(data stored in ACNUC7421 zone)

EMBL: CP001792

ID   CP001792; SV 1; circular; genomic DNA; STD; PRO; 3842635 BP.
XX
AC   CP001792; ACRA01000000-ACRA01000030;
XX
PR   Project:PRJNA32617;
XX
DT   16-OCT-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Fibrobacter succinogenes subsp. succinogenes S85, complete genome.
XX
KW   .
XX
OS   Fibrobacter succinogenes subsp. succinogenes S85
OC   Bacteria; Fibrobacteres; Fibrobacterales; Fibrobacteraceae; Fibrobacter.
XX
RN   [1]
RP   1-3842635
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Weimer P.J.,
RA   Stevenson D.M., Boyum J., Brumm P.I., Mead D.;
RT   "Complete sequence of Fibrobacter succinogenes subsp. succinogenes S85";
RL   Unpublished.
XX
RN   [2]
RP   1-3842635
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Weimer P.J.,
RA   Stevenson D.M., Boyum J., Brumm P.I., Mead D.;
RT   ;
RL   Submitted (06-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 43258486c18d75b6f6988b0e71962d90.
DR   BioSample; SAMN02598491.
DR   EnsemblGenomes-Gn; EBG00001221674.
DR   EnsemblGenomes-Gn; EBG00001221675.
DR   EnsemblGenomes-Gn; EBG00001221676.
DR   EnsemblGenomes-Gn; EBG00001221677.
DR   EnsemblGenomes-Gn; EBG00001221678.
DR   EnsemblGenomes-Gn; EBG00001221679.
DR   EnsemblGenomes-Gn; EBG00001221680.
DR   EnsemblGenomes-Gn; EBG00001221681.
DR   EnsemblGenomes-Gn; EBG00001221682.
DR   EnsemblGenomes-Gn; EBG00001221683.
DR   EnsemblGenomes-Gn; EBG00001221684.
DR   EnsemblGenomes-Gn; EBG00001221685.
DR   EnsemblGenomes-Gn; EBG00001221686.
DR   EnsemblGenomes-Gn; EBG00001221687.
DR   EnsemblGenomes-Gn; EBG00001221688.
DR   EnsemblGenomes-Gn; EBG00001221689.
DR   EnsemblGenomes-Gn; EBG00001221690.
DR   EnsemblGenomes-Gn; EBG00001221691.
DR   EnsemblGenomes-Gn; EBG00001221692.
DR   EnsemblGenomes-Gn; EBG00001221694.
DR   EnsemblGenomes-Gn; EBG00001221695.
DR   EnsemblGenomes-Gn; EBG00001221696.
DR   EnsemblGenomes-Gn; EBG00001221697.
DR   EnsemblGenomes-Gn; EBG00001221698.
DR   EnsemblGenomes-Gn; EBG00001221699.
DR   EnsemblGenomes-Gn; EBG00001221700.
DR   EnsemblGenomes-Gn; EBG00001221701.
DR   EnsemblGenomes-Gn; EBG00001221702.
DR   EnsemblGenomes-Gn; EBG00001221703.
DR   EnsemblGenomes-Gn; EBG00001221704.
DR   EnsemblGenomes-Gn; EBG00001221705.
DR   EnsemblGenomes-Gn; EBG00001221706.
DR   EnsemblGenomes-Gn; EBG00001221707.
DR   EnsemblGenomes-Gn; EBG00001221708.
DR   EnsemblGenomes-Gn; EBG00001221709.
DR   EnsemblGenomes-Gn; EBG00001221710.
DR   EnsemblGenomes-Gn; EBG00001221711.
DR   EnsemblGenomes-Gn; EBG00001221712.
DR   EnsemblGenomes-Gn; EBG00001221713.
DR   EnsemblGenomes-Gn; EBG00001221714.
DR   EnsemblGenomes-Gn; EBG00001221715.
DR   EnsemblGenomes-Gn; EBG00001221716.
DR   EnsemblGenomes-Gn; EBG00001221717.
DR   EnsemblGenomes-Gn; EBG00001221718.
DR   EnsemblGenomes-Gn; EBG00001221720.
DR   EnsemblGenomes-Gn; EBG00001221721.
DR   EnsemblGenomes-Gn; EBG00001221722.
DR   EnsemblGenomes-Gn; EBG00001221723.
DR   EnsemblGenomes-Gn; EBG00001221724.
DR   EnsemblGenomes-Gn; EBG00001221725.
DR   EnsemblGenomes-Gn; EBG00001221726.
DR   EnsemblGenomes-Gn; EBG00001221727.
DR   EnsemblGenomes-Gn; EBG00001221728.
DR   EnsemblGenomes-Gn; EBG00001221730.
DR   EnsemblGenomes-Gn; EBG00001221731.
DR   EnsemblGenomes-Gn; EBG00001221732.
DR   EnsemblGenomes-Gn; EBG00001221733.
DR   EnsemblGenomes-Gn; EBG00001221734.
DR   EnsemblGenomes-Gn; EBG00001221735.
DR   EnsemblGenomes-Gn; EBG00001221736.
DR   EnsemblGenomes-Gn; EBG00001221737.
DR   EnsemblGenomes-Gn; EBG00001221738.
DR   EnsemblGenomes-Gn; EBG00001221739.
DR   EnsemblGenomes-Gn; EBG00001221740.
DR   EnsemblGenomes-Gn; EBG00001221741.
DR   EnsemblGenomes-Gn; EBG00001221742.
DR   EnsemblGenomes-Gn; EBG00001221743.
DR   EnsemblGenomes-Gn; EBG00001221744.
DR   EnsemblGenomes-Gn; EBG00001221745.
DR   EnsemblGenomes-Gn; EBG00001221746.
DR   EnsemblGenomes-Gn; EBG00001221747.
DR   EnsemblGenomes-Gn; EBG00001221748.
DR   EnsemblGenomes-Gn; EBG00001221749.
DR   EnsemblGenomes-Gn; EBG00001221750.
DR   EnsemblGenomes-Gn; EBG00001221751.
DR   EnsemblGenomes-Gn; EBG00001221752.
DR   EnsemblGenomes-Gn; EBG00001221753.
DR   EnsemblGenomes-Gn; Fisuc_R0001.
DR   EnsemblGenomes-Gn; Fisuc_R0002.
DR   EnsemblGenomes-Gn; Fisuc_R0003.
DR   EnsemblGenomes-Gn; Fisuc_R0004.
DR   EnsemblGenomes-Gn; Fisuc_R0005.
DR   EnsemblGenomes-Gn; Fisuc_R0006.
DR   EnsemblGenomes-Gn; Fisuc_R0007.
DR   EnsemblGenomes-Gn; Fisuc_R0008.
DR   EnsemblGenomes-Gn; Fisuc_R0009.
DR   EnsemblGenomes-Gn; Fisuc_R0010.
DR   EnsemblGenomes-Gn; Fisuc_R0011.
DR   EnsemblGenomes-Gn; Fisuc_R0012.
DR   EnsemblGenomes-Gn; Fisuc_R0013.
DR   EnsemblGenomes-Gn; Fisuc_R0014.
DR   EnsemblGenomes-Gn; Fisuc_R0015.
DR   EnsemblGenomes-Gn; Fisuc_R0016.
DR   EnsemblGenomes-Gn; Fisuc_R0017.
DR   EnsemblGenomes-Gn; Fisuc_R0018.
DR   EnsemblGenomes-Gn; Fisuc_R0019.
DR   EnsemblGenomes-Gn; Fisuc_R0020.
DR   EnsemblGenomes-Gn; Fisuc_R0021.
DR   EnsemblGenomes-Gn; Fisuc_R0022.
DR   EnsemblGenomes-Gn; Fisuc_R0023.
DR   EnsemblGenomes-Gn; Fisuc_R0024.
DR   EnsemblGenomes-Gn; Fisuc_R0025.
DR   EnsemblGenomes-Gn; Fisuc_R0026.
DR   EnsemblGenomes-Gn; Fisuc_R0027.
DR   EnsemblGenomes-Gn; Fisuc_R0028.
DR   EnsemblGenomes-Gn; Fisuc_R0029.
DR   EnsemblGenomes-Gn; Fisuc_R0030.
DR   EnsemblGenomes-Gn; Fisuc_R0031.
DR   EnsemblGenomes-Gn; Fisuc_R0032.
DR   EnsemblGenomes-Gn; Fisuc_R0033.
DR   EnsemblGenomes-Gn; Fisuc_R0034.
DR   EnsemblGenomes-Gn; Fisuc_R0035.
DR   EnsemblGenomes-Gn; Fisuc_R0036.
DR   EnsemblGenomes-Gn; Fisuc_R0037.
DR   EnsemblGenomes-Gn; Fisuc_R0038.
DR   EnsemblGenomes-Gn; Fisuc_R0039.
DR   EnsemblGenomes-Gn; Fisuc_R0040.
DR   EnsemblGenomes-Gn; Fisuc_R0041.
DR   EnsemblGenomes-Gn; Fisuc_R0042.
DR   EnsemblGenomes-Gn; Fisuc_R0043.
DR   EnsemblGenomes-Gn; Fisuc_R0044.
DR   EnsemblGenomes-Gn; Fisuc_R0045.
DR   EnsemblGenomes-Gn; Fisuc_R0046.
DR   EnsemblGenomes-Gn; Fisuc_R0047.
DR   EnsemblGenomes-Gn; Fisuc_R0048.
DR   EnsemblGenomes-Gn; Fisuc_R0049.
DR   EnsemblGenomes-Gn; Fisuc_R0050.
DR   EnsemblGenomes-Gn; Fisuc_R0051.
DR   EnsemblGenomes-Gn; Fisuc_R0052.
DR   EnsemblGenomes-Gn; Fisuc_R0053.
DR   EnsemblGenomes-Gn; Fisuc_R0054.
DR   EnsemblGenomes-Gn; Fisuc_R0055.
DR   EnsemblGenomes-Gn; Fisuc_R0056.
DR   EnsemblGenomes-Gn; Fisuc_R0057.
DR   EnsemblGenomes-Gn; Fisuc_R0058.
DR   EnsemblGenomes-Gn; Fisuc_R0059.
DR   EnsemblGenomes-Gn; Fisuc_R0060.
DR   EnsemblGenomes-Gn; Fisuc_R0061.
DR   EnsemblGenomes-Gn; Fisuc_R0062.
DR   EnsemblGenomes-Gn; Fisuc_R0063.
DR   EnsemblGenomes-Gn; Fisuc_R0064.
DR   EnsemblGenomes-Gn; Fisuc_R0065.
DR   EnsemblGenomes-Gn; Fisuc_R0066.
DR   EnsemblGenomes-Gn; Fisuc_R0067.
DR   EnsemblGenomes-Gn; Fisuc_R0068.
DR   EnsemblGenomes-Gn; Fisuc_R0069.
DR   EnsemblGenomes-Tr; EBT00001790447.
DR   EnsemblGenomes-Tr; EBT00001790448.
DR   EnsemblGenomes-Tr; EBT00001790449.
DR   EnsemblGenomes-Tr; EBT00001790450.
DR   EnsemblGenomes-Tr; EBT00001790451.
DR   EnsemblGenomes-Tr; EBT00001790452.
DR   EnsemblGenomes-Tr; EBT00001790453.
DR   EnsemblGenomes-Tr; EBT00001790455.
DR   EnsemblGenomes-Tr; EBT00001790456.
DR   EnsemblGenomes-Tr; EBT00001790457.
DR   EnsemblGenomes-Tr; EBT00001790458.
DR   EnsemblGenomes-Tr; EBT00001790459.
DR   EnsemblGenomes-Tr; EBT00001790460.
DR   EnsemblGenomes-Tr; EBT00001790461.
DR   EnsemblGenomes-Tr; EBT00001790462.
DR   EnsemblGenomes-Tr; EBT00001790463.
DR   EnsemblGenomes-Tr; EBT00001790465.
DR   EnsemblGenomes-Tr; EBT00001790466.
DR   EnsemblGenomes-Tr; EBT00001790467.
DR   EnsemblGenomes-Tr; EBT00001790468.
DR   EnsemblGenomes-Tr; EBT00001790469.
DR   EnsemblGenomes-Tr; EBT00001790470.
DR   EnsemblGenomes-Tr; EBT00001790471.
DR   EnsemblGenomes-Tr; EBT00001790472.
DR   EnsemblGenomes-Tr; EBT00001790473.
DR   EnsemblGenomes-Tr; EBT00001790474.
DR   EnsemblGenomes-Tr; EBT00001790476.
DR   EnsemblGenomes-Tr; EBT00001790477.
DR   EnsemblGenomes-Tr; EBT00001790478.
DR   EnsemblGenomes-Tr; EBT00001790479.
DR   EnsemblGenomes-Tr; EBT00001790480.
DR   EnsemblGenomes-Tr; EBT00001790481.
DR   EnsemblGenomes-Tr; EBT00001790482.
DR   EnsemblGenomes-Tr; EBT00001790483.
DR   EnsemblGenomes-Tr; EBT00001790484.
DR   EnsemblGenomes-Tr; EBT00001790485.
DR   EnsemblGenomes-Tr; EBT00001790486.
DR   EnsemblGenomes-Tr; EBT00001790487.
DR   EnsemblGenomes-Tr; EBT00001790488.
DR   EnsemblGenomes-Tr; EBT00001790489.
DR   EnsemblGenomes-Tr; EBT00001790490.
DR   EnsemblGenomes-Tr; EBT00001790491.
DR   EnsemblGenomes-Tr; EBT00001790492.
DR   EnsemblGenomes-Tr; EBT00001790493.
DR   EnsemblGenomes-Tr; EBT00001790494.
DR   EnsemblGenomes-Tr; EBT00001790495.
DR   EnsemblGenomes-Tr; EBT00001790496.
DR   EnsemblGenomes-Tr; EBT00001790497.
DR   EnsemblGenomes-Tr; EBT00001790498.
DR   EnsemblGenomes-Tr; EBT00001790499.
DR   EnsemblGenomes-Tr; EBT00001790500.
DR   EnsemblGenomes-Tr; EBT00001790501.
DR   EnsemblGenomes-Tr; EBT00001790502.
DR   EnsemblGenomes-Tr; EBT00001790503.
DR   EnsemblGenomes-Tr; EBT00001790504.
DR   EnsemblGenomes-Tr; EBT00001790505.
DR   EnsemblGenomes-Tr; EBT00001790506.
DR   EnsemblGenomes-Tr; EBT00001790507.
DR   EnsemblGenomes-Tr; EBT00001790508.
DR   EnsemblGenomes-Tr; EBT00001790509.
DR   EnsemblGenomes-Tr; EBT00001790510.
DR   EnsemblGenomes-Tr; EBT00001790511.
DR   EnsemblGenomes-Tr; EBT00001790512.
DR   EnsemblGenomes-Tr; EBT00001790513.
DR   EnsemblGenomes-Tr; EBT00001790514.
DR   EnsemblGenomes-Tr; EBT00001790515.
DR   EnsemblGenomes-Tr; EBT00001790516.
DR   EnsemblGenomes-Tr; EBT00001790517.
DR   EnsemblGenomes-Tr; EBT00001790518.
DR   EnsemblGenomes-Tr; EBT00001790519.
DR   EnsemblGenomes-Tr; EBT00001790520.
DR   EnsemblGenomes-Tr; EBT00001790521.
DR   EnsemblGenomes-Tr; EBT00001790522.
DR   EnsemblGenomes-Tr; EBT00001790523.
DR   EnsemblGenomes-Tr; EBT00001790524.
DR   EnsemblGenomes-Tr; EBT00001790525.
DR   EnsemblGenomes-Tr; EBT00001790526.
DR   EnsemblGenomes-Tr; Fisuc_R0001-1.
DR   EnsemblGenomes-Tr; Fisuc_R0002-1.
DR   EnsemblGenomes-Tr; Fisuc_R0003-1.
DR   EnsemblGenomes-Tr; Fisuc_R0004-1.
DR   EnsemblGenomes-Tr; Fisuc_R0005-1.
DR   EnsemblGenomes-Tr; Fisuc_R0006-1.
DR   EnsemblGenomes-Tr; Fisuc_R0007-1.
DR   EnsemblGenomes-Tr; Fisuc_R0008-1.
DR   EnsemblGenomes-Tr; Fisuc_R0009-1.
DR   EnsemblGenomes-Tr; Fisuc_R0010-1.
DR   EnsemblGenomes-Tr; Fisuc_R0011-1.
DR   EnsemblGenomes-Tr; Fisuc_R0012-1.
DR   EnsemblGenomes-Tr; Fisuc_R0013-1.
DR   EnsemblGenomes-Tr; Fisuc_R0014-1.
DR   EnsemblGenomes-Tr; Fisuc_R0015-1.
DR   EnsemblGenomes-Tr; Fisuc_R0016-1.
DR   EnsemblGenomes-Tr; Fisuc_R0017-1.
DR   EnsemblGenomes-Tr; Fisuc_R0018-1.
DR   EnsemblGenomes-Tr; Fisuc_R0019-1.
DR   EnsemblGenomes-Tr; Fisuc_R0020-1.
DR   EnsemblGenomes-Tr; Fisuc_R0021-1.
DR   EnsemblGenomes-Tr; Fisuc_R0022-1.
DR   EnsemblGenomes-Tr; Fisuc_R0023-1.
DR   EnsemblGenomes-Tr; Fisuc_R0024-1.
DR   EnsemblGenomes-Tr; Fisuc_R0025-1.
DR   EnsemblGenomes-Tr; Fisuc_R0026-1.
DR   EnsemblGenomes-Tr; Fisuc_R0027-1.
DR   EnsemblGenomes-Tr; Fisuc_R0028-1.
DR   EnsemblGenomes-Tr; Fisuc_R0029-1.
DR   EnsemblGenomes-Tr; Fisuc_R0030-1.
DR   EnsemblGenomes-Tr; Fisuc_R0031-1.
DR   EnsemblGenomes-Tr; Fisuc_R0032-1.
DR   EnsemblGenomes-Tr; Fisuc_R0033-1.
DR   EnsemblGenomes-Tr; Fisuc_R0034-1.
DR   EnsemblGenomes-Tr; Fisuc_R0035-1.
DR   EnsemblGenomes-Tr; Fisuc_R0036-1.
DR   EnsemblGenomes-Tr; Fisuc_R0037-1.
DR   EnsemblGenomes-Tr; Fisuc_R0038-1.
DR   EnsemblGenomes-Tr; Fisuc_R0039-1.
DR   EnsemblGenomes-Tr; Fisuc_R0040-1.
DR   EnsemblGenomes-Tr; Fisuc_R0041-1.
DR   EnsemblGenomes-Tr; Fisuc_R0042-1.
DR   EnsemblGenomes-Tr; Fisuc_R0043-1.
DR   EnsemblGenomes-Tr; Fisuc_R0044-1.
DR   EnsemblGenomes-Tr; Fisuc_R0045-1.
DR   EnsemblGenomes-Tr; Fisuc_R0046-1.
DR   EnsemblGenomes-Tr; Fisuc_R0047-1.
DR   EnsemblGenomes-Tr; Fisuc_R0048-1.
DR   EnsemblGenomes-Tr; Fisuc_R0049-1.
DR   EnsemblGenomes-Tr; Fisuc_R0050-1.
DR   EnsemblGenomes-Tr; Fisuc_R0051-1.
DR   EnsemblGenomes-Tr; Fisuc_R0052-1.
DR   EnsemblGenomes-Tr; Fisuc_R0053-1.
DR   EnsemblGenomes-Tr; Fisuc_R0054-1.
DR   EnsemblGenomes-Tr; Fisuc_R0055-1.
DR   EnsemblGenomes-Tr; Fisuc_R0056-1.
DR   EnsemblGenomes-Tr; Fisuc_R0057-1.
DR   EnsemblGenomes-Tr; Fisuc_R0058-1.
DR   EnsemblGenomes-Tr; Fisuc_R0059-1.
DR   EnsemblGenomes-Tr; Fisuc_R0060-1.
DR   EnsemblGenomes-Tr; Fisuc_R0061-1.
DR   EnsemblGenomes-Tr; Fisuc_R0062-1.
DR   EnsemblGenomes-Tr; Fisuc_R0063-1.
DR   EnsemblGenomes-Tr; Fisuc_R0064-1.
DR   EnsemblGenomes-Tr; Fisuc_R0065-1.
DR   EnsemblGenomes-Tr; Fisuc_R0066-1.
DR   EnsemblGenomes-Tr; Fisuc_R0067-1.
DR   EnsemblGenomes-Tr; Fisuc_R0068-1.
DR   EnsemblGenomes-Tr; Fisuc_R0069-1.
DR   EuropePMC; PMC3079729; 21526192.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC3277595; 22347999.
DR   EuropePMC; PMC4668043; 26629814.
DR   EuropePMC; PMC5442110; 28536480.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001792.
DR   SILVA-SSU; CP001792.
DR   StrainInfo; 267071; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085750
CC   Source DNA and bacteria available from David Mead
CC   (dmead@lucigen.com)
CC   Contacts: David Mead (dmead@lucigen.com)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Fibrobacter succinogenes subsp.
CC                            succinogenes S85
CC   Culture Collection ID :: ATCC 19169
CC   GOLD Stamp ID         :: Gi03969
CC   Greengenes ID         :: 3576
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Host
CC   Phenotypes            :: Cellulose degrader
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3842635
FT                   /organism="Fibrobacter succinogenes subsp. succinogenes
FT                   S85"
FT                   /sub_species="succinogenes"
FT                   /strain="S85"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:59374"
FT   gene            128..1453
FT                   /locus_tag="Fisuc_0001"
FT   CDS_pept        128..1453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: gem:GM21_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73616"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACX73616.1"
FT                   /translation="MQVEWERCLNYLHGMLSDTVFKTYFAQTKLVSQTPGHAVIAVPPG
FT                   LDVKVYAAYKDLIRLAWKDVSHDEAPVEFEFQPQDVYQPQVSSSDNSFREFIKPSVPLS
FT                   GSFRFENFVPGDKAQLAFNAALAVARNPDGTQYNPLFIYGSSGLGKTHLLQSIGNYILE
FT                   EDPTKRVIYLTSEDFSQQYMKCLQEKRITEMSDFYRNEVDILLIDDIQNWTGKYETQNE
FT                   FFLIFNALHQAGKQIVLTSDAPAAEVKNLSDRLVSRFSWGLTVDIQPPDVETREAILHK
FT                   KAEERHLEISDEVIRYLAENIASNVRCLESAIIKLTLQSSLMSHDIDMNIAQKVVTEIA
FT                   PTLRRRVSLDAVLHAVSQHYEVPETKLIEPGRGTKEISKARQVAMFLMRELSPISLQSI
FT                   GSRFGGKDHSTVVHAIKSVKKEMETDPSFARLIESLKNTIHD"
FT   gene            complement(1578..2561)
FT                   /locus_tag="Fisuc_0002"
FT   CDS_pept        complement(1578..2561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0002"
FT                   /product="diaminopimelate dehydrogenase"
FT                   /EC_number="1.4.1.16"
FT                   /note="TIGRFAM: diaminopimelate dehydrogenase; KEGG:
FT                   cco:CCC13826_1251 diaminopimelate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73617"
FT                   /inference="protein motif:TFAM:TIGR01921"
FT                   /protein_id="ACX73617.1"
FT                   /translation="MAKIAILGYGNLGRGVECAVKQAPDMELVAVFTRRDPLTVKIQTA
FT                   GVPVLNVSEMEAWKDKVDVLIICGGSATDLPVLTPKYASMFNVIDSFDTHAKIPQHFAA
FT                   VDAAAKGANKIAMISVGWDPGMFSLNRVYAQSILPEGKDYTFWGKGVSQGHSDAVRRIK
FT                   GVKNAKQYTCPVESALEAVRSGSMPELTTRQKHTRLVYVVAEEGADKAYIENAIKTMPN
FT                   YFDEYDTTVNFISEEEFNKNHSGLAHGGFVIRTGKTGMNKEHTHVIEYSLKLDSNPEFT
FT                   TSVLVAYARAALRMKANGQTGCKTVLDVPPAYLSTLSDEDLRAHCL"
FT   gene            2821..3609
FT                   /locus_tag="Fisuc_0003"
FT   CDS_pept        2821..3609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dal:Dalk_0752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73618"
FT                   /inference="similar to AA sequence:KEGG:Dalk_0752"
FT                   /protein_id="ACX73618.1"
FT                   /translation="MKNHFLSALSAGFLLFTTCFAQSANEIAKKVHDLPSGKTSSGLVS
FT                   VTLIDKNGKTRNRELVSYTMKDGSTDKTVLMFKTPRDVAGISYLTYDYPDKADGSTVDS
FT                   DSWIYIPAMKKVRRVSGSNKDDDFQGTDFTYDDLGTRSLSKDNFALLGEEKVNGIDCWI
FT                   LEAKAKDPKAKVSRRVTWVNKKTFVVQKGEYYDKQNRLQKTLTADDIKQVNGYWTTLKQ
FT                   TMTNVQTNHKTIYEVKNLKYDEKVNESYFTVSALEREQIK"
FT   gene            3630..6029
FT                   /locus_tag="Fisuc_0004"
FT   CDS_pept        3630..6029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0004"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: dal:Dalk_0753 patched family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73619"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ACX73619.1"
FT                   /translation="MKVEKFNKFFGKIGQAQIRNRWKILAGLLIVTVICCLGLSNFSLA
FT                   LGEEGWFGNSDEITINTKKYEETFGNLNGIGVLVVKQGEGDVFSEDMLKVIEKIGNRMR
FT                   DEIPFADRLTSIVEVDIPVGNDEGFSIVKPYENGIPSDSEGLAKARALVMRGSEKTNAL
FT                   INSLVSDDGKETWISLSLHPFTGKELEEKYGGDNTEVSTDIGYKLMNIIESEEFQNKGF
FT                   KLYGGGMPYDSANEDRYEVPEYGVRVLCSIVVMLLFLAICLRNVFGVIVPAVATISAIA
FT                   TVFGAMSFFGEKADSALVTLPVVLGMALAVGYSVHYIKMFKLHFRRTGKRKESAIKCVE
FT                   ECGWPVLFTVLTTMASFISFLFVNMKPLEWMGKTSAFIVLAIYIYVTVLIPILLSFGKD
FT                   RAPRATQVNGATKLDLSFSRWSKFVHDRKKSFIVISALVIAAFIPGMFKITAQLDYLTI
FT                   TGDKMPYIQEVKKMLAQKLGNQYSYTVMISYDEEGAFKKPENMKALVQLEDYLGTLSLT
FT                   KWSGGKARITSATSILKEMNRALNEGKDSMYTVPEDEYVLAQLMELSSIEMHNDFSDVM
FT                   DDDFKTTVVSVDMTQFATEEALANMDALKAKLAELFPGAKCTLLGDMIRYSEMSNRIIF
FT                   GGLKSFGFSLVIIAIMLVFAFSSLKLGLIGMIPNVAPVILVGGVMGYFNYALDFSTITV
FT                   MPMILGIAVDDTIHLTTHLKMKHEQMGSSEKAMEATFREIGATMFLTTIILCSMFSVYL
FT                   FSPMHFLEVLGVLIIVGLSSALIADYTITPALLHVAKPFGKEKEEV"
FT   gene            6026..7429
FT                   /locus_tag="Fisuc_0005"
FT   CDS_pept        6026..7429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_20220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73620"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73620.1"
FT                   /translation="MNKHSFLTAITPAIALAAITLFSAPTLYAQETTFNGSLTTKAGVS
FT                   LANSHDLKHDFVLGQTIFDGTIKTFFDEGMVYVNGQLVHDAIGTQASNGMSGFVADDGS
FT                   FALKLREAYIDWKTGIFALRIGRQIVSWGKADDIQITDVVSPFDESSVVANDYNESKLG
FT                   VDAVRLSVLTDKAQVDAYYIPFFTPSILPIASKNPLRSRVFPSNVDGLDVYSPYYYDNF
FT                   DLPKKRLSNSEYALRASLYTSVMDLSLYGFYGWDDTPFFKYSPLMYEDANDDPNLEGFT
FT                   VSGKYRRMAMVGADAAIPVGDFVFRLETAYFPKRHIQTSADYQIEKSLNEEHSYTSRRR
FT                   DQLLSLVGVDWTYSFPIIGSLTITAQYISDYVFNYKNYLDRKRYEHQVTLSVEKSFLNE
FT                   TLTVSGSGALEFCACSAAGEVEVDYQLNDAITLSMIGDIYIKGTQGRDGTYGLYRDFSS
FT                   LTLKGKVSF"
FT   gene            7476..8459
FT                   /locus_tag="Fisuc_0006"
FT   CDS_pept        7476..8459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73621"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73621.1"
FT                   /translation="MFCMNKFISILLMTVCSTALFAEETSSKEKSPLNYSLLTSLGYYP
FT                   ETTPKTGSSHFSGISGIYDGIEFVTEFDATYTMPFLNGSDELTADNHLTFNLGVELSPV
FT                   TVAPLASVTFSPIAFLEFAIGGIIGTGWGLTDDIQGLAKLNESKPKYEDLTPFAHWYFY
FT                   TWASGCFMFDLAAVWEGDWHHVVATASYKVGYQKMTGTKSSVWTWRNTYGQASGWVYEQ
FT                   EYFLGYQMPLKVSTVGVGTTLWGNYQASDYGNFSRNYEGDFMTIDIWPMVEVKLSEKDM
FT                   LYALADFRGRRSFLEKYKDDAHEPFMTKTGREWYFYALGFQWKHTF"
FT   gene            complement(8463..8897)
FT                   /locus_tag="Fisuc_0007"
FT   CDS_pept        complement(8463..8897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0007"
FT                   /product="deoxyUTP pyrophosphatase"
FT                   /note="PFAM: deoxyUTP pyrophosphatase; KEGG: rpr:RP399
FT                   deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73622"
FT                   /inference="protein motif:PFAM:PF00692"
FT                   /protein_id="ACX73622.1"
FT                   /translation="MASQTIKIQYLDESIPKLTYVGGKSDWIDLAAAETVTLKAGEFRL
FT                   IHLGVAMKLPEGYEAHIAPRSSTFKNYGILQANSVGVVDSSYCGANDWWKMPVYATRDV
FT                   IIEKGSRIAQFRIMEIQPTLTFVEGALDGADRGGFGSTGI"
FT   gene            complement(8913..9785)
FT                   /locus_tag="Fisuc_0008"
FT   CDS_pept        complement(8913..9785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aqpA; aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73623"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73623.1"
FT                   /translation="MELREKPGKVQKLLELSLRFRLIFVLLMIGFAAAFLVTGWQQMAS
FT                   LPLGASEALGMWIAKFTNVVSAWHSTQYLFVAGLSMLVLYFVFGGVRGGFAGLIALVAF
FT                   LGALYALGGDEDMLLMFFAVIAGLALLFVAFVKWSVACALFPFVLSWLLLTGFVSWFPM
FT                   MIGKAWLMWAVLSAIAFSGVMACALVAGKELGDGSPKAGALVKAGKKLLVPVLISSLLA
FT                   ISALVVDMSVVVDAKRIGCAAFLWVAFNVWFFGFTFSTLSFAPWDRIRSGSRRVKMGDK
FT                   KKKPAKKKK"
FT   gene            complement(9790..13746)
FT                   /locus_tag="Fisuc_0009"
FT   CDS_pept        complement(9790..13746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73624"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73624.1"
FT                   /translation="MRFAPENAFYVDEGDVPVRHYRLALPSNVKPSVSVTNSKLVSLGA
FT                   SPCKSIPAKIQSIDVSSPFFKDNLWMVDVFVPLYVKEGGSIALRKNFRLSVDFGAATSG
FT                   GRNPGARALMQVVNAKSAAKFGSAASRKSLRRSASAEIDDVAQLVELVVGDENIATFSE
FT                   DGMYAVSYEMLRTALRKVGREDTLLHGVPVEKVCVYGASPDTLPDMGPGEKLRNPNQLF
FT                   ELPIKVDDRNSNGIFDDGDSLFFVGYGNAFWKRTDSEPTQVPDVPKTNMGYFHSYSPYS
FT                   FYQHFILGYKQTGSGLRLKTIEPPKSTAKSIEWLRYVRAEKDELLRDGYYGRVVDWEKT
FT                   TGKEYFWKWREFGDTLSLSSADLDFKTTTRLPGLVSGGKGFVALSFFPLRSQSASMMFS
FT                   DSTYEKRINPIVFNLKVNGISYSKLKSDSFYWASGDILPGGNFGIPTSDLKSDGNKFEL
FT                   TIYDNSYQHDRFDGYSVAYQWEPAKVSIDSSEWLLPGFATGVIRIPVGTDSDLRVMKFK
FT                   DFAPVGLLKITDGEAIDSIGANEDVRYLLFNNGNRRKALSLKGVAAPSKNAVQKLSQIS
FT                   SKTEYLIITPDVFLAQAESLAVFRSSEKSASQLVTAVVSAENIYRHYTGGALSPIAIRN
FT                   YIAYARSVCPDLRFVLLAGGGNYDYRGKANIGENYIPPFEKEASVTEDFFAVLDSGEVV
FT                   RSGKTYDVDLALGRLPVTTVQEFEDYIDKAKDYDYIGRFDHGEWKSTLLLAADDDRNAG
FT                   SADPMDHTIYQENLANLIDTTAESQGFRMNMKKVYLLNYEADAAEQKQEAANDFLNMLN
FT                   QGALMTVFYGHGSKVAWASEGLMKLSYLPKLSNEKRYTVLNSFSCTVGRFDEGGSKSMT
FT                   EAFVLLPNAGAIAAVGAARETYAKPNEVFAKNFIGPALLKDGNYLGVAYMQAKDNVFLH
FT                   SKSVPTYTNNVYNSEHYVYMGEPVIRMPLAELKVSMDSPLDSIKALEKIKLSGKVSGMS
FT                   SGNIALTLREGRFTKRLDMISTSNYADVKYDGPLIYSEVVPVVGGRFETEFVTPKKLNI
FT                   GDSLAELRGWAYSSNDVAVGRYFEKNIKITGISNYADSLNDKAPPTIKIQLCNANESTS
FT                   FADNQFVKLLTPACLQVVVEDETALDYREQADEGITFEMFGLENSYHPTLFLEQSSKRA
FT                   VVRKSFTTETYPPGNYTFKVRAMDVLGNVSIKILNIEITEAMQAGLADVFNVPNPMGKK
FT                   GTTFYFKNLAVGVESDVNIFIYNQHGRLVKVIKNAKSGVTQWDGRDNYGRLLANGLYHY
FT                   VVRSKTRIVNSSSDTKMKSKTQTWTKKQKLLISR"
FT   gene            complement(13943..14824)
FT                   /locus_tag="Fisuc_0010"
FT   CDS_pept        complement(13943..14824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73625"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73625.1"
FT                   /translation="MRKFLAACALFSIFATSALAAPASSKAKPAGSTKIYGAVEAKDGF
FT                   VGGRLFDVLDSVGGTGTWMEWDVNGVRDPSVMKVLDPILNSANKPKMIWAITEREKPLL
FT                   SVLLSKGAGEVLVFYELGSLDAKPVPLKLNKVLTPDVVFRDYKQVSEKEFVHLDRSNLK
FT                   ISVLDKLIRFTYDNPDKTPLRYDPDFATKTLVDKHAEVNDYLGFLKYEYSMMLRAFVQS
FT                   TRGIFNWQPWHWYMDKWTSKYMISAKEIEMILSKGIPPEYITVFKAKAQGGEKIEMRTT
FT                   GNGFLEMVITRP"
FT   gene            complement(14852..15514)
FT                   /locus_tag="Fisuc_0011"
FT   CDS_pept        complement(14852..15514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73626"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73626.1"
FT                   /translation="MAGCAGSSNGSTNEPAETAAVRDAKVKAQESQKLAMLEEMYDLFK
FT                   KSVENRAPSDILLDFLTDPSEAWLDELESHAKSYDATAMDTCQFYEAYAIVLYRLYERE
FT                   HLWTVPDYRMLYLLLYDSGFLDLANHVKMGPFEVKNDRGSVGLASSPKVPIMLFNWDDT
FT                   KWKLDLIETLPLITKGVEATAAKKNWTGAKLALYWLDKKYHLQYSRLDESLLEPIGF"
FT   gene            15566..16057
FT                   /locus_tag="Fisuc_0012"
FT   CDS_pept        15566..16057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: peptide chain release factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73627"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73627.1"
FT                   /translation="MHRDTYLKMNLDELLRACTLKGYQGSGPGGQHRNKTNTGVHLSLQ
FT                   QYNLEIKSSESRSAKENKIHALHHMQMALALNVREEPPAVEMKFPGSNGHIQPSNPQFP
FT                   LFVAHVFDIMATKNGDTKAAAAAFGLSPSALVKILRQDKSCAAKLQGNRVENGKSKLHL
FT                   "
FT   gene            16173..17414
FT                   /locus_tag="Fisuc_0013"
FT   CDS_pept        16173..17414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73628"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73628.1"
FT                   /translation="MSPTTKKHVCRYAATALTALAFWNCSSDSRAESPIDSIQIGESAN
FT                   IALNLDYTGTPLLDSLVLDCYGSDTLHLVHSIEKKSFNLDLFPGEEWIFNAKLYANGAL
FT                   MQEGEVTTSLEAGSAVSLKIPMHALVGFVYVKIPIGFGNPAGIKKGEMKLTSGDETFTY
FT                   PMEFDSDNVTFTSDDLKLDREYHISISMQDESEKTIFSMEDDFTLDENTPIPSFQIESL
FT                   RSKIALAIDLAKDVNLQVSLRLPAMKRAPAANDIVVSEFFVQPKDSTQFTFVEFYNGST
FT                   DTLVLDKCTLGKTSNVSGAAEISTVTLPPNEVLVVGTSETADIAGIYKYAESMPQFGKT
FT                   SGSIVLQCNGNVLDSLYYGKADTLHVTPLPIGSSSAAVRKSTQLNIGLWNKRSEPDSWC
FT                   TDTPTPGMISACGN"
FT   gene            complement(17578..18114)
FT                   /locus_tag="Fisuc_0014"
FT   CDS_pept        complement(17578..18114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6735 sensor histidine kinase/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73629"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73629.1"
FT                   /translation="MVLRTDSVKNLSSFVSRLSSNYYIYNMAKEIDNFDDEEMDEANGA
FT                   MLDALNAEENFVPQVRDYSDRRILIWEEDDVRREACLEVLSDLLVGAYFKAVKTEEEAL
FT                   QQLEEDDWDTFVVDFYTEGVSVSDFIKRVNNYPGSILVAINMGPLTLPEEREPAKAENL
FT                   RRLFDIERASSQIHA"
FT   gene            complement(18175..18579)
FT                   /locus_tag="Fisuc_0015"
FT   CDS_pept        complement(18175..18579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0015"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: cvi:CV_3910
FT                   Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73630"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ACX73630.1"
FT                   /translation="MALDYGEHRVGVAFGDSELKMAFSRETIDQKTTNLFERLDQLVRL
FT                   NKIDEFVVGMPYHPDGRKDGKNVVVEAFIKDLTLRFPGMKIHTQDESYSSVQAQEFTSY
FT                   MSKKKKQKNKAIIDRTAAAIILQRWFDERG"
FT   gene            18680..20515
FT                   /locus_tag="Fisuc_0016"
FT   CDS_pept        18680..20515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0016"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; GTP-binding protein
FT                   HSR1-related; elongation factor Tu domain 2 protein; KEGG:
FT                   gsu:GSU0500 GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73631"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACX73631.1"
FT                   /translation="MDQSKIRNVAIIAHVDHGKTTLVNQLLKQCGTFHEGEEIVDRVMD
FT                   SDNLERERGITILSKNTSVMYKGYRVNIVDTPGHADFGGQVERVLGTVDGVLLVVDAFE
FT                   GPMAQTRFVTKKALELGLTPIIVVNKIDRDGCNPLLALDKVFDLFCELDATEEQLDFDR
FT                   VFGSGRKGICRAELEDPDGDFSILMDKIIERIPAPKGDPNAEPLLQIASLEYSSFLGRL
FT                   AVGRVQQGVFKPNQTYAQAFPDGTVKNVRPQKLLRYEGLTPKPIEEAGPGEIILIAGLD
FT                   YFDIGDTLSSTNNPVHLPRIHIDPPTISMLFTVNTSPLAGKYGGKFMTGNQLQERLERA
FT                   HMADPALLVEKAEGASTFKVSGRGILHLTILVENMRRELYEFTIGSPQVIFQKDESGKL
FT                   LEPVEDFKVEVPNEFSGACIQEIQQRKGEMVNMTTDENDRVSLEFIVPSRGLIGIRPKL
FT                   LSLSKGYAVTQSFFKEYQPYKGEIPSRINGVLIAKEPGEAASYALSNLEDRGYLIIGPG
FT                   AEVYPGMIVGEHNRDVDITVNVTKGKHLTNMRSKSADDMIQLTPYRRMTLEECVTFINE
FT                   DECIEVTPEVLRIRKTELDPIKRKQMSKKPAEDDD"
FT   gene            complement(20576..21328)
FT                   /locus_tag="Fisuc_0017"
FT   CDS_pept        complement(20576..21328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0017"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   atc:AGR_L_3056 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73632"
FT                   /inference="protein motif:PRIAM:2.7.4.7"
FT                   /protein_id="ACX73632.1"
FT                   /translation="MSEKMNFALTIAGFDGSAGAGILADVKTMAHFGVFCESVCTALTQ
FT                   QNEDEFVAPGWVIWERIEAQLETLFAKRQFKFVKIGLVEKAKVLQRIVEFVREKSPDAY
FT                   IVWDPIASASAGFHFMRSAERDEFMPVMKQIDLVTPNLDEFGFLGFEQAASRGKFEFGK
FT                   DFALLLKGGHSTDDEAVDTLWDRDGKQYKFTSPRIPGNGKHGTGCHLSSAILANLALGH
FT                   TLPESCQIAKNYLTELLQSGEGRLAKDF"
FT   gene            complement(21330..22616)
FT                   /locus_tag="Fisuc_0018"
FT   CDS_pept        complement(21330..22616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73633"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_0559"
FT                   /protein_id="ACX73633.1"
FT                   /translation="MMIEFNIFYKLAAALGIGFIIGMQRENSYSRNNSRHPAGLCSFSI
FT                   VSLCGALSCYLGDLMGSIVPFVVGLVIVGLLLVASHIAYGLSNQNNGGPAGVTTSAALI
FT                   MIYFLGALCWYNRLLEACILMIVLLWLLAVKRQLHDFAKKISTEDIIATVKFAVISLMI
FT                   LPFLPNRSFGPPGLEVLNPHTIWLFVVFICGIGFVGYVLIKLVGPGKGIWLTGLLGGLA
FT                   SSTALTLNLAGRSVDNEQYAADFTLGIVLSWSVMYARLYLICIFLMPSLALPLLAPLLV
FT                   PVVPGLGYAGYLKLRESKDHRQKTTDFNNPFKLLPAIKFGLVFTVVMFIANAAHAYFGS
FT                   GALMICSFLGGAAEMDAVAFSLIDMCRKATLEHHNLILALLFASLANTLTKGCMVYFLG
FT                   AKSMRRPILPAVGLICGVSVVMIGIYSVV"
FT   gene            complement(22711..24402)
FT                   /locus_tag="Fisuc_0019"
FT   CDS_pept        complement(22711..24402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0019"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: dma:DMR_36470 GGDEF domain protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73634"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX73634.1"
FT                   /translation="MLLRNGKKILRLLIAVVAAVIVVLFVVSFNGMCRHGSCNNVIALN
FT                   DGWSISFGGIHLPPMEHVSDFRVPSNIQPGDTIIYERDMRNDSIPLPTTLRFHAYHVAV
FT                   AVYVDSVCYYRYGFERFKAGKLVGSGIHLVNMPEFLDDHVIRVVTIVTEKAAAKSVTQI
FT                   ELLRSNSMTDYFSQNSDSITIGIFLMFFGMIAFITGCCAVGFDRAYYRLVLIGLFAGLM
FT                   GLWTLNYAKGIQIVSTNYALDTTLEYVSLYLAAIPFGLLIINMRAGKISTWKLNVLKVI
FT                   VGFGVLFFLVTTILHVTDIAHYPTFLLIYHSYIFVSFLFMVFFKVLYDRGAGMQEKILA
FT                   SGTVVFVLFGIADLFRYNVQNLFGLEKSFLDATCLPVGTLLFILFLMVGYLVYMYEELM
FT                   DKTEKEVLRQIAYRDALTGIYNRAKCEHIFEVLNRDDSDYAIVSIDVNGLKYVNDHFGH
FT                   STGDKLLCAFADVFKNAFNGIGTTIRMGGDEFVAIVRAEHLSDLNTALKTMVLLEKDAK
FT                   LPIELNVAYGYSVRRRGDAVTAMDVYRMADANMYAMKLASKQQRMA"
FT   gene            complement(24442..24933)
FT                   /locus_tag="Fisuc_0020"
FT   CDS_pept        complement(24442..24933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0020"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="PFAM: dihydrofolate reductase region; KEGG:
FT                   bmi:BMEA_A1445 dihydrofolate reductase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73635"
FT                   /inference="protein motif:PRIAM:1.5.1.3"
FT                   /protein_id="ACX73635.1"
FT                   /translation="MLISAIVAVSENNVIGRDGHLPWHLSADLKRFKAITTGHAIILGR
FT                   KNYDDIGRPLPNRTNYVLTRNKDFQAPGCIVCSSLGEAIEAARAAGETECFIIGGAAVY
FT                   REAMPLVEKLYLTRVLSHVEGDVFFPEWNDKFQKESAESFPADEKNDFPTTFEIWVRKK
FT                   "
FT   gene            complement(24942..25403)
FT                   /locus_tag="Fisuc_0021"
FT   CDS_pept        complement(24942..25403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0021"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   pca:Pcar_2576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73636"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ACX73636.1"
FT                   /translation="MKWVLAVFGKAGSPFIADEVEKYVKRLRGSAMPLEVVELKESKID
FT                   DHAQALAQEAALFEKKFPRNEFRRVILSEEGKLMTTVKLADTLQARFTGNIVFLIGSAY
FT                   GIDENLKKSADLLLSLSPLTFTHDHARIITVEQLYRVQMVMQNHPYHHR"
FT   gene            complement(25404..26132)
FT                   /locus_tag="Fisuc_0022"
FT   CDS_pept        complement(25404..26132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0022"
FT                   /product="bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mlo:mlr6579
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73637"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX73637.1"
FT                   /translation="MLYGICSDIHSNATAFEAVLQSMRENGVERRVCLGDIVGYGVDTD
FT                   ECVNLVKENMDVCLIGNHDSVAVRYESSAGFNPYAKQAIEWTQKNLSKESVTYIRSLPY
FT                   IQEENDICFVHASPLSPADWVYVTDLEDALNAFDHFSERYCFVGHTHSPVIIASRPLAI
FT                   PKILDEYEYVIANTERLLVNVGSVGQPRDRDPRACWCLLDTETKCVRLIRVEYDIRETQ
FT                   NRMKKQGMPSFLIDRLSVGR"
FT   gene            26202..26834
FT                   /locus_tag="Fisuc_0023"
FT   CDS_pept        26202..26834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0023"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   abb:ABBFA_000962 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase SlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73638"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACX73638.1"
FT                   /translation="MVVIQDKMKVSIAYTLREGKRILEEVPASQPFVYIHGYNNIIPGL
FT                   EDALTGRRLGEKFTVSIPANLGYGEYRKDLILTVPKEELRDVGELWLGMELEMYQDNDM
FT                   REFQLPDTAEEFVNDLNLDGDDDQCDGIYTIKEILEDTVIVDGNHPFAGKDLIFNVEVV
FT                   DIVEASFTEQESGFPDEDEFNDGYDNYDSYDNRMGDDNFDSNERRWR"
FT   gene            26834..27523
FT                   /locus_tag="Fisuc_0024"
FT   CDS_pept        26834..27523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0024"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: hypothetical protein; TIGRFAM: ribose
FT                   5-phosphate isomerase; PFAM: Ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73639"
FT                   /inference="protein motif:TFAM:TIGR00021"
FT                   /protein_id="ACX73639.1"
FT                   /translation="MASMDELKKAAGVRAADMIKDGMIVGLGTGSTAAHMVNRLAERIK
FT                   TEGIHVTGVSTSWSTTLQCRSLGIPLKEMGEVSHLDMVIDGADEIDPNRNLIKGRGAAH
FT                   LLEKIVASMTDNYVIIADSGKAVQQLGTKFAVPLEIIPGAIAVVTERVKKLGGEVKVRM
FT                   GAPGKDGPVISDSGNLIADAKFAPIADPDKLARDLEHIVGIVGHGLFINMATKVILADE
FT                   AKGLIEF"
FT   gene            27662..28516
FT                   /locus_tag="Fisuc_0025"
