT   CDS_pept        complement(608591..609325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0566"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   smt:Smal_0005 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98102"
FT                   /db_xref="GOA:D6XY29"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY29"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADH98102.1"
FT                   /translation="MNKYYWLIILSFVFSQLAPALIAPLLLNMGFDGNETELFATAIAY
FT                   SMTIGFILAVLFSALAGRDPQFDGKRADTGKTILWSFIGIFLAFAGQYAASLIQMLAFG
FT                   IEPGSENTEMIVGFSTAVPFMIFVVAILVPVTEELVFRKVIFGAIYKRTGFWIAAIVSG
FT                   LIFGALHGDFENILVYLAMGVVFSYLYVKTGRIIVPIIAHVGINSFVMLVQVVFGDRLL
FT                   ELIDQLEEMEQSIQALMGVFLS"
FT   gene            609620..609904
FT                   /locus_tag="Bsel_0567"
FT   CDS_pept        609620..609904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0567"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: sat:SYN_00062
FT                   co-chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98103"
FT                   /db_xref="GOA:D6XY30"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY30"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADH98103.1"
FT                   /translation="MLKPLGDRIVIELVEQEEKTASGIVLPDSAKEKPQEGKVVAVGKG
FT                   RVTENGETVTPELKEGDKIVFSKYAGSEVKFEGKEYMILRESDVLAVIS"
FT   gene            609959..611593
FT                   /locus_tag="Bsel_0568"
FT   CDS_pept        609959..611593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0568"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: pca:Pcar_2770 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98104"
FT                   /db_xref="GOA:D6XY31"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY31"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADH98104.1"
FT                   /translation="MAKDIKFSEDARRAMLRGVDRLADTVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDNFENMGAQLVSEVASKTNDIAGDGTTTATVLAQSMIAEGLK
FT                   NVTSGANPMVIRKGIEKATQAAVDELRAISKPIEGRESISQVAAISSADDEVGELIAEA
FT                   MERVGNDGVITVEESKGFATELEVVEGMQFDRGYASPYMVTDSDKMEAVLEDPYILITD
FT                   KKIGNIQEVLPVLEQVVQQSRPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDVATLTGGEVITEDLGLDLKSASITQLGRASKVVVTKDNTTIVDGNGDAAEI
FT                   ANRVNQIKAQLEETTSEFDKEKLQERLAKLAGGVAVVKVGAATETEMKEKKLRIEDALN
FT                   STRAAVEEGIVAGGGTALINVLNAVKAVEADGDEATGVNIVLRALEEPLRQIAHNAGLE
FT                   GSIIVERLKGEEVGVGFNAATGEYVNMVEAGIVDPTKVTRSALQNAASVSAMFLTTEAV
FT                   IADFPEENSGGGGMPDMGGMGGMGGMM"
FT   gene            complement(611692..613524)
FT                   /locus_tag="Bsel_0569"
FT   CDS_pept        complement(611692..613524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0569"
FT                   /product="7TM domain sensor diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor transmembrane
FT                   region; KEGG: glo:Glov_2918 integral membrane sensor signal
FT                   transduction histidine kinase; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98105"
FT                   /db_xref="GOA:D6XY32"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY32"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH98105.1"
FT                   /translation="MNKITVYIKPMTLFVSFVLLIGFTIYLIIVSEYDHYPAATNGELD
FT                   TSFWDTEDGSIPLSGEWHFYWSSLLEPDERSGEEPVVIDVPRSWNGTLVNGETIGGKGY
FT                   ATYHVQVTAPEADDLALYMPYLLTAYRLWINGESVASNGEVGTSAETMTPRYFADVVPL
FT                   ASSRDQIDIHIQVSNFMHAEGGMNIPLRLGTHDTISSETDNRRLIDGIIFGSLLIMSIY
FT                   HFLVFLLRPRFRSALYFSLFCLMIGIRSLLVGEAVMLRVFPDFNWTFAMKLEYVTTYLS
FT                   PPLFILFLSALFPNETSRLFRRVSVTIGLILGSIVILFPVYWFTQTLIVGQVVTVITVG
FT                   YICYILILAALRKRMGATVSLFMAFLYAITIVNDILYDYQLSIYGNLSPAGLLFFILAQ
FT                   SFMLASIFSKAFTDLEDMSERLIASNEILESKVEERTKKLKDLSVRDPLTNVYNRGGFD
FT                   QQMKAKWTEALQERKELSLLFVDIDYFKRYNDEYGHQAGDQTLISVAHTLQEALGEKAI
FT                   VSRYGGEEFVLILPGASEEQAASAAATLLKAIRDQQIPHSQSQVAPYVTVSIGGISRIP
FT                   NETDKPDAFIKQADQALYAAKEAGRDRYILAQDV"
FT   gene            complement(613690..614721)
FT                   /locus_tag="Bsel_0570"
FT   CDS_pept        complement(613690..614721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0570"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98106"
FT                   /db_xref="GOA:D6XY33"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY33"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ADH98106.1"
FT                   /translation="MKENFWHDLPKPFFILAPMEAVTDVVFRHVVSEAAAPDVFFTEFA
FT                   NSDSFCHPKGRESLKGRLMFTEDEQPIVAHIWGDKPEHFRTMSVAMAEMGYKGIDINMG
FT                   CPVHNVAGDGKGAGLIKRPDVAAELIEAAKAGGLPVSVKTRIGFSKIDEWQNWLRHILE
FT                   QDIVNLSIHLRTKKEMSDVPAHWELIPDIKALRDEVAPNTLLTINGDIDDRQTGLELAE
FT                   KYGVDGIMIGRGIFKNPFAFETEPKEHTSEELLGLLRLQLDLHDKYSKDLENRPFTPLQ
FT                   RFFKIYVRSFPKAGELRKKLMETKTTDEVRAILDTFEKEKQAEEKAEAEALCQTASTDH
FT                   VHS"
FT   gene            complement(614874..615761)
FT                   /locus_tag="Bsel_0571"
FT   CDS_pept        complement(614874..615761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0571"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   pna:Pnap_0618 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98107"
FT                   /db_xref="GOA:D6XY34"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY34"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADH98107.1"
FT                   /translation="MEIMTIRHNNRQESAIITANRVYPLQAINECCMTDWPLTIDRILK
FT                   EERMTELTRWYADQTARIWEGIPSEDLEHIETGSLFESPATIWGIGFNYQPTGEPMPAE
FT                   RANHPVSFVKPWNTVTPVNGPILVPNGSESTTGEGEIACIIGKPGKNLTVQEARHCIAG
FT                   YTAALDMTESGIHKEHPRFLARAKSFDTFCAIGPTLTSADSFYTEDITVQTILNGEVSA
FT                   ENHTGRMLMNIPEIVAYFSQGTTLNPGDIILTGTPGPVKIRPGDTLAVHVDGLRPPDQI
FT                   GFRRMIRYNVMAIS"
FT   gene            615942..617585
FT                   /locus_tag="Bsel_0572"
FT   CDS_pept        615942..617585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0572"
FT                   /product="transcriptional regulator, PucR family"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   reu:Reut_B5661 CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98108"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY35"
FT                   /inference="protein motif:PFAM:PF07905"
FT                   /protein_id="ADH98108.1"
FT                   /translation="MRLNDLLEQEVLKGATAVAGEKGLMNQVTSVTMMDAPDIADFVKQ
FT                   DQLLLTTGYHLQNNPDLLMSIVIRMTEEGCAGLGLKVNRFLDHIPPSVIDVANEGGLPV
FT                   IALPDEPSLGDMVNSVLKAILDERTQALSEAMAIHRRFTDLIVGGKGLYEVLDQLSRHI
FT                   CAPVLLLDYRLNLLESSRKFDEDFCFVLAEKVHEVIQQDDLANGAIRKLSMSVSQESEK
FT                   QMISCCPVQMNVYQKGYLIVFLDIDQAGASERLAVEQAMNVIAFELMKLHAVEQQEQIQ
FT                   KNEFLTEYVEGRFSSEKDLGRRGEGYGLRRSCTYLCVAIRPDHEDELYRGVGQAPESER
FT                   RLFKNAIYEQLQIWFDYYFDDVVFFSKNEVYVALIPKPDDEWEDWLMKGLVTIQKEMEE
FT                   FLFISISFGIGNPAAQLLQVPDSFKEALETLHNGRRMGQEAFIKWTDTKGVTELLRTVS
FT                   PQKLREFYESTLKSLVLSSKKEDEDLIKTLTVYLEHNGQIAETAKALFVHRNTVIYRLK
FT                   KCEDKLQVNLKHADDIHKLRTALLVREMIE"
FT   gene            complement(617704..618879)
FT                   /locus_tag="Bsel_0573"
FT   CDS_pept        complement(617704..618879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0573"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: hypothetical protein
FT                   LOC100240917"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98109"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY36"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADH98109.1"
FT                   /translation="MTTDHYGAFIDESLTVEPQKGGILHRKTFAVKDVFHIEGHRNTAG