FT   CDS_pept        27662..28516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0025"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: reh:H16_B1249 esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73640"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACX73640.1"
FT                   /translation="MKFAKIFLPCLLLALVAIVSLVSVDKRPVKEYQIKGMHVYEMAAA
FT                   DETKPVILYLHGGGYRQGITPSHWKILSEISKATGCGFVMPDYPLLPEHTALEAHTLVL
FT                   KLYSELLKRFPASKIIIMGDSAGGGFSLALAEEILEQSLPSPMHLILISPWVDITGGDE
FT                   SIAEYDNWLHIDELHQFGLSWANGMDAHAPMVSPIYGNMQGLPPTDIFVGTWEIFYPDI
FT                   INCSEKMKAAGVSVTLHVGEELGHVFPLYPAPEGEEARQTIADIVKSSTERTTALSLTS
FT                   LMQ"
FT   gene            28554..29873
FT                   /locus_tag="Fisuc_0026"
FT   CDS_pept        28554..29873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_4214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73641"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73641.1"
FT                   /translation="METESKLQPKVQPKFQLPKKNYTKAIIVAVIVVIALILLKCNIGY
FT                   NSATQLLVKQSPFGTLSCIDHAGFYFKGFASIYSYDRTKDFYFNSSTDKVKGEGWEGGD
FT                   DDEDDISVTLSRNANAEISGYLKYQLPTDCEDLVKIHREQRSDKKLKHDLVRNSVLSAV
FT                   RKTAPLFTAEEAKVTKIAEFRRIAEDQLTEGEYLTTIEVLTEKAGEDDYDSEGKIIKKA
FT                   ETQEYKVTKLKLDKNGNRILTKPSALRLYGIRVVQFEIQNVRLDQKAQQQLDIVKDREM
FT                   KRVSNATAAETAKQAAITAEAEGKARIAQAKADQEVEKIKAVTQAEKERDVAVLQAQKE
FT                   QEVARLEALRALEVAKKIKAEKEAEAAANRALVSAGLTPQERAEWDYKTKVGVAEALAK
FT                   SAHPLVPEIMMTGDSKGGASTAMDAVGLNMLMGLTEKLSK"
FT   gene            complement(30005..30658)
FT                   /locus_tag="Fisuc_0027"
FT   CDS_pept        complement(30005..30658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73642"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73642.1"
FT                   /translation="MVDNFKIIRSMLKFESPGDCYYVQLLRRQSDDPKIGGVPDPAYHG
FT                   NMHSRSIKDYFISSLAHFDDVEKEIKTICEVFNVRAYIRLNKRTFKDISMIIFKHITEE
FT                   ICSGETFAPPLHLVARAAGRANAAGKSKTWIVDVDAEFVPYKQAVREMIEKCEPFQSAN
FT                   DIVEIQTKNGFHLIAKPFNTSRMDELWQSFCSENNINLPRFDIHKDNPTILYVK"
FT   gene            complement(30651..31400)
FT                   /locus_tag="Fisuc_0028"
FT   CDS_pept        complement(30651..31400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01518 poly A polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73643"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73643.1"
FT                   /translation="MQNNFRQIENILSSSNPIAEIQLHKDEFFEFIDRYMVGCEHKNFH
FT                   SEGDVWEHTKLVIQNVVAEEHDWMDVLVALLHDVGKKDALQRNNGKNMQGHEIEGARIA
FT                   LEWLVKMNFDRKIREQVLWLICNHMKALDLKVMRSKYDIWQLVKHPLFGRLRHLACADC
FT                   KATLDAEGKPHDDFEEILKRPIVAECLENEMPVAIVEADDFASQKWDDIRVENALVFCH
FT                   KMQINGGVLSKESLIRAAIKTIGGSNG"
FT   gene            complement(31469..32749)
FT                   /locus_tag="Fisuc_0029"
FT   CDS_pept        complement(31469..32749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0029"
FT                   /product="lipoprotein"
FT                   /note="TIGRFAM: lipoprotein; PFAM: protein of unknown
FT                   function DUF285 lipoprotein; KEGG: sun:SUN_1960
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73644"
FT                   /inference="protein motif:TFAM:TIGR02167"
FT                   /protein_id="ACX73644.1"
FT                   /translation="MAAKIIVRNKHELQNIIIQTINQEGDKCSLNFIDVSNVTDMSYLF
FT                   MNLSFKGDISQWDVSKVTNMRGMFWEADFNADISNWDVSHVTDMKDMFLYSSFNGNISN
FT                   WDISNVTNMRGMFWKCDFNGDISHWNVSNVKDMGYMFFKSQFIGDISCWNVSNVEDMSH
FT                   MFEDSAFNDDLSRWNVSNVKKMSEMFSCSPFNGDISNWDVSHVTDMSGMFSGTTFNTSI
FT                   SNWDVSNVQNMYAMFCGSCFNGDISNWNVSRVTNMRRMFYKSKFDGDISQWNVANVTNM
FT                   FEMFCGSYFDGNLSSWDVSHVTDMSKMFQDSKFTGDISQWNVGNVTNMAEMFSGSCFDG
FT                   DLSSWNVSHVTDMSGMFSNSKFNGDISRWNVANVTNMVEMFSGSCFDGDLSSWDIASLE
FT                   YNIDMFKNSKFTGDISHWDVPNEYDEW"
FT   gene            32858..34174
FT                   /locus_tag="Fisuc_0030"
FT   CDS_pept        32858..34174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73645"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73645.1"
FT                   /translation="MIERIQDLSEVIAGQGSYPRKPFLSCQNISYDELVAILDDAPESH
FT                   SANFIFQPKNLTFAFPYNRGKQWLREIKDILLLNSAEVGQSLFPKLYRFVKGSEVKIRG
FT                   KIFIKTKCANRFSLEELTEISRKILSNYIILPQKFCSLDISCKRNEDITVEIGRIQIPN
FT                   YSGIGFYIHFSLSCQLHRVQTAKPLEYFSEMHEIRIGGFGHNTCGRNGIFFVLVQLFEY
FT                   GNTLTEIPKDIENSLLGSENPCENYWSKFHKQYIATDFLPAFIKQKSKIFSARQSNETS
FT                   TSGDFIYHDKFGYGQILKKYEEKGDKRIDVLFSDTITRTLILKYANEHLKFTTNQYHNQ
FT                   EFNEDVHISSENPIYVNCTFNNGVFIEGNVYPIFISCSFYGYDSAGVQLLNGSQGFFYN
FT                   CRFNHTFPYISPNMKNCSFEPNATKDEFRIGGCNIDTNK"
FT   gene            34288..34569
FT                   /locus_tag="Fisuc_0031"
FT   CDS_pept        34288..34569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0031"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: vch:VCA0324
FT                   DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73646"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ACX73646.1"
FT                   /translation="MAQATVSARIDSKDKERFDEFCNNVGLSASAAINMFIKSVINEHR
FT                   IPFEVREPIARYNAKANDIEALKKGIEQLNAGKGIVKTLEELEAMENG"
FT   gene            34562..34828
FT                   /locus_tag="Fisuc_0032"
FT   CDS_pept        34562..34828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0032"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin Txe/YoeB; KEGG: vpa:VP1820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73647"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ACX73647.1"
FT                   /translation="MAKIAFSEQAWQEYLYWQLQDKKTLKRVNQLLKDIERNHFEGLGK
FT                   PEALKGNLSGFWSRRIDDGNRLIYRINGEFIDILSCKGHYENV"
FT   gene            complement(34886..35515)
FT                   /locus_tag="Fisuc_0033"
FT   CDS_pept        complement(34886..35515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt3247 putative ribonuclease E"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73648"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73648.1"
FT                   /translation="MEIIALALSLLAVILCIVILVKVNKLLTMLRTPIFKKLTPDMNLK
FT                   PSARRPISAQEMAQRGGNNKENRQNKERPNNNNKDNRNQQQAQAHAPATRDRNEQQQRP
FT                   ERGPRRERRPERPHREANAEAPVAAAEQAAPVAPAAEAPVAEARRPLAPRIPVETPAAP
FT                   AVEAAPVAPVAEAPAEAAAETAFDPSKVRYGRRNVIKKAPELSEEA"
FT   gene            complement(35809..36027)
FT                   /locus_tag="Fisuc_0034"
FT   CDS_pept        complement(35809..36027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73649"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73649.1"
FT                   /translation="MFKKSLILSSLVCISMFGFSGCSNQEAEYKIATLTEENARLARQV
FT                   LVLKATLDSLNAHNKAVDHSLKSLDMK"
FT   gene            36060..36407
FT                   /locus_tag="Fisuc_0035"
FT   CDS_pept        36060..36407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73650"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73650.1"
FT                   /translation="MTVGQKWLKFKQDGYCGSLTIRSRSEQSFESDTGYNDKHIHNAVL
FT                   EMDPEYTYVKVIHEGYKGSQDIPTIELGNDAAQNQDTLDNAILDGLAHLRIFREANTGA
FT                   IVQFGYNLDEV"
FT   gene            36425..39019
FT                   /locus_tag="Fisuc_0036"
FT   CDS_pept        36425..39019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0036"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: bba:Bd0923 putative
FT                   collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73651"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ACX73651.1"
FT                   /translation="MNNPELLLPVGTRDMLESAINNGADAVYYGVPHWNARGRTEDFSF
FT                   EDVEEMIRYARLRGVKTYLAMNILIFEREIQELPEFLERLIALKPDAFIIQDIGLARLI
FT                   KAISPEQEIHASTQMTLASSEAVNLVKDIGFSRAVLARELSTKQIAQIKSLTDLELEVF
FT                   IHGALCVSYSGQCLTSENFGGRSANRGQCAQSCRLPYRIFVDGKEWKDPKARYLFSTRD
FT                   LCALPKLEELREIGVESLKVEGRLKSPEYVAAVSHAYRKALEILSEKGYKENAECANGN
FT                   AAELTAQDLEPLEVLFSRGLNTGWLDGVNHQELVDGSFSNHHGEFIGTVVQVDRNGVIV
FT                   ELEDKPVPCTLLPGDGILFEEYRAEPEPRQTGSRLYKATFANRAGKSQVRLEFGREFNL
FT                   RKVSYGMKAYRNDSPALEKELHKTFTDKSFAKHIPVCMTLEGKIGEPLKLTICESTKAV
FT                   ADETRTVTVEGAILEASRNEVAPDALQAIAKKELSGLSATAYILDKLEIKLPANAFLPG
FT                   KVLRTLRQEAVQAFDEKRLQWKELAPSADNGRAFLHSVASSTSMVAGNPDKATGTPKNR
FT                   RTITVLVRRPEQIDALQGLDIDKVIMDFDWGVKYDEPLERIHKLGFEAGIATLRIHKPS
FT                   ENHYIKQILTLMPEFALVRNLGSLALLKDSGIPMVGDYSLNATNSASYDWLLAQGLEKL
FT                   HPSWDLNSTQLFDLLKNIDGSKLELALHQYMPAFHSEYCAFARALTTGRRFPECKKICT
FT                   QHKVEILDHKGERHFLQSDAECRNTLFVGKPQSALKLLPRLIAQNVSSYRLELLDEEPE
FT                   SVRRKIDIYTQAIRGKLDIDTAISKAGVEEKYGLSEGQLFNQSVWQDRKKGC"
FT   gene            complement(39022..39366)
FT                   /locus_tag="Fisuc_0037"
FT   CDS_pept        complement(39022..39366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73652"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73652.1"
FT                   /translation="MKKNFPFTLRVLVFFIAYLLFAVVAIAIGVTFKFGYAEAALWLYL
FT                   PLAVPMLYLLVAVFVIELIRMFWNKRNTPNSEVEWRQMHYNAIVVKVLNTVAVVFFTLV
FT                   VAFTVVCSFK"
FT   gene            complement(39367..40410)
FT                   /locus_tag="Fisuc_0038"
FT   CDS_pept        complement(39367..40410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0038"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73653"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACX73653.1"
FT                   /translation="MLSRLDNRTELCSYRRKTKEKSLVSRLSSLVLVFLLALPLHAADD
FT                   FFFKANELYDQGRYKESVKYYRAAIDDGRYEPFAWFNLGNALVQLGKKEVAMVAYKRTV
FT                   ELLPDFVKAWMLLGDLYYLAESPSDAIVAYNRAIELGTETDHIHFALAECYMKGSDWTL
FT                   AQKHFERALALNPDRMDAWYGLAEVYEKLGDYEYAVKTLKNALQMTATAGADVHYTLSY
FT                   YYRSMDSTRLALNEMENGVMMDPENVSARRYLAQMYVKNESPWMAIFTLEEGLRHKKGI
FT                   ADLNLDLGQIYFTQKRYDEAFECYMKAWRAGNSQGRIGAENVGHIFSNAGDTEKAETLY
FT                   ARIRDKK"
FT   gene            complement(40400..41041)
FT                   /locus_tag="Fisuc_0039"
FT   CDS_pept        complement(40400..41041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0039"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: dps:DP2971 TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73654"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACX73654.1"
FT                   /translation="MLDFCAKYFRFPVAFVLSFVVGAVFFLAIPVINVLFFDKGVKSEK
FT                   VLEEVTEVEVLVSEKKPEVKQKVIRTVATPNTFKVSAHMGVSRSQNFQMDLSLARGAAG
FT                   DGVAVDAGSMENVIYEAGEVDEQAQVLREIQPKFPERAKKMGVSGYVKVFIVIDVNGDV
FT                   AQAQVLTQDPAGYGFDIEALKAIRQWKFSPAQLRGFPVAQKATKEFRFVK"
FT   gene            complement(41053..41457)
FT                   /locus_tag="Fisuc_0040"
FT   CDS_pept        complement(41053..41457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0040"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   dal:Dalk_3599 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73655"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACX73655.1"
FT                   /translation="MSFIRKRSRSGGGIDVSPMLDMVFILLIFFIVTSTFTRETGVDVT
FT                   KPKASTAKELAKESILIGVTRQGTIHINETQVNLSTLQTVLRQMMAEAPDRPVIIVSDR
FT                   DAPNGVVVDILDECNLAKVRKVSISANKEE"
FT   gene            complement(41454..42086)
FT                   /locus_tag="Fisuc_0041"
FT   CDS_pept        complement(41454..42086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0041"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   dal:Dalk_3682 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73656"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACX73656.1"
FT                   /translation="MDEYSVIEATMSILLRGGWVLLPLFLIGWLGWFLMFERYGYYFML
FT                   KGTSTSKFFKDLDTVGEEAAFAKLRKRRFGYFLALVENVRKYRNDGPVAVRNAMLATRH
FT                   ELDVSLSKSLKTIVTCASIAPLLGLLGTVSGMVHTFETIKQFGFGNPVLLADGISEALL
FT                   TTQAGLLVAFPLMLVYNYLESRVDSIGDFAWGEALKFEERCFAKEVE"
FT   gene            complement(42086..43654)
FT                   /locus_tag="Fisuc_0042"
FT   CDS_pept        complement(42086..43654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0042"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   dat:HRM2_00070 TolQ3"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73657"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACX73657.1"
FT                   /translation="MFRRKNGASPLQTKDERVSSSSGFLRRLSLVSRLSPLVLVLLLAP
FT                   ASNAQQNTTVDAVKKRAELNSAKADLEEARRKRDMAVAARWKDRETFNKERELFNEKYQ
FT                   LGKERVDALMSERTRLLEDVRVAREDLAQVKLQAEKARAEYLSLAAGPERLEMLAKFQE
FT                   QGVPFKVADRVEAQNKVKKEMGLYRDDPLRIARAMLDVAKKEMKFTREVRTEKADLMFG
FT                   SSVAEGDRMRLGGLFAMQMAKVTDINGFHPSALMLPVAGEKKRVYSWQENLSPETRKDV
FT                   AKAFAGANDSAFVMVPVDVLLSTELSSELANHQETTWKEDFAEFFHNGGILMYPIATLF
FT                   ILGLIIFLVRLVWLLVLGFGGRGARNAVKALANRDLRLATAESQSAHGEVGKVLRSVLG
FT                   KNFKDRASAEKSLEVLFAGEVPKLEMGLSWISVFASTAPLLGLLGTVMGMIELFNVITM
FT                   HGTSDPKLLAGGISIALVTTEAGLIVAIPLQLLHTLLVNISDSVRTRMEKTGLAVLNAI
FT                   WIKEK"
FT   gene            complement(43654..44451)
FT                   /locus_tag="Fisuc_0043"
FT   CDS_pept        complement(43654..44451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_3976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73658"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73658.1"
FT                   /translation="MHMKFSFLPKVLLCLGLSGVFAVAQETVESVRRQIKTVEAETARE
FT                   KSMHEAEKKRHAEFVEVGRKKVQNLSAQNKSLKAEIDSLKVELKKISAARSKTNGSIRY
FT                   FENRKTKYADSLATVIDSLVPFFESDFPYRTDEAVKNILEIASMLHKGLIETDDALNRT
FT                   MEVFYDRIRLGYTTEVWKGFLQVDARNVAGTYLRYGAVASIFVSNDGNDVLFLTRNGLG
FT                   YSWKNVSEDLTMRTVLKDVMKVAEGKTAPRLVTIPVSFPKEAN"
FT   gene            complement(44542..45507)
FT                   /locus_tag="Fisuc_0044"
FT   CDS_pept        complement(44542..45507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0044"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: ank:AnaeK_4308
FT                   pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73659"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACX73659.1"
FT                   /translation="MGKAPSDMFFESEVRLEYEGRLLLDSLCDRFTYHSREDWIDRLTR
FT                   GLVTINGATANVETVAHRGDKVVYHVENYSEPEVPTDFETVFEDDEFILVAKPAGVPVH
FT                   HTGRIFYNTFAAIIRREFDSETATPMHRLDRDTGGLILFARYGETAARFQKNLDRILLR
FT                   KFYLAVVRGKFPEGEVECHMPLREDPEDPIRLRMHHREGGKECFTRFKLVRHLDCPEIA
FT                   PELSLVEAELITGRKHQIRAHLAEMGYPIVGDRLYYRDGEFYQKLAQGGELTDEDIKVL
FT                   GAHNQMLFAYKVELQLPYWKEPRTFESHAYPADMAKLLAE"
FT   gene            complement(45509..46138)
FT                   /locus_tag="Fisuc_0045"
FT   CDS_pept        complement(45509..46138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0045"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   PFAM: cytidylyltransferase; KEGG: cytidylyltransferase
FT                   family protein ; K00969 nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73660"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACX73660.1"
FT                   /translation="MKNVAVLGGAFDPVHKDHMRVARTCLDRGFCDEVWFMPSPDRWDK
FT                   QLNASPEDRFAMLELAFSGDKRLFLSDLEIQQGDYRGSYVFLMSLKEKFPEINFRLLTG
FT                   ADTYEGIPHWRDPLNFYGTNYNGHLLLRDIELIVFARNGYPQPDMEQHKRNGYAPLYWL
FT                   GPEQGFNGVYSSTAIRRSLLLNRSVCPQGLEPSVYDYIIKHDLYRE"
FT   gene            complement(46164..46793)
FT                   /locus_tag="Fisuc_0046"
FT   CDS_pept        complement(46164..46793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73661"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73661.1"
FT                   /translation="MKFSMNFVKRIVLSLAFVLAGATSSLAQGFSGSSPAVSSPFGGAS
FT                   AGAGTSMRWPLFLGGTFGLGSGAGVGDGNGVGICQIKPMIGAWMPGLAFVRLGYGFSSY
FT                   EEKDDEGRKSEVESSDLSIDLGVHLLSEFFVKGSYSRVNALSEKGDVAWNEWSAGFGTF
FT                   WIVFSRTFLTLDIGYHWVLEHYDPLIDRDVSGGRWQMNLGFSVFVY"
FT   gene            complement(46795..47205)
FT                   /locus_tag="Fisuc_0047"
FT   CDS_pept        complement(46795..47205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73662"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73662.1"
FT                   /translation="MSDYVVKIALIASIILMGYNISEFVASYNVVSEKASQFLQMAKDN
FT                   AASDADLRRSNLLLSSVLSIGYSVLIYFSDIVIWLVAIVVSKLIITLLLSDKVLIQILH
FT                   DRTLSQKSFLVSKYDAFFNAVMGLAFALVLVL"
FT   gene            complement(47210..48442)
FT                   /locus_tag="Fisuc_0048"
FT   CDS_pept        complement(47210..48442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0048"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: slo:Shew_0558 ribosome-associated
FT                   GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73663"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ACX73663.1"
FT                   /translation="MRNNDFDSDENEAPLKSVRTSRREHRSRRIDVMRELESGVVDERP
FT                   IKERFSREFKKAKIKRIKNPVENIGEENCVEGLVLEVHRRTCEVRLDDRTLADASYRRE
FT                   TKENTPLSSLDSRLSSNTVTAMYRATTSKTLGEFPAVGDRVLLGLVNDADDEGDGVGSQ
FT                   KYCVVRVLPRKSELKRPGPRDSFYKQQTLAANIDQVVIVASVTQPEFNYGFMDRFLLAA
FT                   NLNDLPFVLVLTKMDLLPNGEADLSSDIRDFMKIVDKVIPVSVKSGDGLEVLRNELVGK
FT                   SSVFSGMSGVGKSTLINELVPHAELRTGDVRERDGKGRHTTTSSSLFDFPGGGYVIDTP
FT                   GIRSIGLMDMEPETLAKIFPGFFEDDLFTCKFSNCKHLKEPGCAVRAAVESGKISEARY
FT                   ASYVRILNSGK"
FT   gene            complement(48432..48719)
FT                   /locus_tag="Fisuc_0049"
FT   CDS_pept        complement(48432..48719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73664"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73664.1"
FT                   /translation="MPFFTKSNLEDLRKEAEQLSICVEHFLYASEHIPESDWKTKGFYD
FT                   NCIEKCNGRLKAIHFLMESIRRGRPVTEEELEEARELEDEKLSKLKKNAK"
FT   gene            48899..49864
FT                   /locus_tag="Fisuc_0050"
FT   CDS_pept        48899..49864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0050"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: HPT1; HPT1
FT                   (HOMOGENTISATE PHYTYLTRANSFERASE 1); prenyltransferase ;
FT                   K09833 homogenitisate phytyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73665"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ACX73665.1"
FT                   /translation="MISTLFTLFKMSRPVNIVIATITLLVGYTLLQHNPTTPVLILQII
FT                   GFSAAIGFANIQNDILDLESDKLNRPERPLVTGEVSVKTAKITWIILMIVTLLCGIGDS
FT                   TIQIVKFINIVKDWDHALDFGWMGALILAFPMLFFAFLVFLLIGYNHYLKRSPAFKNIT
FT                   VAFLCTTPLLYAVQHFFNFANHDYPEEHMWTIIPAIPFAFLLTIAREIYKDLEDKNGDL
FT                   QAGIMTFPIIAGDKVARRLAGDIIIFTWISLPVPVFFLDKLFDHNYPPLFLALTALTLT
FT                   PTFAIVMVSASSQNYRRAQTFTKFAMFLGLITLLICSVVQ"
FT   gene            50089..51474
FT                   /locus_tag="Fisuc_0051"
FT   CDS_pept        50089..51474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0051"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: gur:Gura_2068
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73666"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ACX73666.1"
FT                   /translation="MLDELHEECGVIGIYNGDAVVRNITMGLYALQHRGQESAGFAISD
FT                   GDKIRVRKSMGLVSTLLREHNIDEFDGFAGIGHVRYSTTGASTLANAQPILVSCKWGQI
FT                   AVAHNGNITNANELRAEMEADGHIFQTTSDSEILLHEIARTQADDLGEAIKKAITKFTG
FT                   SFCLVFISKDSMYVARDGFGFRPLSIARMGKAWCVASETCAFDLLGANYVRDIQPGEFL
FT                   TITKNGLHSERFTQKDRLAHCIFEYIYFSRPDSKIFEQSCDKIRRKMGKQLAKECPVDA
FT                   DIVISVPDSATTAALGYAQASGIRFEIGLLRNHYVGRTFIDPTQNVREQKVKLKFNPIV
FT                   GVLKNKRVCVVEDSIVRGTTLKILSKMLRDAGALEVHIRIASPPVAHPCFFGMDFPSQG
FT                   ELAASSMTPNEIAQMLGVESLGYLSVEGMKECTGEGENYCAACFDNDYPDYIGTDAQKT
FT                   RCG"
FT   gene            complement(51591..52511)
FT                   /locus_tag="Fisuc_0052"
FT   CDS_pept        complement(51591..52511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0052"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; KEGG: gem:GM21_0884
FT                   hopanoid-associated sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73667"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACX73667.1"
FT                   /translation="MRVFVTGGTGFIGHYVVKALLDRGHEVVVATRHPNKVPTLRANPN
FT                   VSFVEAALTDFEKMGEGLVGCDACIHVALGWGDTPSAMLMNDTRATIALLEMAARAGCD
FT                   KFIYTSSTSAMGRVRSEMHEMTSNLPIDLYGATKAAGEAFVLGFSHGYGSQFPEVKMKR
FT                   NIIRPGYTFGNPAFPDGCSQPDRRFFEMAYAVKEDRDINIIKNDGTQFIHASQQAQIYM
FT                   KLLESDLNEEIFLGLGSEWISWKEIAEKMIALKPGCKSKIVETDMGWGDEPMLYSVQKI
FT                   KDSFDLAFDAHEFLDEHIRWTFENA"
FT   gene            52625..53659
FT                   /locus_tag="Fisuc_0053"
FT   CDS_pept        52625..53659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0053"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: dol:Dole_1426 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp; protein
FT                   of unknown function DUF201; Phosphoribosylglycinamide
FT                   synthetase, ATP-grasp (A) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73668"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ACX73668.1"
FT                   /translation="MSRLRVLVLMGGPSTEHDVSVVSGTGVVRAMDPEKYNIHPVLIDK
FT                   DGTWHWSSRELSPYQKANFSENYFHSLEGTAANKKKSPALSELPSADIAFLALHGKWGE
FT                   DGHIQAMLENWNIPYTGCGLLASALAMDKIKSKEIYRANGIPTPPYRVIWKHDFTGDTL
FT                   VSVADELGYPLVIKDPLGGSSIGIGIAKNLDEAGKIAQDLFKDSNRLLCEKFIAGGEAS
FT                   CGYIEGEKPLPPTEMRMTTREYFDFEAKYNGECQEVTPAEFAPELTARIQELVKNAHYA
FT                   LGGAGYSRTDVRITKDGELFAIETNTLPGMTPTSLLPQQAACVGITYSQLIDLIIDKSL
FT                   EIKR"
FT   gene            53829..54413
FT                   /locus_tag="Fisuc_0054"
FT   CDS_pept        53829..54413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0054"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   atc:AGR_C_617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73669"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACX73669.1"
FT                   /translation="MALSADSVYEEMVDPSAKGEILSASLDNLLAKVGATLDDVKRVMV
FT                   TVGPGSFSGLRTGVAFCQGLCFSGKRNLYGVTTLQALACFAGVPDESVAVVIRARNGFW
FT                   YLRLNNEESFIETADVVARLQASSVKNAVVDAAALTDEALVAVFKDKGIATTLDTDKKL
FT                   NMWSPLFDTVKPSLIQEANYIQPSYFEKLKV"
FT   gene            54419..54847
FT                   /locus_tag="Fisuc_0055"
FT   CDS_pept        54419..54847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0055"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: glo:Glov_2306 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73670"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ACX73670.1"
FT                   /translation="MLLREMTENDLPQVLELQRELAFQDWNEKQFLSEIRASYAYCVVC
FT                   EDEAKLLGYAIFHLLGPDSELLSIATRASEQRKGIGSQLLKAGLDKLTENGDQCFLEVR
FT                   DGNAKARAFYEKHGFKLYSVRKKYYSDGEDAALYKFCR"
FT   gene            54853..55842
FT                   /locus_tag="Fisuc_0056"
FT   CDS_pept        54853..55842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73671"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73671.1"
FT                   /translation="MSKILKSDKSSQKKKNFSIGIALLILLAIAIITYIIFEKSGHWLV
FT                   QDDNFEHVKWVAILDGQSADLERSDFAANLLNEGQADSVLILGRRVYRDRSNSEYYADD
FT                   FMKLGAFDSNAVFLVPHNDPSTISEAYSLVPWLKKHNADTVLLLTSAASTYRVKRIFQK
FT                   LSGNSPVYITKDIHHVTYNPNCWYSNRESRKDWLRGWAALFVSYFDLFNTDTLEAVDSS
FT                   YYKPIKSYAEYKREFRSNVNLQKLLPKIEDKIKVESEKEAVKDSVKATAKETTKEAVKD
FT                   SSKTQEKTSAKAKDTPKATAKELPKEKAVEKKADAKAPAKAQTKPAKK"
FT   gene            complement(55905..57572)
FT                   /locus_tag="Fisuc_0057"
FT   CDS_pept        complement(55905..57572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0057"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 9; KEGG:
FT                   xca:xccb100_1785 exported putative cellulose
FT                   1,4-beta-cellobiosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73672"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ACX73672.1"
FT                   /translation="MNAKIHYCHPGYVPSGAKSFLVAFSEGSSLPSVKFNILDSENRVV
FT                   YEGLAENLQRCEYTGETLFKGDFSAVKTPGRYQIALVDFDAKSHLFEVSDEWVLRELKS
FT                   NIKSFYYQRSGVELPERLAGIWARPAAHLDDKLEFHPTMERAGLWNAHGGWYDAGDYGK
FT                   YIVNGGVSVATLMLGCELMQVHSQKSSIVGGADFKESYELPVSLLDEVRFELEFFLRMQ
FT                   DDDGGVFFKVTPYRWDGFVTPTESDASQKRYILGKSTSSTLNFVGALAQAHHVYANVDS
FT                   EFAEKCLFAAVRAYLWSEKNPEVDWPHNTEGSGGYGDSDLGDDFFWARAMLYRELKNVE
FT                   SIADVNVAGLLERLESQLPVDMDTYLPTYGLQWRSTQNLAWFALATMDCKWTERARMAF
FT                   KYTAEEILHLQKEDPYGLSICKFIWGSNGDIANHALTLYLAYEWFNDSKYRDAAMEQIE
FT                   FIYGKNPVDVSFVTGSAWSSPKFPHHRISHSDGVDEPVPGLVVGGINEDRQDLHRKPHY
FT                   MGEARGMSYADEQCSFASNEVAINWSAPLTAALLLLSA"
FT   gene            57681..60020
FT                   /locus_tag="Fisuc_0058"
FT   CDS_pept        57681..60020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mei:Msip34_2751 protein of unknown function
FT                   DUF748"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73673"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73673.1"
FT                   /translation="MKKPLKITLIVLGSLILLYFVTLLVAPKIARSYIEEHSKEMIGRS
FT                   ITIKNISLNPFTYVLDVDTLAVMEADDKTRFVAFDKFSMNINPLKLFTRTLDISDIYMK
FT                   ALYVRTTQHGERFNFSDILDFLAQKDSIYYAEHPEEKKVESDSSKSAAEIAAGLPVKLS
FT                   LRNIVFDKGNIIYQDTKVGSKFHLKDFSINIPAIYLEDNSTGVDVSLKFADGGDLNVKV
FT                   DANMATYDFNIFLNLNRFALSCIKPYLNDSINYKDFAGYLSAQISISGNINSILASNVK
FT                   GKVSLDKIDLTEVSGSKMGAENVTVGINKANLVDNEYLIDSVIVDGAFAHIDLYKDGKT
FT                   NIDVLLTPKNKAGSVTDTTAADSTQVEPVAEAAKQEPADTTKVVADSTSATTTAEKPAA
FT                   AKKLKAKINKLLVKNTYITITDHTIIRPFNYKVSAITVTGQNINYDTPCNVNVSAAFPE
FT                   GGSLSLKYHGALSNLNTMDIYISVKNLVLKHFSNYSLHYTAYPLKAGTLAFASENKIVD
FT                   RNLDSKNTIDIYNITVGNKVDDIDPEYTVPMKIGLYILKDKDDKIQFDVPVKGNLDDPE
FT                   FSYGKIIWKTVVNLLVKVAISPFRLVGNLAMAGANALGFDLGKNNEVLIDANTETFTSE
FT                   QYAKAIKMTEMLQKDPKLMLTFTQYYNPRKTAKEYKVKQLKIDFYKQKNNKTELNELDY
FT                   RAIEEIKEKDKEFQAYVKEHSAEIDKNYMMKVLPQMATKRNNDLLKVLRAQPGVTKKNL
FT                   KVITAPRDALRGYKDKPMYKVDVDVQ"
FT   gene            complement(60146..61066)
FT                   /locus_tag="Fisuc_0059"
FT   CDS_pept        complement(60146..61066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0059"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: pca:Pcar_0276
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73674"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ACX73674.1"
FT                   /translation="MKIVLPVAGNGIRLRPYTENLPKCLLPVAGKTILDWIVDDALFLN
FT                   PSETIFITGYKASAVDDFLKQKPEWGAVRTVVQSNPQGLGEAISLALPYVNDDEPLLII
FT                   LGDTLFEADLSILKNASENILYTFKVADPKRFGVAVTDKNGHIERLVEKPQEFVSDEAI
FT                   VGIYYIKDVKALKEALNYLMQNDIRTKGEFQLTDALERMIQGGCKFRTAPVEKWLDCGL
FT                   VETLLATNAHVLNRNATTESPVDGAEIIMPCHIGKNVVIKNSKVGPNVSVGDNCVIENS
FT                   EVSDAILWNGVKVVNQKLADAVIHE"
FT   gene            61460..61741
FT                   /locus_tag="Fisuc_0060"
FT   CDS_pept        61460..61741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0060"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: glo:Glov_2928
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73675"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACX73675.1"
FT                   /translation="MIKPLADRIVVKPAEAEQKTSSGLFIPDNAKEKPMQGKVVAVGPG
FT                   RKNDKGEVVAMEVKVGDVVLYGKYSGTEVTVDGENFLIVKESDVIATL"
FT   gene            61877..63511
FT                   /locus_tag="Fisuc_0061"
FT   CDS_pept        61877..63511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0061"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: rlg:Rleg_5849 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73676"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACX73676.1"
FT                   /translation="MAKQLKFDVAARESLMKGVDKLANAVKVTLGPKGRNVMIARSFGA
FT                   PNVTKDGVSVAKEVELEDAYENLGAQMAKEVANKTSDAAGDGTTTATVLAQAITREGLK
FT                   NVAAGANPMDIKRGMDAAVEAVIKEVGKMAVKINGKEHIAQVATISANNDPEIGELLAN
FT                   AMEKVGNDGVITIEESKTAETVLDVVEGMQFDRGYLSPYFVTNTDSMEVALENPYILLY
FT                   DKKISTMKDLLPMLEHVAKQGKSLLIIAEDVDGEALATLVVNKMRGTLKVAAVKAPGFG
FT                   DRRKAMLEDIAILTGGMLVSEDTGAKLEDAPVTVLGKAKSITITKDNTTIVEGAGDAAS
FT                   IKGRIAQIKKQIEATTSDYDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKDRVDDAM
FT                   HATRAAVEEGIVPGGGVALIRAEKAIDALQFDNADQKTGAAIIRRAIEEPLRQIVQNAG
FT                   LEGSVVVNKVKEGKDGFGYNAKTDTYEDLIKAGVIDPAKVTRTALKNASSIASMILTTD
FT                   CVITEKKEPKAPAAPAMDPSMGMGGMM"
FT   gene            complement(63742..66135)
FT                   /locus_tag="Fisuc_0062"
FT   CDS_pept        complement(63742..66135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0062"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: sfu:Sfum_2676 1A family
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73677"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACX73677.1"
FT                   /translation="MDKFKSFMKILGAAIVKYGSIVWQKIWSLVKIAFANKIFRWFFIF
FT                   MCPIFVAFIAALAVYIHYSPELPSLSQLEQINPRLVTNIYDKDGQIAHEYFVERREWTS
FT                   IDSIPVNAIHAVMATEDRAFYKHWGMNVWAIPSALIESAVSGNKLRGASTLTQQLTKLL
FT                   FLTPERSLSRKIKEMMTAIRIEQTYTKEEILEFYMNEVYLAGGNYGFQAAGKFYFGKPL
FT                   DSLSIPEYAVLAGMLQRPETYRPDRHPKASKRRRNTVLYAMRDAGYITNEEYRKYIEEP
FT                   IVLAKKEDVTGTGLYFFEEIRKYMEKKYGENSLYADGVSVYSTIDPEIQAFLDSVAYAQ
FT                   VERVRRRIKYRATRRLQLTKKYDMPEDSVVAHFDSVYTLFKKEYLAADTVRNKRGQFIR
FT                   FPDSIRYHHAEVAAIIIENETGAIRAMVGGSDFNKSKWNRAVQSLRQPGSSFKPIVYST
FT                   AMDNGASPCDSVNDQPVTIPDPDDKNPNKVWRPGNFEHDFEGMMTLRRALYKSKNLPAI
FT                   LTGMKYGLSNVVNYARKFGIKRAPLQAVPSLALGSVGATLMEMTSAYTVFPNGGNRIEP
FT                   YMIESIVDRNGEVVEKNSKVEHEVLRPASAYLMVDMLKDVNVRGTAGRVWASGFRHPSG
FT                   GKTGTTNDYTDTWYIGFTKQYTMGVWVGSDNPGTMGAGHTGTEDALPIWMATMAKLHKD
FT                   LPKLPFPVPPGVISRGICNHTGLIAGEFCSEKTYCLYTAGYGPTERCDGNHFSSQTKSA
FT                   DNATLFSNKGVVENNRYEAPQPKKKKGKGKDEPQQPKRSTRKMF"
FT   gene            66403..66476
FT                   /locus_tag="Fisuc_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            66403..66476
FT                   /locus_tag="Fisuc_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(66627..73028)
FT                   /locus_tag="Fisuc_0063"
FT   CDS_pept        complement(66627..73028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VP1633 putative RTX toxin"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73678"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73678.1"
FT                   /translation="MKKLKRSMATLIASASVIATSSFAQNPASAAPAPQAAPAPVSEPA
FT                   PEPAPANEPPQVGGIPGESILEGGTFTKFKLDNFVTDDTDQPSQIRWKVSGNKALKVNI
FT                   APDHTVEIATPDALWNGSEDLTFTATDSKGASASETVNFSVESVNNPPVVSQIPSQVIT
FT                   EGQQFTKIRLDDFVNDPDHKKNLITWDTEVVPAGGPQADGDLSVTIDANRVATIVVPDK
FT                   HWYGAARIKFIANDPDYGSDNKTAAFTVTPVNDPPTFTKKIPDQVIDEKNQFDMISLAD
FT                   YVTDPDDDPMKLKWTVTGNKDLKIEIDNYGSAIVTIPNEFWNGQERVTFTATDAAGASV
FT                   KQDVLFKVNSINDPPEFVQNIPDQTIDEKQEFAPIQLGQYVKDPDHRIEMLKWAVAGAK
FT                   DLKVSVSGGVATIRIPNKMWNGSESIKFKATDPEGASADCEAVFTVNSVNDLPKFIRPI
FT                   PNQNINEKQQFTKIKLDDFVKDEDHKNSELSWDVEVKHQGQMPELGTLNVNIDDQHVAT
FT                   VEIPDPSWFGNTIATFTVTDPEGGSAKQEVALNVRSVNDPPVFKKIPDQVIEEKNEFTS
FT                   FIMDDYLSDADHDFSKLKIEVTGNKDLKVNIDNRSHEVSVKIPHDQWNGTETLMFTATD
FT                   PEGARASTSAKFTVKAINDPPVMKDIREQTIKEKGEFQPIELDNFVEDLDHAKNRLKWT
FT                   ITGNKELKVAMDGAHVVRITPPSPQWHGAETLTFKVCDPDNACDERTANFTVESVNDVP
FT                   MFVKQVMPQTIREKGQFQPIKLADMVKDLDNKLSDLSFSVSSKPAAGSKKRESELKVNI
FT                   DANKVATIVIPNKYWNGAEEITFTVTDPEGAKASSTALFTVESVNDLPEIKQVADQTIQ
FT                   EKGEFTPFNVSELVSDPDDRFESLKIDFTGNRDLKVDMSKTGIVTVKTPNKMWNGSEKV
FT                   TFTVTDPSGAKARTTATFTVVSVNDPPVMKEIASQTVKEKESFKPIELDNFVEDLDHPK
FT                   NRLKWKMEGNKELRVAMDATHKVTVTPPNASWNGSEKIRFTVTDPDGASDSKEVTFTVL
FT                   SVNDAPEFVRDLRDQSIDEKKQFQPIKLADFVKDPDHKISDLKWTFKVNPISQGSSKKK
FT                   GKDDGEETSASGLRVTVDPTGVATVNIPNKYWHGAANITFTATDPEGASASKTARFEVR
FT                   SVNDAPVISSSAPTGETILEGGRFKTIDLSTLAEDPDHPASSLKWEVSGNRDLKVDIRK
FT                   DNTVIVSVPDKQWSGKESLTFSVTDPEGAYARHKMVFEVTRVNDPPTFVKRIPDQKIKE
FT                   KETFKQIKLDEFVKDPDNKPNELRWRITGAKQLKAEISPSRVLTVTAPNKDFWCAPELM
FT                   MLEVSDPDGAKTSQTITFEIVSVNDPPVLRDIPPQKIREKGTFKDIDLSKFVRDPDNTM
FT                   EQLSWSVKVKKPESEQPKKSKKGKKGKKDDDDEEEEVVKDPFSVVIYKGGLAHINIADQ
FT                   YWHGERNVVFTVKDPDGATDSKTVNFVVESVNDAPVIRPILAQTIKEKEHFEPIDLLKF
FT                   VSDPDHPTSSLKFEVAPTRALKTTINAKKQLVVTTPDKYWNGSEKIRLDVTDPEGARAS
FT                   QQIEFEVTPVNDPPVITKEIGNQKIKEKERFTPVDLARIVHDPDNKPNELKWSVAGNNQ
FT                   LVVDIKNGRATVTTPNPNWFGKETLTFTVMDPAGDKQSAKATFEVIPVNDPPKFKPIPP
FT                   QVIEEKKTFPAIDLTKFVTDPDNSVDELKWSIDGENPFASAAPVKAKHNKKDKKKKKAK
FT                   KQEEAPAPTFSKHELKYNISEKGILTVEIPNKYWNGTETVTINVFDPSKEKASVEVRFT
FT                   VKSVNDPPIVKEIPGQTTLEGKAFKSVNLDEFVSDPDHKKNEIRWSVSGAKNIDVRINA
FT                   NHVAEIKPRRDNWFGDETIIFTATDPAGGTDKSVVKFIVKHVNAAPVMRDIPDYTIREN
FT                   QNEGVIATIKLDQYARDKDHNFEDLKWKFTGQKQLQVTYDKSKKTVIVAQPYSHWKGKP
FT                   ERITFTVTDPEGATAHKTATFTVIAVNNAPETKPLSYQTREGETLKVPAATGLMSAAKD
FT                   PDGDKLESVKTVMKPRNGRIVLNEKNGSFEYTPNKGFSGIDEFTYKVFDPSGLGSKVTN
FT                   VEISVQFKPKDVRSNSANNKKKK"
FT   gene            73442..73849
FT                   /locus_tag="Fisuc_0064"
FT   CDS_pept        73442..73849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73679"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73679.1"
FT                   /translation="MKFVFLCDANYLKGDMVNFQNNFPTNHELVTMTSEDLLQSKSIIE
FT                   GTFAILAERTTWQKNFSLFRYFGLLPLLEVLPLGIVSRGRRNEPIEGRSQNRNQEIFFN
FT                   PAASAEELYLQVDKFVAAPPSGYSYPRGAAK"
FT   gene            73853..75385
FT                   /locus_tag="Fisuc_0065"
FT   CDS_pept        73853..75385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0065"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: afw:Anae109_0789
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73680"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACX73680.1"