FT                   NPHWLQSHAPAKATAPALVHLLQAGATLKGTTVTDEMMYSLHGENVHYGTPVNPFDKSL
FT                   IPGGSSSGSAVATGAGLRDFAIGTDTGGSVRIPASYCGLFGFRPSHGKVSLEGVIPLAD
FT                   SFDTVGWFTRNAALLEDVGEVLIGDSMPDAPDFKRAVIARDAFSLLTDTQHNALMSAVR
FT                   SCSSKVKSHEEQRITNDDLGDWVDIFRVIQGYEIWLNHGEWVKAHEPDFGPGIRERFHM
FT                   AEQIKEADVAEARRRQLMIQDATADIMQPDTLMIIPTIAGEPPAVGLPPEEVDKIRQRT
FT                   MKLTAIAGLNGLPQVTIPVKRGGGLPPLAISILAPKGRDRDLLSFVTSLCD"
FT   gene            complement(618848..620260)
FT                   /locus_tag="Bsel_0574"
FT   CDS_pept        complement(618848..620260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0574"
FT                   /product="allantoinase"
FT                   /note="KEGG: scl:sce5876 allantoinase; TIGRFAM:
FT                   allantoinase; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98110"
FT                   /db_xref="GOA:D6XY37"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY37"
FT                   /inference="protein motif:TFAM:TIGR03178"
FT                   /protein_id="ADH98110.1"
FT                   /translation="MEVFVIGTQWIRNGTVWTGTSFVRQDIEIRDGIIDRLFDSHTSVQ
FT                   PEPGARITDAADRLVVPGFIDPHVHFNDPGRRIWEGIDTGSKAAVAGGITTFIDMPLNS
FT                   HPSVTNGHLARDKKKAIEGRSHAHYGLWGGITRTNCRDQGALDAQLDAGVIGFKGFMSE
FT                   SGIEDFPYLDRDALREAMGYCGEHRVTLALHAEAEAVLERYRHLSGPDPASFLASRPPE
FT                   AEWQALDWIIEDALRFQTAVHVVHVSTADGVRMLHEAKMSGADITIETCPHYLLFTDTD
FT                   FIKKGPLLKCAPPLRPLSEQEALWQTVADGLVDIIGSDHSPCPLEMKEAGNDDIRNAWG
FT                   GIPGVQSGHAALLSEAVKRGVPLETVLPMMTDAPARRFFPERQIGRIAPGFAADLTLLS
FT                   KSSHTITEKELLNRHPYSPYTGLTVDMTVSGVFLGGVHIYQSGKGIKSPLLGHHFVKGG
FT                   HDHDNRSLRRIY"
FT   gene            620529..621377
FT                   /locus_tag="Bsel_0575"
FT   CDS_pept        620529..621377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0575"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   avi:Avi_5433 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98111"
FT                   /db_xref="GOA:D6XY38"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY38"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADH98111.1"
FT                   /translation="MDQLYIHTPDTLSEAWALKTKDPTDSLWLSGTTWLRTQWEAGQLK
FT                   TQKQWIRLDGIPELTSGIRRDESTLRIAALTTFGEISRCGDTAAFAPLLKQAIHEIAAP
FT                   SIREQATIGGNVATGSGDSIPALLASGASVLVYTEGRDEEWLLEDWLAAGMSGIIVDIA
FT                   IPVHKESEDLNVYVKTGRREAFIPSAATFAIKGSWDSDTKTFRTCRAAAGGGTMVPVRL
FT                   KRLERFLKETPLTSNAVFKKMADEVKKDYRPEDDPFLSGAYKQQIVCNQIIQNIHSNIR
FT                   R"
FT   gene            621383..623674
FT                   /locus_tag="Bsel_0576"
FT   CDS_pept        621383..623674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0576"
FT                   /product="xanthine dehydrogenase D subunit"
FT                   /note="KEGG: avi:Avi_5433 dehydrogenase; TIGRFAM: xanthine
FT                   dehydrogenase D subunit; PFAM: aldehyde oxidase and
FT                   xanthine dehydrogenase molybdopterin binding; aldehyde
FT                   oxidase and xanthine dehydrogenase a/b hammerhead"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98112"
FT                   /db_xref="GOA:D6XY39"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR017609"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY39"
FT                   /inference="protein motif:TFAM:TIGR03196"
FT                   /protein_id="ADH98112.1"
FT                   /translation="MRLNDRTSGRGWRVRPDGRDKATGRLDYLTDLSEDTMLFGKVVRS
FT                   GMPHARLYKVVTEKAMKIPGVVSVLTAADIPGLNGFGIADPNQPVFCDHHIRFEGDAIA
FT                   AVAATSREAAERAAEAIFFDSALLPVLDSPEKALEDDAIPLHPKGNILHERHFEKGNTA
FT                   EGFDQAAYIVEETYHTPRQMHVFMETEGGLFIPEEDGSLTVKAATQHGYKDRMQLSRIL
FT                   DMDEEKIRIISSPIGGSFGGKDELNVQPYGALLALSTQKPVKMHFSREESVIAGIKRHP
FT                   MSITMKTGMTADGKLVAHEASIISDTGAYATLGGPVLNFAVEHTVGPYRIDHVKLEGKA
FT                   VYTNNGVSGEFRGFGGNQATFALEGQLDRLAEKSGIDPVELRRRNIRGEHDLGPLEQQV
FT                   AANDGPALVLSDLTRSELYHLPSCETDEQEPWIRRGRGVALAFHGSGLGYGIPDPAGGM
FT                   LTLTAEGKIEASFGHEEFGQGLIGTLEVMLTEAFTCEVEDVSIQIGDTRHVPPSGSSTA
FT                   SRTTNMVWQSIQRMKEPFCELILKEAARQLNTDQDDLTMGAGGVHSKADGAVVLDYRTL
FT                   ANGSELPLTLSTDHHFPVTPDKVMGGHYLYGSTAVIAEVEVNTLNGKVAVTRVDHAVSA
FT                   GEVMNPLGYLGQIEGGSIMALGFTLSEDAVIEKGRYVTRNLDSYLVPTIQDVPAVQYVE
FT                   ANETLSEGDRFGPRGVGEIGSVALAPAIVKAVREATGAWHTSLPITPDKVLDSTEPFAW
FT                   LTEDEKEVSP"
FT   gene            623671..624204
FT                   /locus_tag="Bsel_0577"
FT   CDS_pept        623671..624204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0577"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: glo:Glov_2414 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98113"
FT                   /db_xref="GOA:D6XY40"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY40"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADH98113.1"
FT                   /translation="MNPLMKAYQEDDATRMTIRFTLNGQTKVIHVPPERRLVDLIRTDF
FT                   NLTGTKISCEVGRCGACMVIVDGKPMNSCLLMAYQIEGRSIDTIEGLTVSDSRTRDLQE
FT                   LFLEEGALQCGYCTPGMIVSLTGCLNGDGDAGFEDLKEALSGNLCRCTGYGGIHRVISR
FT                   LTENQDEKGREADV"
FT   gene            624197..625240
FT                   /locus_tag="Bsel_0578"
FT   CDS_pept        624197..625240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0578"
FT                   /product="Xanthine dehydrogenase"
FT                   /EC_number="1.17.1.4"
FT                   /note="KEGG: mxa:MXAN_6109 XdhC/CoxI family protein; PFAM:
FT                   protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98114"
FT                   /db_xref="GOA:D6XY41"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY41"
FT                   /inference="protein motif:PRIAM:1.17.1.4"
FT                   /protein_id="ADH98114.1"
FT                   /translation="MSEQHRLLDWLVTSGETKALVASVIHVEGSAYRHQGAQMIIGESG
FT                   RMTGMISGGCLEEDLRIHAFQCMKEMKTAVVDYDMRAEDDLGWGKGAGCNGKVYVSLNP
FT                   LDLTDSGTDRRLASALERIGRGETLYRVTALDEHAGPPMFVKEDGTPLSERDDALKPAL
FT                   IREKDGPAVQVSHGDKGRILVERITPKTRVYVFGAGIDAEPVVRQLAALDFDVIVTDTV
FT                   RERLDRTLFPDASGFRWLSPDDFFQCEEIREGSFALVMTHRFQDDQVLLRGLVERREQF
FT                   AYAGILGPRRRTRRLVAGGQIPDWLHSPVGLDIGADGAEEIAVSIAAELIRVRRNQAQT
FT                   KSEQAVM"
FT   gene            625242..625877
FT                   /locus_tag="Bsel_0579"
FT   CDS_pept        625242..625877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0579"
FT                   /product="molybdenum hydroxylase accessory protein, YgfJ
FT                   family"
FT                   /note="KEGG: geo:Geob_0102 molybdenum hydroxylase accessory
FT                   protein, YgfJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98115"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY42"
FT                   /inference="similar to AA sequence:KEGG:Geob_0102"
FT                   /protein_id="ADH98115.1"
FT                   /translation="MFSTTVHAIILAAGQSTRMGEPKQTLSIEGHTLIDHAVLKVSKLP
FT                   VERIVIITGEHHEALKDAVTIEDSRIHFIHNPDYVSGQASSLKKGLCYAQSRGAHALVM
FT                   LADQPLIAAETFKAVLDEGLSMKASRKPYSVRPMFHGRQGHPVFFGRPYLLNLMCLKMP
FT                   GDEGGKRLRNQLVNLHTAVDDPYISFDVDTPADLKKARERMQKPLPVQ"
FT   gene            625980..627338
FT                   /locus_tag="Bsel_0580"
FT   CDS_pept        625980..627338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0580"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   mxa:MXAN_5705 N-ethylammeline chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98116"
FT                   /db_xref="GOA:D6XY43"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY43"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADH98116.1"