FT                   /translation="MQRKVLESLYNQGGLSLFAISDEETLPTEALHKFALALNAGARFI
FT                   VIDFTGKRPFEGNAPFQTSHLSQKLLSAEDIQKITASSTEDGCISFTGTKAIPTSDIEF
FT                   RTLYHNLKNLEKIAPQVIGIVSTEQVENVGKLVAMARLLIMHVTPLSMKSAASFIEDVK
FT                   EAQKIEILWLSKERPARRAYPKARKAISRNASATKEAFNLDFQKNPEELAKVIQKLHKV
FT                   SILVKNPLDGFPRLIRNLFPLLLIAVIIAPFLFVTDIDRSDSNLRDRIQERNQLSVAPS
FT                   FEYTFDGNESMQRIARYAIGRFDAIITNEKMIKNYVAKTLEDNGYGVTAWEKGCHNIPP
FT                   KGTTIRFSRPDEIKRPASADTIGAAWKFWTSVISDSIAYITEFYHETATATQRKHNGID
FT                   VASRQGARILAPYGAKAWTSRDERGGVIIALVRKQDVILFMHCDKLLYLNGQEVMPGDP
FT                   IATVGTTGHTTGPHAHIVTGLVSKKGKKRIGNVRYDVIDPIKWFYKFKPTSK"
FT   gene            75553..76005
FT                   /locus_tag="Fisuc_0066"
FT   CDS_pept        75553..76005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73681"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73681.1"
FT                   /translation="MKHSIIGASLFIAVALITGCSSVVTPKAELAVHNDSVHDIPAIDS
FT                   LIVSMKQDYIKQCYMPVASHLPPENSCQSDLFQMVERRYHMEYNQNHVAAASNELFFKD
FT                   VVPEINKKVKREPALRDPLRRAFSNSNEMLAYYKDKYKFNTQIEQF"
FT   gene            76149..77558
FT                   /locus_tag="Fisuc_0067"
FT   CDS_pept        76149..77558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0067"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   scl:sce0086 isopropylmalate isomerase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73682"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ACX73682.1"
FT                   /translation="MGKSLYQKIFESHTVAKLPSGQCQLFIGLHLCHEVTSPQAFAQLR
FT                   EEGQKVLFPERTFATVDHIIPTTFPERNRPLQDGISEEMFSHIENNTKNNGIKFFGPST
FT                   CEQGVIHIVGPEEGVTQPGMTVACGDSHTATHGAFGAIAFGIGTSQVADVLATQTLAMS
FT                   PLKTRRIKFTGKLKPGVTAKDVALAYIAKLGVNGGVGYAYEFAGPVIEEMGMEGRMTVC
FT                   NMAIEGGARVGYCNPDEKTFEYLKGRPYAPKADKWDEAVAYWKSVATDADAQFDDEVEI
FT                   NCDNLEPMVTWGITPAQAIPLNGNMPKIDEFEGSEKKVISEAYEYMGWEEGSKMIGRPI
FT                   DIAFVGSCTNGRLSDLQAAAEIIKGHKVAPTVKMWVVPGSMKIKVEAEQLGLDKIFKEA
FT                   GAEWREAGCSLCLAMNPDKLKGRQVSASSSNRNFKGRQGSPTGRTILMSPAMVAAAAIE
FT                   GKITDVRKYIK"
FT   gene            77577..78185
FT                   /locus_tag="Fisuc_0068"
FT   CDS_pept        77577..78185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0068"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   scl:sce0085 isopropylmalate isomerase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73683"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ACX73683.1"
FT                   /translation="MNSIDIVKGSGVPVRGNDIDTDRIIPARFLKCVTFEGLGANAFAD
FT                   DIAGLAAQGKVHPFRDPAYKNGSILVSNQNFGCGSSREHAPQALKRWGIRAIIAESYSE
FT                   IFFGNCVAIGVPCYKVSHEVADKILSWIEAHPSEELVTSTESRTLKMGDETIELTLADG
FT                   PRGQFLDGSWHARSALMANADKVQELAKKLPYMQFLKNA"
FT   gene            78486..79364
FT                   /locus_tag="Fisuc_0069"
FT   CDS_pept        78486..79364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0069"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bph:Bphy_3423 DNA methylase N-4/N-6 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73684"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ACX73684.1"
FT                   /translation="MCYKVFNEDCFDWMENQSENTITAIVTDPPYGVKEYTEKELVKKR
FT                   AGSGGIWRIPQKFDGCTRQPVPRFSVINDDPEERKNVYLFFERWARLAKKILVPGGHIF
FT                   LASTPLLSDIVGSALRSAGLEKRGEIIRSVCTLRGGDRPKNAEDEFPELSVIPKALWEP
FT                   WCLYRKPLAEKTVAENLRVWKAGALRRPAIDRPFSDFIQSEKTPKIERDIVNHPSIKPQ
FT                   SFLRQIVRAALPLGEGIVLDPFSGSGSTLAAADYLGYDSIGVEKDTEFFRQSLHAIPKL
FT                   SKLYGQTTLQI"
FT   gene            complement(79348..79983)
FT                   /locus_tag="Fisuc_0070"
FT   CDS_pept        complement(79348..79983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73685"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73685.1"
FT                   /translation="MLSRRNLRHEVPLPPELTLDSIYKALEKTQDLFSLIKDKTGVALS
FT                   KIIQSNNFSGIVSNVFTKMLDECSPYKAFSDQRYPDLKNMNNGIGLEVKASNKPLKGGE
FT                   GHNGHSGWHIVVCFVVLENGNIDFSQVEIANLIGFEQQNSDWKYQGSERNENDSQRTET
FT                   YITTNIGTAKLRDGTIYLNSEYCTITEALKRNRRKLDLAIPYYSIFAE"
FT   gene            complement(79961..80197)
FT                   /locus_tag="Fisuc_0071"
FT   CDS_pept        complement(79961..80197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0071"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: shn:Shewana3_3803
FT                   XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73686"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX73686.1"
FT                   /translation="MSKSNKNPLLKKFGNLVHDARVKKGLSQEELGFELDLHRTYIGMI
FT                   ERAERNISFFHAIKLIQYLDINIKELYVKQKKS"
FT   gene            80453..80977
FT                   /locus_tag="Fisuc_0072"
FT   CDS_pept        80453..80977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0072"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   gbm:Gbem_3990 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73687"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACX73687.1"
FT                   /translation="MTINRILLLLLLTFLLFSCSSEKESPKVMLTSPVDNILVEKAKRQ
FT                   MHLRSGENIVKTYKISLGKNPVGAKVKSGDNKTPEGNYTIERHNPKSIFHLSLKVSYPN
FT                   AEQIKAAKEGNYEPGGDIMIHGYPNKIPAFLFKFWHKWKDWTAGCIAVTNDEIEEIYDA
FT                   VKDGTPITILP"
FT   gene            80998..81675
FT                   /locus_tag="Fisuc_0073"
FT   CDS_pept        80998..81675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0391 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73688"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73688.1"
FT                   /translation="MKKILITLFTICIAQTFAAKATPEQWIAKANGVLKEQPRISSKYI
FT                   YPGLEPSSVFEASAILDSATKEYPYRIDMWLGQVQLFGEINECGMQSKFFDKINTLLKT
FT                   KKDKCELAGGKKINKAEKLLEGEFTIVIRKYFDLEYDSCYEYMSRQMYKLLPNSVEALN
FT                   AMSIHYMLQKNDSALALLERANKIAPTDCIVLSNLALYYKRKGNTKKEDEYKKKQDLFC
FT                   KEK"
FT   gene            81681..82109
FT                   /locus_tag="Fisuc_0074"
FT   CDS_pept        81681..82109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73689"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73689.1"
FT                   /translation="MSFIKISLIFLVAATAFSCSDKQESSSNNVDTKAIEKIQTFYTNY
FT                   IFGDEFANDSVIAKYCTKNLAQELSKAYDNEFSDGGGYAVWKFRSDAQDGEDIREIEKI
FT                   EPLGDGKYLVHYNDMGNKGSHTITIVQQSGEIFFDKID"
FT   gene            82121..82558
FT                   /locus_tag="Fisuc_0075"
FT   CDS_pept        82121..82558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0075"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aha:AHA_0282 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73690"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX73690.1"
FT                   /translation="MDIKVLRATEEWQRAGAYSVRIQAMNRAYHISLRDEFDEHDCDGT
FT                   KFIVLLDDEYPVATCRFYEIDAETATIGRVVVMPEYRGQKLGAMAVREAEKWIAECGYK
FT                   QIIIDSRLEATGFYEKLGYKHTGDKPHRWGVFDCTRMKKIF"
FT   gene            complement(82555..83409)
FT                   /locus_tag="Fisuc_0076"
FT   CDS_pept        complement(82555..83409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73691"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73691.1"
FT                   /translation="MNLRYLICCLLFLTASFSFASDDEKREIRRYEFQSSQDAFLDFNR
FT                   SVRTTAFLLDEKQAEEAPIETILNFYWCWSKRDGSPFCKIEFLDEKGEPIMTSEINTHH
FT                   EKTCFGNQTDNCREGNLLEVVEEHKQQYCASLERDQFSKAKQVSLWEYPKKNGKKNDAS
FT                   EDICNKSKKNTQNLDYWTPLKKMQIQSDLNYRIDDVKSVHMYQDTETSIGWGIFGGLYG
FT                   AIFVALTSMVVEIPVSYALDEDYNWKHVGLASLVGFVGFSTWGVIRIAKNPDATRVDVT
FT                   IKF"
FT   gene            complement(83438..84067)
FT                   /locus_tag="Fisuc_0077"
FT   CDS_pept        complement(83438..84067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0077"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: vvu:VV1_2417
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73692"
FT                   /inference="protein motif:PFAM:PF03703"
FT                   /protein_id="ACX73692.1"
FT                   /translation="MDNELKLLIGKDEKIIYAGKPNKKCFIFESIFNPLLPFALIWGVI
FT                   DFGFIGASLSSKDEHIGFFLVPFMLLHLMPVWIYLGGALLSFRRYQNTNYIVTDKAIYA
FT                   SGGVFSKHYNSKPFAELSHVDLHRGIFDQWFGVGDVITTSAQANPVTRNGRTTSTNAGI
FT                   SIDSISNYIEVYNIVKKLQQDVYADVMYPNDLRPRENHGYNTKYRG"
FT   gene            84235..84753
FT                   /locus_tag="Fisuc_0078"
FT   CDS_pept        84235..84753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73693"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73693.1"
FT                   /translation="MEEQNIHSAEVQKQMRKVGLKIAFIMALLMSFGLSLTGQLMAEHP
FT                   PEMPTIAIVIGFLKCFALSFVISFVIGFFVPISKVNAALARKFHLQPHTPKAHFVESLA
FT                   SNLIYTPLITTAMVCFVYFTMMPEGHKPPFLAMFIFSQVVCLVVAQVLIMVFVPIIMKL
FT                   VLPKMPPQQ"
FT   gene            complement(84856..85455)
FT                   /locus_tag="Fisuc_0079"
FT   CDS_pept        complement(84856..85455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0079"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: Manganese/iron superoxide dismutase-like;
FT                   KEGG: sed:SeD_A1912 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73694"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACX73694.1"
FT                   /translation="MFEPVNGKFEMPVLPYGMADLAPALSQETMLFHFGKHLQTYVNNL
FT                   NAALPGSAFEGKSLEEIVKTSEGGVFNNAGQILNHAMYFLQFKAPTMSNVPTGEIAKLI
FT                   ERDFGSFEKFQEDFQTKGAGLFGSGWVWLSALDTGKLVITQEGNAQNPITKGLKPLLTF
FT                   DVWEHAYYIDYRNRRPDYLKSLWSIVNWDVVNERLG"
FT   gene            complement(85691..86182)
FT                   /locus_tag="Fisuc_0080"
FT   CDS_pept        complement(85691..86182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73695"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73695.1"
FT                   /translation="MNLKNISIALTVLVFGVIAMLFMQKGNYVNQAREHYEATTNKSFK
FT                   GNSMVLDLVNNGIEMNKSTWAIACGALQTVRTSQDMARLEAKFFPATKGNMSLANKTRR
FT                   FEASSANVIVANFGKVEEDKKTGVKSLADLQSVDVSILLGNYAAAAAASDEGSDEGDEE
FT                   "
FT   gene            complement(86194..86754)
FT                   /locus_tag="Fisuc_0081"
FT   CDS_pept        complement(86194..86754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73696"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73696.1"
FT                   /translation="MDKKKMKILVVADVVILVALIIILMTLKGGYEEQAKRTANEQESA
FT                   YLEKNTQVLVEQWRSVDQYSMAWKLVYTVLSGAKSEAAFKSALAAIESDKDARFKQISH
FT                   LYTGAGINDAVQNGIFQKAGLAEGTILLKNEKGSKEVACGKNCVVKFSYAKGKLKNVDY
FT                   SALVQYNLANSLKIEKPAEYHFE"
FT   gene            86871..87386
FT                   /locus_tag="Fisuc_0082"
FT   CDS_pept        86871..87386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73697"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73697.1"
FT                   /translation="MKVDINKLPSQIIYNNLKEMVRAKNTAHDSIFKFHWKKMWPFSLI
FT                   WPQVDFVRIVRLMDELRKNVVSQKALIKEAKSKAKPYEKTFLDTVPAYLDNFDTSCKCL
FT                   ADVAQWKQDMLEKKLHHDVKMIRDVSEYNNILKAYEKAQNDLVQAGAFVRAGWVEVIQG
FT                   ITKEGEGK"
FT   gene            87386..88351
FT                   /locus_tag="Fisuc_0083"
FT   CDS_pept        87386..88351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0083"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   shw:Sputw3181_0057 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73698"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX73698.1"
FT                   /translation="MPAVSVIIPLYNTEAFIKDCLDSLVAQTFTDFEVIIVDDGSTDGG
FT                   ARIAASYASADTRFKLIGQPNKGPSEARNTGLKIMRGEYVTFIDSDDCVAPNFLETLFF
FT                   IAQLHKADVACCSIKNIDEAYKCDGTTPNTSISASLTPEEAARISLYQDSLPDYSAWNK
FT                   LYKADLWKGKFFPANTIYEDLAVIPEILLGANKVVTTKSHLYFYRKRAGSELATQTGST
FT                   KIILLLDIAEDVFEKMKHISKPLYKAARSMLVSASFSILMRTSDDEKFAESRKRAIAHI
FT                   RKYRFGTFFDLRIRMRNRMAILLSYLPRSIFLKILKKGLS"
FT   gene            88348..89445
FT                   /locus_tag="Fisuc_0084"
FT   CDS_pept        88348..89445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73699"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73699.1"
FT                   /translation="MIPLTFKEVVIRMARRILGEERVHDRLIERGIKLRHLQDGYSRNG
FT                   EILESCDGGESRDGGESRQTLIFMADGKWMHGGLTDRLRGMASAYKFATEHNLDFKIFH
FT                   TSPFLLQEILQPNKVDWIIDEHEISHNCEIAKPVLLYREDFNNDSALERQLDSRHKQFH
FT                   LYSCVDTVGEEFPKYFNELFKPSPLLENELAHYSELLGENYTAISFRFQNKLGDFKEFT
FT                   FKELSEKGKRKLLSAAINVLKKEMPHQVGHDNSDTALSCPPVSGHHHLVNETSKILVTA
FT                   DSPTFLAEAEKLPNVVTVKGKSIHIDFNSSKNATDYLKAFTEFFLISKASKAILYRNRK
FT                   YKTYPSNFPKYAAMLGHVPYEIVEE"
FT   gene            complement(89455..89802)
FT                   /locus_tag="Fisuc_0085"
FT   CDS_pept        complement(89455..89802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73700"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73700.1"
FT                   /translation="MHEGKPLQVSLTSSTKKAAVRVARSAGIVAKNVLKGLRSVQVGNQ
FT                   LQVSFDAPESLAGERSKVELLDVKGHVIATVSAKALSGTNAMTTKLPKLGVYILRVRVG
FT                   SQQLAQCIFVK"
FT   gene            complement(89811..90554)
FT                   /locus_tag="Fisuc_0086"
FT   CDS_pept        complement(89811..90554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73701"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73701.1"
FT                   /translation="MRRSSFFFVFVALFVMSASFGVSFANAADPGDGLKFCFIEDKEGT
FT                   LDYPRLNFSQKPDTETPATGEVCFDKWYEANPTGAGTPDANTYLNNWLSAKQGAIAFVR
FT                   VTSDIKFAGRSIIGCAEGNNAFNGKMITLYSFQTLYSQIDPQTNEPYVISGLCHFGNVQ
FT                   IVAFIEKFSGTMYNMNFDDAYLNASATNSSAGIIAEGVTGLDGTRVFNGYIHDVKVSNS
FT                   EFQGTNVGAIVGKGNTDISSAELMV"
FT   gene            90805..91002
FT                   /locus_tag="Fisuc_0087"
FT   CDS_pept        90805..91002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73702"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73702.1"
FT                   /translation="MAIEALAAMAAKKAVVDVAPVVVTAVATAITKEIINHSDDIIEEM
FT                   ACAPFKVAGEILDSIDRWFF"
FT   gene            91186..91893
FT                   /locus_tag="Fisuc_0088"
FT   CDS_pept        91186..91893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0088"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   tbd:Tbd_1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73703"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACX73703.1"
FT                   /translation="MENNTAVFVDAENLTFWAYNNGVHDLMKSLQSQGPVVIRKAYGKW
FT                   TSPQLSPLQQEFNINGFELIQTYHPITGKNSADIKMVVDAMEAATNPCLQTIVLATGDS
FT                   DFSPLFRKLREMGKKVIGVGPLSKLSECVQSSCTHYIYTGSPSPVSKMVALFPGEVQSH
FT                   ERAHAFATLHKILEAQDEPILLTKLKPLMLKEDNEFDHAKLGYESFKDFLLASGEVHLS
FT                   PMIAGPVYASLAS"
FT   gene            92296..92967
FT                   /locus_tag="Fisuc_0089"
FT   CDS_pept        92296..92967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73704"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73704.1"
FT                   /translation="MTLKTPIDYKQRETETAILTNFFQRYPTEVLATLAAWYRPVLKQW
FT                   ASKFRSEFYRPDIPLRDYEAVAISSLADAAKNFDSTANTRFSTYLYAYARNECQRLAYN
FT                   TSNNFRVFKPCKKKNREATDAIPFEKLTVQDFNTYNDITFYHRSQLLESQRRIEQFYNM
FT                   LRHMSNSTSAVAKKQATRVQELAHHVLMGGTKKSFCDASGTNRGTLDEALMAIRAKLLK
FT                   E"
FT   gene            93019..94647
FT                   /locus_tag="Fisuc_0090"
FT   CDS_pept        93019..94647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0090"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: cla:Cla_0048 anaerobic ribonucleoside
FT                   triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73705"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ACX73705.1"
FT                   /translation="MNELANIQKNTMSSILGAGEKVCKSAVLDGIPERFAEFHRQGYIH
FT                   IHDLEFYDKTYNCIGVSVSDLVKDTDIQVSTVLRRLYRGIVSLTNNQSGGIGFLDFDGD
FT                   MAAYRMDESDEILTEAFRNFFEDLNIYSRKGCEKPYTTLNIGCRTSTKARRIAKAVLSA
FT                   ALEGNSEGKPFIFPNIVFKYSRAINGTESSPNYDIFQMALKGTASRMIPTYFNCDAPFN
FT                   RNANPNKIGIMGCRTRVVADIHGNTTGLNRGNIACVTTNLVRLAIDSNHDFQVFLKKIG
FT                   TLFEECKELLLHRFATLCKGTSPIFAIEKGLYLDSEKGREVALMHGTLSIGFIGLWDAL
FT                   SELLDTDFSDVDNLRMHHGKALAVLQVMRQKVDSFIEQSHMNFSLLASAAEATTGIFAD
FT                   RDFKEYGIQCKSAAKGFYTNSFHIPVDTSIRLFEKIQLEAPFHKLCNGGCISYVELDEQ
FT                   PCYNVGAIQKVVEFAMKNNCNYFGINFPLDQCNACGHFGRIGDTCSSCGSSDILRLRRV
FT                   SGYLSEKRAFTKGKKRELNLRKASF"
FT   gene            94746..95348
FT                   /locus_tag="Fisuc_0091"
FT   CDS_pept        94746..95348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73706"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73706.1"
FT                   /translation="MRPKEFIDMFPYGYTRLRNLNGSAALRLETKCTNAYVYVKKIHRR
FT                   MPEINQDIVDDIQLECDNGVIIDWFNDNACRYFIIMRKHDELLAYKIVLNAFFQKETFE
FT                   IIGYFFENEHENHRKRVYNERYLKNVSPDALITETDFTNERYDIIFPDDALTHCRRLGN
FT                   TIAMSSICSTESCSQNHSDLNIHNNESLEDNSESDIE"
FT   gene            95329..96594
FT                   /pseudo
FT                   /locus_tag="Fisuc_0092"
FT   gene            96713..97396
FT                   /locus_tag="Fisuc_0093"
FT   CDS_pept        96713..97396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0093"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: pst:PSPTO_4762 von
FT                   Willebrand factor type A domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73707"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACX73707.1"
FT                   /translation="MNRNLLSIEDLENNPSSRVPVCLVLDTSGSMEGDSINELNEGVRL
FT                   FYDAVRSDETALYAAEISVVTFGGHASCQAGFSTLEHQPDAPQFYADGGTPMGEAMNMA
FT                   LDMLEKRKSEYKASGVDYYQPWIVLMTDGMPNGSQAELSRSIQRTCDMINDRKLTIFPI
FT                   GIGEDADMDVLARFSPKRSPLKLQGLNFKEFFAWLSKSVSKVSQSTPGDKVQLDVDGIK
FT                   GWAEL"
FT   gene            97398..98399
FT                   /locus_tag="Fisuc_0094"
FT   CDS_pept        97398..98399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73708"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73708.1"
FT                   /translation="MNWVTIQCAVRGRGHVSSGTPCQDKTFSIVKDACSVCALADGAGS
FT                   ASHSHFGAEAVTQAICNYMAENFDLIINEDGAAVKRNILAVIGERLETLCSEKGCAIRD
FT                   LASTLLFVAEKGGKFIICHIGDGVIGYVKEGKVLVASQPENGEFANTTVFTTSSNAIAS
FT                   MRLIKGDLKQISGFILMSDGTETSFYNKRNKALSPSLARLTRLASVCTPDYMSQKLNCT
FT                   FEDLVKQQTSDDCSIVLMSRSPGSRGYMDFSEKDKCEFLGLANTRVSRKRLRSFDKALT
FT                   VLQSWGTYRAIKRRLHLRGKKLDRILKRLDNANILETREDGRYKSALRAFFV"
FT   gene            98440..99126
FT                   /locus_tag="Fisuc_0095"
FT   CDS_pept        98440..99126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CCAAT-box DNA binding protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73709"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73709.1"
FT                   /translation="MRFRDYIDTAQRHLISCEAICRTIEWDKCSNEEKNEILKDLFYLT
FT                   GYILEALTIYTVYSRGHFNPNKDITELDIKFTKDTHVDYYNTREIHPNKNDPKDKFSIS
FT                   CRTPKNAESYETFNKNLEELNKLIRETTIYPIQSHKFFAIIQNVLNDSNKGLIFSSENI
FT                   PLFSNIKVSNNEREKKILTLIMSWDSSLRYSTNQWNKIKDILTKENIEYIIILCKMIKK
FT                   LVYKVG"
FT   gene            99130..102276
FT                   /locus_tag="Fisuc_0096"
FT   CDS_pept        99130..102276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dze:Dd1591_4206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73710"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73710.1"
FT                   /translation="MTFISKYAIALQAFLHSLINEERGEKFKVFIRAGFQIDVFVFLFN
FT                   HQHHQDIEKKFDNFCKANKDLADLDPIAENDEIQIFFNIYPISELEDSFYSSIVNKPNC
FT                   IDYGPRYRFDSFYSTSKIDLTKEDQTKIPVITFYSHKGGVGRTTAMASYALHLAKLEKN
FT                   VAIIDCDLEAPGYLNFFNLSENDEHEELKEGKKNGLVEFLCDSQFLGKNIKIEDYILNV
FT                   GARNRNSNYHPALDRIWLIPAGNLNEGVTEDNALESPNRQDYIEGLAKLNLGNTQNVIK
FT                   SFNTLFEHLKTLNVDAILIDSRTGFNDIFGTATLHLSSCVVGFFGLSRQNEPGLINLLA
FT                   KHVQNENLFKLILAYSILPKNYKEDNILMEAYNRMETFIMNVYDQKNAPTRIPIHRNDD
FT                   LERIGIGDLAADKKFIDMNTSTDRNIQFSDYTQLFNEIDRNCFPEGLLSSIFGLMADNL
FT                   KSNKDNRYNSYDLRNIILQHLKKVLDESINSAEEDRINENTFFYRQCMNDLFDKDKFII
FT                   CGRKGTGKTHLCKSLQNQQISNKIKSNSRQKDNAEFIYANALPDNKDQEVALSIIIRSA
FT                   FNKDVDYLNLWRIYTWSKLFLDNGNESLSEIRSVVKQQSPLANKYSSINGELDTLEFME
FT                   LVNDIDSLLHIVEDLYRFDEELAKNNKKLLILYDKLDLYIRPSYWEKAISSLFEYWTHA
FT                   GSNLHNIAPKIFIRTDLFWQSIQGSITELSPNNIISTEWTIEEIFGYLFKLIFSDQRAS
FT                   SAYWDIAKNFGIDPQYIADTEKAFKTNNNQLKVLSQAEMEPLLQVFFGKDTQGLGKPWD
FT                   YFKKELSNADYTTNLQLFINILYHNAIDKSLAIAKSNITEIISPAIYTSTEVRAYAAKM
FT                   LFEKLAEDQFCKNLANFQHAVFFADNGLYRYKSLDTNKFDNLINTVCEQNKFLDFGSTK
FT                   ENLINAIFSNGIMTINNTTKGDIFVFAPLYWYPWGLQEVSFESKNKTIKKNDEYFEYKD
FT                   ELASNNADAAKKAIIASNAALMALGLGSIFGGPVVASVASAAVIATSIAKMISKINSKK
FT                   "
FT   gene            complement(102334..103209)
FT                   /locus_tag="Fisuc_0097"
FT   CDS_pept        complement(102334..103209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0097"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pfs:PFLU0479 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73711"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX73711.1"
FT                   /translation="MTPKVSVILPSYNHELYVEAAVRSVMEQTGVDFELIVIDDGSKDR
FT                   TPEILKRLADELKFTYIHRPNKGVVPTLIEALALARGRYVCSFSSDDIMPPDRLKKQSD
FT                   FLDAHPEAASCFGQIVSLYEGDKIGSEMDVRYLRSVPQISFEESFLGQKALHGCAEMFD
FT                   REKILAIGGYDKRYYFEDYPLYLSILYHYGPQPVSKDFVCCYYREHGDNLHVDNNRIFS
FT                   EILRILAENYSKHPLYKKAVRCWKANWFSAVAAQSKLKALRLIPKVISLSPRFWMRLPK
FT                   LFIPRKLLKF"
FT   gene            complement(103206..104498)
FT                   /locus_tag="Fisuc_0098"
FT   CDS_pept        complement(103206..104498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_0633 polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73712"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73712.1"
FT                   /translation="MSSRENKTNPQPVNFWKAFMGSGMVTFLNALRVFVVNKLLAMFLP
FT                   PSAFACVGQFMNFMTMGQATSSLALQNGWVSLSAQNKDNLEQLKGVWRGGFRLTTFASI
FT                   ATFAVALVLCFTVPLESFFPGIHPRLVQAAIIFALPGVFATNIITITASVMNGLGHYRR
FT                   WALINMVSSLWQMLWVAFFLYSGRLSVLSIVATQSVVAGIFAAQIASRAGFSLREIRKS
FT                   ALDIRAPWLSYALMGIVPMLLSPVVLTFMRQTVGDNLGWDAAGIWQGIWKISDFLTAFF
FT                   SAILGVIILPRVSAKMTKSEFWGMFRPIFLKTMLLALVAVLILYFGRSLLVAVMLSSSY
FT                   AGAADYLPVQLLGDFFRVGGWALGLVLIVRRETKKFLTLEICSELVLALSTYAFVKLYE
FT                   FNGPMMAYALENFLTLVASFVLVSRLKWGEK"
FT   gene            complement(104488..105606)
FT                   /locus_tag="Fisuc_0099"
FT   CDS_pept        complement(104488..105606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0099"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   pct:PC1_1304 glutamine--scyllo-inositol transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73713"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ACX73713.1"
FT                   /translation="MAKVPFLDLKLLNAPYMESLKEAASSVVESGWYIRGHYGEQFERA
FT                   FAEYCGVKYAVGVGNGLDALTLMLRASMELGRLRAGDEILVPSNTYIATVLAVSAVGLK
FT                   PVLVEPAENSYDMDPKRLKDACGARTRGILVVHLYGRLCAMDEICEFANEHGLLLFEDS
FT                   AQAHGARLGDGRCAGSFGSAAAYSFYPTKNLGALGDAGMVLTNDTDIANAVRSLGNYGS
FT                   EQKYVNMYKGVNSRLDEMQAALLLAKLPHLDECNDRRREIAARYCRDIKNDKVILPELP
FT                   ATPSEHVYHVFVIRLKSEEARDEMQKFLTAHGIGTLIHYPIPPHLQEAYAHEFSGEYPI
FT                   AEAMAKTILSIPMSPVMTDDEVSEVIGAINEF"
FT   gene            complement(105674..105746)
FT                   /locus_tag="Fisuc_R0002"
FT                   /note="tRNA-Lys4"
FT   tRNA            complement(105674..105746)
FT                   /locus_tag="Fisuc_R0002"
FT                   /product="tRNA-Lys"
FT   gene            105875..106888
FT                   /locus_tag="Fisuc_0100"
FT   CDS_pept        105875..106888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73714"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73714.1"
FT                   /translation="MDLLKKLSAIAALAIACPASDFGYFSQHDAGQEVFSFLSTFDSPR
FT                   NAALEKSASALPTTDPTVVQLNPAAILMPEGKKRVAEAHWQTGEFADNQGTLSYTTQFE
FT                   KFILQFSYNWISYGTITGYDEYGDENGSEYKPFSQLATLSVAYPMKHIRVGATIKFASD
FT                   KLTGDNEDQTAMAAAFDWGLTWVSDSKNYGFSFVARDFGAMLRGYVKEDADDTYPLSQT
FT                   FAISGFMKPRSVPRLTLFAETDFPRYAEPDLNLGAEYALGEFFRIRAGFTRTWLDITRD
FT                   IKELANSSSRPDETNEARIFSLGLGYASDLFAVDYAFSYLAQSLGFEHRLGLRVEF"
FT   gene            106907..107701
FT                   /locus_tag="Fisuc_0101"
FT   CDS_pept        106907..107701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73715"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73715.1"
FT                   /translation="MRQFDVFVFNENYDETQGNLPQPPFTDPELGWFFTRDWNKHLDEI
FT                   EGEWVVFAHPSIKIDRNFLNNVAEVTDSFPMVDAFAPRIRTNNGKFLGGYLLRPSSKGS
FT                   GFIEIDENAPLRYVAAPHPYLGIFSRRIIQRTGGFDTTLPENARLADFTLRMMHAGGKM
FT                   FSVPYLVAQATGDGAEAVTGNNRKENAHNLAEMRAGMRDLKSIAIILSKAFGAEASTPF
FT                   ALHHPSVIPTLLRNRKQRKKKRKAATLLSKLKADFLKEVTAK"
FT   gene            complement(107877..108905)
FT                   /locus_tag="Fisuc_0102"
FT   CDS_pept        complement(107877..108905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0102"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: smt:Smal_3219 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73716"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ACX73716.1"
FT                   /translation="MALKLGINGFGRIGRMVFRAAVENFSKDITVVGINDLLDADYLAY
FT                   MLKYDSVHGQFNHDIKVEGNFLIVDGNKIQIFAEKDPTNITWGALDVDVVVESTGFFLT
FT                   AELAEAHLKAGAKKVIMSAPSKDSTPMFVYGVNDKTYAGQKIISNASCTTNCLAPISKV
FT                   LNEKFGIVRGLMTTVHAATATQKTVDGPSKKDWRGGRGILENIIPSSTGAAKAVGKVLP
FT                   ELNGKLTGMSLRVPTSDVSFVDLTAELKNAPAADKDAAYAAICAAMKEASEGELKGILG
FT                   YTEDAVVSTDFRNNSCTSIFDAKAGIQLDPTFVKVCSWYDNEWGYSNKVCEMARVITNY
FT                   KG"
FT   gene            complement(109070..109837)
FT                   /locus_tag="Fisuc_0103"
FT   CDS_pept        complement(109070..109837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0103"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Thioredoxin domain; KEGG: glo:Glov_0506 alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73717"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACX73717.1"
FT                   /translation="MSKIIRAICILSLFSVSAFAGPWLGLIYKKDLYQNHLALRVSGVH
FT                   PESGCLAAGVVSGDLVIGFGGKDLVNVAQMQDVLKTAKVGSKVAIEIFRDGKRIPLTVT
FT                   LTERPDDISSLTGSAIGSKMAEFGKNFYKNGEKRKDAPKATLLDFWATWCGPCRQTLPV
FT                   LEKIYNKYSSQGLEVIGISSEQTKPLLAFYKKQHASPYPLYRDADQGLWRRYGIHAVPT
FT                   LMLLDSNGYIKRVWSGAPSFEMLEKLVLEVLEK"
FT   gene            complement(109865..110419)
FT                   /locus_tag="Fisuc_0104"
FT   CDS_pept        complement(109865..110419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73718"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73718.1"
FT                   /translation="MVRCVKIFLVALLLSCVQSFAGYFIEQPYEDAPASDSLSALSFGG
FT                   ELQLVYYLSSVHPGILLSSEHRFHKHHSADLFAAFLFSGDYFEVGTDWRFFFRGTREDD
FT                   FVRLGFSMISFDRYGKNYFQPRATLGYGRDITFFKNTSFLCRIELDASYIMGKALVDKS
FT                   DDIFSREAHFSAALNIGFYLF"
FT   gene            complement(110429..111604)
FT                   /locus_tag="Fisuc_0105"
FT   CDS_pept        complement(110429..111604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0105"
FT                   /product="Dihydroorotate oxidase"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: dihydroorotate oxidase; KEGG:
FT                   erg:ERGA_CDS_01750 dihydroorotate dehydrogenase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73719"
FT                   /inference="protein motif:PRIAM:1.3.3.1"
FT                   /protein_id="ACX73719.1"
FT                   /translation="MNNNCINHEYYMRVSDRILALIRRIFHNNPEFRHDSLKHVARFAP
FT                   IIPFMGGRPDLSKTLNRVVTFADGSNPLHFGCPIMLAAGANKTAKRICDFANMGFGGIS
FT                   VGTATRHVREGNTHRPRIGFIENDRAIHNSMGLNNDGVDAVTRRVDTQITAAHRVQMCV
FT                   GISVAETPGLTDENEKLQDIVESFSIAYRVADYVEINLSCPNTGENRLDLDMTLVNKIF
FT                   TAITDYRNKQPVRKAIYAKLSPDMPENHTATIMDMLVKVGVNGVVMGNTYPTKKVTDLP
FT                   VHVKYDDLTPLRADNDRGGMSGRPLYENTVRNVKFIREHYPQMSVIACGGIDHGYKIYD
FT                   LIKLGVDAVQCYSVVAFRWMAAHAMRKELEEALSKDGFKSLADYDAKNPKG"
FT   gene            111726..113099
FT                   /locus_tag="Fisuc_0106"
FT   CDS_pept        111726..113099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0106"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: mxa:MXAN_6011 M20 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73720"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACX73720.1"
FT                   /translation="MQNQIKKDIHENMPRYIDMLSSLVAIPSISFDNFDQKYVLDSANA
FT                   VKAMFEKAGLTNIQFLMPPSGRPSVYAESLTSPDKPTILLYAHHDVQPPMREALWDTPP
FT                   FTATQKGDRLFGRGTADDKAGIITHLAALEQVRRELKGNGPNLKFIIEGEEESGSAGFE
FT                   RILTEHAELLKSDAVIIADLGNFAKGTPSITTTLRGMSAINVTLRATKAPLHSGSWSGP
FT                   IPDPAQALCRMIASLTDKDGKILIPHYEDDIIPPTKEELESYKSLGMTEEIFRNDGGVL
FT                   EQVKLNVPEDEILLSLWRRPSIIVSTIESGSRVNAGNVLQDSAYARIGIRLAPGMDAVR
FT                   CTDMLADFLKAQVPNNMEITIDKEDGANPFTTDTNHPFFKKMSEAMADAYASPTKFIGC
FT                   GASIPGAELFRNTLGNVPILLTGLEDPECNAHGENESLYLPDFESGIVAEALFFASIS"
FT   gene            113109..113798
FT                   /locus_tag="Fisuc_0107"
FT   CDS_pept        113109..113798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0107"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: yen:YE1714 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73721"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACX73721.1"
FT                   /translation="MKRKRLVVLTGAGISAESGLRTFRGNDGMWEHENIEDVCTPDALR
FT                   RDPKRVKDFYNFLRKGLPEHAPNAAHIALAKLEERLGDEFLLVTQNVDDLHERGGSKRV
FT                   LHMHGDLMKLRCTKNEHEFEFTGEETLDTKCPICGSPVRPDIVFFGETPLYMDEIQEAL
FT                   MNCDEFAYIGTSSVVYPAAGFKSFAKSYGAKVTCLNLEAPYGDPYTDVVIQGKATEVVP
FT                   KWCEEFK"
FT   gene            complement(113848..114789)
FT                   /locus_tag="Fisuc_0108"
FT   CDS_pept        complement(113848..114789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73722"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73722.1"
FT                   /translation="MFCKECHKNLKDFDALIDKMENCPFCGAKLVRPPVKVAQKDVNAL
FT                   CEALVQKVGDSIFANESTLEKELRDLNAPEFADAKDRLFLLVLKQIPSSMYEVRSFSDG
FT                   EQQEVLEACQRRLCVDLGLSFEPCAQMLDILQEYIWQKRFSLSPNLFESQFVDPRDGQV
FT                   YKTVRIGDQVWMKEPLKYKCVGYTGEGLYEWSSVNKYCAVRGWRVPSKKDFETLIKTAA
FT                   GLGLGDPSSVLMSRKGWEKCNVTPTDNLGFEATPVKCSTGISNNFFSHFWTSEDKFCFE
FT                   IFPGRVTFSTHSQSYVRLIKDDTPETKTPEKK"
FT   gene            complement(114933..116150)
FT                   /locus_tag="Fisuc_0109"
FT   CDS_pept        complement(114933..116150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0109"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73723"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACX73723.1"
FT                   /translation="MFRRETRDERREERVILSEVEGSSKVPVLRVKEVSVAFGFDKNGN
FT                   SRDGRKPLQVTDRVSFDIFPGEFFALVGESGCGKSVTAMSILRLLPWPSAKIVNGEILF
FT                   DVGANDAQAQDSRDADDGNANSRDLATLPLKDLQSVRGSEIACIFQEPMQALNPVVTIK
FT                   KQLLEVFKFGAVSKNTQSKQDSAPSRGSSSSSERSGGDPVNSPLDLIREQLRLAGFNDP
FT                   DRVLNSYSHELSGGMLQRVCIVMALLPKPKLIIADEPTTALDVTVQAQVLAVLKEMAEK
FT                   TGTAVLLITHNMGIVSQYAHRVAVMYAGRIVEEGPVREVINHPMHPYTQGLLAAIPESH
FT                   SDLRTLASIPGAVPHPKDFAKGCRFADRCCKCAQASAEVREKCLSAELPTKIAEANHFA
FT                   YCFCAK"
FT   gene            complement(116143..117222)
FT                   /locus_tag="Fisuc_0110"
FT   CDS_pept        complement(116143..117222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0110"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pap:PSPA7_3488 ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73724"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX73724.1"
FT                   /translation="MKLRLSTETLNRLKRFRKNKRAFWSLVILVVAYLLSLTSPWTVND
FT                   EPFYLRYNGKSYFPAFARYSEADFGGEYKTEQDYAKLFADVEECKQDEEDGFPRAGGCP
FT                   EMWTFMPPVPHDPLKADLSEEGTPPFAPSAKHWLGTDSNGRDVLSRLIHGFRICISFSL
FT                   LLTVLGTFLGIVIGGIQGYLGKFWDTGMQRMIEIWSSLPMLYVVILIGSIYGRSFWLLI
FT                   LIMAAFNWLSLSYYMRAEFLKLRSMTYVMSAKVLGLGHRHIFFKEILPNAMTPVVTLFP
FT                   FTLIGGIGSLTSLDFLGFGLQPPTPSWGELMSQGLNNLYAPWISVSTVVALFVTLLLTT
FT                   FVGEGVRDAMDPKSGDRYV"
FT   gene            complement(117277..118374)
FT                   /locus_tag="Fisuc_0111"
FT   CDS_pept        complement(117277..118374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dal:Dalk_0937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73725"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ACX73725.1"
FT                   /translation="MVTLALSHFEKSFPVVLRGKRLGAVLHPASVCADLSYTLDLLKDL
FT                   DGKLFKLSALFGPQHGIKGHTQDNMIEWEGYEDPELHIPVYSLYGEHREPTAEMLSHVD
FT                   AMLVDLQDVGARYYTFIWTLFLCMKACEKAGIPVVVVDRPNPINCVDEEGPVLDLNYTS
FT                   FVGLHSIRTRHAKTIGELAEQFKAERFPKCELYVMHMDGYDKRMWFDETGLPWILPSPN
FT                   MPTLDTAIVYPGMCLFEATNVSEGRGTTRPFEIFGAPFIDAVKLCKYMNGLKLPGVYFR
FT                   ENYFQPTFHKGAGQICGGAQIHVTDRNKFRSFEMAVKLLQYIFNEYPKDFAWKQPPYEY
FT                   EFHKLPIDILLGNGTFRKEFIESSI"
FT   gene            complement(118400..119476)
FT                   /locus_tag="Fisuc_0112"
FT   CDS_pept        complement(118400..119476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0112"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sfu:Sfum_2430 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73726"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACX73726.1"
FT                   /translation="MHLGIKKFLALEAHRLYRHSQIKDHPLTYLFWECTLRCNLHCLHC
FT                   GSDCVADAIPDMPREDFMRVLDGVSPHVDPSNFIVVITGGEPLMRADLEEIGKDIKARG
FT                   YPWGMVTNGLALNPERYTKLMNAGLRALTISLDGLEENHNHFRGNAHSFERAVRAINMA
FT                   SHTDGITFDVMTCVNRKNLKELPKIYNLLLNLGVKRWRVSNVFAKGRAKDNPLFQLTNQ