FT                   /translation="MGSIVLKNAEIITMNAGREAVFGDVLIEGDTITAVGKNLPCPDDA
FT                   EVIDATGRVVIPGFIQTHIHLCQTLFRGRGDDLELMDWLKGRIWPLEAAHDEESIYYSA
FT                   LLGTGELIQSGTTSIVDMETVHHTDSAFEGMAQSGIRAISGKVMMDKGDEVPLPLQEKT
FT                   AESLQASQDLYEKWHGYDNGRLQYAYSPRFVVSCTEELLRETARLSEMQNVRVHTHAAE
FT                   NRGEIAIVERETGMRNVEYLHKLGLANERLMLAHCIWLSDNEKKIIRDNRVNVTHCPGS
FT                   NLKLASGKAEIPQLLDAHVCVSLGADGAPCNNNLDMFNEMRLAALIHKPEHGPTAMDAK
FT                   TVFEMATIGGAKAMGLDDKIGSIEPGKKADLAILNLNDLHMYPSYGVDTLSRIVYSATR
FT                   ADVETTIINGKPVMKNRMLHTMDKETLMQEANTSIKRLIKRSGIPGQTKAVSG"
FT   gene            627372..627899
FT                   /locus_tag="Bsel_0581"
FT   CDS_pept        627372..627899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0581"
FT                   /product="OHCU decarboxylase"
FT                   /note="KEGG: sme:SM_b20874 hypothetical protein; TIGRFAM:
FT                   OHCU decarboxylase; PFAM:
FT                   Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98117"
FT                   /db_xref="GOA:D6XY44"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY44"
FT                   /inference="protein motif:TFAM:TIGR03164"
FT                   /protein_id="ADH98117.1"
FT                   /translation="MQMTELHRLSREAFVAQIGHVFEHSPWVADSAYEQAGPFHTSEEV
FT                   YKQLLTAMHEGTEDQKLSLLRAHPDLGGRIQMTDASVAEQKGAGLNQLSEKEYETLKRL
FT                   NTHYTERFGFPFILAVKGKTKEDIISNIESRIENSREEEFETALNEVGKIAVFRLNDLL
FT                   GGEHEKEELNHV"
FT   gene            627892..628848
FT                   /locus_tag="Bsel_0582"
FT   CDS_pept        627892..628848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0582"
FT                   /product="urate oxidase"
FT                   /EC_number="1.7.3.3"
FT                   /note="TIGRFAM: urate oxidase; KEGG: hypothetical protein;
FT                   K00365 urate oxidase; PFAM: Uricase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98118"
FT                   /db_xref="GOA:D6XY45"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY45"
FT                   /inference="protein motif:TFAM:TIGR03383"
FT                   /protein_id="ADH98118.1"
FT                   /translation="MSERTMLYGKGDVFVYRTYATPLKGVRQIPESNFTGRSNTIFGMD
FT                   IQVSLAGEAFLTSFTEGDNAKVVATDSMKNFILHHAGEYEGTTMEGFLAYVSACFLDTY
FT                   DHISEVEMSGRQFPFEAVEVGSPAGVVPSETVFREGMLEKPGTRISVGRDENGEAQIGS
FT                   LESAVHDLHLIKVKGSSFAGFIRDEYTTLPETKDRPLFIYLNISWTYKETEHALGATPE
FT                   QYVAAEQVKHIAQTLFHQEDSPSIQKLIYDIGIRVLERFPQLETVSFESNNRTWETVRD
FT                   EIPASGEGKVFTDPRPPFGFQKFTVLQEDVKREEALR"
FT   gene            628848..629186
FT                   /locus_tag="Bsel_0583"
FT   CDS_pept        628848..629186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0583"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="KEGG: reh:H16_A1009 transthyretin-like protein;
FT                   TIGRFAM: hydroxyisourate hydrolase; PFAM: Transthyretin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98119"
FT                   /db_xref="GOA:D6XY46"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY46"
FT                   /inference="protein motif:TFAM:TIGR02962"
FT                   /protein_id="ADH98119.1"
FT                   /translation="MGRLTTHVLNTATGLPAVGMKLILRKGNEEGGYTMLSDTVTNHDG
FT                   RVDAPLLEGDAFTSGVYELTFFVGDYFQTEDAFLDEVPIRFTVDDATRHYHVPLLVTPY
FT                   SYTTYRGS"
FT   gene            629212..630471
FT                   /locus_tag="Bsel_0584"
FT   CDS_pept        629212..630471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0584"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: mes:Meso_2546 allantoate amidohydrolase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98120"
FT                   /db_xref="GOA:D6XY47"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY47"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADH98120.1"
FT                   /translation="MQTMTGIDQLRLWRTLMDLRQIGAGATEADGITRLAFSPPELEAK
FT                   AYIRVLMEECGLDVYTDAVGNVFGVYQGREPDLPVIMTGSHVDSVIRGGAFDGTLGVLG
FT                   AIEAVRTMKEAGIRPRRTIEIVSFSDEEGTRFGAGYMGSKALAGKLDDRFLTLTDQEGE
FT                   SYETVLTKAGYEPSAYPKAKRDSREIGAFLEMHIEQGRVLEEADIAAGIVTTIQGPLWL
FT                   QVTIEGAADHAGATPMAIRKDASLAMAEAMLAVEEAAVTHGGVGTVGSLKVKPGGINII
FT                   PGEVVFTVDMRHGDTTLRDRMLTDIEASFSAIAGKRGVSFKTLVTKKEPPATCSEDIRA
FT                   SIHQAANTCGIPVKDMPCGAGHDALIMSTVTRMGMILVRSQDGISHNPQEWTSQEDCAK
FT                   GTELLMRTLHSLAEERGDEA"
FT   gene            630468..631724
FT                   /locus_tag="Bsel_0585"
FT   CDS_pept        630468..631724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0585"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: dda:Dd703_0911
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98121"
FT                   /db_xref="GOA:D6XY48"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY48"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADH98121.1"
FT                   /translation="MIRQKPLHVAPRTIMTPGPVEAEPSVLKAMSSTVLGQFDPDFTSV
FT                   MNEVMVMLRDVLQTGNHWAYPVDGTSRAGIEAMLGSVIEEGDRVLIPAFGRFGFLLKEI
FT                   CERVGGDVKMLTCEWGEVFEPSEIIGEIQAWQPKVVAMVHGDTSTGRVHPLKEIGEACR
FT                   SNDALFIVDAVATVAGMDVRPDEWCIDGLITGTQKCLSIPSGLAPLTYNDRIEAVIQER
FT                   KSVEAGIAAAGDPSGHDRRIRSNYLDLSQLQDYWSPKRLNHHTEATAMIYGLHEGLRVI
FT                   LEETLEARFERHRLNEQALTAGIRAMGLELFGDPDAKLTTVTCIRIPEGTDGEAVRRQL
FT                   LDDYGIEIASSFGPLHGKIWRIGTMGYSCQKRNVLITLNALESVLTHQGCKVHKGTAAQ
FT                   AALEVYHQKKAPEITGIPG"
FT   gene            complement(631791..632234)
FT                   /locus_tag="Bsel_0586"
FT   CDS_pept        complement(631791..632234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0586"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   dda:Dd703_1214 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98122"
FT                   /db_xref="GOA:D6XY49"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY49"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADH98122.1"
FT                   /translation="MAHVKTEEILNRHVSNWSVLFVKLHNYHWYVGSTQFFTLHQKFEE
FT                   LYNEAATNIDELAERLLAAQGNPVASMSEYLKTATVKEAEGETTYEAMLDTLIGDFDLI
FT                   SKELNADIATLEDEVGDDVTADMLIGIRQSVEKHNWMLRQYTR"
FT   gene            complement(632330..633256)
FT                   /locus_tag="Bsel_0587"
FT   CDS_pept        complement(632330..633256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0587"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: azo:azo2810 hypothetical protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98123"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY50"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADH98123.1"
FT                   /translation="MKTTILAIPLLALLLSGCSDNGASDAAFHNEPEQTDNESVSEPVP
FT                   DEDEIRFTAGAAYFNRLTTNRYMLSEDDIDPADSGTWLIDLRNSAAFSEGSLPEAVSSD
FT                   PASLGDVLGALRQTDQVVFISEDGQVASQVMAATRMAGINSSLLAGGIRDYKGDLQPGQ
FT                   RSVSELLDTVEEAPGGDPETQIMDEVVNRYLSGDIATDRSRVDPETLHANLSDYYIIDT
FT                   RSEADYKEAHVPTAHHIPVASIGQHMPDIPADKPLLVYCYSGQTGAQAATVLAVAGFET
FT                   YTLTGGMGNWVQQGFETAQPEADPVTQ"
FT   gene            complement(633399..633818)
FT                   /locus_tag="Bsel_0588"
FT   CDS_pept        complement(633399..633818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0588"
FT                   /product="arsenate reductase (thioredoxin)"
FT                   /EC_number="3.1.3.48"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; TIGRFAM: arsenate reductase (thioredoxin); KEGG:
FT                   hha:Hhal_0091 protein tyrosine phosphatase; PFAM:
FT                   Protein-tyrosine phosphatase, low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98124"
FT                   /db_xref="GOA:D6XY51"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY51"
FT                   /inference="protein motif:TFAM:TIGR02691"
FT                   /protein_id="ADH98124.1"
FT                   /translation="MTKPILYFLCTGNSCRSQMAEGWGKEILGEEWDVYSAGIEAHGVN
FT                   PNAVKAMNEVAIDISGQTSDTIDQDLLNKADFVVTLCGHANDVCPATPPNKERAHWGFD
FT                   DPAKAEGTDTEKWAVFQRVRDEIGERIRTFKETGK"
FT   gene            complement(633959..634336)
FT                   /locus_tag="Bsel_0589"
FT   CDS_pept        complement(633959..634336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0589"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: sfu:Sfum_0264 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98125"
FT                   /db_xref="GOA:D6XY52"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY52"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADH98125.1"
FT                   /translation="MQHPAITSKVSLYKMLADEKRINILRFLNEAGLCVCDLEALLGIS
FT                   QPAVSQHLRKLKQADIITSHKHDQWHIYSINDGYEHHQHLLHILNELPSAEKDVADITA
FT                   QGIRSRCSIEITEIRFLEKKN"
FT   gene            complement(634407..635162)
FT                   /locus_tag="Bsel_0590"
FT   CDS_pept        complement(634407..635162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0590"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: pmr:PMI0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98126"
FT                   /db_xref="GOA:D6XY53"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY53"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADH98126.1"
FT                   /translation="MTTFYNTLSSAVYNYDKAIGISFGDVGFYTSRLEGISGKILEPAV
FT                   GNGRLLIPLTEAGLTVDGFDLSEAMLSHCRQNCHDRGLSPHLWQDSMTTFTSNEQYEAI
FT                   ILPAGSFLLLPSHADGMEALRRFHDHLVPGGRLLIDLFLPDELNAGQESFRRFPLNNRE
FT                   TITLTSTVRSVDVVRQSVESYNRYEKWVDGKLTETELERFPVRWIGIEEAKLMLKEAGF
FT                   TDIRLSADYQMDKQPEQAGEMLTFEAVAK"
FT   gene            635279..635710
FT                   /locus_tag="Bsel_0591"
FT   CDS_pept        635279..635710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0591"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tdn:Suden_1505 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98127"
FT                   /db_xref="GOA:D6XY54"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY54"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH98127.1"
FT                   /translation="MEDIFIVELTEEDAVSAYPVVKQLRDHLDEESYLELVKEAMANEG
FT                   YRMFGLVNGDLLVSVIGLMPMTTLYDGRAIWVSDLVTAEMQRSKGYGGILLEFAEEWAR
FT                   DHGYGKITLSSGLQREDAHRFYEEKMNYSKKSYVFKKTF"
FT   gene            complement(635766..636116)
FT                   /locus_tag="Bsel_0592"
FT   CDS_pept        complement(635766..636116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0592"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: pca:Pcar_1345
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98128"
FT                   /db_xref="GOA:D6XY55"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY55"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADH98128.1"
FT                   /translation="MIASVLDAVVILVSVSFIIYGITCIGSVRMKQEFERFQLPGFAPW
FT                   IGILEITAGAAMLVGLAVPWLLLLASGGLTLLMAVAVFVRIRVGDTLWQSSPAVVFFLL
FT                   TAWLFFMTLQAL"
FT   gene            complement(636113..636460)
FT                   /locus_tag="Bsel_0593"
FT   CDS_pept        complement(636113..636460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98129"
FT                   /db_xref="GOA:D6XY56"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY56"
FT                   /inference="similar to AA sequence:KEGG:Pcar_1345"
FT                   /protein_id="ADH98129.1"
FT                   /translation="METLAIISQIIIAISIVIVWVFRFDNIVKEFKQYELSDLTRNMVG