FT                   EFRQVFEFIREAKKQNLMNVNYDCEGFLGSYEKAVRDNPFFCWAGVNIASVLCDGSISA
FT                   CPSLRGDYIQGNIYKDDLWDVWQNRYQVMRDRSWAKIGDCKTCKYWRYCEGSSLHLRDE
FT                   RTKELAYCHVKRLEAAGV"
FT   gene            complement(119494..120141)
FT                   /locus_tag="Fisuc_0113"
FT   CDS_pept        complement(119494..120141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_0645 glycoside hydrolase family 9
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73727"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73727.1"
FT                   /translation="MYKHWKKFLLALTAFFWNACDNGSSPAAPVFPDSSSSTTNGQNSS
FT                   SSVEKVSSSSTVKNQFSSSSDVQPSSSAESSSSVESSSSSPIAESSSGEIEVVPLYGVY
FT                   MDRETCTAHKDDNVYECTDGVTCVESTADEEQVPVTRDPTEVTAKYGIVFKPEVTAKYG
FT                   VVYVKDKVYTCSDGKVYNEAEFQANYNTIIIDETVVLYGPPCAFEGSCKDDE"
FT   gene            complement(120301..121758)
FT                   /locus_tag="Fisuc_0114"
FT   CDS_pept        complement(120301..121758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73728"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73728.1"
FT                   /translation="MEMMRLVTLLVLVGVLSVPALAKKSDEAVQDTSSGSMSFTEVIAW
FT                   PFIHVIQPFFSSLVYPIAAPLHYAIENGVADKAVDLITFGEKRNIFIYPVFNLKPGSST
FT                   MIGLCYRHRNLFYQNDYAVFEGHYYANSDFDVKMRYSKQSLFGKKLYGLVNLNIYMDRD
FT                   NGFTLPVTKESFKQADTTINAGLRFGFPITESRNLNFSFGSELVYHLADFTDTKDSVLD
FT                   HPKFPIEDRGLYQGHFEIPFYVNLVFDNLDFPYAPSKGQRLSLSASYVLTSHYSGITAD
FT                   DMSIVGLHRSSALKDGGKNHDYVSVDAFYQIYFFIGRADKYVLSAKEGRKTRKFYTDFS
FT                   LNEVLRVWRPENLVETLFEHRVFAFQLRFQGMWEMEKGGAPYSAFPSLNARFPLRGYTG
FT                   AWVAPFVLGLSTEYRWPVDRLVDGVVFNEYAMISDKINSWSKDHLYNSWGFGVRVRKPD
FT                   MYLFRVQFAFHSWHGLSLILTIAPEFR"
FT   gene            121782..124214
FT                   /locus_tag="Fisuc_0115"
FT   CDS_pept        121782..124214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0115"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: mxa:MXAN_0440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73729"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ACX73729.1"
FT                   /translation="MMFSLFAKIIKKLAAYPKIILTVFLAVGILSIYPIMHLRWDLQLQ
FT                   DTITSAREPSNVQKIEDEFGGLGSLIVILQSEDSSANYQIAKNLAQKMQQSPAVHFADF
FT                   ETDIEFYKKNKFLYASENDIDIMVHRIEKLKHDYIMKNNPLFIDLKSAIDSITQTTSEQ
FT                   REQLLSDLEKKYFDKLAVSHSNKTGTIRIVEIYPTHSISDLQANRNLFYEVSNQLKNEK
FT                   TPSDFQVYFAGKVYESIQTGKRLLPEAKMVGCVTAGLILLLLILNFFRQPQLIFISALP
FT                   IATPIFTTMACSYMFYGRINLFTLLLAIVLPGQALQIINHVLNRYFLEREQNLSPQLCI
FT                   ESALLGIGPSTAVSSFAFATLFASLILIPLPGLQELGVLGSTGCILNWAITLLFSAALL
FT                   QVTQRKKPFSIRHSQIHPEYKISMLSNRLNWTIFSIIIAASLVGLYIGGTRIHIRNDFS
FT                   ATEINYKDATIDSLIAETGFMNKTPVIVMLPESAESENLLERFTELKNNGELSTVNSLF
FT                   TLAQFSPNLQQKKMEKLRQLHSLVTKEFREALSKSELENLEKVEQALEFDEADDFEPPE
FT                   YIAKKFRDKHGKQGRFAFIFTDIKENFGSECVKLHKELHQIEGIDNGKYLVAGIPITRA
FT                   IFLDRITNNISRPLQVGGILVFLFMLVYYNRFSRALFTALPSVFAASWFLAALNAFDVK
FT                   ISAYSALAFPILIGASVDGSLQFFSAYYEKQTGTALTILRDKFFTIFLSQMAAFIGTYG
FT                   MLVSSHPGLRSMGYVSLTGLICIFISQFTIFPLIAGSLDQYRLRQKRKKEAKDENAF"
FT   gene            124198..125388
FT                   /locus_tag="Fisuc_0116"
FT   CDS_pept        124198..125388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0116"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   atc:AGR_C_3991 aspartate aminotransferase A (transaminase
FT                   A) (ASPAT)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73730"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACX73730.1"
FT                   /translation="MKTLSDRTQNIAASLTVAIDTMAKQMIADGKDVVSLGAGEPDFGT
FT                   PTPIQDAAIDAIRAGKTRYTAPVGILDVRKAVAKKLEEENGLHYNASQIIMTSGAKHAV
FT                   FNALAALINPGDEVIIPAPYWVTYPELVKWLGGTPVFVEAGIEKNFKIDAEDLRKACTP
FT                   RTKAILLNNPCNPTGAVYSKRELEALAKEIVAQDIYCISDEVYEYFVYDTEFTSAAVFP
FT                   GMAERTIVINGFSKSHCMTGWRIGYDAAPAPIAKIIGKIQGQATHHPSNVAQYAALGAL
FT                   NMDKSNVHAMQAAFRKRRAYMLERTSFLSTKPRAPEGAFYLFAPVSDYYGKKTPDGKVI
FT                   AGSIDFCSALLESKGLAIVPGAAFGDDTCVRFSYAASDENLAKACDRFEAFVKELS"
FT   gene            125401..127464
FT                   /locus_tag="Fisuc_0117"
FT   CDS_pept        125401..127464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0117"
FT                   /product="FHA modulated ABC efflux pump with fused ATPase
FT                   and integral membrane subunits"
FT                   /note="PFAM: ABC transporter related; ABC-2 type
FT                   transporter; Forkhead-associated protein; SMART: AAA
FT                   ATPase; KEGG: abc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73731"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX73731.1"
FT                   /translation="MFPFRLVNPDPSKPFTIGRKSDNVLQFDNLMVSRYHAVLNFTDGK
FT                   WILQSLTQNSITMLNGKDVTTAVINDGDVILIGPRQLRATLRGADLTLLIMERETESDM
FT                   QTVTLSTEWREIEIPGIGKARASKNARENRAEIKFAKAIVDESGKRTRTITIASGDASR
FT                   FESAVVGFRNNDLLIEAQNSGFDVFAQNVNVFAGKKQLLKGIDFELPAGEILAIIGRSG
FT                   QGKSSLLKMIQGINSCDKQSIVRIGGVDYRKNEIRRRIAILPQDPPLRPELTVEETILD
FT                   GARSSMDVRNFKQDALARLEKFCELFGLSGRKHNLVKTLSGGEMRRVALARELMGNPGL
FT                   VILDEPLSGLDPYNSRILCTHLKQLAFLGHTIILTTHSYEALQIANKVLVLHQGEEAFF
FT                   GTVQAAYAHFNTNDPQALLTSITQSKAAEFHESYKHEQKVRDSKYYFERTKLPHNFAYT
FT                   VRITAKQWFRDKGRIAALFVQPAIIGFLLSQIFSDQSSLWTVAFAIILCANWFALSLSI
FT                   REIVQEKDILRDKFRRGVSAISTLTAKCTLPIIFTMMQTAIVYAFISTRITPHPQIALI
FT                   ACVFACIAVPATTVGLFTSTLAKNTSQANAFLPLLIIPQVALAGALVPLDQMQPIGRAL
FT                   SSVIWSRYNQASLLNILLERKDDIFNTIFAIAIALSFYIVTAILLHKLKKPR"
FT   gene            127461..128966
FT                   /locus_tag="Fisuc_0118"
FT   CDS_pept        127461..128966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0118"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: azo:azo3774 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73732"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACX73732.1"
FT                   /translation="MIRPEQPLNFPYPFNENYELLGTLGKGGMGYVYKALDKRLNREVA
FT                   FKILDSTSDVEAIKRFYLEAQAMKELDHQNIVHVFDFGQQGNQLFISMTYVQGISLAEI
FT                   LQNKSKLSFEAIEVIIKQIARGLLYAHSKGIVHRDVKPSNIMLTRDNRVYIMDFGISYI
FT                   QEMEKERLTRTGMTMGTPEYMSPEQCHGDEVTLQSDIYSMGVILYEMTCGRLPFEGSRP
FT                   VEIALKHVQEPPPAPELFREDIPDGLSALILKCLKKKLNERFHDMQEFLDECDQVFPQH
FT                   DTPYQNSSVGRKTGSHRSVPSIAEAAKRFGSNLTPHKLIIVAFSVLFPLIVILLMLLMF
FT                   THKPQNMLHEVEWSEVIANYETRAIEPEMKKGYPIENLTDGDLTTAWLNKMPLKPLNPV
FT                   LAMYFDQNTLITNIGIAVGYQKSVDDAFGDRFRIFKKPHTLTIETKDGFKQRIKLENIR
FT                   GMQYPNIQAVETTELRFYLEDVYEADNDDYAISEIRLLGMEVE"
FT   gene            129025..129441
FT                   /locus_tag="Fisuc_0119"
FT   CDS_pept        129025..129441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0119"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   gme:Gmet_2864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73733"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ACX73733.1"
FT                   /translation="MQKRIVQRSCNRAKGNFIETQAVAFLMREGYQVVTRNYAYHGGEL
FT                   DIVARDNGTLVFVEVKSVWNNQEGNPAARVNALKQKKIWQTACHFLATQKTIAPKGFDT
FT                   PCRFDVLSARAYQEPLQFAHIKNAFEGNQVIPNI"
FT   gene            129619..133422
FT                   /locus_tag="Fisuc_0120"
FT   CDS_pept        129619..133422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0120"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat;
FT                   KEGG: mxa:MXAN_1193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73734"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACX73734.1"
FT                   /translation="MNLKTVKISRSSLCASLFGLFFLVSCAGNNTPEVNPSPTPEISES
FT                   TDAYYDDESSTDYVTEEAPATVATGGTIETSGYTFTAPDNGWTIIGGEDNAPYEFYNPK
FT                   TGRRAVLVEVMLPEGEPLRLMDRAQIEMQSFESSGKKATLAETYPEEAFGTTGAFFDVA
FT                   GKRYDTPYEAVGLVIGAGNRIFTLTLAATDTQLPAGTLKQEWKDFYASFKLKEVVQEAV
FT                   SELSEERIMQYSSADLGYSWSTSDTLWHNWTGVARQNEDPDLVLSNKKEDISLFVYGAI
FT                   VPSDEVSQQDMFKVLLSRLGLSMNEPSFEVQRVKVGDRYAQEFTLTHVVNKFDFYYTGR
FT                   FYYDNGRGILIATWTQGINKKKYASVMKNAVNGLKVGAMPKMASDEEARKKQNKFNAAV
FT                   MSQVGILRLLEDQPFVALSYFERANKMDPEEPLYLINCGFVYQMKELYGPGISYFTSQI
FT                   DLVRKNGKLLSILGEMYEALFDYGHARECAEAALRYTPNNPEYVINLSDALWGLGQRHQ
FT                   SLIVVQRLYDTQPSSRLGVYLAKTYMGLDQYAEAVDILYAIRGRFGMSKELGETLMDAL
FT                   MFLGRYEEARAISDETLAKAKNDYKVWTMHGKILFYSRNYRDAEKALTKALALKPDNED
FT                   AKSFLSATKAYLGKADNRTLQKPITPVEDRTADLKTLLRPQAKQNAIEGDFPAVIHYQK
FT                   ESLKAEKNANWVRSEEMLLEVLDQRGAAIYREFTFDFLPGYDRIFLNALEVYDSNWKLK
FT                   QKATLNGAYITYATEIGGGNESQTAHFPLSELAPGDFIYMQFSRTNLENKGMIPYTNYE
FT                   SSRDVPVGESVFRIYADTTRFVTEEYGPLEKTAIKGGIEWKIENPVIVRKELYMPVYRD
FT                   FGAGLMLTGKQEWRDVGDDYQNLISHQFKKAVKVREQAFEVRGNKIGDEAVKAIINFVR
FT                   QDIRYRDVRFGGHSLIPQTAEVTLKEHRGDCKDMALLLKDMLDAIGVKSYLTAIHLTEE
FT                   GFSHLPTIQQFNHMILYIPKQGKISERWVDATDKTGNDRPVPLDMEGKVALVIDGDQSH
FT                   VVTTPILEDNQEHQIAIQHDLFIAEDGKCEFRDSVQLQGKFASAIRNKFFGRDVKDQEK
FT                   LLEQFLAAGVPDVSIGNIRIKNLDQFNKPLIIVNTYASKGYFGQGGSELKGRFPNVWER
FT                   SLFKLPKVAKRHHPIRMPHETQFSFKLNIKTASGHTVTLTEAKPLNRAPDYVSFEKQPK
FT                   SKTSSGIKWTTFALYADPTEYDKIREEWNYLLSETSPMITVK"
FT   gene            133564..134223
FT                   /locus_tag="Fisuc_0121"
FT   CDS_pept        133564..134223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0121"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: spe:Spro_3319
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73735"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACX73735.1"
FT                   /translation="MRALILSDIHGSALAARQALTFFEKFNCDKIFLLGDTLYHGPRNP
FT                   LPAGHGPMQVVEALAPYKDRIVAVRGNCDADVDLMMLDFPIENEYKVVKDCGLHLFMSH
FT                   GHIFMPECFPRDALNAIESTGAAQSSAQSTQPEAEVPQKPQIDVYLYGHTHIWKLEKNF
FT                   RNVLLVNPGSTSLPKGGNPPTFGFYESTPATANEHAHAKFSIHTLEDGMEIAAVSI"
FT   gene            134266..135513
FT                   /locus_tag="Fisuc_0122"
FT   CDS_pept        134266..135513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0122"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   tbd:Tbd_1045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73736"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACX73736.1"
FT                   /translation="MVLNVIWLVFFFGAFIACIVQWLAFGDTGIFNKAILGAFDMSKTA
FT                   FEIALGLTGILSLWLGILKIGEKAGAVQILAKIVQPLFSRLFPEIPKGHPVVGTMLMNI
FT                   SANMLGLDNAATPMGLKAMKQLQDLNPNDDKTVASDSQIMFLVLNASGLTLIPVSIMTY
FT                   RAQLGAANPSDVFLPLLLSTFFSTIAGIFALSFFQKIKLKDPVTVMWLGGISACVIAVM
FT                   FYFSHLTAEALGTTSLFISGLVLFGVIVAFLGLACYKKVQAYEAFVEGAKEGFNTAVMI
FT                   IPNLVAILVGVAVFRASGAMDLVMNGISALLGLIGVGNDVVPALPTALMKPLSGSGARG
FT                   MMIDAMKNLGPDSFAGRLSCMFQGAADTTFYIIAVYFGSVGVKKTRHAVTCALIADAVG
FT                   VIAAIVIAYIFFPPFH"
FT   gene            135654..137348
FT                   /locus_tag="Fisuc_0123"
FT   CDS_pept        135654..137348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0123"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: nam:NAMH_1316 sensory box/GGDEF family
FT                   protein; TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73737"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX73737.1"
FT                   /translation="MDYVIFSSVYKDFRDAILDNIPDMSAMSKRISAAIPPICNILNIG
FT                   FIKLKLIAPSSIIAKEGLNDEKIIYEDTNGYESMPLIQTYRTGENGMATIEIRAKKSHK
FT                   FSNPELQAVKLISDDMFIILGRSRLMSAIHYASQTDTMTGAPNTAKLVHHSIELKSKNK
FT                   LHNFSGLFLNLKNYKYINQSKSPAIGDKGIALFTHTIMAMCHDDEMIARLGGDNFFVLV
FT                   KKENRDQFVKNLSSIKVNVPTPQGQVIPLTIQSRIGVYDIQPQDTMNEIMHCSSVALNE
FT                   SRVHPGNDIVYFTRKMLEDVYHEKEISSIFREALRRKEFIVYYQPKVSVKEQKLCGCEA
FT                   LVRWNRNGQVIPPSEFLPILEKEASICLLDFYVFRKVCEDIRNWLDTGIEPVRVSSNFS
FT                   RHHLSNPHLTEDILDIMKEFNIDSKFIEIELTESSNFEDKIAMQKFVNGLRQHGISVSI
FT                   DDFGTGYSTFAAIKDLNVNVIKLDKSLLDHIGDEKYHDEVVIKNMVNMINELNLEVVAE
FT                   GVENSKQLDFLQNAKCSIIQGFLFDKPLTKEEFEKRLSKEVTYTNIS"
FT   gene            complement(137345..137788)
FT                   /locus_tag="Fisuc_0124"
FT   CDS_pept        complement(137345..137788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73738"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73738.1"
FT                   /translation="MSMFANAVACLLCLIFAAFLWKIKGMFRITLVMFFIVMTSCLYTA
FT                   FAGNLAIPTLENYPFRMVALTFCVFTTGLRDNRRRFMVLAQTFWLWVELLGIISLYQAG
FT                   EEAPWIRLAAIAEIALGCCFMARISREIEFGLIVLWMAIWMFF"
FT   gene            complement(137785..139044)
FT                   /locus_tag="Fisuc_0125"
FT   CDS_pept        complement(137785..139044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3874 NrfD family oxidoreductase
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73739"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73739.1"
FT                   /translation="MNSKVVTIVFIGLCLLLLLSVGGSFWDGSYDHLLHNSGSWKFPKT
FT                   LFIFWIGMSQAGVLLSAFLLVMKVKIHRRTSLLLELSSLCSLVVAVVLSFVYSRSIQMN
FT                   SDVHSDVYGIGIVGFMSLLFFVTHLVAADSAEDVSLCKELAKIRRPLAWIILPTVFWVI
FT                   SEFALDFARLENSVWQGAFFPLYVVSIVFYMGLASSIALLSFENYYNRLIERFVLLCSW
FT                   FISLLFLWVILVKGEGSYTAFAFACVVPQLLFIEAVRENLWGRLLVVAFILFGVLLKCD
FT                   FVVNLDEFHFFSNAVFANAGLMFACGALFVAIFFGVRFLLSRFFENDEILMGEESDSSD
FT                   GEVVETDVNKYYSPFSAPEFKVVRLPVLCGVLTAVAYGYFTSDWVNLAGPFGAYVSCLL
FT                   VCLQPFVHLGFSKKHRRVRK"
FT   gene            139093..139641
FT                   /locus_tag="Fisuc_0126"
FT   CDS_pept        139093..139641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0126"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   asu:Asuc_1994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73740"
FT                   /inference="protein motif:PFAM:PF02659"
FT                   /protein_id="ACX73740.1"
FT                   /translation="MTTLEIIIIAIVEAMDCFAVAISTGLCKSGIKRSRAVLQAISFGF
FT                   FQGGMTLLGYFLGSFAERWFNAVGTPIACAILCILGSRMIWGAIRGGEATASCAHLSLM
FT                   NILLLSVATSIDAFAVGISFAFLNANMVFATSAIAIASFVMGVLGFEIGRHASKRFKTK
FT                   IPEIIAGIILIAIGVKMFV"
FT   gene            139686..141833
FT                   /locus_tag="Fisuc_0127"
FT   CDS_pept        139686..141833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0127"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: maq:Maqu_1167 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM: NAD-dependent DNA
FT                   ligase adenylation; BRCT domain protein;
FT                   helix-hairpin-helix motif; zinc-finger NAD-dependent DNA
FT                   ligase C4-type; NAD-dependent DNA ligase OB-fold; SMART:
FT                   NAD-dependent DNA ligase ; BRCT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73741"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ACX73741.1"
FT                   /translation="MSEQKDIDRTRYFELKKQLEEASRLYYKDGVSPMSDQDFDFGLKE
FT                   MEALEAKYPELRGKGSLTQKVGSDLTNDFAKVAHAVPMLSIANVYSEEEMREFVKAAEE
FT                   GLSSFVSRLSSKKWICERKIDGVSLSVIYENGRLKQAATRGDGAQGDDVTLNALTIADI
FT                   PEYFDAKKLKIDPSEIPQGTFEVRGEVYMEREAFERLNEQFILENKKTFQNCRNTVSGS
FT                   LKLKSVAECKTRPMRFFAYHIPQSNNKTHEENLKQLKRLGFHTNDYWTADTVDEIMAIS
FT                   EKIGASRDSLPFDIDGMVVKLNDLQQQRELGSTSKSPRWAIAYKFKAERAYTPLLSVEF
FT                   QVGRTGAVTPVANLAPVRLAGTTVKRATLHNFDEVARLDLHYGDTVGVEKGGEIIPKIT
FT                   DVKRELRPAGASPVVAPEKCPVCGEQLTHIDGEVILRCENLHCKAQVQCLFEHFVSREA
FT                   MNIENLGPALIASLLATGKIKRIPDLYRLTLEDLESQERMAKKSAKNVFDAIQASKQRS
FT                   LENLLHGLGIRFVGRTSARNIAKHFRTLEKIRTATVEELQNVTDVGERIGKSVYEFFHT
FT                   PLYTNEIDELVALGLPTEFKGVVKTLFQGQTAVITGTLPNMDRDEARKLIEENGGKVSG
FT                   SVSKKTSWVLAGEAAGSKLTKANELGIPVHDEAWLMAQIANADESGDAPDENAGSSAGN
FT                   FANEKASVSATPAEDQMSLNL"
FT   gene            complement(141830..143941)
FT                   /locus_tag="Fisuc_0128"
FT   CDS_pept        complement(141830..143941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73742"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73742.1"
FT                   /translation="MKLNVLGIVLCLLALMGCSEVSKGVNIESEDNAPEYELNKLVGVA
FT                   SFISSEDYNSIDRGGTKYEVTLYELDSSASWTGREFTTYVTYPNVFKFENLKLQSSNVV
FT                   MCVRNKMSKSGYWSFADLSRVDSVYVNFMTNMEYNRILYLMKKGIPSDSAERTAQHEIM
FT                   EYMLSTSLDIKLSNQIEGNEKDAELQAVWQMLSRIPYTRLSSQLSSDTAVFWMLETDSA
FT                   KIDTFKTKYADMIEGNLWVKSIPKTDYLVTKLSGYVFGQTNGLGECSDKNDGEVKKVTN
FT                   PLSRYVERPYMCSKDTGWICPNGTFQELYGIEKGHDGEVIKANFTSFSYAYDSLQGKWV
FT                   SAHVEQGFACVSSRFGMVLVSETMGKSSYLVCKAEDNAPDYLHWAATGSEEDYIAYWSR
FT                   NLKCEIGIVQKLPNDSTVEVVCVDGIFRKATDIDKTGSVLELEKIANPCGEKEEVRRGK
FT                   TDSTLYFYCNNGEMGYSNEMEYTLGYGCNANHVGYHQYQNSIYYCNKFTWKYSTDSLVK
FT                   GVLVDSRDNSEYKTIGIGNQVWMAENLNYEVEPSWCYGDSLEYCEKYGRLYQWDGILGA
FT                   SAKVENVCPEGFHVPSNKEWDELNAFVNLWFHGNSYSARKVLLSSDPKEFDNIVHVGDD
FT                   LVGFTGIYAGHRTANGFFTGRLTSAYFCSADMNEEGSAYIYMLRQDEFDLTKYAQKTTS
FT                   NCNVRCVKD"
FT   gene            complement(143953..145221)
FT                   /locus_tag="Fisuc_0129"
FT   CDS_pept        complement(143953..145221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_3475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73743"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73743.1"
FT                   /translation="MIFSAKNKLIPIIVSVFGVNALLCSCSDDNLTSSNFPQIENSKET
FT                   THNIVGYVDRTRGYSMTEVVLREVDSTLSQTGVAYHGFVDDYSGHFSLENVKLTQPYVY
FT                   LEVNGNFYSNCYDANETEPMTNWKVLEAYADVRKGDSISVNLLTHMQAKRLKHYVDRGL
FT                   SFDSSMALLQKEISDLFLLDSLHEDFSKMNLSTLRDYNYYLLGVNVLNETYVWRSGGLD
FT                   DLLKEDVLTDSLFSTYWSYAYYFNHNSSCDKFDDFVPGFGYKTDAYKVKEYLNNIWQKK
FT                   YNLGNCSAENYHEIKATESNKTQFLYCDTLGWTLPRNGCYDLDMIVLNSSVGDTLPGHL
FT                   TKGTYCTDDYYKWGRMYDGSVGWTKASAAESGVGFACTKETLNRYGKSGRKCYRCEYSY
FT                   GYYLPDVDMSECDENLPKQEPLK"
FT   gene            145570..146889
FT                   /locus_tag="Fisuc_0130"
FT   CDS_pept        145570..146889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0130"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bur:Bcep18194_A3246
FT                   cobalamin synthesis protein/P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73744"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACX73744.1"
FT                   /translation="MKSVPITLLTGYLGAGKTTLLNYVLNNQQGYHVAVIVNDIGEVNI
FT                   DQTLIEKGGNITKEDSGKVVPLSNGCICCSLKTDLIEQIAELLEMGKFDYILIEASGIC
FT                   EPIPIAQTISFAGSQLRSKDGRPLPCHLDNIVAVVDVLRLADEFAGGEKLLEEDLEEED
FT                   IANLLIQQIEFCNTIIMNKVDALSKHDLEHVKAVVKALQPTAKMIETNYGKVDMKDILD
FT                   TKQFDFNKVAESSTWAIKLNEEGHDNDDDDDDDHDEHEHHHHDHDDDHDEHEHHHHDHD
FT                   EHEHHHDHDDEDHSHCDHEHGVCHCGHHHDKDHPHGDEYGISTFVFEDHRPLNREKFEA
FT                   FLDDYPTSIIRTKGLLWFSDERSESYLFEQAGKQASAQNFGRWFAAESKAEQQRILEEN
FT                   PQLQKIWDEKYGDRIIRLVFIGQHMDKKKIIQVMKDCLDD"
FT   gene            complement(146989..148437)
FT                   /locus_tag="Fisuc_0131"
FT   CDS_pept        complement(146989..148437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0131"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   pap:PSPA7_4351 RmuC domain-containing protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73745"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ACX73745.1"
FT                   /translation="MTIAVAIICAVLGIVIGVLFARNGNSQREAAARQANVEMEKEVAV
FT                   LRSQLATETVKNAELKENTEKQLEMVKADAEKRIADERAAAAKSLADEKEASAKRLESM
FT                   KLDMERVHQSSLNEQNARFTEMSQRLYAQAKNSTEEMLKQREKQISESGHATMEQLVSP
FT                   LKETIAKMEKTMNDTTRAQTEANSSLKEVLKQSIDANDKTKNAANELVRAFKHDSKIQG
FT                   DWGERVLEEVLESLGLEEGKHFDVQATLRDANGNVVRAEGNNAMLRPDVIVHLDPYKEV
FT                   VVDSKVSMAAFMDYMQAENPDERKVLLKKHIESLRKHVNELSVKDYSSYVKAPKKTMDF
FT                   VVMFVPRAAALWTALAEDHALWRDAFEKNVYIADEQSLYAMLRMVKMTWRQVQQAQNQQ
FT                   KVFELANEVLKRVGIFVKNMDEIGAALGKAQEAYNKGMAKLDDKGQSIVQSCRKLERLG
FT                   AKQDSKNPLPPDVDAIEMQEIEEM"
FT   gene            complement(148525..150837)
FT                   /locus_tag="Fisuc_0132"
FT   CDS_pept        complement(148525..150837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0132"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; SMART: Ankyrin; KEGG: ankyrin repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73746"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ACX73746.1"
FT                   /translation="MNKRPLHIIMRQLVNTYGNDIVCDHRLRGLLADELGESFYEYRSS
FT                   IVLAEQLGVGSSMLGFASNRSDLNLCIRKQKQFFAENSRLDRVMSDYVIDSYAYALGLV
FT                   KNVVVPTLEGTLVGLTQQITTLQRERDSTQQRARETAMYSQVALVKARRVRLWGLLFTL
FT                   IGAALLISVAYFVLYDNGYIPKDPKRKMEKLFSACAVGDAKYVADLLNNGVFVNSKDSV
FT                   GDAPLHYAVRIGSAELIDTLLHHGADERLTDNMGRTPLELALESGCSYYAKPFVQARPH
FT                   EWIQENYEHLKNYAKTQQSLLVLQDAYTKVEQIQNAIKAGNIAALDAKLAYRNGADLHY
FT                   TDEKGNTLLHYAAVNGNVPVLKHLIALGLDVNTPDNAGVLAEKLTKNAVNKKFLNHYRL
FT                   KNQLIFDAVKKGNIDLLKEVVGYGASVNDKDENGVPLIHYAVARNLTMFTELQKLGADI
FT                   HARNRLGETALFVAVKKNDLAIAQKLMSFGLSVYDKNSSAQTPMTFVHNKTSKYLFDYT
FT                   YRDSLFVAAVKHRNLDLAKSYLQLGANINYVSKYTGCAAIHYAVENNDVSSLKFLKSKG
FT                   ANMMLPYKSMAPVEKALMGQKKESLQFLLANDVGSANRVFANGKTLMHRALSMQNGAMW
FT                   MNVLLSQGAKVDAMDNAGETPLAYAIQRNRTDLVAFLIKKNANVNRVDAYGNRPLHIAA
FT                   RYANGRIVKMLVDAGADPSVENNEGDKPVNVAENVGNESAQDELDNYSFFGKARKSLKS
FT                   VKNAGAKLWDKVKDLAS"
FT   gene            complement(150838..151815)
FT                   /locus_tag="Fisuc_0133"
FT   CDS_pept        complement(150838..151815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73747"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73747.1"
FT                   /translation="MQNAETFAVSKVGAKHLPANIPCQDFSLEYNDGEIQLIVVCDGHG
FT                   SPSYVRSDVGARLAAGIAKDELMQFMQSEDARKFLGNRTGAVTARTDVGDSCWTEKSEE
FT                   KSETAKLREEQAMLYQQQIGNIQPQEKLIRDVCRRICEKWVAAIQQDAQENPLTDAEKE
FT                   LLGKNDLVKAYGSTLMAYVQTRWGWLAIHVGDGRLLCLNDSAEPYENWTPPVPWDSTCF
FT                   LNYTTSLCDKNPADSFRYAFDGTGHFPFAVFACSDGIEDSVGDYDVAPECLNRFYMRLL
FT                   QMYLDIGKEQAVARMDEGFSDMSLHGSKDDMSLAGIINKKGNEQ"
FT   gene            complement(151832..152602)
FT                   /locus_tag="Fisuc_0134"
FT   CDS_pept        complement(151832..152602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0134"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: dac:Daci_4203 von
FT                   Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73748"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACX73748.1"
FT                   /translation="MATKDPFALEPIPRRVTHLIFMVDTSGSMSGSKIASLNTAVRDAL
FT                   DDVGDISKNCGDSQIKIAVLEFSSAVNWMYEQPLEAEKFQWQDLSASGTTSFGSACAEL
FT                   DAKLSRSNGFMGEKTGCRAPAIVLLSDGAPTDGYVRKLEKLKGNRWFKAGVKVAIAIGD
FT                   DANNDVLREFTGSSESVITVHNVDQLKKMIHTVSVSATTVASQSASVGAAMVTQNQLVA
FT                   QSISNTVANDASLSGVDVGSSTANSGSNDWSGWN"
FT   gene            complement(152617..153903)
FT                   /locus_tag="Fisuc_0135"
FT   CDS_pept        complement(152617..153903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0135"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   hso:HS_0632 serine/threonine kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73749"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ACX73749.1"
FT                   /translation="MSELKKGDVVALAGGDTCQVVRELGRGGQGIVYAVNYNGSEYALK
FT                   WYTQKVSERFRENLKRNANRQTPNEHFIWPMAVAEDPNGGFGYLMKIRPAGYVDMSKFI
FT                   LVTARFADVNAQLNACMQLVKSFLDLHRDGYSYQDMNDGNFFINPKTGDVLICDNDNVA
FT                   PDGTDDLGILGKAGYMAPEIVEGKSRPRKVTDYHSLAVCLFILIYMNRPFEGRRYLSCP
FT                   CDNDPEMARQLLGYNAVFIMDPNDKSNAPDPSLHKNVMRRWDIYPKVLRDAFCKTFSKE
FT                   ALQNGDLRVKDKEWRDILLQVRADFVKCPKCGKFSFADPDSVDKKCAYCDKSFGDYRML
FT                   RVGKFKIPLMMEQKLHECLVHCSTDYDKVVGRTVVKNNEVGLCNNSGESWTVTCLDGTQ
FT                   RVVADGQGMPARKGYKIKFGNQGETAVIE"
FT   gene            154152..154892
FT                   /locus_tag="Fisuc_0136"
FT   CDS_pept        154152..154892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73750"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73750.1"
FT                   /translation="MMNTHTTANEVMNLIDLAQHTKNGKEGSDAINKLWDIFGDKVTGI
FT                   TIKKSFSHDSDHSMHGMSVYERRNQLQEQAFDTFRNAVLTYDASTNVPFMAYVSKKINW
FT                   QQLDFKRKNAKHTHNEKATDFSIEGGSSISMDDPKNAEMLETMNHIDLESPMAGRFVED
FT                   FEKQSYLDDMVHVLFGKLQNEKKLLEFATTYYEVCQEEDKDTDAEVAKRMGCTRSYASQ
FT                   LHKKLIAFLSNTDFADDCRMALAA"
FT   gene            155236..156681
FT                   /locus_tag="Fisuc_0137"
FT   CDS_pept        155236..156681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0137"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; KEGG: sde:Sde_0747 anthranilate
FT                   synthase, component I"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73751"
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /protein_id="ACX73751.1"
FT                   /translation="MTKITHITERPGYAPRTDSIYVALPGERYTPFSLAKKLGAKAIFE
FT                   SASFDHGRSRYSTLMVDEGFRLRQNDKNVSIVVDGKESEFLAEGDGDILDALLKISAEN
FT                   TVPPNQIPIPSSGVGYLGYEFCARCDTIRLAPQVDELNIPEAEFLVGHIYIVFDHFTEK
FT                   LHLFALNYEEHQIDLKAAIEKVKARLADLDFSYLAPEKQYSKGITMTDLEQSRKEYVEK
FT                   VAALQKHIVAGNIVQAVPSRRIQFASDIEALDIYRRLRTVNPSPYMFFLDYGTHQFIGA
FT                   SPESLIRVREGIATIHPIAGTRRRGKDDAEDEALMKNLKGDPKERAEHLMLVDLARNDL
FT                   GRVCDAGTVETTKYMECEKFSHVIHLVSDVQGRVSKNKKAIEVLRSSFPAGTVSGAPKI
FT                   SAIEILSGLEKIKRRFYAGAVGYIESDGDLDFCIAIRCCLKQGKTISLQAGGGIVAASN
FT                   ADREFEETNEKLGAIRAVLEGEN"
FT   gene            156683..158278
FT                   /locus_tag="Fisuc_0138"
FT   CDS_pept        156683..158278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0138"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   glutamine amidotransferase of anthranilate synthase; PFAM:
FT                   glycosyl transferase family 3; glutamine amidotransferase
FT                   class-I; Glycosyl transferase, family 3-like; KEGG:
FT                   hhe:HH0314 anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73752"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ACX73752.1"
FT                   /translation="MIIIIDNYDSFTYNVYQALAKITTEEIRVLRSRECTIADIEKLNP
FT                   SRLIVSPGPGRPEDAGISVEAIKHFAGKLPILGVCLGHQAIGYAFGAKIVQAKFIKHGI
FT                   AEEIDLDGKGLFRTIGKKNIFTRYHSLVIDESTLPGDFEVTARATDGDIMGIRHKTLPI
FT                   EGVQFHPESIASGRADEFFKAFLNYRREPLDIRGILNTLTAGKDLTRETAEMFMEDLTD
FT                   GIMDERQMAAILTALSSKGPVADEIAGCAKVLSSKKRKFPYSGDELTDIVGTGGDGKGS
FT                   FNVSSLSGLIAASCGAKIAKHGNRAVSSKSGAADFYTAAGFKLDMTPEKAASVIDKTNF
FT                   VFLMAPVYHSAMRFAGPVRGALGVKTIMNLLGPLTNPAEAKYLMLGVYSKSILEPFTKA
FT                   AKFLGAKRVMVAISDDGYDEISPCVPTTIAEILEDGEYREYRIDPKEFGVPAVDPEDLA
FT                   GGTGVDNFNLALDVLNGKGRPGIKYACALNAGAALYISNKAASIKEGFDKAIKAMEDGS
FT                   VLKKIEEVKVATNA"
FT   gene            complement(158399..159337)
FT                   /locus_tag="Fisuc_0139"
FT   CDS_pept        complement(158399..159337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ots:OTBS_0295 transposase and inactivated
FT                   derivative"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73753"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73753.1"
FT                   /translation="MNARKSFRDCIVKPGETSPYANLLVDLAFKKAFDPDKPTSRNNLI
FT                   NLLNDLLEPQLKRPIKNVWTRSVAKNLSGSKASRTAIFDLHCKDDLGSLIEIEVQIREV
FT                   DNFMKRLAFYASEMVANQAEPGQYWDYDIQPTYVIALTRFSVFPDERAVHRATVIDLES
FT                   GEQLVDTYNFTAIELSKVPFFIEKTSSDLSKWLFFFRYLNRLKELPEELDEGKFKNLTE
FT                   SAKVSNFNKKEFEVYRNMYHKVWDHNAMRRGIFKEFADDINAKIEERISDRNREFAKKM
FT                   IELGKLSDEEIAATTDLSLEDIVVLRSQLEA"
FT   gene            159791..164329
FT                   /locus_tag="Fisuc_0140"
FT   CDS_pept        159791..164329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0140"
FT                   /product="CRISPR-associated protein, Csn1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csn1 family;
FT                   KEGG: pla:Plav_0099 CRISPR-associated endonuclease Csn1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73754"
FT                   /inference="protein motif:TFAM:TIGR01865"
FT                   /protein_id="ACX73754.1"
FT                   /translation="MKKILGLDLGTNSIGWAVVNADEITRDDGSRYLKPNGISAAGSRI
FT                   IPMSADILGDFEKGNSISQTAERTRMRMARRLHERALLRRERLLRVLNLLDFLPKHFAD
FT                   KIDRYGKFTDDSEPKLAWRKNTEGKYEFIFQDAFNEMLAEFKDKQPEIVEEGKKIPYDW
FT                   TIYYLRKKALEKALSKEELSWILLQFNQKRGYYQLRGEEEEIPQDKKIEYLAQKVVKVE
FT                   ATDQKKGDDVWYNVYLENGMIYRRTSKAPLDWEGKVKEFIVTTEVENDGETPKKDKEGN
FT                   IKRSFRAPKEDDWTLLKKKTEADIENSHKTVGCYIYDSLLNNPKQKIIGKLVRTVERKF
FT                   YKEELTQILKKQVELIPELRDDNLYKQCIEELYPINEAHRNTIAKTDFANLFINDILFY
FT                   QRPLKSKKSQIDNCPYEERIFIDSKTGEKKKVPVKCIAKSNPLFQEFRLWQFIQNLRIY
FT                   QREKEIDGKLLTDIDITSECLKSEEDYVRLFDWLNDRETIEQEDLLKHLFNTKKSKNKE
FT                   NPYRWNYVEDKVYPCNETRATILKGFSKCGINASVLSPELEMALWHILYSVEDKKEIET
FT                   ALTHFAQKQGWNDDFAKVFSKAKPFKKDYGSYSEKAIKKLLSLMRMGKYWNQDNIDKNT
FT                   LDRIDKIINGEYDEKISNRVRDNAINLKDISDFRGLPVWLACYIVYDRHSEAKDCTKWN
FT                   SPEEIDSYLKKFKQHSLRNPIVEQVVTETLRTVRDIWIQEEQIDEIHLELGRDLKNPAD
FT                   KRKKMSENILKNENTNLRIKAMLMEFMNPSMGIENVRPYSPSQQDILRIYEENALDNLT
FT                   KDDKDFDFISKISKQAQPSKTDIIRYKCWLEQKYRSPYTGKTISLSKLFTPAYEIEHVI
FT                   PQSLYFDDSFSNKVICEAEVNKLKDRQLGYKFIAEHHGEKVQLSQGEVVEILSVDAYEK
FT                   FVKENYANNRIKMKKLLMESIPDEFIERQLNDSRYISKVVKGLLSNIVREKIDDENYEP
FT                   EAVSKNLISCNGAITDRLKKDWGMNDVWNSIILPRFIRMNQITGKDCFTTTNAEGHLIP
FT                   QMPLELQKGFNKKRIDHRHHAMDAIVIACTTRDHVNLLNNEAAHSKFNATRYQLQRKLR
FT                   RFEKAVIDGKEREVAKEFLKPWDSFSSDSKNILENIIVSFKQNQRVINKTTNAFLHFDE
FT                   NGKKTFIKQGKGDSWAIRKSMHKDTVFGEINLRKVRSVSLNEAIKVPERVLNKKIKEKI
FT                   LELKNNKIDAKNIKKYIEENHTGGYGIDSSKIDVFYFTKETKERFFATRKTLDTSFNQA
FT                   KIKDSIADSGIQKILLAHLKSKNGDAEQAFSPDGIDEMNKNIVELNNGKFHQPILKVRV
FT                   YEKADKFAVGQKGNKKVKFVEAAKGTNLFFAIFEKDGKRSYLTIPLNVMIDCQKQYGNQ
FT                   WKNNIEAYLKEKELVEKDVKLQFILSPNDLVYLPTEGSIDKKRIYKVVSFTNNRLYAIP
FT                   YAIAKSIVDKNEFTQLNKIEFTDNKESIKDACVPVIIDRLGNVIEFNGKRL"
FT   gene            164326..165222
FT                   /locus_tag="Fisuc_0141"
FT   CDS_pept        164326..165222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0141"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73755"
FT                   /inference="protein motif:TFAM:TIGR00287"
FT                   /protein_id="ACX73755.1"
FT                   /translation="MIKRTLYFGNQAYLSLKDNQLVIKKRNDEIVTAAIEDIAYIVLDS
FT                   PQITVTNALLGALLENNCAIINCDKTHLPSGLLLPLSGNTLQSERFQAQIDASLPLKKQ
FT                   LWQQTVQQKILNQAAVLHGSHDAEIGNMTAWANSVRSGDVDNREAVAAAYYWKEMFPDI
FT                   PDFVRDRNGVPPNNMLNYGYAILRGVVARALVSSGLLPTLGIHHHNRYNAYCLADDIME
FT                   PYRPIVDKLILEVINEIEEYPTDLSTEIKAKLLRIPVLDCVIDGNRSPLMNAVSTTTAS
FT                   LAKCYLGTTRKLLYPEV"
FT   gene            165224..165559
FT                   /locus_tag="Fisuc_0142"
FT   CDS_pept        165224..165559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0142"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   CRISPR associated protein Cas2; KEGG: pla:Plav_0097
FT                   CRISPR-associated Cas2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73756"
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /protein_id="ACX73756.1"
FT                   /translation="MDRFSEYRIMWILCFFDLPTETKIERQRHSEFRKNLLKDGFSRFQ
FT                   LSIYVRHCASVENAEVHIARVKSFMPPDGSVSILCITDKQFGKIQVFYGRKEKPKPKST
FT                   GQLELFL"
FT   repeat_region   165662..167961
FT                   /rpt_unit_range=165662..165710
FT                   /note="CRISPRS"
FT   gene            168481..169341
FT                   /locus_tag="Fisuc_0143"
FT   CDS_pept        168481..169341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0143"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: gsu:GSU1351 iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73757"
FT                   /inference="protein motif:PFAM:PF01077"
FT                   /protein_id="ACX73757.1"
FT                   /translation="MAVDYSTLKKGGWMRQKQKNNFSLRVRVVGGNLTATQLAKIAEVA
FT                   EKYGEGYAHLTSRQSVEIPFIKLENIDDVKNALAEGGVEPGVCGARVRTITACQGEAVC
FT                   PSGCIDTYAIAKELDDRYFARELPHKFKFGVTGCQNNCLKAEENDVGIKGAIKVDWLED
FT                   KCIGCGLCAKVCRKEAIKIENKKVIFDKEKCNYCGRCYKSCPTDAWSHIHGYIVSFGGL
FT                   FGNNINKGETIIPFVEDKQKLLDICDAAIQFFADNGKSGERFKYTIDRVGRDVFAKKIQ
FT                   DVYNG"
FT   gene            169385..171148
FT                   /locus_tag="Fisuc_0144"
FT   CDS_pept        169385..171148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0144"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; KEGG:
FT                   dma:DMR_29670 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73758"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACX73758.1"
FT                   /translation="MNIEKIKTDLLIIGGGTAGCYAAITASTLGAAKDVADIKILVVEK
FT                   ANIKRSGCLAAGVNALNAYITEGRTPKDYVEYAKKDADGIVREDLLYSISEKFNEVTAH
FT                   LEKLGLVILKDKDGKYVTRGNRNIKINGENIKPILAAAVAKAPNVQVLNHVNIFDFSVH
FT                   DNRIDGAFGFGIENDTFYAIEARAVIIATGGAAGLYRPNNPGFSRHKMWYPPFNTGAGY
FT                   AMGIRHGAEMTTFEMRFIALRCKDTIAPTGTLAQGVGAKQINSLGEVYETKYGISTSER
FT                   VYGTVAENLEGRGPCYLRTVGITPAQEDSLLKAYLNMAPSQTIRWLENETPSKANVEIE
FT                   GTEPYIVGGHTASGYWVDTKRATTIDGLYAAGDVAGGAPQKYVTGALAEGEIAAKSAVE
FT                   YINAVDCRTPLQGVRNDVDADPREDVDAKATIKEAEIARHVAEIETYLSQKNSLYTTEQ
FT                   LEEAMQIAMDEYAGGIKTGYGYSEKHLNIAKEKIDEIESLTDKLSAADLQEVMYIYELK
FT                   ERLTVCKSVIAHLKARHETRWHSFAENLDYPEKDNANFRKYVNSRLENGEIKIILRDLT
FT                   AEGQKNYEHQH"
FT   gene            171132..171446