FT                   AAKISLATLLVAGIWTSEFIVIPALIMAFLMVCAQLAHFKVKNPWSKHVPSLILLLLSL
FT                   FVAGVHSGLIG"
FT   gene            complement(636674..638038)
FT                   /locus_tag="Bsel_0594"
FT   CDS_pept        complement(636674..638038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0594"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: NADH oxidase
FT                   lateral transfer candidate"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98130"
FT                   /db_xref="GOA:D6XY57"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY57"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ADH98130.1"
FT                   /translation="MNIAVIGSTHAGTAAVKNMARLYPDATIHVYERNDNVSFLSCGLA
FT                   LYVGGVVQDAKALFYSSPDELSSMGIQVHMQHDVLNVDDENKTLRVKDLLTGEVRTDRF
FT                   DKLVMTTGSWPVIPPIEGIGQDQILLAKNYNQANTIIKQTEHAHHITVIGAGYIGVELV
FT                   EAFQQAGKSVTLVDGESRILSRYFDSAITDEVERALTDRGIELRLNETVQAFKGDGRVR
FT                   QVVTNKGAVDTDLVILCVGFRPNTGLLTDKVDMLANGAIKVNEYMQTSHPDIFAAGDCC
FT                   AISYNPTGEEAYIPLATNAVRTGTLVAHNLLTPRIPHPGTQGTSGLHLFGLNLASTGLT
FT                   DTAATQAGLTLQEVTVQETNRPTFMPDAEEVRFTLRFDPVTRIIKGAQVLSKADVTQAI
FT                   NTMSVVIQKEMTIEELAFVDFFFQPHFNHPWHFLNKAGLAAIDALTPAEAVQAAR"
FT   gene            complement(638256..638522)
FT                   /locus_tag="Bsel_0595"
FT   CDS_pept        complement(638256..638522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ilo:IL2050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98131"
FT                   /db_xref="InterPro:IPR019882"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY58"
FT                   /inference="similar to AA sequence:KEGG:IL2050"
FT                   /protein_id="ADH98131.1"
FT                   /translation="MAKRNNLSVEEIDRIVEMAWEDRTPFEAIEIQFGLKEKEVIKLMR
FT                   AEMKASSFKMWRKRMNERTTKHRSIRGDDIKRFRSPMQKHISY"
FT   gene            638636..640072
FT                   /locus_tag="Bsel_0596"
FT   CDS_pept        638636..640072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0596"
FT                   /product="cryptochrome, DASH family"
FT                   /EC_number="4.1.99.3"
FT                   /note="TIGRFAM: cryptochrome, DASH family; KEGG: cry-dash;
FT                   cryptochrome DASH; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98132"
FT                   /db_xref="GOA:D6XY59"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D6XY59"
FT                   /inference="protein motif:TFAM:TIGR02765"
FT                   /protein_id="ADH98132.1"
FT                   /translation="MRMVNVIWFRHDLRIHDHEPLRLAHWAKEETEAVFVRDARMDEKV
FT                   TPGLKRAGEHRERFLMESLVVLAGSLEAEGMPFTVLKGPVVKTMIDWLTERGATDVFLH
FT                   EHPGFEERRDLEEVQRALPHIHWHVSEGHTMFRRDQLPFSFSEFPMSFTMFRKRLEAHL
FT                   RLPEKKRSFSYDSYDTVTEAEPVFLSGKESGSFGAVRGSGDHIPHAGGQGIVRGGEQEA
FT                   LARLRSYVGNASRLFTYKETRDGMFAFDDSSKLSFWLANGSLSPKRVYRAILDMEAANG
FT                   RNESSYWLFFELLWREYFQWLMLATDARLFTKQGLLDVAIVWHEDKALFQAWKDGETGF
FT                   PLVDAAMRELKATGYMSNRARQNAASFLTKNLGINWLWGARYFEEQLIDYDPASNYGNW
FT                   AYQAGVGTDLRELRAFNVIGQGIRYDPKGSYAKNWLHLPDTLPGHTVYDPVKLSAHTDW
FT                   PQPIVDLEESLERRKQELGL"
FT   gene            complement(640190..640324)
FT                   /locus_tag="Bsel_0597"
FT   CDS_pept        complement(640190..640324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98133"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH98133.1"
FT                   /translation="MSRVQKHLNFPKELYEAIEEYRKENMIPTFASAVYELVRKGLKA"
FT   gene            640394..641512
FT                   /locus_tag="Bsel_0598"
FT   CDS_pept        640394..641512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0598"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: pin:Ping_3063 transposase, IS605 OrfB family
FT                   protein; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADH98134"
FT