FT                   /locus_tag="Fisuc_0145"
FT   CDS_pept        171132..171446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0145"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: pub:SAR11_0836 adenylyl-sulfate reductase
FT                   chain B"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73759"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACX73759.1"
FT                   /translation="MSISIDQSKCIGCRRCHDVCPGTLIKINEDKKAFIKYPKDCWGCT
FT                   SCIKECPVHAIQFFLGEDIGGKGSKVHTEKVNGLIRWIVEFPDGNVKSIDIDPKESNKY
FT                   "
FT   gene            171457..172356
FT                   /locus_tag="Fisuc_0146"
FT   CDS_pept        171457..172356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0146"
FT                   /product="sulfate adenylyltransferase, small subunit"
FT                   /note="TIGRFAM: sulfate adenylyltransferase, small subunit;
FT                   PFAM: phosphoadenosine phosphosulfate reductase; KEGG:
FT                   maq:Maqu_2734 sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73760"
FT                   /inference="protein motif:TFAM:TIGR02039"
FT                   /protein_id="ACX73760.1"
FT                   /translation="MSEFSHLDELEAEAIYIIREVAAECEKPVMLYSIGKDSSVMLHLA
FT                   IKAFYPEKPPFPFLHVNTTWKFREMIEFRDRTAQKLGIEMLEYINQDGVKQGINPFDHG
FT                   AAYTDIMKTQALKQALNKYGFTAAFGGGRRDEEKSRAKERIFSFRNSAHAWDPKNQRPE
FT                   MWKLYNTKINKGESIRVFPISNWTEKDIWQYIKRENIDIVPLYFAAPRPVVVRDGNIIM
FT                   VDDERFPLREGEKPEIKSVRFRTLGCYPLTGGIESTATTLDEIIDETLSAVSSERTSRV
FT                   IDNEAAGSMERRKREGYF"
FT   gene            172356..174041
FT                   /locus_tag="Fisuc_0147"
FT   CDS_pept        172356..174041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0147"
FT                   /product="sulfate adenylyltransferase, large subunit"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: sde:Sde_2143 sulfate adenylyltransferase
FT                   subunit 1; TIGRFAM: sulfate adenylyltransferase, large
FT                   subunit; small GTP-binding protein; PFAM: protein synthesis
FT                   factor GTP-binding; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73761"
FT                   /inference="protein motif:TFAM:TIGR02034"
FT                   /protein_id="ACX73761.1"
FT                   /translation="MKGLLKFITCGSVDDGKSTLIGHILYDSKLLYTDQEKALELDSKV
FT                   GSRSGKIDYSLLLDGLMAEREQGITIDVAYRYFTTDHRSFIVADTPGHEEYTRNMAVGA
FT                   SFADLAVILVDASQGVLVQTRRHARICRLMGIRHFVFAVNKMDLVGYSEDVFNKIKVQI
FT                   AELAQTHSLSNIQVIPLSATEGDNVTIKSKNIAWYQGPALLEYLENVDTSSSALEKGFY
FT                   MPVQRVSRPDRTFRGFQGQIESGTIRVGDVIKSLPSYEKASVKSILYTNRNVEEAHAGE
FT                   PVTITLDREVDVSRGCVLARDASIGSYKKIKASLLWMDDEPLSLGKDYLVKIGTKIIPG
FT                   TLTKIDYAIDVNTGAHLETESISKNGIAVCEIVFAEAIVVDLFEKHKTLGELILIDIVT
FT                   HATAACGVVEGLYEKQLQSNEKAAFVQGERHGRGEIFEEFFYDTATLSVVKQQPVKQHY
FT                   TVGDEIPTAGESYHYPDDFDIIILRDSIAVKVRGKRIAEITTAEEYHYGNVPVINGRGF
FT                   EIKVHSDEDVKQLLNEYEKAGIAGREEFFRKWASFNTYRKVVLH"
FT   gene            174263..175282
FT                   /locus_tag="Fisuc_0148"
FT   CDS_pept        174263..175282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73762"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73762.1"
FT                   /translation="MNQTISKILITTALVSSICSAAESANESTFKLTGNVQAQAIKSLY
FT                   DNDADNTLDNSFLRANIGAKYNSENLSAVINLRIFSPAFGNTIEGKNYDKISADTYYAN
FT                   YKWDTEYGKFNVQFGRFRTDWSVGGNFGTYVDVALNKRGFLARDYQHDAFAFGFEKGIS
FT                   TFNALLGTYDAKFNTGYIRFEETLKFGDAKVSAAYRVNALDVIQHTAQLTHRAAARASY
FT                   YFQKNFGLYGEVALIATGDGENLKAANAIKPEYAQDTQYIPFFVGVEIPTAGIFNNVYA
FT                   ELEYVSHRDELQAGADGIAWTVSFIKKINDYSKIQVNVYSEKKASDVALAARFTASLK"
FT   gene            175395..176414
FT                   /locus_tag="Fisuc_0149"
FT   CDS_pept        175395..176414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0149"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: mfa:Mfla_0620 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73763"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ACX73763.1"
FT                   /translation="MNFKKITIASIALLSIAFTACSSSDSKTESTKQTLTNVSYDPTRE
FT                   LYANYNQVFAKHWKEKTGKDVEITQSHGGSGKQALEVANGLEADVVTLALEYDVNAVRD
FT                   AGLIEDGWVKEFPLNSAPYTSTIVFLVRKGNPKNLKDWGDLVKDGIGVITPNPKTSGGA
FT                   RWNYLAAWAWAEKQYNGDEAKVKEFVKKLYKNVLVLASGARGSTTTFIENGQGDVLLAW
FT                   ENEAFLSLKDYPNDYEIVIPSVSILAEPSVAIVDKVVDKRGTRELATEYLNFLYSDEGQ
FT                   HIAAKNHYRPSNKAILDQYKEFDQNVNLIDISYFGGWDKAQKTHFSNGGIFDQIYEKK"
FT   gene            176570..177403
FT                   /locus_tag="Fisuc_0150"
FT   CDS_pept        176570..177403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0150"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit CysT; sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: abm:ABSDF0938 sulfate ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73764"
FT                   /inference="protein motif:TFAM:TIGR02139"
FT                   /protein_id="ACX73764.1"
FT                   /translation="MKRTNRSVIPGFGLTTGITLAILGVVVLIPLASLVVFTAQMSFDE
FT                   IIETITRDRVLSSFRVSFTTAFIASFINAVMGIILAWVLVKYTFPLKRLIDGMIELPFA
FT                   LPTAVAGIALTALTADTGLVGGFFAKFGIKIAFTQIGITVALVFIGIPFVVRAVQPVLE
FT                   KLDPAYEEAAGVLGASRGRIFWKVIFPEIVPAALTGFGLAFGRCLGEYGSVVFIAGNKP
FT                   FETEIAPLIIMSELQEYDYASATTIALVMLVASFVTLFLVNLIQTRNTKILKGGA"
FT   gene            177403..178224
FT                   /locus_tag="Fisuc_0151"
FT   CDS_pept        177403..178224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0151"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit CysW; sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mca:MCA1182 sulfate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73765"
FT                   /inference="protein motif:TFAM:TIGR02140"
FT                   /protein_id="ACX73765.1"
FT                   /translation="MYKETTSSKIVKWSLIGISIAFVVLMLLLPLITVIAEAFKQGFDI
FT                   YAKAVSDNYTIKAIWLTLEATLLAVIINTVFGLSAAWSLTKFHFKGKKILTTLIDLPVT
FT                   VSPIIAGLIFLLTFGRQSPIYPLLQSWDIKIVFAVPGIVLATIFVTFPFISRELIPVLE
FT                   ARGNDEEEAAALMGAKGWTIFRKITFPHIKWAFLYGVVLCAARAMGEFGAVSVISGHLR
FT                   GKTNTLPLHVEILFNEFQYVPAFAVSSILVMLAIAILIARSAIEYRGRKKI"
FT   gene            178236..179294
FT                   /locus_tag="Fisuc_0152"
FT   CDS_pept        178236..179294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0152"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: abb:ABBFA_000910 sulfate/thiosulfate import
FT                   ATP-binding protein CysA(sulfate-transporting ATPase);
FT                   TIGRFAM: sulfate ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73766"
FT                   /inference="protein motif:TFAM:TIGR00968"
FT                   /protein_id="ACX73766.1"
FT                   /translation="MYVELKNINKHFGNFKASDNVSFGIEKGKLIGLLGPSGSGKTTIL
FT                   RMIAGLENPDSGEIIIDGKVINNVPASKRGIGFVFQSYALFRYMTVFENIAFGLRVLKK
FT                   SENEIKERVAELVKLIGLEGLENRYPSQLSGGQRQRVAFARALAPNPQLLLLDEPFAAI
FT                   DAKVRQELRHWLKEMIAKLGVTSIFVTHDQDEAIEVADEIIITNKGRIDQIGKPLEVYS
FT                   KPKTAFVASFFGQPSIFKDYNKFHSFDTIPNVDQAIVRPEFVKVTKKNEVQKFKNSAEE
FT                   GVVTDVAFRGSGIEITVLVNGETLTARRSFDEPSISVGEKVDVFIYRLFVTVGNYAFLL
FT                   ENKSIREPIVVI"
FT   gene            179443..179718
FT                   /locus_tag="Fisuc_0153"
FT   CDS_pept        179443..179718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73767"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73767.1"
FT                   /translation="MKNFLVSTKDRIVKKLQSFSFRTGIIVLLLCIPFYILSFAQMTLP
FT                   ISAEAKGVLWVVLFGLAKTFQYSGLSILGVEGVKRLKNFFKKKSAA"
FT   gene            complement(179734..180297)
FT                   /locus_tag="Fisuc_0154"
FT   CDS_pept        complement(179734..180297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0154"
FT                   /product="metal dependent phophohydrolase"
FT                   /note="KEGG: gem:GM21_0703 metal dependent phophohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73768"
FT                   /inference="similar to AA sequence:KEGG:GM21_0703"
FT                   /protein_id="ACX73768.1"
FT                   /translation="MALSANITREGALELLKKYNKDPFHLEHGEIVENTMRYFARELGY
FT                   GEDEEFWGIVGLLHDLDFELWPEQHCIKERELMQEAGLSEELIHATTSHGWSITVDVKP
FT                   EHEMEKVLYAVDELTGLIGAVVLMRPSKSVQDLELKSVLKKYKSPKFAAGCSREVIERG
FT                   ANILGWELNDLISRTIAALKTFRP"
FT   gene            180624..181979
FT                   /locus_tag="Fisuc_0155"
FT   CDS_pept        180624..181979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0155"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: glo:Glov_0359
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73769"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ACX73769.1"
FT                   /translation="MTKNTSKKKIESAKNTANVTDPSKWNFATKCLQAGWKPKIGEPRV
FT                   LPIFQSTTYKYEDVDEVERLFALKQSGNKYTRTGNPTVAAFESKITELEGGVGAVATAS
FT                   GQAAVLLAISNLVKAGDHIVASKTIYGGSYTLLSVRLSKLGIETTFIDPEDSIAELRKA
FT                   FRPNTKLIFGETIGNPALGILDFEKFSKLAKEFDVPFLVDNTLATPFLVKPLKLGANVV
FT                   IHSATKYIDGHAVALGGVVIDGGNYNWENGKFPDLVEPDAQYANTSYTQKFGRAAFIAK
FT                   ARAQFLRDYGAALSPFNAFLLNLGLETLHLRMPQHSNNALALAEFLSKHPAVNWVSYPG
FT                   LKSSPYFKRIRKYFDYQGGSGVLTFGLKGGRAAIRSFVKALKVAALVVHVGDARTSVLH
FT                   PATSTHSQLSPKDRLAAGIPEDMIRVSVGIEDPRDIIADFEQAIAASTKGGK"
FT   gene            181979..182938
FT                   /locus_tag="Fisuc_0156"
FT   CDS_pept        181979..182938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73770"
FT                   /inference="similar to AA sequence:KEGG:An18g00710"
FT                   /protein_id="ACX73770.1"
FT                   /translation="MSIVVDVNKYLALNGATKRIKDYLSIEVADHAYLPKTEDIKSDWV
FT                   AYIAAPAFKLIREKLGHDIDSFVSIGTGSGIDVLTGIELLGAKRVGFTDLQRSVVAAAA
FT                   QNVRSNIKETSKIEFEFGNGDLLQPLQNGKRNYDVIYENLPNVPLASNTKIEDKRNSGH
FT                   YLEKREEAIPEFVHEQMLDLHYLALKQARDYLAENGAVYSTLGGRVPLNAFIKLGELAG
FT                   LRSEIFTYSWKVQAEPEDVISGYAAQEKAGLGPFRFYRAEDLQKAFANISVKDSGKRAF
FT                   EIEKTLDSVKLTATAAYEAFKKGEVIGHTVAVLKSSLK"
FT   gene            182946..183548
FT                   /locus_tag="Fisuc_0157"
FT   CDS_pept        182946..183548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0157"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   eca:ECA3961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73771"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACX73771.1"
FT                   /translation="MKNVIQNLIEESQKFLFKRAKIDDKIGLEAANFAVRDIPKPIGKF
FT                   EKSDSPLIRYIGEAIKHGNPETADLLKALEPALPYLPWKYNYEPRPDMPDLADQMGWGE
FT                   ILGPEAPYHDEHFCFGFTLLGKNTFYPSHLHPATELYVILSGHAIWTLDGISKVRSPGE
FT                   FVLHPSNHIHSMQTEHEPMLALYTWSGKDVKTLSKYV"
FT   gene            183672..184223
FT                   /locus_tag="Fisuc_0158"
FT   CDS_pept        183672..184223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_0992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73772"
FT                   /inference="similar to AA sequence:KEGG:CCV52592_0992"
FT                   /protein_id="ACX73772.1"
FT                   /translation="MYSTHYMDLLMQNSPWNLILFMAIPVILAETIAITELFLLKSPNA
FT                   HPTLSKVNRTAGILAGFAFFGIIIYFIPNVIIPLASAGEFRTWIDVVAIFSYILAGIPM
FT                   ILLALLNLKLLFRKVVEQKKTTYAILLLAAFLVLSHIAMIFGMVDPGIAGYKPKAKAVS
FT                   EVQPPAHHMDSMHEGHHYHH"
FT   gene            184343..185332
FT                   /locus_tag="Fisuc_0159"
FT   CDS_pept        184343..185332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0159"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: lip:LI0420 biotin synthase; PFAM: Radical SAM
FT                   domain protein; biotin and thiamin synthesis associated;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73773"
FT                   /inference="protein motif:PRIAM:2.8.1.6"
FT                   /protein_id="ACX73773.1"
FT                   /translation="MTITDYLTKDWDESKTLTREECLQILNFPDNQLDLLIEAAFKLRT
FT                   KYKGNRVNIQLLTNVRSGNCTQNCAYCAQSRDSQAPIEKYKSVSDDKLYGDNNLVDEFH
FT                   LSRHCIGLSGMGFTDKEIEELAERIAHMKKSGTHICCSIGFLTEHQARILKAAGLDRIN
FT                   HNLNTSRRFYPEICSTHTYERRIQNIRMLQSIGFEICCGGIIGMGESKEDVVDMLFDLV
FT                   AIHPESVPINFLLPVKGTRLANRDISGLTFEYGIKILCLARLLLPKSDIRCAAGREIYF
FT                   KGHEKELFKVADSIFASGYLTEGGQSLEATFRQIENAGFTWAIESKDE"
FT   gene            185445..185948
FT                   /locus_tag="Fisuc_0160"
FT   CDS_pept        185445..185948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eum:ECUMN_2903 neutral amino-acid efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73774"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73774.1"
FT                   /translation="MGSGKSVAIKQWYGLFTGYTIVSLVSVFIVYFISSAFENFIRVFA
FT                   FVGAIYIAYLAISLLIQAFKPLEEIRNSRTTGSFSTGLFVQLTNVKIMVFCLTAITTYI
FT                   LPYHQDFPHLLLFGILLPLTGPICNLAWLFTGVLLQGLFKKHHRIFYTLMGLSLLYCAI
FT                   GIVK"
FT   gene            186035..187060
FT                   /locus_tag="Fisuc_0161"
FT   CDS_pept        186035..187060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0161"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: mfa:Mfla_0620 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73775"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ACX73775.1"
FT                   /translation="MNLHFFKTVFAVALVAGAGCFFGCSSEKAPEVENNTLVNVSYDPT
FT                   REFYSNYNHIFMKHWKEATGKDVKITQFHGGSGKQALEVVNGLEADVVTLALEYDVNIV
FT                   RDAGLIENGWVKEFPRNSAPYTSTIVFLVRKGNPKKISDWNDLVKDGIGIITPDPKTSG
FT                   GARWNYLAAWAYAEKQFNGDEEQVKGFMKKLYQNVLDLASGARGSTNTFIEERKGDVLL
FT                   SWENEAFLSLKDYPKDYEIVMPSVSVLAEPSVAIVDKIVDKRNTRKLATEYLNYLYSDE
FT                   AQHVAARHHYRPTNKAILDEYKEFDQNVNLITIEHFGGWENAQKTHFSEYGIFDQIYEK
FT                   N"
FT   gene            187267..188496
FT                   /locus_tag="Fisuc_0162"
FT   CDS_pept        187267..188496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0162"
FT                   /product="O-acetylhomoserine aminocarboxypropyltransferase"
FT                   /EC_number="2.5.1.49"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: gbm:Gbem_1982
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73776"
FT                   /inference="protein motif:PRIAM:2.5.1.49"
FT                   /protein_id="ACX73776.1"
FT                   /translation="MDFNTTLLHHNFESERSTGSTLTPIYQVSAFSQESAEKLEAVFNN
FT                   RAPGFAYTRIGNPTTDSFERRIASLEKGIGAIACSSGMAAVTMSLLNILQSGDEVIAST
FT                   ALFGGTIDLFHDLEAFGIKTRYVTEVTAESVRSQLSDKTKAVFTELIGNPKLNVVDIQS
FT                   VADVAHEAGVPLIVDSTTATPYLVHPFDFGADIVVHSSSKYINGNGSAISGIIVDSGKF
FT                   KWDYTKYKGLEEYKRFSKFAYLAKLRNGVWRNIGCCLAPATAFLNSLGLETLGLRMERL
FT                   CDNALQLAEFLQGFEGIKVNYPALKGNPYYDLVQKQFNGKGGAIISIDAGSKEKAFKLI
FT                   NNLKYATIATNIGDLRTLVIHPDSTIFTHSTKLQKENAGVFEGSIRISVGIEDIADLKE
FT                   DFEQAIKQIS"
FT   gene            188627..188875
FT                   /locus_tag="Fisuc_0163"
FT   CDS_pept        188627..188875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0163"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: gur:Gura_3940 redox
FT                   protein regulator of disulfide bond formation-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73777"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACX73777.1"
FT                   /translation="MSEEIKVDDTVDVTDVKCPTTFVKAKVAIEELDEGQILAIRLNDG
FT                   EPVQNVPRSLKEEGHEILKLNDNQDGTFTLFVKKVGD"
FT   gene            188948..189154
FT                   /locus_tag="Fisuc_0164"
FT   CDS_pept        188948..189154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0164"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: gur:Gura_3944 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73778"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ACX73778.1"
FT                   /translation="MIITVVGNKKEVKDGLTVAELIEQEKVETPQYVTVSVNDEFVENG
FT                   NFATTALKDGDNVEFLYFMGGGQ"
FT   gene            189154..189963
FT                   /locus_tag="Fisuc_0165"
FT   CDS_pept        189154..189963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0165"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: gme:Gmet_1568 UBA/ThiF-type
FT                   NAD/FAD binding fold:MoeZ/MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73779"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACX73779.1"
FT                   /translation="MAFTNEQLERYSRHIILKEVGAKGQKKLLNAKVLVIGAGGLGAPV
FT                   AMYLAAAGVGTIGIADADVVDLSNLQRQIIHATKDVGKPKVQSAKETMEAMNPDVKVIT
FT                   YHTFVTSENIMDLIKDYDFIIDGTDNFPAKFLINDACVMAKKPFSHAGIIRFQGQLMTY
FT                   VPGQGPCYRCVFKEPPPKDAVPTCKQAGVIGAMGGVIGSLQAMEAIKYILGVGNLLTGY
FT                   LLTYNALTMEFRKIKLPTHTKDCAVCGDHPTIDHLIDYEQAVCEMKH"
FT   gene            189973..190383
FT                   /locus_tag="Fisuc_0166"
FT   CDS_pept        189973..190383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0166"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="PFAM: Mov34/MPN/PAD-1 family protein; SMART:
FT                   Mov34/MPN/PAD-1 family protein; KEGG: gur:Gura_3942
FT                   Mov34/MPN/PAD-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73780"
FT                   /inference="protein motif:PFAM:PF01398"
FT                   /protein_id="ACX73780.1"
FT                   /translation="MITISKDDYQKILEHAQKNLPEEACGLIAGKIEGNDKHIEKVYLL
FT                   TNIDHSNEHFSLDPKEHLAAIKDMRQNGLSPLGNWHSHPESPSRPSQEDKRLAFDSKAS
FT                   YLILSLMDRENPVLNSFHIEGDNATNEGLVIG"
FT   gene            190463..190843
FT                   /locus_tag="Fisuc_0167"
FT   CDS_pept        190463..190843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0167"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="PFAM: Mov34/MPN/PAD-1 family protein; SMART:
FT                   Mov34/MPN/PAD-1 family protein; KEGG: kpe:KPK_1753
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73781"
FT                   /inference="protein motif:PFAM:PF01398"
FT                   /protein_id="ACX73781.1"
FT                   /translation="MMAKYSKNIYEQMVLAAKKAYPNECCGILVGKKSEQSEIEVTEIR
FT                   EAENQFQGQKAVHFKIDPLYLYHLEQELDPRGLEIVGIYHSHPDCPAILSKEDEKYMVP
FT                   GLEYVIMSVQNGEVVDVKSYRK"
FT   gene            191055..191282
FT                   /locus_tag="Fisuc_0168"
FT   CDS_pept        191055..191282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73782"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73782.1"
FT                   /translation="MTYSEIEEKIRKVPEEYLAIIDAFIDGLMIQHQMKKKPSDELTAA
FT                   IKESEAMLNDPNAKKFDSVDALFADLDAEE"
FT   gene            191283..191558
FT                   /locus_tag="Fisuc_0169"
FT   CDS_pept        191283..191558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0169"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: pmr:PMI3308
FT                   plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73783"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ACX73783.1"
FT                   /translation="MAYQIEYTSRFKKEYKLAKKRGRDINLLRTVIEILAKGEPLPEKY
FT                   KDHPLVSNWSGYRECHIQSDWLLIYKYKDNELILSLTATGSHSDLF"
FT   gene            191768..193246
FT                   /locus_tag="Fisuc_0170"
FT   CDS_pept        191768..193246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0170"
FT                   /product="thiazole biosynthesis adenylyltransferase ThiF"
FT                   /note="KEGG: kpe:KPK_1755 putative thiazole biosynthesis
FT                   adenylyltransferase ThiF/rhodanese domain protein; TIGRFAM:
FT                   thiazole biosynthesis adenylyltransferase ThiF; PFAM:
FT                   UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB domain
FT                   protein; thiamineS protein; Rhodanese domain protein;
FT                   SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73784"
FT                   /inference="protein motif:TFAM:TIGR02356"
FT                   /protein_id="ACX73784.1"
FT                   /translation="MRIYISATLRNFFGKNAQVSVPENTVRKALANLISTYPEGEKVLF
FT                   DENNKLRSFIKIYLNGKNLNVDTLWDATLEDDSEILLLPAIAGGAPIEESQSKHVESLI
FT                   SDERRKEVAFDDSEIERFGKHLMLKDIGVKGQKRIKAAKVVVIGVGALGSPVIQYLAAA
FT                   GVGTIKAIDFDEVSLENLQSQVLHGTRDVKRPKVASAKDKVKNINKNIVFEAVKEQLDA
FT                   SNIEAEIEGYDLVIDCTDNYKARYLINDACALHGIPLVFGAIYQFEGQVGIFNLDGGPC
FT                   LRCQYPSPPPAGLIPSCAEGGAISPLPGIIGSIQANEALKLILGIGEHLNGKILHVDSL
FT                   YLSSRIFKVERDCHCPICGNNPTITNVEDIDYEDLCGLKTTNETPVEGFTPEELAKRID
FT                   NGDDITIVDVREPHERAILRFPNAIVIPIGQLVRRQKELDPNKDTIFICKQGKRSELAI
FT                   NTLREAGYTGPLYNLKGGIDAMKDIMFSHEGAWL"
FT   gene            193402..194364
FT                   /locus_tag="Fisuc_0171"
FT   CDS_pept        193402..194364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpe:KPK_1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73785"
FT                   /inference="similar to AA sequence:KEGG:KPK_1756"
FT                   /protein_id="ACX73785.1"
FT                   /translation="MANEAEKNTGINALGAKAAYNLANVTKTKPQFGALTPKWLTKFLE
FT                   FKGLETGLFRVNKVVEGQTPLDVLCSATKKSDIIPEGYVEYETEPREYKLNSISTIINV
FT                   NTAIEDVYSSPYDQVQEQLGLAIESLRERQESQLINNDDYGLLKNIADSQRIQPLRADG
FT                   RPTPDDLDELISKVWKEPSFFLAHPRAIAAFARECTRRGVPPVVVDLAGSRFLTWRGIP
FT                   LVPTDKLLVDGVKNPKSQGGKTNILLVRTGEAKRGVIGLFQAGLKNEHSRGLSVRFRGI
FT                   DNKGVASYLLSLYCSAAILADDAIAVLEDVEVGEYYDYE"
FT   gene            194351..196093
FT                   /locus_tag="Fisuc_0172"
FT   CDS_pept        194351..196093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0172"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   kpe:KPK_1757 cysteine desulfurase, SufS family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73786"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ACX73786.1"
FT                   /translation="MTTNNPETRSLEELAGVPNAAELEQLANAYFPDLTDSAYAATPAA
FT                   PEAQNASAAQGVSAAQGAAAISQTPAFDWEHPFATYGDQPTSSAPFAYGGSSTDTWLNT
FT                   VEAPAVPESQFASQLSDIPTAPAPAQGYSPKVVSKTQAAEASRQIDAPTSLGGDSVKTG
FT                   SANSGANSRNDSIRIGSKTLAQIRSDFPILSKQINGHPLVWLDNGATTQRPQVVIDRLK
FT                   YYYENENSNVHRGAHTLAAASTDAYENARNIVRDFIGAPSSQEVVFVRGTTEAINLVAN
FT                   AYVKPTLQPGDEIIVSILEHHANIVPWQLIAEETGAIIKVIPCDSTGQLKLHDYEALFT
FT                   KRTKFVSVTHVSNVLGTVTPIEELIAIAHRHGVRILIDGAQSIAHIPVNVAALDADFFV
FT                   FSGHKVFAPTGIGVVYGKKELLEAARPYHGGGNMIADVTFERTIYNGIPNKFEAGTGSI
FT                   ADAVGLGAALQYLTEIGMPCVFRWEHELLQYGLKELKTVKGIHLVGTALNKASALAFKL
FT                   DGYSDEEVGKRLDAYGVAVRTGHHCAQPVLRHFGYESTVRPTLALYNSPDDIDALVRAL
FT                   KTFA"
FT   gene            196242..197204
FT                   /locus_tag="Fisuc_0173"
FT   CDS_pept        196242..197204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0173"
FT                   /product="Serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: dal:Dalk_2650 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73787"
FT                   /inference="protein motif:PRIAM:2.3.1.30"
FT                   /protein_id="ACX73787.1"
FT                   /translation="MHELIQESEVEKAVQIIFDDYNRGKHIDNIDIYNRPDQAEIQTIL
FT                   QNLIRVVYPGHFRDRSHKIYNPKNSFAVLIEDTFYHLHKQVAIALDYCKLRGSMTSDER
FT                   KIESYRICKEFFAKIPQIREFLETDLHAAFDGDPAAGCLDEIILAYPGLMATTIYRIAH
FT                   ELYLLHVPVLPRLMTEYAHSKTGIDIHPGATIGKYFFIDHGTGIVIGETAVIGKNVKIY
FT                   QGVTLGALSTRGGQKLSGKKRHPTIQDNVTIYAGASILGGDTVVGENAIIGGNAFITRS
FT                   IEANTRVSLKNLEMDYVSTTNSKHKTEELQQSDEWYYII"
FT   gene            complement(197321..199090)
FT                   /locus_tag="Fisuc_0174"
FT   CDS_pept        complement(197321..199090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0174"
FT                   /product="Pectate lyase/Amb allergen"
FT                   /note="PFAM: Pectate lyase/Amb allergen; SMART: Pectate
FT                   lyase/Amb allergen; KEGG: scl:sce6839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73788"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /protein_id="ACX73788.1"
FT                   /translation="MNYLLSKTMRVAATFAALAVTTAAVPAFAVTSPDFPMAGFATQNG
FT                   GTTGGKGYSEVTVDNVNDLKSYAKAGNKIIYVKPGTYMGPVEVGSNVTIYGYQGAIIAQ
FT                   PASGSAMKLSGSKNVIIRNLKFKGVGAHDDDDEDCLQVNHESKNVWIDHVDVYDGHDGN
FT                   LDITNASDYVTISWTKFSYTSASTGHQFSNLIGNSKTKTSDRGHLNVTIHHTWWADGVV
FT                   ERMPRVRFGKVHVANNLFDSKNASYCVRAAVEADIRIERNVFIGVQKALDLYTSDGTIT
FT                   AAQMIENYEENVKKPQAGTGTAFKPSYSMSLTDVSTQAKAYALRDSIKLYAGATLPDPG
FT                   KSQTVTPASSSSEVQSSSSVAVSSSSVAKSSSSVAQSSSSQAVSSSSQGEAVSGTATLT
FT                   KHGSGSAKQEVKQGESIEEFYFTVAGATGATVTGLPEGVSGTMKGSDFYISGTVAQNAA
FT                   VGAYNFTVTTTGATTNATKNGTITVVGANGAVAESSSSSVESSSSKVDSSSSSEQGTTS
FT                   LDVATVASHFNVSVNGRVLTVQGATQTAYLLDAQGRLITKVQSLGRESLITVPRAGMYL
FT                   LRVGNEARRITVR"
FT   gene            complement(199284..201149)
FT                   /locus_tag="Fisuc_0175"
FT   CDS_pept        complement(199284..201149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_4101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73789"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73789.1"
FT                   /translation="MKTLKLSNIVWCAALTLCACGDSSVDSTGVVAPNAAESDSAGETT
FT                   EVSNPEISSDNQGSTAENQSSVSTEQSSSTEEVIIEQVASDPVMVSEISGDPVITFTNA
FT                   SVSVSNDNGCIAQNEKTITISCQGNYQLTGSSNDNQIIVNAGSTDNVYLYLNGLQLASA
FT                   SDAPIYVQNANKVFLLLVDGTKNTLEDASTRTKAYTKSNGSSDTTNATIYAKDDLTIKG
FT                   SGALTVTGNYNNGIHCSNDLRIRDLPEITVKAKNHAIKGKGSVNIEGGYFELTATNGDG
FT                   IKSDEGDDEGVVTEEKGIVIITGGEFNINAGDDGIQAYNYILIADSTSTPLITVNSKGK
FT                   GIATDNRLYVNGGVTSVTSGDDGLHSNMNIYFNGGRTTISAGDDGIHADSTLRISDGSI
FT                   NITKAVEGIEAFYIRAEGGKTATVASDDAWNAAGGSADANSTSGSQWGGRGGPTGMMSG
FT                   SKGYIIISGGYHYLYAAGNDIDVLDANGTATMSGGVLLLEIGSSGRSSAMFASGNQGGN
FT                   QGGSWGGSSSCSTNTAGGLIDTDNGFSINGGVLLGFGSQTEEYPYCTATSYTAGTAYGS
FT                   SKAAFKPSSSGSMIIYGGEVSSVSQVDVSGMTEVTLPNGMTYYEK"
FT   gene            201353..202912
FT                   /locus_tag="Fisuc_0176"
FT   CDS_pept        201353..202912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0176"
FT                   /product="Indole-3-glycerol-phosphate synthase.,
FT                   Phosphoribosylanthranilate isomerase"
FT                   /EC_number="4.1.1.48"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase;
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI); KEGG:
FT                   hhe:HH0002 phosphoribosylanthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73790"
FT                   /inference="protein motif:PRIAM:4.1.1.48, 5.3.1.24"
FT                   /protein_id="ACX73790.1"
FT                   /translation="MSEDILQKIVRMRREDIDRLGLNFNIDIPEARRVGHTEFLGNAGA
FT                   ILEVKRASPSKGDIAPNLNPVELATTYAEAHAQAVSVLTEMNFFKGSLRDLIAVADLME
FT                   RRRQQGLHTCAVLRKDFLLFEDEIDIAYRCGADAVLLIARILDDAQLVKMAQRAQKFGI
FT                   QAFVEVREADDFRKLAVVTAALGDAAAKTIVAGVNSRDLATFHTDPLIPASVRSKLPAK
FT                   AVFESGILSAADATYARNLGFTGILVGEAVAKNPPLAKDVVSAFESGCENARGLFWKKF
FT                   AERKFANNETRAASSQDARRPLVKICGITREEDGLLAAELGADMLGFVFSTTKRLTTEE
FT                   FVRSFKTRLLRSACNDVAPLLVGVITDPNSVEGKTAIKLAQEGVLDAVQFHGVNPHNSD
FT                   ALAESCSAALPYYCAARVGAPEDFDYIASLRKNGEPRILLDAKVEGIPGGTGKTIPESL
FT                   LREKANGAPLWLAGGITPENVATICEKFHPELIDISSGIEDAPGIKNHDKMKALFAEFA
FT                   AK"
FT   gene            203161..204429
FT                   /locus_tag="Fisuc_0177"
FT   CDS_pept        203161..204429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0177"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: phosphoesterase RecJ domain protein; KEGG:
FT                   swd:Swoo_2464 putative manganese-dependent inorganic
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73791"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACX73791.1"
FT                   /translation="MCRKPIFLHFHFAAPLQPQKKIKIYKIPQKAKKAIFCGMNKQTLF
FT                   NNIFSICLSSALFCACGDSTSSDSNNEGEEFKNTINALDWGSDTTFVIGHKTPDVDAVT
FT                   SAMSYAALMRALGHNAVAKIISPINRETAYIAEKFGFKVPEEMKSVEAGTRLILTDHAE
FT                   SAQSVEGVKEAKILQIIDHHIPGDLDEKVTSDTYVNRQIIGSTCTIIWDLYKKADVKID
FT                   NDMAKILLAGILSDTRNLTKVASSALDSSAWKSLIEQLKISPDSVAKLSREMDDASHDY
FT                   YGMTDKEIFLSDYKDYEIEGVKIGIASNDWYVDSTKSDFFKRLAAVMPEIAKEKKRDIL
FT                   FAKVDGHDPNPDPETAAETPFIESGSYTIIYASDDYEATAKEIAESAFGELFSEGVYFS
FT                   AEKISRKSLMVPKITEYLEGKKK"
FT   gene            complement(204566..205417)
FT                   /locus_tag="Fisuc_0178"
FT   CDS_pept        complement(204566..205417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73792"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73792.1"
FT                   /translation="MKSKQVKWTSLVGVFALVGMSLLSACGDDSASPLAPQVSEKESSS
FT                   SMQKSSSSVQRTSVKTTFELGKCSYDNESEKIFVSDEGEFYTCSYKNGDYTWVKPNNVK
FT                   SSNSVAKVSSSSVLDEKIYYSSSSVRSEYNAERETFLYKEFFVEIDLTLFKQVSDNWEK
FT                   QNSHKENYTDGDPRISFVIKTYSDDSLIDSVKTNVFNPGDNVGKWTGHEYFTKKFSGGV
FT                   NVIYVCPVVYEYNVIESNVLHSSNYCYIIHDAGDKVDVPILQSDSKATDLKLEWAVTIS
FT                   YK"
FT   gene            206011..207288
FT                   /locus_tag="Fisuc_0179"
FT   CDS_pept        206011..207288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0179"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: hhe:HH1415 tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73793"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ACX73793.1"
FT                   /translation="MTSTTSNNGFFDKFGGKYVAEIIRRPLDDLEAAFNKYIHDPEFLE
FT                   ELRIIQRDYIGRETPLYFAPTATKLLGGAQIYIKLEGLANTGAHKINNAIGQCLLAKKM
FT                   GKTRIIAETGAGQHGLATAAACAKLGLECVVYMGEVDVRRQQPNVATMEMYGAKVVPVT
FT                   SGSRTLKDAVNEAMRDWATNFQNTHYVLGSALGPAPFPDIVRTFQSIIGEEVKRQAAER
FT                   NIDIAAVVACVGGGSNSIGVFTPFIEDKNVRLIGAEAGGVGPNVGENAARMTGNASREG
FT                   IVQGYKSRFLIDEDGQSMPTRSISAGLDYMGIGPQLAALGESGRVEFTAILDKEALEAV
FT                   KFFARNEGILFALESAHAGAAAMKIAKELPKDKALVINMSGRGDKDIFITSPVFRPEKW
FT                   KEFLKAELVRLENNEDIHDAEIMTRK"
FT   gene            207294..208046
FT                   /locus_tag="Fisuc_0180"
FT   CDS_pept        207294..208046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0180"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain; KEGG: hhe:HH1414
FT                   tryptophan synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73794"
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /protein_id="ACX73794.1"
FT                   /translation="MNLMSHLIAGFPDAETSIAIADALVKGGANILEIQLAFSDPSADG
FT                   PAIQTASTIALEKGYSTKQGLAIVKQIHERHPETPIYIMTYGSLAFTPGVENFVKMCKD
FT                   AGVSACIIPDLPFDHDEGLTEACKKHGLENIPVAAPSMTKERLETMASAGFKYIYAALR
FT                   AGTTGSETTIDQATLDFIDTVGKHGAKVLGGFGIRNGEQSKVLSKHVYAVVAGSVFVNI
FT                   VLANADTAEGRAKAIAAIEAKAKEIAGK"
FT   gene            208372..210645
FT                   /locus_tag="Fisuc_0181"
FT   CDS_pept        208372..210645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0181"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="KEGG: similar to Aconitase CG9244-PB ; K01681
FT                   aconitate hydratase 1; TIGRFAM: aconitate hydratase; PFAM:
FT                   aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73795"
FT                   /inference="protein motif:TFAM:TIGR01340"
FT                   /protein_id="ACX73795.1"
FT                   /translation="MLFNFDMIQATYARIPARVAVARKQLGRPLTLAEKILYSHLIDGA
FT                   ENRTYKRGADFAEFHPDRVAMQDATAQMALLQFTTAGKSRVAVPSSVHCDHLIIAREGV
FT                   EKDLPRAKEESKEVYDFLQSVSAKYGIDCWLPGAGIIHQVVLENYAFPGGMMIGTDSHT
FT                   VNAGGLGMLAIGVGGADAVDAMVGLPWELKYPKMIGVKLTGKLQGFATAKDIILKLAGI
FT                   LTVKGGTNAIIEYFGEGARSLSATGKATIANMGAEVGATCSTFSYDDSMSRYLRATGRA
FT                   DVADAADKIAADLKADPEVEAEPEKYFDRVVEIDLNTLIPHYNGPFSPDRAFAVTDMAE
FT                   SLKATETKPESTPVVSAALIGSCTNSSYEDLYMAANMIKQALAKGLTPKCPLLINPGSE
FT                   QVRYTAERDGLIDLFKQFGATIMTNACGPCIGRWDRAGADKKELNTIVHSFNRNFAKRA
FT                   DGNPNTHAFVASPLMAVIAALSGDIRFNPMTDTLVNNEGKAVKLDPPEQCELPPKGFDV
FT                   KDAGYQAPAADGSNITVSINPTSKRLQALAPFAAWDGKDIAGAPLLIKAKGKCTTDHIS
FT                   MAGPWLNYRGHLENISNNMLIGAVNAFNGETNKVLANDGSYKEVPELAKIYKAKGTGSI
FT                   VIGDENYGEGSSREHAAMEPRFLGVKAVIVKSFARIHETNLKKQGMLALTFKNAADYDK
FT                   IQEQDVFDIVGLTKFAPGSEFTLVAHHKDGSVDNIALSHTYNEQQWAWFKAGSALNLIR
FT                   ANNK"
FT   gene            210801..212186
FT                   /locus_tag="Fisuc_0182"
FT   CDS_pept        210801..212186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0182"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: nam:NAMH_1744 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   histidine kinase HAMP region domain protein; SMART: GGDEF
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73796"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX73796.1"
FT                   /translation="MTHKKTIHRSLILGSAVFIAFMCFLLSIQAYLTYSQSLYKRYDDK
FT                   LSNILNYATNRIDMDDLYQNTITGQKTEKYNDVQQLLNGMVDDFELFYLYSLFVRNDSM
FT                   YNICSATSKAERERGEEDMKLLEPTDAYELSEIRKFAKAMTKNEISYFEEDSDWGPAYT
FT                   ACKPYVNSLGVHFGVICADVSIAELHKTVNNYVLYNVILTLGLGLLFALILLVWLRHNV
FT                   TGPILALEKSARHFAEKSRGKKTPDELIFDAPEIHTHNEVESLSNAISQMSKDMRTYVQ
FT                   GLLEAEEQARSAQEQAEDMTQLAFKDALTHVNSKVAYDKMKESLQEQIDKGGATFGFVM
FT                   IDLNNLKEVNDHYGHDCGDKYILGCCHIFCTIYKQSPIYRFGGDEFVVLLQNSDYKNRD
FT                   KLFKVIESEFKKTRNNTSRPAWERYSVAYGMATYQLGDNVEDVFKRADDSMYQKKMEIK
FT                   GMA"
FT   gene            212273..213940
FT                   /locus_tag="Fisuc_0183"
FT   CDS_pept        212273..213940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0183"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   vco:VC0395_A1598 sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73797"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ACX73797.1"
FT                   /translation="MANNRENWGSKLGVILAVAGSAVGLGNFLRFPVQAATNGGGAFII
FT                   PYLIAFVFLGIPLAWIEWTLGRYAGYHNYGTSPSTYHVIFQKKKKWAKYLGSLGLLPPI
FT                   FIIFYYGFIQSWILAFAFYSATGTLMDVVAQGPEKMTEFFGNYIMLKTCVGGIPVAIIF
FT                   FLITFIANMIVLSFGVRKGIERANKICMPILLILGLVLVVRVLTLPGIGKGLAFMWNPD
FT                   FSQLTSPKVWMAAAGQVFFTMSLGMAIIFCYASYLKPKEDLVLSSLTASATNGFAEVII
FT                   GGTVVIPMAVLIAGANIEECAKLGTFGLGFQTMPYVFGTLPFGGVLQTVWFTMLFFAGI
FT                   TSAISIIQPLISFCEDDLKFTRKKSVTTVSTITFIGSLAAGTVDELDFWGGTYLIVFVG
FT                   MIQAVLFSLVLGRRNAKKAQENGDLPAEVVVEPGENEAFATMNDGSLLKLPRFLRPIIL
FT                   YVCPIYLIVLLVSFTATDGLPFITLSNVDPSATVDFLGHTFPKIGFTWAFRGFLLVLFL
FT                   LLNLAIAYAWRKGGPAEKGRSKSIKKMEIGNSDENMEG"
FT   gene            213953..214045
FT                   /pseudo
FT                   /locus_tag="Fisuc_0184"
FT   gene            214174..217572
FT                   /locus_tag="Fisuc_0185"
FT   CDS_pept        214174..217572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0185"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase;
FT                   phospholipid/glycerol acyltransferase; major facilitator
FT                   superfamily MFS_1; SMART: phospholipid/glycerol
FT                   acyltransferase; KEGG: sun:SUN_1164
FT                   2-acyl-glycerophospho-ethanolamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73798"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX73798.1"
FT                   /translation="MKRTTCPGEVPYYISVFLTSFMQLGLFIHFQRWITFNSEGARFFW
FT                   LSLLLQFAMFSPSIIMMHVASYFAGRFPKSKVMGWTSIGMAISVLLIAFFFGDRLDFGA
FT                   FAFLFLYGIFLSIFNPAKIGLMKEITDGNDLVKINAKHLIFMALGITIISFLTFDYSPN
FT                   DSSTISYSLLPFILSAVGLFAAISSFCIRICKQNKFVKLRSPRRNFASTWSNPMLKLSM
FT                   LGIAAFWSVTQFLIMISQNMTGTQSTTLFQWTFIFTGIGYVIGAISAAKSSKNFVETGL
FT                   IPLAAIASSITMIITPFINNQYVLAFLYAFIAFWAGSAFVILRTVIQNVTRPDTSGRIH
FT                   AVSFMIQMSFLFILLGFQVILFLMTELSLHKQLFFLAVILALTFVFTLKRTPMTLLRAG
FT                   LRFAFSYVFRYKVKVHGIQNMPESGPLLLVGPHYSFIDWAVLQMASPRPLLIASNRNTF
FT                   ADWYLRWFAHGKSVIDINRRDPSEAMEKIHEALLKGEAVVIFPEGEVSKTPFVSKFSLD
FT                   YTKAIEGTEAQIVPFYIQGLWGSRYSHASECVNRPQYFNRVISVGFGKALPATTPENVI
FT                   RKDLQNLGTDIWNMAMDHSASIIPLWYRAMRKRRSRPILIDPAGRHVNGYEMIRLCHHF
FT                   SKKIKSLTKNDQNVGFMLPTSRDAALGIMSILGCGKTTVNLNYTSPVDTLIGCIDKAEL
FT                   STIVTSRAFFDKLCGKNADFKQLAEKCQMFYIDEEEQKISTFCRLLESFIVLTFPKKLL
FT                   RDLWFTTAKLSDDAVILFSSGSEGTPKGVELTHKNVISNAQQGDHVIRLCRTDVMTSLL
FT                   PLFHSFGFTMTFMMPLLDGVPMVLCPDPTDIKTLARVCAEYKATILMGTPTFLRAIAIN
FT                   RWVHPMCLDSLRYVIAGAEKLRPEMRETFKLKFGKDIYEGYGCTELTPLATLNAPNVLL
FT                   DDFLTMEKCCDHSSIGMVVPGSTGAIIDPETNQFLAPGEEGMLVITGPQVMKGYLRDEA
FT                   KTDAVIFEVDGRRWYKTGDKCTITEDGFVKILGRYSRFAKLGGEMISLTAVELRIAETG
FT                   IMGEHEFAITAVPDSVKGERIVLLVKGDATLDTEEISRSLRKSGIPPLMQPGSVFCVEA
FT                   IPKLGSGKWDFNGMKKLATELVEKK"
FT   gene            217699..218166
FT                   /locus_tag="Fisuc_0186"
FT   CDS_pept        217699..218166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0186"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: sme:SMc02103
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73799"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACX73799.1"
FT                   /translation="MSQIVSKFQELGLTLPACPAPVAAYVPATRFGDTIIVSGQLPSVK
FT                   GDFSAFTGIVPNQISVEKAKEAAQICFLNNIAAALTQLKAGETLRLVQIQGFVQSANDF
FT                   HDQPIVLNGASELAVQILGENGKHARTAVGVSTLPKNVAVEISCTFQAIKE"
FT   gene            complement(218167..218670)
FT                   /locus_tag="Fisuc_0187"
FT   CDS_pept        complement(218167..218670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73800"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73800.1"
FT                   /translation="MIDFAALMNFAFENRLYESEVHGIEHWHQVEYNGLLLAKKTGADI
FT                   DVVRLFAIFHDSQRLDDAYDREHGARGAEFAKRCREEKRFELDDERFGWLYDACRLHTI
FT                   QPRTGIVTIDTCFDADRLDLGRVGFPLDPKKMATEWGAKIAQKSLTSGCSVFHMREWIR
FT                   KLVL"
FT   gene            complement(218830..221469)
FT                   /locus_tag="Fisuc_0188"
FT   CDS_pept        complement(218830..221469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0188"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="KEGG: sat:SYN_01405 DNA mismatch repair protein
FT                   MutS; TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73801"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ACX73801.1"
FT                   /translation="MAVTPLMQQYYEIKKENPGCILFFRMGDFFELFEDDAVIASKILG
FT                   LTLTSRNNGASGATPLCGFPHHAAERYVPKMVAAGYRIAICEQVEDPKLAKGIVKRDIV
FT                   EIISAGTAMNEENLNAKEANYLCAYVPATSDDGKGGNGDVAAFAIADVTTGYLATCRSS
FT                   VQAFECEFSRRMPKEIVIPEGTTIPSAIMDLIKAENVLVTELPAILFAEDQAKDVLFTH
FT                   FKVEALDGLGLDGRVFETSVTGALLQYLINQKKSELSHFTTLEILNLDDYMTLDPSTLR
FT                   NLELVRPLNADDYSSTLCSVLDFTVTAMGGRTLKDWVSHPLIAVDRIREREEAVGELVQ
FT                   NPVALDELKESLTSILDMERLMGRVGSGRANARDLAGMGRSLSQASKVADVLEGLHAPL
FT                   FEGLRETLNAAKGRGEDLLKYFNDDLPMTVREGGMIRPGASAELDAMNEDIKERREWIA
FT                   SLEGRERERLGIPSLKVGYNRVFGYYIEITKAQMAKATQPIPDEYIRKQTTVNGERYIT
FT                   PEMKECESVISNAEVNIHALEYKIFCELRERVNSWRAELQGIADAIARVDSLYSFARAA
FT                   RKYNYVCPEVFEGTGIEIRGGFHPVIVAVNPDLNFVPNDVTLSPDGTRLMLITGPNMAG
FT                   KSTYLRQTGLIVLMAQIGCFVPAESARIGVVDRIFTRVGASDRLSRGLSTFMVEMIETA
FT                   NILRNATPHSLVLLDEIGRGTSTFDGLSIAWAIVETLHSEPARMALTLFATHYHELTGL
FT                   VESLEHAGNFQVAVQEKGDKLTFLHKILEGACDSSYGIHVAEMAGLPPNVVRRARKILL
FT                   RLEKQKIDPSDEAQNKKIKAQPQMDLFAPPDENTLLLKDEIRRLKPEEMTPMQALQRLM
FT                   DLKENYGK"
FT   gene            complement(221469..222173)
FT                   /locus_tag="Fisuc_0189"
FT   CDS_pept        complement(221469..222173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0189"
FT                   /product="chromosome segregation and condensation protein,
FT                   ScpB"
FT                   /note="TIGRFAM: segregation and condensation protein B;
FT                   PFAM: chromosome segregation and condensation protein ScpB;
FT                   KEGG: pca:Pcar_1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73802"
FT                   /inference="protein motif:TFAM:TIGR00281"
FT                   /protein_id="ACX73802.1"
FT                   /translation="MAEDQNVEELAEESAELPKVESREDLARIIQALVFASPDVVTLKK
FT                   LREILGDFLDARSVADALITANDSLNKIQSPFEIVEQAGGYRFRTRAKYYPWVRKLFPE
FT                   ANARRLSQAALETLAVIAYQQPITKAAIEQVRGVSSADGPIRNLLDKGFITLGARAETV
FT                   GNPYTYVTTQEFLKYFGINRIPEDLPRLREFSELLEAGALVPQYSKPDNAPEEPTPLEE
FT                   STDQIELSMGDA"
FT   gene            complement(222215..223354)
FT                   /locus_tag="Fisuc_0190"
FT   CDS_pept        complement(222215..223354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0190"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: ccv:CCV52592_0755 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein; SMART: PUA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73803"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ACX73803.1"
FT                   /translation="MSELRKNILDEARRVVVKIGSRILVDSERGGVRTRYIQKLADSVA
FT                   RLMDAGKEVVIVTSGAVGTGMAELGYAQKPTVLAEKQACAAVGQIDLMYAYREMFRWVQ
FT                   LSVGQILLSAEDFRDRARYKNLQNTIKAMLARKIVPIINENDSLAVAEIKVGDNDKLSS
FT                   DVALFLDADLLLIFTDEDGLFDDNPKKNPNARLLNFVPEITPAILALAGKPGEAGSAVS
FT                   TGGMRSKLEAIRNVTKSGANAFLASGMKVLPHQVFFENATGTLFAGSKKKLNSRQRWLS
FT                   FITTPRGSVIVDEGGVKALRENHSSLLPVGVIAVQKHFDKGDLIEVQDEKKNPVARGVA
FT                   GFDSETLKLVLRKKTAQVHEILGKNVPDELIHKNDLVVF"
FT   gene            complement(223384..226371)
FT                   /locus_tag="Fisuc_0191"
FT   CDS_pept        complement(223384..226371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0191"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   vfm:VFMJ11_0258 ATP-dependent helicase HepA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73804"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACX73804.1"
FT                   /translation="MMFKIGQRYVSQAEPTLGLGIVSEVQGRTVKILFPSIGQARIYRT
FT                   DEAPIERFVLQVGETVKSEKGVSFVVDSVREDAGIMVYVGRNGKEMKESELSAKISTAR
FT                   PAVLFKALADDEVCSSRDFLRHEDAMEMYYKWISSPVRGMIGPRVNMIPHQYYLCYRAC
FT                   SSSTLPRLMLSDEVGLGKTIEAGMIWHALKSRGRIQRTLVIVPETLKHQWMIEMKRRFN
FT                   QLFTLVDEGYIRGLFVGVAKDETKPNPFMQSNDIIVSIDFLMAQPALIEDLLKTNWDMT
FT                   IIDEAHHLVCEDGFTSHEYMLANRVIGRSKGVLLLTGTPLQLHPESQFNRLKMLDPVRF
FT                   ADYNDFIKDQEAYLKLVRDLNKLPTDPNHHMSWDDLYECVPKNSQIRPWLEQENSKSMT
FT                   AGEWMRRIVDGMGTGSVVFRNTRKGVGGFPKRVLDEIPLEPNPAYREMVDVAADRDLEA
FT                   STDIQENGLLCTRFSDAWAMDERFVWLKGFLKEYKNEKVLLICESIQVVQALETLLLEF
FT                   LGEGAFVMFHEDMSIMARDKAAANFSKPDGANLLIASEIGSEGRNFQFSHHLVLFDLPL
FT                   DAALVEQRIGRLDRIGQDKDIIIHVPYVKGSGQEVMFRWYNEGLNSFGAPLMSGGELFL
FT                   KYTESLIEALATPRASLENFVENVIPQVKKDCEQMRKHIENGRDRLLEFNSRNPEKAKE
FT                   ITDEIRELDAEPELKNLVFDSLMNRGLDVEKSSVQDCFLITMGPQVEAGSVPGMPDLAM
FT                   AAATAGGGRVNSQTDLCGEGGGDGDGDGRVSGGTCMTVTFDRDVAMTHDDIEFISLDHP
FT                   LAQGVFDYETSFGRGTVSCAIWPNSGLRGLMMQYNFAVELPVSEEWGCADIAGPKYFKV
FT                   LVNAKGENMSEHFEDLSDAALKDVGVPQGNAAVDMTLRYFAKDGLAKARLIVSEQAKKY
FT                   AEEAANAVEARSEQEYQRMNHLLSMRGKAGTSEALKQLRKNVQERKKIVANPQLRLDAI
FT                   RLVVCK"
FT   gene            226441..227205
FT                   /locus_tag="Fisuc_0192"
FT   CDS_pept        226441..227205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0192"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   dal:Dalk_0967 RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73805"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ACX73805.1"
FT                   /translation="MKWFYIDTSITDGDRRQGPYSIDEIRDFVNEGKIKDETLVWHTGE
FT                   ANWKAWKDFPEASEPPEPTEEELLKQTIETLLQSKMNRKRYAGFFVRANAFIIDNIILS
FT                   IVGALFLYVMSLAGMLDLNAVSEIVNQYIDNPGSTDLVSKALDLPGMSTFFTIWSIVQA
FT                   IYFIVFHAVWGATPGKKLLRIHVEMANGEKLSWAFSFFRFVASIVTQATLIFYGLGYLI
FT                   VLIDPQKRALHDFVAQTRVVHNAIEQKEKKEV"
FT   gene            227211..228491
FT                   /locus_tag="Fisuc_0193"
FT   CDS_pept        227211..228491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0193"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   lpf:lpl0878 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73806"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACX73806.1"
FT                   /translation="MDQFIVPQVKAPVNGEVEISGAKNAVLAVMAAALLADGVSEITNV
FT                   PHLKDMKTMSDVLRVIGCHINGGSHVLRIDTRGVDHLEAPYELVKTMRASFYVLGPLVA
FT                   RFGRCRVSLPGGCAWGPRPVDLHLKGLEALGAKITVTHGYVEATCQGRLPGGNFNFPIS
FT                   SVGATVNVLMAATLAKGVSVLQNAALEPEIDNLIDFLTSMGAKIQGRGTRTLTVQGVES
FT                   LRPGTGVTIPDRIEAGTFLCAAAITRGRVKVTRIIPEHIASTLDAFREIGCKVNVGADW
FT                   AEVDARQQELKPMSLVTLPFPGFPTDMQAPFMATLLSIPGNSLVQDTVYNDRFKHVAEL
FT                   ERLGASIQLNGNTATIKGGLPLEGADIMGSDLRASAALVLAGLIAEGETTISRIYHLDR
FT                   GYEDFEAKMAKIGATVKRFNPDARDAE"
FT   gene            complement(228573..229313)
FT                   /locus_tag="Fisuc_0194"
FT   CDS_pept        complement(228573..229313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0194"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cko:CKO_03838 iron-dicitrate transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73807"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX73807.1"
FT                   /translation="MDVESQNALLECRNLLVGYGRALESMKNPFDFRLSAGTVVALMGE
FT                   NGCGKSSLLKTLAGLLPPVSGEVSLEGRMLSEWSPRHRSQKISLVRMSNVVPPRMSVRE
FT                   FVRLGRSPYSGIFDSRTAEDNRIVEESMVLLDVAVFAERPVAELSDGERSRVFLAEAVA
FT                   QRVNVLLLDEPNAFLDIPRSHALFRLLKKIAVERQMGIVISTHSVEYAERYCDRIMVVD
FT                   GGTVKNALASEARKCGLLDWTEAF"
FT   gene            complement(229326..230303)
FT                   /locus_tag="Fisuc_0195"
FT   CDS_pept        complement(229326..230303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0195"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ppd:Ppro_1257 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73808"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACX73808.1"
FT                   /translation="MFLRRRLFGFIALAVLIVLLCVATLCYGVVDIPFASVVQSLFSPG
FT                   DDVSSNILWNLRIPKMIAAVLAGASLAVSGLSLQTVFRNPLAGPFVLGISSGASLGVAL
FT                   ALLAGVGFGSVGVLGSAALGALLVTFIVMFVATRFAQTGVLLIVGLLTGYFIDAIVSVL
FT                   IAGNSSESLRVYVAWGMGSFGRVTLGDVWIFTCAILVGLVLIGGSLRYLNAALLGDDFA
FT                   HGLGLNVKRSKICVLLGASLLAGTTTAFCGPVAFIGIAVPHLAYMLFKTTNHRLLLPGA
FT                   ALCGVALALLAGLFPASVPLNAVLSLVGVPVILWVLVRGSGARF"
FT   gene            complement(230306..231166)
FT                   /locus_tag="Fisuc_0196"
FT   CDS_pept        complement(230306..231166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_2208 Tol-Pal system YbgF"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73809"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73809.1"
FT                   /translation="MNLKTLSLGFVLASFMLSGCSSITMLRTKEMRAVGDDVIAKNDSA
FT                   YKALSAENAALRAELDSVKAQLDASAVAQKRLQAEVTVLSNRMSEETVRRDTRQEEIIY
FT                   RLDLLLGKSDKILAKKVVVNNGVASAVMEPDANAEKMVEAETMFNAAHSDYHRGEYKLA
FT                   YNGFKQVYELVKKGEMAEGALYWMSLCLMEANQPAKAKTLLTNLVDSNPNGMKACAGMY
FT                   KLASIYGNECNLDRKKQYLQMILSNNTCASTPELEQAAISLQEMLDFKSSDGRSATEIC
FT                   REQMR"
FT   gene            complement(231184..231762)
FT                   /locus_tag="Fisuc_0197"
FT   CDS_pept        complement(231184..231762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0197"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: dvm:DvMF_2359
FT                   peptidoglycan-associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73810"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACX73810.1"
FT                   /translation="MGKVFKLALMGTAVALFAWGCSKEKPETDPQPQTAPEAPADSTLN
FT                   LDALVADTLDADSLARLEAERLEAERARLEELINRIMLEDVYFDYDRSELTENAKRLLA
FT                   QVAEILVNENRFIVTVEGHTDARGTEDYNISLGARRSTVVREFLIAYGVDANRLVSVSY
FT                   GKERPKVQGTDETAYSKNRRAHFRVSIDQ"
FT   gene            complement(231774..233048)
FT                   /locus_tag="Fisuc_0198"
FT   CDS_pept        complement(231774..233048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0198"
FT                   /product="TolB domain protein"
FT                   /note="PFAM: TolB domain protein; WD40 domain protein beta
FT                   Propeller; KEGG: gur:Gura_0203 WD40 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73811"
FT                   /inference="protein motif:PFAM:PF04052"
FT                   /protein_id="ACX73811.1"
FT                   /translation="MNKIKLLFVFVAMALAAPAFAAIDTIAVDVGISVFQTMPIGVVPF
FT                   EEEGTIKWTNEAPHLILTRDANLSGRFEAVNSDKFDLVLFSKKRARQYVTGTATKLSNG
FT                   KIKLDCYLYAAETKDVLLGESYTVKPYDVRQAVHSFFDKVVYRLFGERGVASTKLAYVS
FT                   KIDGVKQVVISDYDGFSRRQITRDSSINMMPVWQKGNKGLVYVNFRKQRPNLYAITFGG
FT                   KETPLFTQFKQTFSPAVNPKTGELLFSVTEGAKTELYRGDMKTGSAQKFLHLKSNQVSP
FT                   SWSPFASEVLFTSDRGGSPQVYAVGKDGTDVRRITYMGHYNERASWSPEGDRIVYTSMD
FT                   DGKMNIYTCALDGTDIIQLTSNAGNNEHPTWSPDGKLIAFASDRGGNYQIYIMRKDGSG
FT                   VTRITNGSENTSPTWSWFFDEKKVK"
FT   gene            complement(233058..233990)
FT                   /locus_tag="Fisuc_0199"
FT   CDS_pept        complement(233058..233990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_0783 protein TolA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73812"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73812.1"
FT                   /translation="MERNRDHIQYFETENDGSLFKIIVCAVVFHLAVVGTLIALNNIDL
FT                   SKPAEEIPVFEMVQVDEPVKAPAAKTALPEPEPQQAPKVEPPPPQPPEPVPETTPEPEP
FT                   APEPTPVKTLEPEAPQVPEEPAPEVKPDTPEPVPVPEPKAEEKKPEEKVEKPKPVEKPV
FT                   EKPVEKVAKKTVEKKKVEKKPAKKPKDDDFDIDDLNLQKSFEMPSLKAVNPIDMDPLMQ
FT                   VFLERAKAKIMSNFNPPNGLTIDRDAKTMVQFTVERSGAITSVFLKRSSSNSAWDHLSM
FT                   RAVKISKLPELPPTYKGSSLVLQFNFTPN"
FT   gene            complement(233977..234393)
FT                   /locus_tag="Fisuc_0200"
FT   CDS_pept        complement(233977..234393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0200"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   aci:ACIAD1530 putative biopolymer transport protein
FT                   (ExbD-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73813"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACX73813.1"
FT                   /translation="MKRSRRKDLKQELNLTNMIDIVFAILIVFILCAPLMSQGVKVNLP
FT                   QVKAPTMEQQKLLKVSITKNLEIFIADMQVDMESFESIFKSLWNGEMAVVINSDEAVSY
FT                   GFVMKVVTQVQKLGVTKLGFLTMTPKDELVNGKK"
FT   gene            complement(234390..235064)
FT                   /locus_tag="Fisuc_0201"
FT   CDS_pept        complement(234390..235064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0201"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   gem:GM21_3579 protein TolQ"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73814"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACX73814.1"
FT                   /translation="MITQSDIVTMIILGILAFMSLGSWGIIIVKFFKHKSNLRANAKFF
FT                   KEFCKLKHFSELQKLCTVSNDSALRLLSVEVLNEVSKFKGKVTYESIQHRSSLLEDAIQ
FT                   RSIEGIRMGEDRYLTFLATSSNLAPFFGLLGTVWGIMIAFFQIGHHGSADLTVVAPGIA
FT                   MALITTVAGLLVAIPASAGYNYFTSKNGSNETSYYNFGSQVLSLFKRGDMLAVEGVAEE
FT                   EA"
FT   gene            235287..235826
FT                   /locus_tag="Fisuc_0202"
FT   CDS_pept        235287..235826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73815"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73815.1"
FT                   /translation="MKKLIACLALAALFAGCSSNPPQTPQEKSASLLVEMQMQKKNYLK
FT                   QHIPAGIGIGESANEQLAYEKADQNARVDLAKSIDAQTKALIKNFKEEVSDEIAEHFQS
FT                   TSKTAVDQRLNGATLNDVKVETTADGKFKVYGVMTLDSDLVSEYIKMLEQQEKKEEAEK
FT                   IRAAAEKAYAELDEMD"
FT   gene            complement(235915..237204)
FT                   /locus_tag="Fisuc_0203"
FT   CDS_pept        complement(235915..237204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0203"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="KEGG: gbm:Gbem_3348 FolC bifunctional protein;
FT                   TIGRFAM: FolC bifunctional protein; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73816"
FT                   /inference="protein motif:TFAM:TIGR01499"
FT                   /protein_id="ACX73816.1"
FT                   /translation="MIQNGLEYLNSRLIFGMMPGLASTRKLCEALGNPQKKFKTIHVVG
FT                   TNGKGSTSYYLSGVLQAHGLKTGLYTSPHLVSMRERIRVNDLPIDDESLDRLIMQVKAA
FT                   AEETQVEPTFFEVLTIVAFLYYAEQNIDVAVLEAGMGGRLDSTAVADGELIVLTSIGLE
FT                   HTEVLGSTESAILKEKMGVAGSAQSILSNGRSKTFVLGGLNDALIAEAKVFAASHGCSC
FT                   VVPEIRNDIELPNLGQHYIENASLSLKAAELFLNKFDDSLALKTLTTRSWAGRMQKLID
FT                   ANGVTKFILDGAHNSHAVRRLVETLDKYYPNQKFHCVFGALRDKDVGEMLKLMAPHVSA
FT                   WHITRTPYPRFRELEDLQGELEKLGLNVASAGEFSREYLNEVCASVTDGSPVLITGSLY
FT                   MIGATVQALKDDFDGLAFFRGMEPTTNEHR"
FT   gene            237458..238201
FT                   /locus_tag="Fisuc_0204"
FT   CDS_pept        237458..238201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0204"
FT                   /product="Deoxyribonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="PFAM: Endonuclease I; KEGG: lhk:LHK_03164 EndA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73817"
FT                   /inference="protein motif:PRIAM:3.1.21.1"
FT                   /protein_id="ACX73817.1"
FT                   /translation="MKVSASAVALILCVFAAFSFAKVDPEAAPRHYNYRDAGKQMRRIY
FT                   YGELQETIYCGCRYLDKKHVDFSTCNYKPRENPNRKSLERTKRIEWEHIVTAHNMGKHL
FT                   PCWRDGGRKNCSANDTTFKIMEGDLHNLYPAIGEVNGDRNNFMFSQWTNNPAPMYGECE
FT                   TIVDFKDKKVQPRKEVRGLIARVHFYMEKTYNINISKQDRKLFEAWDKMYPVTERECER
FT                   DRRIFKVQGDHNPFVFEKCQDSVDK"
FT   gene            238299..238904
FT                   /locus_tag="Fisuc_0205"
FT   CDS_pept        238299..238904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0205"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: nam:NAMH_1696 ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: RNA-binding S4 domain protein;
FT                   ribosomal protein S4; SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73818"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACX73818.1"
FT                   /translation="MSSFRGPKGKVARSLGVAVSQKTQKALDRRNFAPGQHGQTRKKSA
FT                   SVYKQQLVEKQRLRFTYNISEAQLAKAYKEANRREGSAGDNLMILLETRLDAVVYRMGF
FT                   ARTIFAARQYVAHGHFTVNGVRSFSPSRLIKAGDVIAVREQSKEHVQIKEAIASAAAAP
FT                   EYLSVDLGKMQGTLVKLPLRDQIPVKLEEQLVVEYYSR"
FT   gene            complement(239072..239329)
FT                   /pseudo
FT                   /locus_tag="Fisuc_0206"
FT   gene            239423..240541
FT                   /locus_tag="Fisuc_0207"
FT   CDS_pept        239423..240541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0207"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   scl:sce3220 endo-1,4-beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73819"
FT                   /inference="protein motif:PFAM:PF01270"
FT                   /protein_id="ACX73819.1"
FT                   /translation="MRNIFEEIGKTPAEIEAKLNKAFTQLFKGDRENERICFDKGNDMA
FT                   YIVDIGHNDIRSEGMSYGMTVAALLGKQDLFDKLWKFAKTHMKNTEGDLAGYYSWQVST
FT                   ADFSMMDPGAAPDGEEYFAAALLYAAKIFKNEQYKRDAVELINDMAHKPQAGDVYTMMD
FT                   VNAGLVRFSPMKGNDYTDPSYNTVAFYRMYGEASGDAIWNKIADNSVAYLKKACHPVTG
FT                   LAADYSEFDGTPKKTPWHPESDCFCGDAWRVVWNIGLDAAKLQDKCERADVSEWEVSAV
FT                   RKILGYLHGRRPYLADMRVDGSAFPREARPATGGLIAMNAASTVALPAGDPLIKPFAED
FT                   LWNMEIPTGLWRYYDGLLYMLGLLACSGKFNV"
FT   gene            complement(240584..241909)
FT                   /locus_tag="Fisuc_0208"
FT   CDS_pept        complement(240584..241909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0208"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: hch:HCH_01884 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73820"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACX73820.1"
FT                   /translation="MLIEDVKKSIIDAGFHDGEKMPSVRKMAERLKLSVNTIHKAYKLL
FT                   AIEGRIQLVHGKGCFWGTAPSFEVKAEESVYSVVERLFQNDLDSGYLNAFDELPSCKEL
FT                   SNRYNVSLYIVKKFLMQKCSQGILRHVGHRFFFSEERPVEKSNFILFVHRSDEFGRLKI
FT                   ESERESDVFRTFAQIAAEQKIAVKFIGYHEASNLFYLSSGETFVVKNDTHCLGVFLSTW
FT                   LVNDAAKLFAHFASFKNPISVWWEYAPDVIPVIARNKKKWAFYNVAFGKEAGVIVGRYL
FT                   KSKDMGPVHYLSPYHASFWSKARLQGLLDAGTDVIPLVDERYASPFDLADAAEHEGVER
FT                   QVLLDNILESLLKNATLDKFVCSNDWVAASLIDYFKAKKLPAPYVVGFDDTIESYRYVF
FT                   DSFAFNVGTMVKEAIYHIVAPTIYAEQRRQMQTPLGRVVEKH"
FT   gene            241977..242588
FT                   /locus_tag="Fisuc_0209"
FT   CDS_pept        241977..242588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73821"
FT                   /inference="similar to AA sequence:KEGG:Patl_2976"
FT                   /protein_id="ACX73821.1"
FT                   /translation="MRIGLVFMLLAACIAAAAPSKKASAKKFKDPRDGHTYKIVKIGNH
FT                   NWLAENLTYKTTKGSYCYNDDKENCHKYGRLYTWKAAMKACPTGWKLPDRKDWNFLSKY
FT                   LGSSKKNGFRVKQAGQRICFGNNDMWSPYCEETKASFNADGKSDTHFAYEDMDKSAFFW
FT                   TATEETTYIANFVTIGGYNERYAERAIEENNAFSVRCIQK"
FT   gene            complement(242650..243669)
FT                   /locus_tag="Fisuc_0210"
FT   CDS_pept        complement(242650..243669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73822"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73822.1"
FT                   /translation="MKKLSFVACTAFAALMFVACSDDPVTAAVPPAGGGAGQGGGVALD
FT                   STRNISVAFKGCFDYSYNDALKKTAVENPKAYLVTDDAGYHVVIPDMAGTCGYENIVFN
FT                   NQRVLDTLKINFEGDPAECRCINDVWFNIDPLDADIKYLVYLNTVYEIVAEPLLERSSS
FT                   SELLMQSSSSDVAESSSSVVSSSSEEDPSRVIVTDANVQCEDRRTFDPMLDGNSVESFT
FT                   REKSDAALPPVAYRYVSTENVGFTIKNVTATCGSTIESLNVVALDGTLKVNVEYGSAYD
FT                   LNQNCICHSQITFSVKIDPVYSTAEYLVLNDHGSNFNNKMMIVDLDVIRTDDIPNSDF"
FT   gene            243897..244781
FT                   /locus_tag="Fisuc_0211"
FT   CDS_pept        243897..244781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0211"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: gsu:GSU2091
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73823"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ACX73823.1"
FT                   /translation="MSLKFETPITEVPLFHQGKVRDMYDLGDSFLMVASDRLSAFDVVL
FT                   PTPIPGKGKILNQLSLFWFKHLGMKNHLITADVNEYPAVLKKHADYLRGRSMIVKKANR
FT                   HSVECIVRGYIVGSGWKDYQKTGKICGHVLPEGLQLCQKLEKPLYTPSTKPDVGHDENI
FT                   SFEQTFDIVGEKVATTLRDMSLDIYTKARDYAASKGIILADTKFEFGEIDGETILIDEV
FT                   LTPDSSRYWPADKYQVGKNQESFDKQYVRDWLETLDWGKTYPGPEIPPEVVKNTLAKYE
FT                   EIFVRLTGKQPEL"
FT   gene            complement(244835..245644)
FT                   /locus_tag="Fisuc_0212"
FT   CDS_pept        complement(244835..245644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0212"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: reu:Reut_A0624 protein tyrosine/serine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73824"
FT                   /inference="similar to AA sequence:KEGG:Reut_A0624"
FT                   /protein_id="ACX73824.1"
FT                   /translation="MANVLKFESIDNARQLGGIPAGGSHVKHNLLFRSSNLSKATEHDL
FT                   HRLRDDFGVHLVIDLRSDFEYMQKPDKLLDGMDSALIPVLDDSMHGDAFNKDQVVPATG
FT                   VDFMEFLFGIARHPIANTLKDKLYNYFVDSDYASSQYAKVFETVRAQKGAPVLWHCTSG
FT                   KDRCGFCSALMLAALGADDNAILDDYAESENSYRKPLEAMTAKGRESGMTDEQLDILHF
FT                   LVSVKREYLEIPLKRINAEYGSLLNFITQRMHVPTATIDALREYYLE"
FT   gene            complement(245671..246357)
FT                   /locus_tag="Fisuc_0213"
FT   CDS_pept        complement(245671..246357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73825"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73825.1"
FT                   /translation="MNQFVLAFPIPVAVNEPFAITETVQVNADTKTLMIPGCSVQFNVV
FT                   RQGASADLLEIFKERDELSAEEEKAIVDHKSLLFLLGNVKTMDDVEMVNSAILKVLNAK
FT                   AAGVYMQQSGTAWTAKAFEEQFGDCDYPMDPWINILDSGDSLYTLGLAVFTLPDLCISN
FT                   TIEDPEEALLMAADSLFGDGVPAKSGSVIDWGEGERYTLRQETKTLFSKDAPEFNKQGV
FT                   LRIVKK"
FT   gene            complement(246354..247595)
FT                   /locus_tag="Fisuc_0214"
FT   CDS_pept        complement(246354..247595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0214"
FT                   /product="Glycosyltransferase 28 domain protein"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   maq:Maqu_2452 undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73826"
FT                   /inference="protein motif:PFAM:PF04101"
FT                   /protein_id="ACX73826.1"
FT                   /translation="MKVLVAPLDWGLGHATRCVPVVREFLRAGAEVELAVVKANANFFR
FT                   EVFPDLRQRLAPSYNIVYPKHGYNMALWLLKNSMHLNAVMRYEHHFAEEMVKRHGYDVL
FT                   FSDNRFAFYSKKALSIYMTHQRRIAFPRAFAAFERIGVMWHANIMRKFDEVWVPDLEIY
FT                   PGYAGSLSHSGATPGDKPMRFVGTLSRFSEMGNDGNALGNAPAPVDLEREVDLMSMSEF
FT                   MAHSANVEWDAAPEKRTSGNHSFEMRANYKVVAVVSGVEPARTQFEQQLRDALAQIPGR
FT                   HMMILGKPSAEQKTWTEGNIEFHTHLATNDFAEAVKRADFVVSRGGYSTVMDMAELGAK
FT                   CIFVPTPGQFEQIVLAHDLSKAGYAVEIPADELSAETLTSAFEKSVKMPKVEKQNLLHD
FT                   AVEDVVRKFKERLI"
FT   gene            complement(247592..250132)
FT                   /locus_tag="Fisuc_0215"
FT   CDS_pept        complement(247592..250132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0215"
FT                   /product="Glycosyl hydrolase family 98 putative
FT                   carbohydrate binding module"
FT                   /note="PFAM: Glycosyl hydrolase family 98 putative
FT                   carbohydrate binding module; SMART: Glycosyl hydrolase
FT                   family 98 putative carbohydrate binding module; KEGG:
FT                   slo:Shew_2289 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73827"
FT                   /inference="protein motif:PFAM:PF08305"
FT                   /protein_id="ACX73827.1"
FT                   /translation="MKKETLGRDGVKSKSLRQSFMEWKNSLHWDKPQNIMLAVTMFVLV
FT                   AAFLIFNNLSVPYARHWDIQWGYYSILATFLLLVAGVVVNAPFVAKHVRGFLPSGKSFC
FT                   GLALLLIVFSVFIFGNIGNTHRVLSDETSWESMGLQMYFQHTGGVCNEGVWTDGVLDCK
FT                   TEVNNFKGKALGFVYSLVFNFMEPNRDSALMVNYPFYILSLIAFFLALSKWFKSDKLAL
FT                   AATAFLGGMPIYLLQSRSASTEVLYILLLAVLMAWYAFVPTNKVTWKHFLLTVPLLGFF
FT                   AQTRQETVFAFIPFALYYYRYFLEKPYRLPAFVASVIAVSWPSINTMAAYRGYDFQGGT
FT                   HAAHSFENLWFNLKTNIEVMMNLKPDSAFGGIMENPFYTTFTVILLLATVWLLFRMIYS
FT                   RRYVRGFILGITFCVQIFVILLNVSGTFTIDINQRYVLVALPLFALLMALGLYDALVFT
FT                   TKMKSDAAAKIVAGFACLLSIGLMLYHAPSYKANMLYYKNKLLAEEDFLNTELAKYPKN
FT                   SVFIYARPWQMLASGHTSFSESSFKSWSTEKFAEWMQKSGGNIYLVRGQDGYGKVNRNS
FT                   RVVGFKTTDQIDDILSDYKNERVLMEARLFGYGLAIYKIISKKGVSHYAQNFMVSEETN
FT                   GMIVVNKRFPESIACDYKVNDKDQGEMLVSQSADTLQLDSAKIRAGLNRVVLSCYMPDE
FT                   DTLVTYRDFFVEGENVALLSKLKMGKFFQEWGEPQMNETVDHHKITIDGEPFRYGIGSH
FT                   ANSAIEFPLSRGYDWLNVVIGLDDESACGDGAYFAVEADGREIYHSKKLYTTDKERLRL
FT                   NIKGAKSINLRVLMGNDKDCDHGDWAHAWLEAEK"
FT   gene            250338..250988
FT                   /locus_tag="Fisuc_0216"
FT   CDS_pept        250338..250988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73828"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73828.1"
FT                   /translation="MFYKHWKKISLALTGFFWASCDSGTTTEPPLYGAPPQYSRSSEIQ
FT                   NSSSSSEDKISSSSEPLPMPAYGVPQMDCEVTSESDLTVTCENGYTCTAKTDTVHVSAP
FT                   ACETFNGTTICPAYGVDADVFIKKYECNDGFTYDDTEFKKIYKTLSCTFKGSEIENTVP
FT                   PKAYHDYECNDGAFCYSEQGTEKTTFNCIDTQGNEITYTEDEFKAMYNVKEPE"
FT   gene            250985..251839
FT                   /locus_tag="Fisuc_0217"
FT   CDS_pept        250985..251839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_3361 glycoside hydrolase family 5
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73829"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73829.1"
FT                   /translation="MNIRKHWKNLLLTTTAFFWAGCNGDSVTESGCPCYNGSGISSEAS
FT                   SSSESVESSSSSEAVASSSSESASSSSANGSSSSEVTCAPGDSLVSYYPPSYSADIAKM
FT                   NAEEKAKHASVSKIDSISNTLQTVPQCLADLRQELNMFVALYGAPMKFNKNEVCSDGTT
FT                   RPTQEYLDYLKMKEEWERNKPALDAECQKIYEDKLKEIEQTIKECIATSNPNTDLTVCD
FT                   FDAMCPEYGVDSKCTYKYTCNDGVTCRRTEGETNMVCTDKQGEKTTYTKKDFDKKYYTK
FT                   ENY"
FT   gene            251855..252259
FT                   /locus_tag="Fisuc_0218"
FT   CDS_pept        251855..252259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73830"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73830.1"
FT                   /translation="MLYKHWKKFFLSVLALFWSGCENEDDAVASYGCFPTQCYNTTATN
FT                   DLGEVFDIIECDDGYKYLRQSGIYYEHPELQEKLPEGVEAITPPAGSCGASNCTNKGPD
FT                   YCYKESKKTLEGTTQEYEVCVPSIDCPEKH"
FT   gene            252281..253357
FT                   /locus_tag="Fisuc_0219"
FT   CDS_pept        252281..253357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0219"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sfu:Sfum_2430 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73831"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACX73831.1"
FT                   /translation="MQLSLKKKLALEAYRLYRHNEIKAHPLTYFFWECTLRCNLHCLHC
FT                   GSDCVKDAIPDMPREDFMAVLDKLTPHIDPKHFIVVITGGEPLMRPDLEECGQEIKKRG
FT                   YPWGMVTNGLAMTPERYTRLLNAGLRSLTISLDGLEASHNHFRGDPHSFERALRAIDMA
FT                   AHTQGLTFDVMTCVNRENLKELPKILDMLLKIGVKRWRVATVFPKGRAKDNPLFQLTNQ
FT                   EFRQVFDFIREVKSMNVINVNYGCEGFLGSYEKDARNYPFFCRAGVNVSSVLCDGSISA
FT                   CPSLRGDYIQGNIYKDDIWDVWQNRYQVMRDRSWAKIGDCKTCKYWRYCEGSSLHLRDE
FT                   KTKELAYCHVQRLEAAGA"
FT   gene            complement(253451..254353)
FT                   /locus_tag="Fisuc_0220"
FT   CDS_pept        complement(253451..254353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73832"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73832.1"
FT                   /translation="MKKLSICAAAIIALAMTGCDNGKTGTIEGEVRDAFTNKPLEMPTV
FT                   GMDSTIYTTLSKKYEFNQELRKGKFKFVKVPVGAYRVYAGRSKYVKTRMKIETTEQNPN
FT                   ASLILYIYSAQVDPGLYQGTPEGPLKIDNKWVVYSTNCDESIAGYRLTMPQQQAGDAKA
FT                   SLAEKIGVKKKGKKGKKARKAAPVAQVAAAVTNLPDPRVVEGKLEVFYHNSSSVSTAIT
FT                   AKTYPAVVAPIASHKDCKGFGAGETKGVFPVKDKATDLKVEYVAENLYKISGNLPKGKQ
FT                   IIQLSQDGKTLQTYYFEAK"
FT   gene            complement(254421..254729)
FT                   /locus_tag="Fisuc_0221"
FT   CDS_pept        complement(254421..254729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0221"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: rpf:Rpic12D_1117 ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73833"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACX73833.1"
FT                   /translation="MKEGIHPNYQPVVFVDANTGKEYITRSTKSSAEKKTIDGVEYNVI
FT                   SLEITADTHPFWTGKQHRVDTAGRIDSFNKRYGGGANITSAKRKTRKAAPVKAEEEA"
FT   gene            254828..255412
FT                   /locus_tag="Fisuc_0222"
FT   CDS_pept        254828..255412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73834"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73834.1"
FT                   /translation="MKSLLLLSSLLLIACGNDHPTAKIVEVNKRMVLEEWPDSNYIASL
FT                   DSILKLEPVKKGKDTADVSLKMNAFKAPTFKLPPSVTGKSTSRKSGLSKPPKQVKQAAE
FT                   ASKPSNNAENFVAKFSNALSALQSDPSNKGLYKVVTANDGEDLFKLLRRTYGAGTQNLP
FT                   RFYVLSALQSVNPGVMLEHLNAGDKVRVPRL"
FT   gene            complement(255681..257066)
FT                   /locus_tag="Fisuc_0223"
FT   CDS_pept        complement(255681..257066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0223"
FT                   /product="Outer membrane protein/protective antigen
FT                   OMA87-like protein"
FT                   /note="KEGG: hhe:HH0992 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73835"
FT                   /inference="protein motif:COG:COG4775"
FT                   /protein_id="ACX73835.1"
FT                   /translation="MKLWWQNTLFCVVAVLLLGAVLCCASECRIVRVEWVGDHSEFEEL
FT                   SMNDVVGAPCDSWRGAKQKLLRYYEDKGFLGAKLQVAVDSAGVMRCEFVRGSAWVWARP
FT                   ENLDSGATDVDVFARLTGLELGGKVSLSDLERSERKMARLGYYEKTADVRLFRDPVRNR
FT                   IIPAYSMRAVPISAAEGFLTYSSDDNVWEGKINLDLYNILGTGRDLQMEGYSQSDSRRL
FT                   EGLYRERFIFGTSWDVVVRGFFEDDSLSRNSRLELGVSRNIGFSFDVAAFVGIGNDEKS
FT                   STLELSYISFDRSVLPRSGMSVDLSLAWMMDRPDSLDSYLRLQSSLVYYLPLWKNFIVR
FT                   YSAAAGAMLPSGGAFAREDLFSLGGINSFKGMMYGFMRTRAYGFSQAAFLWQDGYDLSI
FT                   ELFFQPGLYRRMKPFHGWASEHDYGIGFTQYRKSWSFSIYYALRNGCDYLDGVLGFGVK
FT                   TLF"
FT   gene            complement(257068..259962)
FT                   /locus_tag="Fisuc_0224"
FT   CDS_pept        complement(257068..259962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73836"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73836.1"
FT                   /translation="MRSIPCLGLLFASLAFALDVDSLPVWDPSILAKNALENAPGAALN
FT                   SAQAEDSSRAEIETHGYKTMQVTVGDGGTQVDQELRLSIQGRLADSVYIDALLSDVDRK
FT                   AGDQTTATLQDVDQIYFRVESPYAMLHLGDFTWTDNSMAFTSFSRSTLGAMATLRYRGS
FT                   EVSGAWGTDEVTRYSRSFSGVQGQRDGYHLDESGSFVSVVPNSERVWLNGVELVRNRDY
FT                   EVNYAGGLLDFKNGIIPGSDDEVFVEYDAYLNDDIYTMYAARGSLRFENVFFDVSGFHL
FT                   ENDVDRMRKSTLDSADYERLKNDRGGELKDSLNQDLHRPKMSERLGARLRLQAEHRFYA
FT                   DVELGLNRMDSNTVSKNVGGPSGRAFRWYVTTDSTQNMNTFPVALSVYGNYVQEGFAIS
FT                   EFGGRDRDWDAYALRNEWDLDSAKLSGDLRYDELALRIRLGKDWFGTAKWGYRRGDDER
FT                   WNSSRSQLSLVHRGLDAKSEFTASYVSSAQEVEQKRYQGTFSSEFLRGFFRPFGSGDVR
FT                   YSVRDSLGYKSERGYAKTAVGATLNDDLWNVKESVGTLTVRKHDLTDRADGLSRREGWR
FT                   DSVNLVTWTQSAEANFHNFSLSHLLQYSHAVTDSLGASDSWVGDLTTNFGDDDMGVQGS
FT                   IAYRFGMTSEQTYTAIYKAVAKGTGDVRYDSLTGTFIEGVDNGDFVYEGMGRNDSVGAV
FT                   LSSNASFEASLEWNPGVSLGVNQGLLRDITLSASYHSEAEDTTGEKIYFPPVYSAALRR
FT                   MTAGTVSWDASLAWDHPSGISASYNPSASYEKKMSSIGYFQDMFDHSLRASFNINESHY
FT                   VGVDNTFEKVHLTALQKLDWNIWEITGRYTWKLPAGFSLSPRVRYREGSGEDDMEESFG
FT                   AHLWEEELRVGYEKEGVVDAHVSFASIQMDTHEGAIPYQMMSGFGNGVTYRLETMVSVE
FT                   VNHFLSFSLRYILRFGDAEENVFQKLTSEAKAFF"
FT   gene            complement(259969..260436)
FT                   /locus_tag="Fisuc_0225"
FT   CDS_pept        complement(259969..260436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73837"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73837.1"
FT                   /translation="MAGKFPPLRNLRKTTVLAIVVFLGFFVHRFVMFFIDDEVNFTDNS
FT                   DIELSPANSVVCRHIVNGEPFGSDSVFEENTRLYVFSSITNSARYQEDTLVHIWFLGID
FT                   TIFVETCNLTGDVCSSMLASDLVELGEWSVDLVAGRKLLASRQFRVVTPSR"
FT   gene            complement(260446..260871)
FT                   /locus_tag="Fisuc_0226"
FT   CDS_pept        complement(260446..260871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2941 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73838"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73838.1"
FT                   /translation="MSDYTIYSDDANKVRRLMSAYQASVKCEYVVLCHRDGNIIAEVGS
FT                   LGSDLDATPLAVLSIAAFDSSRQIGVMLGGEKFQSVSFTGENRSVYISPVDRSLLLVQV
FT                   FNGGRLPNRIDDFNRLLVEKLEDAVPAFTQNTSSLVR"
FT   gene            complement(260896..261837)
FT                   /locus_tag="Fisuc_0227"
FT   CDS_pept        complement(260896..261837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0227"
FT                   /product="GTPase-like protein"
FT                   /note="KEGG: gur:Gura_4332 GTPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73839"
FT                   /inference="protein motif:COG:COG2229"
FT                   /protein_id="ACX73839.1"
FT                   /translation="MSSINFATREISCKVVYYGPGLSGKTTNLQVIHQKMPQDKRTDMV
FT                   SLATEGDRTLFFDFLPLNLGDIKGFKTRFQLYTVPGQVYYNSTRKLVLRGVDGIVFVAD
FT                   SQRSRQAENLESLQNLRQNLQDYGMNLDDIPFVLQYNKRDMDNVFTLDEMNEMLNPDKK
FT                   IQFFPATAHNGKGVVTTLKTIAMLVIEKFNVKQGFLRKAAVNAAAAAPTASDAPAQNAD
FT                   AGKPQNESAAPQQPTSPFRMPSFAAKPQANMSNSGGAGSGLFQKGAMSSPFARPRVATA
FT                   VPRMPTFGRAVEKPTQTDDDEIVLRPYKPKDK"
FT   gene            complement(262071..262331)
FT                   /locus_tag="Fisuc_0228"
FT   CDS_pept        complement(262071..262331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0228"
FT                   /product="30S ribosomal protein S20"
FT                   /note="KEGG: apa:APP7_1620 30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73840"
FT                   /inference="similar to AA sequence:KEGG:APP7_1620"
FT                   /protein_id="ACX73840.1"
FT                   /translation="MPQHKSCKKRLLQAEKANAMNRSTRSAIRASLKVIRTAATKAAAL
FT                   EEMPKLFSMLDKAAVSHRAGFCANRAANYKAKVAKVINGLA"
FT   gene            262643..263728
FT                   /locus_tag="Fisuc_0229"
FT   CDS_pept        262643..263728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0229"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aminotransferase class I and II; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   tdn:Suden_0902 DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73841"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ACX73841.1"
FT                   /translation="MIPFINVRAQREAYLSEFKQAEQEVLDSGCFIGGPQVQALETELA
FT                   EFTGAKHAITCGSGTDALTIALLALGLEPEDEVIVPDFTFIAPAECVMRLGGIPKFADI
FT                   DAETLQISVESIESLIGEKTRGIIAVNLFGQCAPYAEIRKCARANNLWLIEDSAQAFGA
FT                   MQNGVPACTFGDISITSFYPAKPLGCYGDGGALFTANDELAKKIRLIANHGSQQRYIHE
FT                   ICGMNSRLDALQAAVLRVKLRHFKDELKKRSENASKYNEFFNAVPGIAPQKIAVGNTST
FT                   YAQYTVLADDRPAFLKQLENAGVPYCIHYPQPLHTQPCFKGLNQGIGNGNAIEACQKVV
FT                   SLPMCAFTDVDEIIARLKKVM"
FT   gene            complement(263832..264677)
FT                   /locus_tag="Fisuc_0230"
FT   CDS_pept        complement(263832..264677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0230"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: kpu:KP1_5479 putative hydrolase of
FT                   the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73842"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACX73842.1"
FT                   /translation="MKLLFTDLDGTLLDDEKNISQADMASIQAMIGAGHKFVMTTGRPL
FT                   TSVKHIAEKYGFLKPGYFLVSFNGGLIYDCGTEQPILTRRIAVDQVKFIMDEAHKRGMH
FT                   AHTYAGDLVVSEYETEQLKTYCRLMKMDYVVVDDIRNYYGGVNCNDGPINVVVKPPIKV
FT                   NVITPFEHSSLVDFRAEMRTITAGKLFDVFSKPEMLEFSHMLSNKGAAVRYMADFYHEP
FT                   IENTIAVGDEENDCPMIEAAGVGVAMANASPAAKAVANYVTEHDNNHSGITEVIEKFVL
FT                   "
FT   gene            264753..265703
FT                   /locus_tag="Fisuc_0231"
FT   CDS_pept        264753..265703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0231"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: sat:SYN_01784 phosphoesterase,
FT                   DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73843"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ACX73843.1"
FT                   /translation="MQIDDLLKEAKSVAIFGHVRPDGDCVGSTLGLYNYICDNYPTMKT
FT                   RIFLERFPENYKILSNSNEINEFYNDEFGSFDLAFLLDSSTFDRVGANGECCIKAAKKT
FT                   CNIDHHVSNPLNLCDVNYVDAKASSACEVLYFLLDPNKVSKATAECLYLGIVHDTGAFK
FT                   FSSTGHKTMMVIGDLLEKGIDFTRIINETYYTRTYTQTLVTGYVMMSSKLALDGKVVYS
FT                   YITPEDMDRYSVTPVELSSVIDTLREVTGTEVAIFLYPVNGDYKISLRSNYVVDVNKVA
FT                   GVFGGGGHVRAAGASSKDSPEETIAKLLKVIQEQL"
FT   gene            complement(265700..266320)
FT                   /locus_tag="Fisuc_0232"
FT   CDS_pept        complement(265700..266320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0232"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rme:Rmet_3911 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73844"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACX73844.1"
FT                   /translation="MLEFFIAALVIGIAPGPDNLFVLAQSATYGARLGFCIILGLCTGI
FT                   AIHTCLLVAGVSALIAASPTAFFVIQCLGAAYLLYLAYKSFGVKAGVVQMNGDSRSEPG
FT                   MTSARSLYMRGIIMNLTNPKVILFVLSLIPPAVRLERPIHPSLQMAIFGGEFILATMIV
FT                   FGCIALLAGTVKKFLLTSPKANRNLNWFSGAVFVFLAVALFFV"
FT   gene            complement(266320..266700)
FT                   /locus_tag="Fisuc_0233"
FT   CDS_pept        complement(266320..266700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73845"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73845.1"
FT                   /translation="MSEMDIECPHCGTKFKVQIDGDFSNMMVFPCARCQTPLMCYHGEI
FT                   SELDREEFSKLREKLSKVLNVVMRQDGTVGEVANALKKLVDVSNARADEREQNHTVITD
FT                   DELDALQKDLADLDVDAFLSKL"
FT   gene            266837..267985
FT                   /locus_tag="Fisuc_0234"
FT   CDS_pept        266837..267985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0234"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: nis:NIS_0312
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73846"
FT                   /inference="protein motif:PRIAM:2.7.8.13"
FT                   /protein_id="ACX73846.1"
FT                   /translation="MLCHWLYQTTNIDLFDGRLFRAGVAAMLSIILVLFFMPKYIRFLQ
FT                   RLDATSDFDKDGKTKSPPIMGGLLLVIVVEIVSLLVCQMNGYTISTLVILALFSAVGAT
FT                   DDMAKVRAKRLVNQGKLKAAEYMDKADGISSSLRLFLYFLFSFVVAVFCYKFIPELKGD
FT                   LTIPFCPIDVFQIHLPNWIFVAFMTFVIAASANGTNFTDGLDSLVSVPILTSMVFVGLV
FT                   AYVSGNFIFSQYLSVPYLPGCDELFPLATAIAGALLAYLWFNSPPAEIYMGDAGSVGFG
FT                   AAIGIMFILVQAGLFLPIVCIIIIAEACSVLMQITWFKITKRTTGTGKRIFLCAPLHHH
FT                   YQKKWDGRFPSKPLMNSKIVWRMHLVSIFALIFSMVVFFGIR"
FT   gene            268108..269445
FT                   /locus_tag="Fisuc_0235"
FT   CDS_pept        268108..269445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0235"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /note="PFAM: UTP--glucose-1-phosphate uridylyltransferase;
FT                   KEGG: udp-n-acetylglucosamine pyrophosphorylase ; K00972
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73847"
FT                   /inference="protein motif:PFAM:PF01704"
FT                   /protein_id="ACX73847.1"
FT                   /translation="MNIIETLNAAGQQELAQHLESLTGDARANLERDILSQDWQELKAL
FT                   HAEKSAANLSDNVSADLTPMPWKLATDDLRYDFWKETGEILLGQGKVAAFLVAGGQGSR
FT                   LGFDGPKGMFDIGLPSHKSLFQLQAERLRNLGARVGHAIPWCIMTSPLNHEATVNFFSE
FT                   NNFFGLNREDIRFFQQGTICALTADGKAVRDGEDHLALVPDGNGGCFRALAQSGTLAWL
FT                   VERGVQYVFLYSVDNALCRICDPAFIGALAEKGTILSASKVVHKAGPNEKVGIFAFQNK
FT                   KPGVVEYSDLPENFRDMTNADGSLTFDGGNIAIHLFKISGLRKLQTSKLPWHTARKTVC
FT                   GIEKCFKFEQFLFDAFPQLGSMLPFGVVREEEFSPVKNAEGNDSPKTARIMIGKLHREW
FT                   LRKAHVKIDEKKLYEISPTISYAGEGLKQSVFDRELGRNILEFDED"
FT   gene            269537..270484
FT                   /locus_tag="Fisuc_0236"
FT   CDS_pept        269537..270484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0236"
FT                   /product="Lauroyl/myristoyl acyltransferase-like protein"
FT                   /note="KEGG: gem:GM21_3414 lipid A biosynthesis
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73848"
FT                   /inference="protein motif:COG:COG1560"
FT                   /protein_id="ACX73848.1"
FT                   /translation="MHRIKVITYKFLIYILLRLPDAFYAVLFAIVFPVYKALHKKRAYG
FT                   RVEKHLATAKKYEARESDGTNKMQRNVKSPSPNAIAKINARDTFKGIFWNALESYRGLA
FT                   HIKSVEKRIVYENEHIIRDAIADCAKTNAPIAGISIHQGAFELLHRALCRYSEHVHLIT
FT                   DSVGDIAFREVLKDLRSDPHLTEYHPDETGCLIRELFHTKGILAMVIDQGKHTKGNTVS
FT                   LFGRPSTLYLRLPQKINEMGAGIVTFRTWSEKKRIVIRFEKYYPPKYDESFGNAENAAS
FT                   SESALVTKIAREVETWIAEHPEQWSWNYHGNFIG"
FT   gene            270546..271001
FT                   /locus_tag="Fisuc_0237"
FT   CDS_pept        270546..271001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0237"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; SMART: Smr protein/MutS2;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73849"
FT                   /inference="protein motif:PFAM:PF01713"
FT                   /protein_id="ACX73849.1"
FT                   /translation="MPLNADEEFQLEWIKNHQMEDKDELAEIQAEAEAEARPQRATRGK
FT                   KMRRNPAAWEMPNPEDEIDLHGLTSEEAAEAVERRIDDLLIAGLSVLRVIHGGGNPEYG
FT                   NVKRIIDRKVRSEWKNRVVFYKVEPDNAGSSIMKIGKPRPQVTKKKK"
FT   gene            271103..271179
FT                   /locus_tag="Fisuc_R0003"
FT                   /note="tRNA-Pro1"
FT   tRNA            271103..271179
FT                   /locus_tag="Fisuc_R0003"
FT                   /product="tRNA-Pro"
FT   gene            complement(271247..271396)
FT                   /locus_tag="Fisuc_0238"
FT   CDS_pept        complement(271247..271396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73850"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73850.1"
FT                   /translation="MLTSFQFLPFVDYRNSEMDAYGVRCFGSVISASLLAAATLASLLL
FT                   ELTS"
FT   gene            complement(271411..272313)
FT                   /locus_tag="Fisuc_0239"
FT   CDS_pept        complement(271411..272313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0239"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ade:Adeh_0871 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73851"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACX73851.1"
FT                   /translation="MRRITLLTNPDACNLHCPLCFLNQRALLNCGESNCNGERPPDNNR
FT                   GRCAFGMGEMNFEIARAAVEKYAAERDASGKRLLREVIPSTMGEPLLYSHFDELLELCR
FT                   ALGIPLNLTTNGTFPGKWGSEDAMGVLLRSCRDIKVSYLASEQFDGWKANVEKLVRVRD
FT                   RLRENARCATVSLQVTLHKKNLHEVPEIVSWASAIGIDRIKWNKVVVLSVSSQELREMY
FT                   ALDDAQLESLRNEFRSGVYSALSVKHEGSLFFSDSVDLCAVGGKCESCPFADEVWVWPD
FT                   GHEDHCPNPERRFGCGKNL"
FT   gene            complement(272326..273192)
FT                   /locus_tag="Fisuc_0240"
FT   CDS_pept        complement(272326..273192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0240"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dvm:DvMF_0260 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73852"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACX73852.1"
FT                   /translation="MADILILGHGPAGVSAALYGLRAGLEVQLVGKDVGALAKAHKIEN
FT                   YFGLEKPLTGAELAEVGKKQAIALGAQIVDDEVTDLMFDGFGFVATGLNGTYRGKVCLM
FT                   ATGSARKKTPLPGMAEMEGHGVSYCAVCDAFFYRKKDVAVLGSGEYALHEATELLSVVN
FT                   SVTLLTNGAELTAKFPESVKIETRKITGLKGAGQFEGVKFDDGLEANFDGMFVAMGSAN
FT                   ATDLALKAGAAFDAGKLVLDKDFQTTVPGLFAAGDCTGGTLQVAVAVGEGAIAGLAAIK
FT                   YLREHRE"
FT   gene            273268..274383
FT                   /locus_tag="Fisuc_0241"
FT   CDS_pept        273268..274383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0241"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   scl:sce3034 endo-1,4-beta-xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73853"
FT                   /inference="protein motif:PFAM:PF01270"
FT                   /protein_id="ACX73853.1"
FT                   /translation="MLQRYPTRDLFVEAGYGPNFADQLIQNAYSKLFEGDPIDERIYFE
FT                   ASDDMAYIIDIGHDDIRSEGMSYGMFIAALTDHEVTFDKLWNFSKRFVRNNDGPHKGYF
FT                   SWQVNTTDFSMMDPGAAPDSEEYFAAALLIAAKRFNREDLLNDAKELIHDIKYKPQNEL
FT                   VGPIIDPERKLIKFSPVLGNDFTDPSYHTMAFYRMFAEATGDESWLEVAQASIEFLQKA
FT                   AHPVTGLCADYAEYDGTPKAMPWFPESNNFSGDAWRVALNLSLDYAIFHGHESEKEICE
FT                   RILHFFQNCTPYLSDYSVDGGPYPHQGRNATPGLIAMNAAATQVLPVDDPRITPFVRRL
FT                   AALSVPYRFWRYYDGMLYLIGLLATAGKITL"
FT   gene            274394..275308
FT                   /locus_tag="Fisuc_0242"
FT   CDS_pept        274394..275308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0242"
FT                   /product="MORN variant repeat protein"
FT                   /note="PFAM: MORN variant repeat protein; KEGG: hhe:HH0490
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73854"
FT                   /inference="protein motif:PFAM:PF07661"
FT                   /protein_id="ACX73854.1"
FT                   /translation="MKLPAILFIAASSIAFTACDDVRVEKYPNGNVRFEATYVNDKKEG
FT                   IEKEYYDDGTLKRESNYVNDRREGVTKEYYKDGTLQSELPYVNGYVEGTVIRYHKNGKV
FT                   ATKAEYKQNKQVAFGETYNEDGTPATSGSYKDPRDGISYEWIVIGDQLWTAENMNFATA
FT                   SGAICSQCNHWGRLYDFQNAQKACLEGFHMPSKAEWQKLLKVAGKKPGVALKAGYGWDP
FT                   IKPESPIFGNGKDELGFGAKAGGAHFAKSDVAIKDRKFDEAGKKAYFWTREGDVLVFFH
FT                   DKDIAKFEKFNPEFGASLRCLKD"
FT   gene            complement(275484..276662)
FT                   /locus_tag="Fisuc_0243"
FT   CDS_pept        complement(275484..276662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0243"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   asu:Asuc_1136 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73855"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACX73855.1"
FT                   /translation="MDNFNFYSPTEFVFGKDRENECGELVKKYGGTKVLIHYGGGSAVR
FT                   SGLIDRVKASLNAAGVSFVELGGVKPNPRDTLIYKGIEMVRANGVDFILAVGGGSVIDS
FT                   SKGIAVGALYDGDFWDFYAKKLPVTKALPIGVVQTIAAAGSEGSGDSVVTKEEGMLKRD
FT                   IGADVIRPRFAVQNPALLCTLPAYQTACGITDIMAHVFERYFTNTLEVETTDRLCEALL
FT                   ITILKEGPRAMAEPANYEARANIMWAGTVAHNGLVGCGRSQDWNSHAIEHELSGLYDCA
FT                   HGAGLAVIMPAWMEYVVDHNVMRFAQMATRVFGCQMNFENPKATALEGIKAFRRFLHSI
FT                   GMPINFAELGAKEEDIPTLVEKLNPGDGWGFVPLKAKDVTAIYTIAAHASLD"
FT   gene            complement(276755..277504)
FT                   /locus_tag="Fisuc_0244"
FT   CDS_pept        complement(276755..277504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73856"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73856.1"
FT                   /translation="MSKLVKIALVAVMLLALTSFAQSEGIQKKNIVFHTFSIALPMDWG
FT                   GTWTQYSNLEYDDGSFSRDRDFKMDMIMGLQLKWTRDLVYQNGLSFEVGAGIGFINFPV
FT                   NESKKYSYFDPYDHMNQIDSRFDLNAKVGLGYAPFVNDFILAVHAILGGDMKYLGKSYQ
FT                   MEDFTEEYSTLLFNFVVGGDIVLGYRITEKLGINAGVDVVVNLFGFGNRTNEFNYRNDN
FT                   FETIDYKLNHVFSGFQIVPCVGVSLKF"
FT   gene            complement(277712..278929)
FT                   /locus_tag="Fisuc_0245"
FT   CDS_pept        complement(277712..278929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0245"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: dat:HRM2_22190 ArgJ; TIGRFAM: arginine
FT                   biosynthesis bifunctional protein ArgJ; PFAM: arginine
FT                   biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73857"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ACX73857.1"
FT                   /translation="MYTVLEKGGVCSPKGFTASGICAGIKASGNADMALLKSEKAARCF
FT                   AVFTTNKVKAAPVLYDKAALEHAHFASAVIVNSGNANACTGEKGYADAERMAVLTEEAL
FT                   KLTPKSVLVCSTGVIGHLMPMDKIEAGIPKLVEKLHEDASEEFGRAILTTDLALKSHAV
FT                   EIKTEKGVVTIGGACKGSGMIHPNMATMLAFITTDLALPIDFFAEFRANIADSFNAITV
FT                   DGDTSTNDTCIMLANGMSGIKYEDLSLSEQGEFRAALTLVMQSLAKDIVRDGEGATKLI
FT                   ELRIEKAESHEEALRMARFIGTSNLAKCAMFGEDPNWGRILSSAGSSGCNMVAEHTDLY
FT                   FGEVKVLEGGRPVQLDEKQTAALHAVVRQREYKVTLVLNIGQASASAFTCDLSYGYVKI
FT                   NAEYTT"
FT   gene            279016..279471
FT                   /locus_tag="Fisuc_0246"
FT   CDS_pept        279016..279471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0246"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: dal:Dalk_1239 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73858"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ACX73858.1"
FT                   /translation="MFTQEAYDKLVKDLENLKNVERPRVLQELVDARAQGDLSENAEYH
FT                   AAKERLASIDNIEMPKLQDQLARAQVIAFDANSDTIKFGATITAKNLKTKREIVYQLVS
FT                   PEEADALNGKISFKSPIGAALMGKKRGDTVEVVTPKGKNQFEIIDFK"
FT   gene            279475..280443
FT                   /locus_tag="Fisuc_0247"
FT   CDS_pept        279475..280443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0247"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta; KEGG: ppd:Ppro_1733 DNA
FT                   polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73859"
FT                   /inference="protein motif:TFAM:TIGR01128"
FT                   /protein_id="ACX73859.1"
FT                   /translation="MFVTLIGKDQFSKDKRIEKFLSETLGDRISDPMAKQVLYATDTNI
FT                   ASISDVIIEACDSVSMFSPEQVIVVRKAEALKTDDMKALAKWLPHAASGKLLFDFETLL
FT                   ASSELYKALAKVGKVEKFDVPKQYEMAEWISAVVPTHFNKAIEPTASQYLAEALGNDTK
FT                   LVSEEVEKIILYAPDCKKITLDLVKTMVVSQRDIPTYEIEGFFGMQNAKAYVQKLNELL
FT                   NSGVDAIRISNTLYNYALSLLNYGSLTAKGVSPEEAAKKIGKNYYMFVKKGQAAECCRR
FT                   WRKPLLVRVLRRLADLNYEIKSGKCPTRMSQELALAALVVR"
FT   gene            complement(280528..281991)
FT                   /locus_tag="Fisuc_0248"
FT   CDS_pept        complement(280528..281991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0248"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   Secretin/TonB short domain; NolW domain protein; KEGG:
FT                   gbm:Gbem_1550 type IV pilus secretin PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73860"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ACX73860.1"
FT                   /translation="MKKLTKILTILIMVASFATAWAAPAEGSVAPNKKLYDFNFVNMDY
FT                   EAIFRSVSVIAGVDILIAPDVKGKISLRVTKKTWQETLDIICNMNDLTWVIQDKYISIQ
FT                   RLSTYQAKQKKLADEENQAEQNAPLVRKNFQVHHAKADELVKVLESMKSNRGKISVVER
FT                   TNSIIVYDTESKIEQMGNALVELDVETLQIMITAKLVVVNSELARELGVDWTAALGSST
FT                   LTPGTAAAATGATAGSSRISGVIQSFPNGTSPAVGKANTAITASLLDNNLQIAISNLMG
FT                   DASTEVLASPQVSTLDNTEAQVFMGDKVSIRVIDDSGESSTKMVETGIKLTVTPHVSGD
FT                   NRILLDLHPENNSYGYDEKGEVVISTQEAKTKVVVADGETVVIGGLTRNENTESESGIP
FT                   FLKDIPLLGNLFKYSRKSITKKDLVIFVTPRIIRNYIGNVDISEKSEEINGAAPELKPV
FT                   DDKIMTSPVVTGETPDAPVPENSHDDWNQ"
FT   gene            complement(281988..283760)
FT                   /locus_tag="Fisuc_0249"
FT   CDS_pept        complement(281988..283760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_5199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73861"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73861.1"
FT                   /translation="MKCKFLLMLLSSAVALQAALIKDVRFDCSKNCQMVFQFASDKNLP
FT                   TFFQKYDNASKTLTVGFSESDFALGVGNFDVDQSSPYVRSMNVSKELYRGMNFLMIRMP
FT                   VGASIASDKNAIALDKSRFLLKFSGKNGNSWTLSKLFASKKAAAEKAAREEEKRMAAER
FT                   KAAEKQAALDRKAAEKQAALDRKAAREEEKRLAAERKAAEKQALLERKAAEKAARDNIA
FT                   QAASAPGASALLPGLKEMTVIIGSGMEQFRLVANTSLNINKVSLPNGSFVIKLSIDGPE
FT                   RSPVFKVGAGSLVKSVFWDMDGLNIQLSAGAKPAILVQEGALILQTSENAIRRDGFVFW
FT                   SARPNGIYVRDWMKSPDAVPEFSDFVKSYEKDSKKVVASTQTFHLRPVLRELIVVADET
FT                   EFYASPSDKAPVMQRVVFGDRLVNMDLTGLYRKVQIGNKIGYVNRRAVSFTDELSAVQM
FT                   ERLKKVDQERGDMLTQGMRPGGSALDELYEDRVTYSSFGRRDPFVEIKGLVEEGINIDQ
FT                   VELVGIIWESEEPVAILVDSKNSGVSYTIKEGDKIMNGKVLKITQTDVLFLIQEFGVSR
FT                   RYSMGLPDKFGGQK"
FT   gene            complement(283760..284365)
FT                   /locus_tag="Fisuc_0250"
FT   CDS_pept        complement(283760..284365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_11010 PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73862"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73862.1"
FT                   /translation="MGNLNIDFKDKKNLYCIVTIVVICLALYSVYTYIWDPFQIEYESL
FT                   ESQRVSAQKELDKINSKKHRVAELEMQLVQAEKDFQKLKEMFPEEEKVPLRLQDLYSVL
FT                   RSSGVQIQKFNPEGRSEREHYIENRYSIAVNSGYHMLGYLFAEIANFNYPTAITNLKLS
FT                   RYSGIAAEVQKAETHGWTPITMSVNFNLTTYTSKKVGK"
FT   gene            complement(284367..284978)
FT                   /locus_tag="Fisuc_0251"
FT   CDS_pept        complement(284367..284978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0251"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   bba:Bd0864 fimbrial assembly membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73863"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ACX73863.1"
FT                   /translation="MATKKNKGVNKALAITINLLPGEHRKQQKDLTWLTDRRVVWPTVF
FT                   LILAIFVALFTYAYTLQELSSKEAELQSVRAAVERERPLLKKISELEKNQSIINTKINA
FT                   LKSIQISKKRWVVLFENISSVLPPNMWLLSVSQVSEFNLEMKGTTFDFSEVAEYMVKLE
FT                   KQVSVQKVSLVSISTTKVDGDEAYSFTLKVELKKDLGEEG"
FT   gene            complement(284978..286126)
FT                   /locus_tag="Fisuc_0252"
FT   CDS_pept        complement(284978..286126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0252"
FT                   /product="Tfp pilus assembly protein ATPase PilM-like
FT                   protein"
FT                   /note="KEGG: geo:Geob_3070 type IV pilus assembly protein
FT                   PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73864"
FT                   /inference="protein motif:COG:COG4972"
FT                   /protein_id="ACX73864.1"
FT                   /translation="MALGLIARIRGERETVGIDVGHYSIKYVKVYHDANGKRIVREVDL
FT                   EPVPAGSIINGLIQRRDTDDLSTEKGAKKEKDGFDKLGEAFSKLLLRHPIDENVDVVAS
FT                   VNCGAGEGGVLVDRLSIKVPKNGNEAAIIVQTAQSRPPFDDQDNVLDYEVVSREGDEVK
FT                   VNVVAAKSSMLDSWAQFFTRKGVRLSALDVDIFGLLNSFVMTASDEERKKTTAIFNIGD
FT                   NKMSVGFIQDGAFHSVRSMNGGSLNVIINKLSSSLDISAEKCHEMFEKNDLKVIDNVAI
FT                   SVLEDAMKVAFEELMSQITFGIRYHSSAEDSRPLERILIGGGGAAVPGLLEYIAEKTGI
FT                   ETATVNPFRSVECDSSVVDKDGMSIALSNIYAPALGLAMRKF"
FT   gene            complement(286218..287294)
FT                   /locus_tag="Fisuc_0253"
FT   CDS_pept        complement(286218..287294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0253"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73865"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ACX73865.1"
FT                   /translation="MISWFQEVGRDILDVWMFFTDHPSLQILVIVLIFLAVVLIEVQLM
FT                   YKRRETDVMFGTDAFNEKIKAFDFTPKEVETLGDLVRSSKFENMDAVLNSSGLFEAAVS
FT                   EYYRIRNVFSVRDETLEAIAGLRRKMDFTGSNPLSMVCSTRQFNIGDKVDLEFENGQSF
FT                   KRIPIYERTEKVWSVKIDGSPSLAKALVGSHALVRWTRMNDAVYSIHLNVLAATPDKVV
FT                   FTHSASLDKEQLRKWVRQVVDFPVTATFPNGDTHSGVLYDLSAGGILLGLADDVKPDQQ
FT                   FSISFELPTFGVQNVDVKVLNNLGHRNPNFPLYNSISAVFTGAYAWTQERVLQYIFEST
FT                   RKAKSKKTELNGVNSETT"
FT   gene            complement(287309..288568)
FT                   /locus_tag="Fisuc_0254"
FT   CDS_pept        complement(287309..288568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0254"
FT                   /product="dihydroorotase"
FT                   /note="KEGG: azo:azo3463 dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73866"
FT                   /inference="similar to AA sequence:KEGG:azo3463"
FT                   /protein_id="ACX73866.1"
FT                   /translation="MKMRKPCKGRLVNVVLKNAKFWNGKSFELQNEVRLNACETSETVE
FT                   FDCNGALVMPALFGLGLDFMEPLRDDVYTFADGFDAMRKGGFYGGLYESAANPIDDADK
FT                   YTAMVNRFKSEERGEDAFDIKFLGAYSKGFGTDSLAEMVELAEAGVAGFGDGNGVIPHS
FT                   RFLRLAMEYGKMTGKRFFFQPMDKTLRHSGCVHEGAYSDMLGMKGIPRIAETIAAYTVL
FT                   ETARFLQVPVHFKQVTCGETLELVRNARKNGIDVTCDVNLYHLLLDDSCLETLDSAYHI
FT                   LPPIRSAADREALWQGIVDGTVNAISVNHTPVLRQDTVVNFEDSVPGALSLEVALPAIW
FT                   NKLVASVGEARAIELLSTAPARLAGAESAGESVVVLAPEKTHKVLESDFAGHVCNSPLT
FT                   GKVLPSSILATYINGVFTQL"
FT   gene            complement(288555..289496)
FT                   /locus_tag="Fisuc_0255"
FT   CDS_pept        complement(288555..289496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0255"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: dps:DP0106 aspartate carbamoyltransferase;
FT                   TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73867"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ACX73867.1"
FT                   /translation="MSALEIKHLFGLRGVSKHDIRLILDHAKQFREILERPVKKVPSLR
FT                   GMTVVNLFFENSTRTRTSFELAEKRLSADTVNFASSNSSVKKGETLVDTLRNIEAMKID
FT                   IVVVRHKGTGVPKFLADNSNAIIVNAGDGAHEHPTQALLDMLTIEEKLGTLEGKNVTII
FT                   GDIRHSRVARSNLWGMSTMGAHVTLCGPSTLVPRNTDLMNHVTWEPDVKKAVANADAII
FT                   ALRLQKERMDDALLPSMREYRNTFGITEELLECAKDKVIIMHPGPINRGVELDSDIADG
FT                   EHSVILDQVTNGVAVRMAVLFLLAGGRNNENA"
FT   gene            complement(289498..290055)
FT                   /locus_tag="Fisuc_0256"
FT   CDS_pept        complement(289498..290055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0256"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: dde:Dde_2016
FT                   bifunctional pyrimidine regulatory protein PyrR uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73868"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ACX73868.1"
FT                   /translation="MNDNCKKVSELLTAQTMEFALDEMAAKIAKMHPSADNMIVLGMAS
FT                   RGIPLAKKLTERLSQKFGKPIEMGSLDATYYRDDFHYRKKVATEMRFTEMPASVEGKTV
FT                   ILVDDVLYTGRSALAAMRSILDLGRPAAIRLCVLVDRGHRELPIAPDCAGLTVETARNQ
FT                   EVRVAIEPIDKENSVYLVEVEA"
FT   gene            290301..290852
FT                   /locus_tag="Fisuc_0257"
FT   CDS_pept        290301..290852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0257"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: spl:Spea_2685 peptidyl-prolyl
FT                   cis-trans isomerase cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73869"
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /protein_id="ACX73869.1"
FT                   /translation="MAFNQLDKPQAGETIAIMKTNHGTMKLRLFEEIVGECATNFIELA
FT                   KQGKYDGAPFHRIINDFMIQGGDFTNRNGTGGHAAKGPGSTIGDKYDPRLTHMRGALSW
FT                   AKTSMPHSIGSQFFIVHGNRVHFLDHAECGPGPADGYSVFGQLYEGFEVLDEIASVATD
FT                   RMDRPFEDVIIESVTIEKAV"
FT   gene            291033..291108
FT                   /locus_tag="Fisuc_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            291033..291108
FT                   /locus_tag="Fisuc_R0004"
FT                   /product="tRNA-Ala"
FT   gene            291268..293283
FT                   /locus_tag="Fisuc_0258"
FT   CDS_pept        291268..293283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0258"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: pca:Pcar_2324
FT                   metalloendopeptidase-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73870"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACX73870.1"
FT                   /translation="MVRLTKISSLLLSAGCALSFAGTGSNTVCDASKMDAFAYEDCIAV
FT                   QRGAKLDNTDFSERAAPPPELISESYVEPFSYDPFNRDAYLTSSFGENRGTRYHAGIDY
FT                   STLMEEGWPIYAPENGYVREIKTSPFGYGKVMFFEGESGKTWVFAHQSSFPQTIENLIS
FT                   QKQYATQNNDISIKPNLRFRKGDTLTFSGSTGIGNPHLHLEVRLNKDIVVSPCQVGVKC
FT                   LDTIAPQIFGVAVWQGNELSLTTDEALRNGCVEIPVKNEFNLSMAIKIADYSRTPKENP
FT                   MAIRRLELWRYDDKIYSKVLDTLNYKKMIDIRNELLWAEEADTAGDWHYINAKLGPIST
FT                   YRLEIEDFSGHITKREFNFHQSCKTNNGKFVLTQNQNTPLYTFLSKSMLDIYRCESGYK
FT                   FTALNKDKQTINGDLCKIFDHSKPLPLGKVVETFPETRYIQYSADASSTGTGRGVNELI
FT                   SIYPYGKYKTNINWYTQVGNVKISQKISGIPVVGDTSQRVLAVTRNQTDSVDFYEFHPK
FT                   GLQFYGKWNVCIENDDNSSPLYWLGETTRRWFYFEKQTGSKNRCASTNELRDLANINDE
FT                   DGFSLGFPYWTETLVAGRPQSALKIPLYSRYAGIPDGNAITVKAGKKWIAAEYDSEPRE
FT                   IILLGEALPDAGETITVEITDDSKRKTKKEITIPGF"
FT   gene            complement(293280..294005)
FT                   /locus_tag="Fisuc_0259"
FT   CDS_pept        complement(293280..294005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA6939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73871"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73871.1"
FT                   /translation="MCKRFLLCFHDFSVWNHQKVTPILEELKELVGGPFSLLVIPDTEN
FT                   ATDEAVENFRAALAKLKSEGFELALHGFKHKAEFSQGRSYVGLVGMNLTGGEAEFAGLS
FT                   EYESSRLLQAALESWKKLFADENGNADAPIAFVPPTWFSNKFLPGQVRAEKMLYEDRFS
FT                   LTTAEGVRYASPVASFAGIPKSTEKAAFVYAEGILKIPFGVPRIAVHPVDFPRLNDKIR
FT                   DLIRLALGRKRRLTLYRDL"
FT   gene            294059..294901
FT                   /locus_tag="Fisuc_0260"
FT   CDS_pept        294059..294901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0260"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   dal:Dalk_2390 undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73872"
FT                   /inference="protein motif:PRIAM:3.6.1.27"
FT                   /protein_id="ACX73872.1"
FT                   /translation="MFESIILGLLQGLAEFLPISSSGHLVLGHELLGMNEAGMFFDIML
FT                   HAGTLLSIFVVFHKKITDIIVGCLRRDRDQLREAGYIILASIPTALIGLGFKDALESLF
FT                   ENPRAVCVAELFTGLLLFTSQWGPTGAKHPDNEGVKMNWWRALVTGTVQGIACIPGISR
FT                   SGSTISAMMFMGVNRKYAGEFSFLMSIPAVGGAALLDCIKWIKCQTMTPEKALLNPEKA
FT                   LKCVDAGGFTPELLVGMIVAFIFGIIALKWLMNFVQKGKFQHFAWYVWAVGILGLILL"
FT   gene            complement(294995..295195)
FT                   /locus_tag="Fisuc_0261"
FT   CDS_pept        complement(294995..295195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73873"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73873.1"
FT                   /translation="MDETLLNEVDGMTDLLYEKQGSYLQGKGDGILESAQLMVDSGILT
FT                   PEKAAELFKVRKEDIRPRNNK"
FT   gene            complement(295847..298507)
FT                   /locus_tag="Fisuc_0262"
FT   CDS_pept        complement(295847..298507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0262"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   KEGG: tbd:Tbd_2275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73874"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACX73874.1"
FT                   /translation="MILKSYQKQIIDDLALFLEKLKERRNIAEAFNAFWMLHPRTPITP
FT                   SFGEAVEPYKNNVPNCPHVCIKVPTAGGKTFIAANALSAIFKELDPARPKIAVWLVPSN
FT                   SILEQTIRNFSNPRHPYREQLNTDFANKVNVFDKRMLLQGAGFNTSSVRENMTLCILSF
FT                   DSLRARKKEDRKVNEENGNLQSFAKDVGEEEISVMSVLRAFNPVVIVDESHNAESELSV
FT                   EMLKNLNPSFILDLTATPRKNSNIISFTPAIELKKENMVKLPVIVYNHHKKEEVVSSAL
FT                   ELRSKLESAAVEAEKSGAPYIRPIVLFQAEPKTKDDNATFECVKSMLLEKKIPEEQIKI
FT                   KTADKNELQNVNLLSKDCPVRYIITVNALKEGWDCPFAYILASLADRSSSVDVEQILGR
FT                   VLRLPNVRKNENVMLNMSYVFTASARFSETLDSIVKGLNRAGFSSSDYRQVELEKSVEP
FT                   TEMPMNESIASMSLLNDSNGGSKEGEFDLSSILWNGDDSSLSPASVASVSDHGDAKSEL
FT                   QNQQSSIMAQIEHLAQKENEELEKRIEENRTSPVAPPEMEKQVKTYAIKSIFKDSASQI
FT                   ILPKFFMKGAVEGLHVDLFGIANTPFDKDMLLKNFPLRNADTNINFENVDVEMRSIDLD
FT                   ESQKDFTPTIFSVGKNQQAEITRWLSNIEDVERKRQKCAERLRDWIGNMYPIPDPDIIE
FT                   YIRRVLSNFNDKDLNQMLNSQSTYAERIKQKINALAAEYIETEFDRTLDQDKIILRQHY
FT                   RIADKLTLSSAGKPLPKTLHEKEENVNGFEETVINAVANLENVEFWTRNREKKDFCING
FT                   FINHYPDFIIKTKHGKIVMLETKGDHLDAEKKIKLGNLWASKAGNNYRYCLVYEHRKVD
FT                   HAYTKDEFLATLKEW"
FT   gene            complement(298546..300324)
FT                   /locus_tag="Fisuc_0263"
FT   CDS_pept        complement(298546..300324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0263"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   tbd:Tbd_2276 adenine specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73875"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ACX73875.1"
FT                   /translation="MPTLNWLGKDAVLNHHLDVPYRTLELKESFNCESGKSENKIIHGD
FT                   NLEALKALLPEYEGRVKCIYIDPPYNTGNENWVYNDNVNSPKIRKWLGQVVGKESEDLT
FT                   RHDKWLCMMYPRLTLLQKLLADDGAIFISIDDNEQANLKLICDEIFGAGNFVTQFIWQS
FT                   TPGSNTGNDIKVVTEYILMYKKRFFIPNTRNIDDFEKYDLEDEYKDRRGKYTTNKLDRR
FT                   MTGSHYSESLNYQIKMPDGTFLYPGSSIDKLKHWNWRWSEAKVAWGIEHGFIVFKNNNG
FT                   NWSVYFKQYCNVNNNDELIERSLPYQNLLEDESFNSARGTADLMKIMSMKAFDYPKPIS
FT                   LIEEILEIATDKSSIILDSFAGSGTTAHAVLNLNKQDGGNRKFILVEMEDYADKITAER
FT                   VRRVIKGYKSDEKRELYSKELTLKDIANGQEIMDELKGVRDEHKDEFDKFETTFENNCL
FT                   KLAGITKGRSEGTGGDFCYYELGPEMLLDGYLNEAQPVEKIREYIYYTETNKSIDYQRV
FT                   EQVGHEFFLGDVDNTSYYLFYKKSEVTTLDFEFLATIKLRSERYVIFADNCVLPKDFLF
FT                   EHNITFKKIPRDVRKF"
FT   gene            300813..301610
FT                   /locus_tag="Fisuc_0264"
FT   CDS_pept        300813..301610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0264"
FT                   /product="KilA, N-terminal/APSES-type HTH DNA-binding
FT                   domain protein"
FT                   /note="PFAM: KilA, N-terminal/APSES-type HTH DNA-binding
FT                   domain; KEGG: tdn:Suden_0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73876"
FT                   /inference="protein motif:PFAM:PF04383"
FT                   /protein_id="ACX73876.1"
FT                   /translation="MKIKVMDAEISVQRIGNEDYISLTDMLKAKDGDFFITDWLRNRNT
FT                   LEYIGIWEKVYNPNFNYGEFAIIKNHSGLNSFKISVKEFQARTNAVSLVAKAGRYGGTY
FT                   AHKDIAFEFAMWISAEFKIYMVKEFQRLKEAEQAQMGWSVRRELSKINYHIHTDAIKQN
FT                   LIPATLTKQQMSMIYANEADVLNVALFGFTAKEWRDTHADLQGNVRDYASVNQLICLSN
FT                   MESLNSVLIKEGLPQPERLQKLNQIAISQMTVLESIGENKLLK"
FT   gene            301777..303663
FT                   /locus_tag="Fisuc_0265"
FT   CDS_pept        301777..303663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0265"
FT                   /product="Heat shock protein Hsp90-like protein"
FT                   /note="PFAM: Heat shock protein Hsp90-like; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: psa:PST_1885 heat shock
FT                   protein 90"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73877"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ACX73877.1"
FT                   /translation="MATEKMEFQTEVRDMLNLMINSLYSNKEIFLRELVSNAADALDKR
FT                   RFLSLSNSSLLPVGTQLRIDISVNKEGKRLIVEDNGIGMNKEDLINCLGTIARSGTKNF
FT                   IKNLKDADKSSVDLIGQFGVGFYSVFMVAKKVEVLTLKAGETQGYLWSSEGTGDFEISE
FT                   APLDKVGTKITLYLKDDEDADDFASEWKIKDIVQKYSGFVSYGIYFHPEATKNDKGELE
FT                   EKPEERLNDKTALWRQSEKEVTEEQYKDFYNVISHEADEPAAWSHSHAEGSQEFWSLVY
FT                   IPSKAPFNIWHNDALHGLKLYVKKVFIMDDCKDLLPPWLRFVRGVVDSEDLPLNVSREI
FT                   LQNNKIITNIRKHVIKKVLDALQNMADKDVAKYNAWWRELGMVLKEGFYMNWEHLDELK
FT                   KLLRFESTKTEGDALVSLDEYVKRMPEGQKEIYYLVGDKNAIKSNPMLEAFKAKGYEVL
FT                   LMSDGIDEFMMSSLTEFGDKKFHDISRGDVDFEKTEEEKKAEEENKGIFKGLCENLQKV
FT                   LDENIKEVRVSSRLKDSPCCLVTSEDAMSAQMERMMKAMGQKNLPKSKRILEINPTHPI
FT                   CEMLKKKAEANEDLGDWPKALYGQALLAEGSPLPNPAEYVAAITKLLTASVK"
FT   gene            complement(303737..306004)
FT                   /locus_tag="Fisuc_0266"
FT   CDS_pept        complement(303737..306004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73878"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73878.1"
FT                   /translation="MKMFARFLPFLLVTAMSVFTACGGDSGSNADSEEPVSSSAVKKSS
FT                   SSNANSSSSKKVSSSSAKSSSSAKTSSSASGAKAVYDEKNNTMKDPRDNKTYKTVKIGD
FT                   QVWMAENLNYNSGLSYCFGEEPSYKQNSHPGLCGTYGRLYKWDAATEVCPGGWHLPSKD
FT                   EFETLIQTVGGSGNAGIKLKSVDGWKFEKKETVGTDEYGFTALPGGFRKEDDLSDYVTE
FT                   NIESYDFIGDKTEAYFWSSTEDVESSTRLDGNRILVDHAFCMSLENRYAKADIWGEPMI
FT                   NAMSVRCILDSKTSSNEKSSSSKANSSSSAKSSSSAKSGSSVAVPKGCKTSTKDNCEYG
FT                   ELVDDRDGQTYKTVKIGDQWWMAQNLNYRREAKYKNDYCYCYNNSKDNCDKFGRLYVWT
FT                   AAADACPEGWHLPSTAEWKTLIDSVGGEEVAGITLKTSGWNRGGDATDAFGFSVLPAGY
FT                   RDWLYQDDYYEEGYQALFWSSNEYENSSGCVYFQSVYDGADIRSGNKDDGYSVRCVMDV
FT                   EPKIIEPPVIIVPEAKACKTKTKDECEYGTLTDSRDKQTYKTVKIGSQIWMAENLNFET
FT                   NSSYCFNDSAKYCSKYGRLYTWAAAMDSAGVWSENGKGCGYQKTCTPTYPVQGACPSGW
FT                   HLPTKAEYDTLFAAIGGSETAGEKLKSTSGWSEGGNGTDDYSFSASPAGYRFINGIYPI
FT                   YSEIGYLGVLWTSTEAESDEWCDETCRRVVACNVSLTSLNDDSFVGNVGKDDAYPVRCV
FT                   KN"
FT   gene            complement(306054..306179)
FT                   /locus_tag="Fisuc_0267"
FT   CDS_pept        complement(306054..306179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73879"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73879.1"
FT                   /translation="MRFSCFVIPDLYKYKALRLSYENASIFAAFALVAFVPGSPF"
FT   gene            complement(306176..307591)
FT                   /locus_tag="Fisuc_0268"
FT   CDS_pept        complement(306176..307591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0268"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   gbm:Gbem_3060 putative transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73880"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACX73880.1"
FT                   /translation="MLSYDISKAGDDTLYHFLYRSIKDDILSGRLEADAKLPSKRPFAN
FT                   ALGVSVVTVENAYEQLLAEGFIYSLPRKGFFVAAIQSKNPQILPKPVPTKQSRESQRVE
FT                   PPKTPHYIADFVNNQVDASTFPFSTWAKITRKVLCEQQNELLTRSPNSGVIALRKAIAK
FT                   MLLEFRGMRVDPEQIVVGAGTDCLYTWLVQLLGFDKKYGVEDPGYSKISKIYQKLNVVC
FT                   NFIPLDEQGVRIDQLEETCTDVVHLSPSHHFPTGKVMPVSRRYELLSWASKSSNRYIVE
FT                   DEYDSEFRMVGRPIPALQNIDVQDKTIYINSFSKTLASTVRVGYMILPKPLAQKFREEF
FT                   SFYTCTISNLVQYVLAAFISGGHYEKHINRMRNFYRHRRDTLLDIIRRSPLHDRVEIAE
FT                   QDAGLHFILKVKTTLSDEEFCNRALEKGVRIGALSDYYTMATPSQHEFVINYSSVPEKQ
FT                   MKKAISLLEKIVE"
FT   gene            307854..308732
FT                   /locus_tag="Fisuc_0269"
FT   CDS_pept        307854..308732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0269"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; KEGG: hip:CGSHiEE_03820
FT                   pyridoxal biosynthesis lyase PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73881"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ACX73881.1"
FT                   /translation="MPTENRYELNKNLAQMLKGGVIMDVTTPEQAKIAEAAGAAAVMAL
FT                   ERIPADIRAAGGVSRMSDPKMIKGIQDAVSIPVMAKCRIGHFVEAQLLEAIEIDYIDES
FT                   EVLSPADDVFHINKHEFKVPFVCGARDLGEALRRIEEGASMIRTKGEPGTGDIVQAVRH
FT                   IRLMNQEIARITSMREDELFNRAKELQVSYELVKFVHDHKRLPVVNFAAGGVATPADAA
FT                   LMMQLGAEGVFVGSGIFKSGNPAKRAAAIVQAVTNYKDAKLIAKLSEDLGEAMVGINEN
FT                   EIALLMAERGK"
FT   gene            308733..309356
FT                   /locus_tag="Fisuc_0270"
FT   CDS_pept        308733..309356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0270"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   hiq:CGSHiGG_01920 glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73882"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACX73882.1"
FT                   /translation="MSENKTNNHIKIGVLAVQGAFAEHRQILEKLGVETFEIRQLRDLE
FT                   QDFDGLILPGGESTVQGKLLHDLRLFEPLRERIESGLPTFGTCAGLILLAEKLSNDGHT
FT                   YFATTPVTVERNAYGRQLGSFYTEENFEGIGKIPMTFIRAPLIQRASQDVQILATVQNQ
FT                   IVAVRYKNQLAISFHPELNNDLRVHQYFVEEIVKANQIQAKKAA"
FT   gene            complement(309361..309753)
FT                   /locus_tag="Fisuc_0271"
FT   CDS_pept        complement(309361..309753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0271"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   dol:Dole_1253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73883"
FT                   /inference="protein motif:PFAM:PF06803"
FT                   /protein_id="ACX73883.1"
FT                   /translation="MANGKVYDDVEVHDMNDMHREKRSVKTGDEQNGAPVVWKALSVII
FT                   AMLAVVYDLSPIDAVPDTIPLFGWLDDVGFTVMAALNAYQQFAKDQNSMVVRLAKYVKW
FT                   MMVAFIVLAGVAVGGLITAIIALVTR"
FT   gene            complement(310002..311486)
FT                   /locus_tag="Fisuc_0272"
FT   CDS_pept        complement(310002..311486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0272"
FT                   /product="Domain of unknown function DUF1846"
FT                   /note="PFAM: Domain of unknown function DUF1846; KEGG:
FT                   ATP-dependent Zn protease"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73884"
FT                   /inference="protein motif:PFAM:PF08903"
FT                   /protein_id="ACX73884.1"
FT                   /translation="MFKVGFDNDAYLKTQSEKIQERISKFGGKLYLEFGGKLFDDHHAS
FT                   RVLPGFAPDSKIRMLEKLKDKAEVIIAINAGDIEKNKVRGDLGITYDQDVLRLIDAFRG
FT                   YGLYVSSVVLTRWQEQPSAVAYQKKLEGLGLKVYRHYPIAGYPSNIPLVVSDDGYGKNE
FT                   FVETSRELVVVTAPGPGSGKMAVCLSQIYHENKRGVKAGYAKFETFPIWNIPLKHPVNL
FT                   AYEAATADLNDVNMIDPFHLEAYGKTTINYNRDVEIFPVLNALFTRILGESPYKSPTDM
FT                   GVNMAGNCIVDDAAVCEAANAEIIRRYYNTLCQVRKGNAEKDQVYKLELVMEQAHISAK
FT                   DRKVAVAAVAKAEETNGPAVAIELNDGTIITGKTSSLLGASSAMLLDSLKHLAGIPDEV
FT                   RLLSPMVIEPIQNLKTKQLGHKNPRLHMDEVLVALSVCALTDYNAKIALEKLPELRHCE
FT                   VHSSVILSQVDVGVFRRLGVNLTSEPNYQTSKLYHG"
FT   gene            311592..313220
FT                   /locus_tag="Fisuc_0273"
FT   CDS_pept        311592..313220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0273"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; HI0933 family
FT                   protein; KEGG: geo:Geob_3530 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73885"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACX73885.1"
FT                   /translation="MFTYRYRELAVALEKKGEVRLALAKTLRVNPEEIFNLEVERFSLD
FT                   SRRKGDLHWSYNVVFDLKRKVRASGNNARGLIESKREIRSLDAEPLKDTVTMASHVDVI
FT                   GAGPSGLWAALHLLRKGFSVDIYEQGKQVEERFRDIRKFFVDRKFNAYSNVLFGEGGAG
FT                   AFSDGKLNTRSRNLFSETVLKDMVDFGVDESVVTFAKPHIGTDKLVLMLRQIRAEIVRL
FT                   GGHIHFNTSLEDIEIKEGRICAIKLGDALGVAGSHWQPCEALVLAVGHSARSVYEMLHA
FT                   RGVTLESKAFAMGVRVEHPQSLINMRQLGLNVDTRLTGAAEYFLATPTINKTSSAYSFC
FT                   MCPGGVLVPCASEPGTLATNGMSYSRRNGAFANGAIAVPITAGAEGFDITSSGSLFGGL
FT                   DLQRKIETDAYNVGGKVYAAPAQTIKNFLAHREDKTLPKTTYPCGLVPSNLWDWMDTTI
FT                   CQSLAEGFQNFDRKIPGFINEGLIVAPETRTSSPLRITRNNETLESVNTQGLFVLGEGA
FT                   GYAGGIVTSAADGVRLAHYAKKEKI"
FT   gene            313217..313369
FT                   /locus_tag="Fisuc_0274"
FT   CDS_pept        313217..313369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73886"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73886.1"
FT                   /translation="MSYEVASLWGRAKALWGRIALSKKHCFLTLFLKAPIGASPYLITP
FT                   YPKSL"
FT   gene            313366..314526
FT                   /locus_tag="Fisuc_0275"
FT   CDS_pept        313366..314526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0275"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein; KEGG:
FT                   mxa:MXAN_5912 RluA family pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73887"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACX73887.1"
FT                   /translation="MITRTIDRNFANMRLDRFLRKAFPEESLSVFFAVIRKKKVRVNGV
FT                   VGKANQMLVEGDVVNIYENFKSVNESDERRETKDERNINGESLPLASAAEAAPATPSSG
FT                   DTPQRPDAKSATGFAKNKSTWGRHLTGAEKQAHWGAHELDLVVQTEDYVIVNKPSGLAS
FT                   QPGSGTRPGESLVEYLWEWGRNEGLDFKPTIAHRLDQETSGLIIAALHGDTLRDFTRMI
FT                   REHVVDKFYFALVKGNLKKDRGTISESLLRTDSAKGSKMLVGQDDENAQKAITHYRVKQ
FT                   HYEGYDLVKIKLETGRMHQIRAHFASIGHPLLGDTRYGDFALNREVKKLFGLNRLFLHS
FT                   CRLEFDWQGEHKVFDCPLPKELRDVIKQLKPMRFERPENNFQRSRR"
FT   gene            complement(314569..316980)
FT                   /locus_tag="Fisuc_0276"
FT   CDS_pept        complement(314569..316980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0276"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: bba:Bd3339
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73888"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACX73888.1"
FT                   /translation="MEKSPKSENIENSLEWERSRLDKEQLEAVETTEGYVRVVAGAGSG
FT                   KTRTLTHRYLYLVKEMGISPANILCVTFTNKAAAEMKKRIRSILGGDDSGYISTFHGFC
FT                   VQFLREEIHVLNYPKEFMILDEDDQKSLLRKAYADLGFSLKDLKISSVLDFVGGRKAND
FT                   IGYVSLFAEHLADEVGASAAENAPAVENEKREHLVELADEAPDKWMAVYYRYLYEQKKN
FT                   YALDFDDLILVTLYILENFPEKLDKWRKRMMYVMVDEYQDIDGQQYCLADLLSSYHKNL
FT                   FVVGDPDQTIYGWRGADINRILEFDQFHKGTKTILLQNNYRSTPSILKVPDAVIKNNKY
FT                   RIEKVLRPVRAGGKTPVFYHAKNTREEAKWIVERIQNAVQNSVKNGAGGVHYKDIAVLY
FT                   RMHSQSRSVEEALMSESIPYKVYSGVGFYQRKEIKDIICYLRMLVYADDLSFIRTVNTP
FT                   KRQFGPKKMAILQAFADTRKVGLYEALLEIVYEAGRLNDVAPDVTTQAELSSVGNDHRK
FT                   IDFDCKEFLSRSNVVEYVKLIEKYRSRYKDMRVSELLSKMLRETKYEEMLRLDGDEDRL
FT                   DNLAELKQGILEFENYYEEDASLDEYLQNIVLFTNADEDSQEKDRVQLMTIHNAKGLEF
FT                   PYVFVCGLNEGFFPVKRVQNKMQLEEERRLAYVAFTRAENVLCLSDAEDGVAGESGSRY
FT                   PSRFLLEMNMDELDVARGFSDDLLLAARAFIAESDRNRDLMNDFDEDESLGAVKKAPTA
FT                   EFAVGDRVVHKIFGIGTVSGVDKKNFCYEITFDKFATPRSIQFDFPLVRG"
FT   gene            317184..317969
FT                   /locus_tag="Fisuc_0277"
FT   CDS_pept        317184..317969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73889"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73889.1"
FT                   /translation="MFTKLSKTVAISVIMCCTLSFAQADTEANNNEIPNPSTISQVQTT
FT                   DQQATLTPVQTSCEYKEKNQIRHRKTIQSMNFSLPIESERWKIKPQRFDWKSIGYQFSW
FT                   TRYGTEENGYSSVFGLGIGFLTGNLEDNIDMKGLDFNIKVGLGMAPISNNLIIAFHFIC
FT                   GLDLKVVEGDISVQTDARHTYKFTHGSAYIDAFFGGDLIIGYHIFESLGIISGVDITTN
FT                   AYGIGAYYTDLEQKSKVYKMSYLFTGVNITPHIGLFFLF"
FT   gene            318107..318421
FT                   /locus_tag="Fisuc_0278"
FT   CDS_pept        318107..318421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0278"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   ppr:PBPRB0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73890"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ACX73890.1"
FT                   /translation="MIIVNTDFISGKEIETIQLVKGSIVFSKNVVRDVFAGLKTIIGGE
FT                   IKGYSEMMSEARQEATDRMIREATMIGADAIVNVRYATSCLMAGAAEIIAYGTAVRFKK
FT                   "
FT   gene            complement(318425..318769)
FT                   /locus_tag="Fisuc_0279"
FT   CDS_pept        complement(318425..318769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73891"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73891.1"
FT                   /translation="MDFSELKPRNRTQMAVVACLGGFVGAHNFLLANSVSGSIKIYLTL
FT                   VAIIAPHHVGMSLAAVNLAWILFDLWQICFMSTLPEIRLEGSRKKAVVFVFTYMAFATA
FT                   LAILLCQRYL"
FT   gene            318891..319628
FT                   /locus_tag="Fisuc_0280"
FT   CDS_pept        318891..319628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0280"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   gme:Gmet_0060 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73892"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACX73892.1"
FT                   /translation="MSNSLLFGKFAAVLPAGGLGKRMGGTIPKQLMNLGNKPVYQYSLE
FT                   TFLNMDEIAEVVIAVPADWKDYFEKDIFSRLSPAFGTGYGNNLNKLRIVVGGKERWQSV
FT                   QNGVNSLTSGAEYVLVHDVARPFISEKIIRDICETLVNKGSCLVAKPAIDTIKIASDGR
FT                   VESTIDRNKVWLAQTPQAARIDLLKSLYARIEKEPLNFTPTDEASILEFFGEPVYIVKG
FT                   ESANDKLTTPEDFEIFASRANML"
FT   gene            319655..320137
FT                   /locus_tag="Fisuc_0281"
FT   CDS_pept        319655..320137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73893"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73893.1"
FT                   /translation="MKYLKLLGILSACVLMTSCAQSLSVSKKETFEQKSGIIGVFRQPV
FT                   GFCSGGYQQQIKLGGEKIIVKPTWTSEQDNLFSAYIQPGNADLESYRYSCGFTETTLKP
FT                   IEKHGVVIPQNGFCKIVISFLNNDELFSKNEVLLFNHFKKEEVAKDFEEIPYCETY"
FT   gene            320265..322700
FT                   /locus_tag="Fisuc_0282"
FT   CDS_pept        320265..322700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0282"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: ppd:Ppro_2303 phenylalanyl-tRNA synthetase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73894"
FT                   /inference="protein motif:TFAM:TIGR00472"
FT                   /protein_id="ACX73894.1"
FT                   /translation="MKVSLNWLRRHVDLPESAEDVAKALTSIGLEVEGMEEPGKVYDKL
FT                   LVAKVLTCDPHPDSDHLHITTVNDGTNTIQVVCGAPNVAAGQTVVLAPIGAELPLPDGT
FT                   KLKMKKSKIRGVESFGMICAEDEIGLSDDHGGIMVLDDSIPAGTPFVSLGMYDVCFELN
FT                   VTPNRPDALSHRGVARELAAKFNRPLKPLAYNFKEDSEAASSAISLEVVPGCGCSRYVG
FT                   RVIKDVKVEKSPAWLAKLLHAVGMNSINNVVDITNFILMDVGQPLHSFDMDQLHGNKIK
FT                   VRRAVKGEHIETIDHTAHELIENDLVICDGDRPACVAGVMGGVESEIVDATKNVFLESA
FT                   WFNPTVIRKQAKRLCISTDSSYRFEREIDFATQDEYSKYACAMIQEVAGGRILKGSVEY
FT                   TGEDHKKENNQVTLRVARAAKVIGMEVSAEQIEKFLTGIALEVVKKDAESLTFKIPSFR
FT                   PDLEREVDLIEEIARLIGFDNIPYSLPKFTMQPNELPAIEVLNRKIRKTLSAMGLHECL
FT                   SLRFTSKARTEALFGPESDDRRSKPALLLNPLSEELGAVPTSLLPNLLKAVAENEKNRP
FT                   GSVRLFEVAKGQFKRDRKDERDTGFDESNLVALTIAGNFDVDPLNDKPKQIDFAAFKGF
FT                   VQSFFKRLGLVVEFRAAAKPELFLHPGKQAEIVCNGTVLGTMGELHPNCLKANEISYET
FT                   YVMEADMDKMEHESHKKIVFQAFSRQVPSTRDISIEVAKSMTHEDVLARIKALNPKNLA
FT                   KITLKSIYEGEKIEAGKKNMVYSLTYQAMDRTLTDDEVNKAHNKLRDKLVQNGDIVLR"
FT   gene            complement(322794..323450)
FT                   /locus_tag="Fisuc_0283"
FT   CDS_pept        complement(322794..323450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73895"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73895.1"
FT                   /translation="MRKMKLAFAIASACALLVGCAAPRSVMDQGWTQKPAKVKVVFTEP
FT                   FIANPDDLQDDLPEYVNNFSDWYKAQLETNLGSQTNGVLYSVEKVSMDKVKFEAAAVNG
FT                   VNIKVPKVEEMDGQADVYLVVNDIWIGRVESETTCTTGGFNAGGGLGMGTTCTQDKDFT
FT                   GKGNYAYYDAKTGKRLGYGDFEAKSGYTFAVSLSDWQKVVQKTVSSVLDNTPIKK"
FT   gene            complement(323582..323917)
FT                   /locus_tag="Fisuc_0284"
FT   CDS_pept        complement(323582..323917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73896"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73896.1"
FT                   /translation="MVQLKSIAIAVLAGSVLCAAQLAIKPATESDNVPTIDERYLIFKP
FT                   VENEFRDETPEQAKTIPAGFHNPSLAIGAEDRASVNEAMSKVGKGLCYGSIAAKILSAG
FT                   NVPILCE"
FT   gene            complement(323943..324326)
FT                   /locus_tag="Fisuc_0285"
FT   CDS_pept        complement(323943..324326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73897"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73897.1"
FT                   /translation="MNFDMALLILCWQTACLSHNHENEQLLPGATSATEAESAELDKIH
FT                   DEVTPNASWDDFNNLYASYKSASDRTKACVKALKSASNDFKIQVTNCMTRIANASREDE
FT                   NKTNMSPEEYEFIKNVREQLGLN"
FT   gene            324509..326236
FT                   /locus_tag="Fisuc_0286"
FT   CDS_pept        324509..326236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0286"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gem:GM21_0195 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73898"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACX73898.1"
FT                   /translation="MAYIAMARKWRPQSFSDMVGQEHIAKTLENAIQGGRLHHAFLFTG
FT                   TRGVGKTTSARILARTLNCKGSDPLHPCGECDSCKDIAGGNPMDVYEIDAASNTSVDNI
FT                   RDVIERVQYPPVIGKYKIFIIDEVHMLSTGAFNALLKTLEEPPAHVIFIFATTEVNKVP
FT                   QTILSRVQRFDFKRLTVDQIRSRLRYICEQEGIKATDEALDIFAEKADGSMRDGLTYFD
FT                   QAYAFTGNEMTAESVRSVLGIPPVELFFSLIQSIENHDIKGCFRMVDDAVKIGIEFIPL
FT                   LDGFGKFLRNLLYARLDAFTPDALNITEELYTKYKSCAQSLTNGDILRISKMLIDLQGT
FT                   LRYSTNPRLLVETTFARMAWLDRLVDLRKALAAINDPKSAENDAVKKKVTEVSAMIDAQ
FT                   EEVQASYDDPFAGYDQGGVQAFSRYEISAAWPSILSNIANDGDYVFSAAIAGTTLETGD
FT                   PEQNPFPIALTYAGSTENAENWGYRQMTEHPEYVERVTRILEDRLQTKIALSIRTRAFT
FT                   ESELAEQRAAKMSPYELDLEKEPGLSKLQQMFATELVFTKKLKKAALVAQTDEEDCEA"
FT   gene            326315..326623
FT                   /locus_tag="Fisuc_0287"
FT   CDS_pept        326315..326623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pca:Pcar_0375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73899"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACX73899.1"
FT                   /translation="MDMSKMLKDLQKMQSKMLKAQNDLKAQSFDAEAGGGMVKVAMNGK
FT                   GVLTMVKINPDAVDKDDVEALEDLIMAAVNSAVKKKDDAQQASISDITGGMKIPGLM"
FT   gene            326768..328183
FT                   /locus_tag="Fisuc_0288"
FT   CDS_pept        326768..328183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0288"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dat:HRM2_40110 MdtP1"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73900"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACX73900.1"
FT                   /translation="MSRKFLVLSALALGLIVPASAKVYTRDEAIKTAMENSSDIKSAEE
FT                   DLISANSQVDAGYGNAYPSIDFNATVTRIFGLDDVKKTTALTDAAKDMADKKDDAGYPK
FT                   ANAFDQNVMGPAVDGLIYGMKSQGYRWQSSVGLTLTQVLYAAGKVGTAIDIAKAYKHLQ
FT                   EVNLDNTKSKVRYEVDNAFDQLIYLDSSIAIVDESIKITQDNLDFVEQGVKSGLATELD
FT                   LARVQLSMEALKVDRKALEDKRLLAKNALLNTMGLDWDNDVQFNGELRTPDSNLPYPDT
FT                   AMTSVKQRRRELVMLQATETMKEKNIEIEEGGYKPTIALVGGLKYANNKNKITEWDAPK
FT                   WDKLNKYVALNVSMNLFQGMQTKEAIVQAKSSLRSTQIQKETAERGFRVQIESCAQTLA
FT                   STERNLEVLKNNIDLAQRIYDMTDAAFRNGMETQLNLLTANMDLRKAKLNYLQGILNWN
FT                   TAYNALLQATGEY"
FT   gene            328204..329253
FT                   /locus_tag="Fisuc_0289"
FT   CDS_pept        328204..329253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0289"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: pna:Pnap_3901 RND family efflux transporter
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73901"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACX73901.1"
FT                   /translation="MKTITKSIITISALSLLLAGCGDAKKDAKSEKKVSTIEEIQKVNG
FT                   KPARVVKAATVKLTDVRAFSGTIEGSQQTTATAKLGDPIAKINVRVGSKVKKDQVLAEF
FT                   VFTGDNTAYQQAKAAMELNEKTLARTKEVQAKGGVSQSTVDQLETQISVAKMQLEAARR
FT                   ATLVLAPSSGTITEVKHKAGEVPGVGGAMFTIANLDKVILKLNVTSSEIGFFKKGAKAT
FT                   IELNGEKLQGEVSLIPLAANPITRFFPVEVTFKNKGQKLLPGMYLTTKIDAREVTGVTV
FT                   PVEAIVYSNGVNSVWTVDSEGKAKRKIVQLGVQTKTDIQIKDGLSEGDVVMVEGQNRMN
FT                   DGDKVLIVE"
FT   gene            329274..332438
FT                   /locus_tag="Fisuc_0290"
FT   CDS_pept        329274..332438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0290"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   mxa:MXAN_2967 RND efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73902"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACX73902.1"
FT                   /translation="MIKASIYKPITMLMVILTVVVFGLYTYSMMVVDLMPKFEVPVVTA
FT                   TIIYKGANPEEIETTIIKPIEEQVELVDGIDYVQSICLENYGIIVAMFNMGVNVDVAAN
FT                   DVRSKVDLASADFPDAVQAPIISKVDINGAAIMAISFTGPLNSTELRQKVEDEIEPLFT
FT                   SVSGVASVDIFGGTTRQIAIEVDKEKMMDRGVDIGTMMGLYGMSNVNLPIGEVIGKHKN
FT                   TSVRTAGKFKNLDEMRNMEIPTEKGVVKLSEIAVVKDTIETITSTSRFNGINSVALDIK
FT                   KRSDANVVEVSRGVLKRMAEVNKTLPEGFKLTLIYDKSEAVNESIDNVIQNIIIAIVLT
FT                   AALLLLFLGKFSTMIIAALTMPISVIGAFTLMYFAGFGINMMSLMALSSSVGLLVTNSI
FT                   VVLENINNKLNLGLDPKEAAYKGTSEIMIAIMASTLTNVAVFVPIAFMKSIVGIFFRTF
FT                   GMTMVFATFVSLLVTFTLTPLMAAYLFKGKKKDENGNIIEEKPGIVGTILGLFPKVLNG
FT                   FRFVYLKVLGFCLSVPGFFVQVLGLGVTIFVVIVLAKNNLTVELTPRQDQGMMSIKLEM
FT                   PVGTNIETTDSVAHIIESRVKDIPEIVHYSMNVGGSNGFTTVNQATMRVRLLKDWEKKK
FT                   MKDWKGRHRSTDEIVDSIRPYLANIPDAYISVKSTSASEMQNNSSGDVVLEVNGLHADS
FT                   VIKASQIVLDRVQQKIDGIVDIKTSYEAGKPEIRLIPNRAALADYGVTLETVANYNYIA
FT                   VNGFEAGQYTEDGEEYDVYVRLMEKDRQSHADIEDLPVKTPKGYVSASELFHIEDGAGP
FT                   TRIDRKRKMRRVDVSMNLLPGHTTGEIMGKLGKLTAEMKDELPEGITFSFGGNADMQND
FT                   MQKEFMTAIVMAIILTYILLVALLESFMQPFIIMTTIPMGAIGVLLALIFTGKALSMIA
FT                   LMAIVMLIGVVVNNAILLLDEANRLLRSGSMGRRSAMLTAAKAKFQPIVLATLASVIAQ
FT                   LPLAFALGGNVAAMTQPMGIASVGGLIVSAVLTMFLVPTFFWLPNALFSKVKKGAKKLQ
FT                   AKMNKA"
FT   gene            332580..333878
FT                   /locus_tag="Fisuc_0291"
FT   CDS_pept        332580..333878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0291"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mpt:Mpe_A3137 pili biogenesis ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73903"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACX73903.1"
FT                   /translation="MNTKNLSKKWCQKNGIAIVESAGESAQECAAPIKIAVPNATDEFL
FT                   LEKIRFATQQRIVPEQHSPAEIKMMHSHAESIDDEDLLQHLNHLEISRNSSWESEPIIN
FT                   LVDSLIIKALQKKATDIHLEPLADALRVRFRIDGLLTEYRTFPQWLTEPVLIRLKVMAN
FT                   VDITERRLPHDGSFAFENFQEKVNVRVSTIPVNNGEKCVLRLLPANDSAQTLDSLDFSE
FT                   PTLQAIRKIFSAPQGLFLVTGPTGSGKTTTLYAGLREIIQRKINVTTIEDPIEYELRGA
FT                   NQVPVNEKCGFTFAVALRSILRQDPDVILVGEIRDAETAQIALQAAQTGHLVLSTLHTN
FT                   SAKAAAARLLDLGVQKSILDEALLGVFAQRLVRKLDKTTSQESTPQYKGRTVVCELLLP
FT                   NNTYADSSMQENARKLVESGITTEEEIKRVLGS"
FT   gene            complement(333899..335071)
FT                   /locus_tag="Fisuc_0292"
FT   CDS_pept        complement(333899..335071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0292"
FT                   /product="zinc finger CHC2-family protein"
FT                   /note="PFAM: zinc finger CHC2-family protein; SMART: zinc
FT                   finger CHC2-family protein; KEGG: bpa:BPP0490 putative DNA
FT                   primase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73904"
FT                   /inference="protein motif:PFAM:PF01807"
FT                   /protein_id="ACX73904.1"
FT                   /translation="MTEEELKQFKAALSITTVAMDLGLPVVRGRCRCFFPTRHAHGDRT
FT                   PSVSFSEERGTFRCWVCDDVRGDVISLVQFVKNCSFLEALNWLKETYGFLLRGAKPQVQ
FT                   NRISTTSSASASTMPNRAPASNVSLEQSAALVAKTAVRDAALEYRSPEPAKELVSEDER
FT                   KKIILSFLKMLSPVDKTPAAAYLARRRIYKPIWDKMLLRTITDYGALNNKLKETYDLEV
FT                   LKYVGLFSEKGNLRYYKHPLFFPYLDTKRRSFYFQARAIDSTVVPKELNLRGTVPFPYN
FT                   VSALDERPGWVYLCEGVVDTLTFLGQRIAAIGIPGVRSFKTEWLPLFKNKSVVLCLDKD
FT                   EAGRSGTEYLQTVFANANIRTVVLGDGVDQFGKLSMKEGEDINDWFGGKK"
FT   gene            335099..336022
FT                   /locus_tag="Fisuc_0293"
FT   CDS_pept        335099..336022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0293"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: tgr:Tgr7_0771
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73905"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACX73905.1"
FT                   /translation="MIIQENIPMSEHTSFKVGGSARYFIKAESVSDIKEAIAFANEHAL
FT                   PNYILGKGTNLLVSDSGYNGVIIQLGKFFSEITDLGNGKICAKGATPLARLARYTINEG
FT                   LAGIHKLAGIPGSLGGAIYMNAGAYGQDVSQTCIEVESIDAAGNLHTRTATDCVFSYRH
FT                   SIFQELATSENAETILSATFQLTPATELGKTAKDLESEMQECMTKRRNSQPLSMPNAGS
FT                   TFKRLDAGAAETPTQIAPGYYIEQAGLKGYRIGGAEVSRVHANFIVNAGGATAADIKAL
FT                   SEYVQKVVAEKFGINLHREVILLGEF"
FT   gene            336055..336699
FT                   /locus_tag="Fisuc_0294"
FT   CDS_pept        336055..336699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73906"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73906.1"
FT                   /translation="MICHKCGKEYEDDMPNCLWCDAPNLQHPANKGKQFTEAPAQSIST
FT                   EPAETEATEAHPAGLFMWTAAILAACNLGYLYIAILITFFHKKALQENKALGRFFVGML
FT                   IASIGLYFITAPVISVISTSLLKINELNGGHSSSTILLALSALYPITQGFIGAKLLKFY
FT                   TPDYDSKDYRKNSVVSTIAAIVLFFICALCGFYTDIAQNGTQFTQILTKKY"
FT   gene            complement(336704..337111)
FT                   /locus_tag="Fisuc_0295"
FT   CDS_pept        complement(336704..337111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0295"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: dps:DP2825
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73907"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACX73907.1"
FT                   /translation="MFESLFDKYPFFRKVPAILCMAIIFKISSMTSYELEDFPHVWDKL
FT                   AHTCEYATLAGCFCMWWARGEWSIKPWLKVLIVMAIALAYGCTDEYHQSFVEGRDCSGY
FT                   DLIADALGGMIGGLVYWLVVKILNKYDPLVK"
FT   gene            complement(337138..338733)
FT                   /locus_tag="Fisuc_0296"
FT   CDS_pept        complement(337138..338733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0296"
FT                   /product="FecR protein"
FT                   /note="PFAM: FecR protein; KEGG: glo:Glov_2621 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73908"
FT                   /inference="protein motif:PFAM:PF04773"
FT                   /protein_id="ACX73908.1"
FT                   /translation="MIVNFFFEILITRLKNMVAMNRAKNFRVGLLGLALVFAVSLSACG
FT                   DSESSEKDSLNAIPEKPLFNGVVQRVVGDAHVKISDDHAKSLKVGSRVHEKSSIVTEAG
FT                   SSVVISVDDGSALKIDGRSEMAIEVAKADELKTRMTVALRHGKLLFDVQKQAVKDEFEI
FT                   RTENVSSVVRGTAGFIENVDGLEISSLKEGRLDVAVKTDTAQSVKSGQTLIANMNGVKI
FT                   LSLASSGTLILARALDSIATGAATELGVHAARLNLDKLETMLLEFDEAYKKKAEAFIKS
FT                   SQIEFKPKVLNEYIGKPSVTLEALFIPGSLVSVLGIVDTIPESGLYKRTFEWADSTAFG
FT                   PKHFVVNCSNGEVEYICHTWHTNFVSAKMAEVLTKADVRKSNAPKDTVQPKKLKPSIVI
FT                   EGSGRERIHVLPEERDIPATLRFSVAGLMGSDLSQIKKIIVKRKGVVVKAFADDELMTN
FT                   SFKLPIRLKQNRIAHFEIDAIFVNGKKIKARKVYETYCFFENYEDGKKSNRINDMTAEE
FT                   EYKNVVSKRLLKNE"
FT   gene            338840..340042
FT                   /locus_tag="Fisuc_0297"
FT   CDS_pept        338840..340042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0297"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: protein of unknown function Met10; SMART: PUA
FT                   domain containing protein; KEGG: vfi:VF_1505
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73909"
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /protein_id="ACX73909.1"
FT                   /translation="MKAITLKAGRDKSALRYHPWIFSGAIDEVVGDPALGDVVEVYSYH
FT                   SDFLGLAAYSPKSQIRGRFWTFGTEGKNVKIDREFFSDILDRAIASRKSRGFDIHDKEC
FT                   AFRLVNAENDGIPGCIIDKYADIYSVEILAAGAEVNRQIIYELLAEKTGCRGIYERCDS
FT                   EVRKKEGLPLRTGVVFGEVPDEPVIINENGILFPIDVKNGHKTGYYLDQRDARRRVGEL
FT                   ARGKKMLNCFCYTGGFGLYALRGGCEKVYQVDVSKDALKLAKEGIMRNKLSTAHATHIE
FT                   ADVFQYLRKCRDKAETFDFIVLDPPKFVESKDNLQKGARGYKDINLLAMKLLAEGGMLA
FT                   TFSCSGLMEMDLFQKIIADAAADAHRRVQIIERFGQPADHPVNTAFPEGQYLKGLLVQV
FT                   V"
FT   gene            340158..341690
FT                   /locus_tag="Fisuc_0298"
FT   CDS_pept        340158..341690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0298"
FT                   /product="Carbohydrate kinase, FGGY-like protein"
FT                   /note="PFAM: Carbohydrate kinase, FGGY-like; KEGG:
FT                   dol:Dole_2975 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73910"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACX73910.1"
FT                   /translation="MYLVTYDIGNSFIKATLTKIANSIEFVGATVVSTHSTSTLGGKGV
FT                   EQSTEQWWDSICRSTKDLLKNYGITSDQIKGISFCSQMNATVLVDANGNTVRPPMTFLD
FT                   RRADKEFKDYFDHGFKIHGLNIWKLIKAMRHTSLVPVGAYSPIWKYKWVQNNEPEKFAR
FT                   VDKFLDVGDYLLYKTTGRFVRTEDSAFCTALNDCRKGHSGWSHTMAKAYGIMEKHLPEI
FT                   VQSTDIVGRITATAAEQMGLKKGTPVIAGGGDVAMVAVGCGNTQNNQTSIYCGTSGSVS
FT                   TVVDHIIQFADIMMIAVKGPNPRQKYLYGELETAGKCFAWARELIGKLDNSQYSYEECA
FT                   QLVSKAKPGAHGLMFTPFMNGCKTPFEDGDIRSSLSGISLETTRGDLLRAVIEGICFHF
FT                   RWLLECQAKKCKISDTIRFAGGLARINIMNQILADVTGHTIETVKHPQYVGALGAAAVA
FT                   AIGLGQMKFEDIHSYIEITNTYTPNPENHEIYNKLYKKFLDKVKSDRKLVKG"
FT   gene            complement(341848..343185)
FT                   /locus_tag="Fisuc_0299"
FT   CDS_pept        complement(341848..343185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0299"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /note="SMART: Tetratricopeptide repeat; KEGG:
FT                   mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73911"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACX73911.1"
FT                   /translation="MVFTKFFTMNKKLSFIALALLVGMSQAWAVDPRIEQGARFEAKGQ
FT                   YDKALGEYRAMLAENKKNTEAYMAAGKVRMKMKDYKGAVANFRLAYGYDPSLTEAYEGA
FT                   AKAYEAMGQQAKADAERAKMKGGKAAASTPKAEAKAEPAKTAQPAQTAPVAKAEPAKTA
FT                   APAKVETPKAAQPAPATAVASEDPFEKGKALLAEGRYAEAAPLWRAVLSKKPGDAGAYF
FT                   YAGLTRYEMGEYDKAEFNLKKGLSYKERGNDANYYLAKINQKSKRTEQEKKYLAAYLKK
FT                   AAPDAKFRKVAEDRMAEINAVASAAAEEKAMQEAEAKALKDAKKSGNDKSKSVDVAPQR
FT                   EDVAPTASNSIANANALYADGYHEAALQMYKALLENEITPDERYFAMLQMGNIYREMRD
FT                   FHSAVTRYRDVVREFPDSDWATEAERALEDAVWLEKHASELPRNKR"
FT   gene            343259..343504
FT                   /locus_tag="Fisuc_0300"
FT   CDS_pept        343259..343504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73912"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73912.1"
FT                   /translation="MKITEAVDKYNAAEQELIIEAYEREGGDTEDVDLILLDRICARLG
FT                   LGLDNDDIDNDDIAEEVNFDEYGSHFGDVSESEDEL"
FT   gene            complement(343730..344737)
FT                   /locus_tag="Fisuc_0301"
FT   CDS_pept        complement(343730..344737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73913"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73913.1"
FT                   /translation="MLDEVWRSLCAVAILTVSVVTHNYAVEFKDFRDGRVYRGIPSGSL
FT                   NWFKQSLKYSKTSYFTDENGIPFYRSDSWKASCPEGTQLPDETDWDELIEDKFSGPDKM
FT                   QNMSDFAGNSSRGFYKFEMDEVVNARKGFVYFAVRGPANHVIRLETKRGTTKYVDIEDA
FT                   DAVQIRCVFPRDQFAEKNISPKDMIFTDKRDNKKYKVGVRGGKIWMMKNLAFSVTSAKQ
FT                   CYVEDKSFCEKFGRYYTYEDALKACPPGWHLPDDGEWRDFQKDRATLDWDNLGQGGCQD
FT                   WDNFCDGFNSGHYWSKSSIQENTARSWEFNRSDKDIDRTDVSVYKGLYVRCVAD"
FT   gene            complement(344822..345688)
FT                   /locus_tag="Fisuc_0302"
FT   CDS_pept        complement(344822..345688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0302"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: scl:sce0315
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73914"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACX73914.1"
FT                   /translation="MFSGRFKSLFQALFAVLCSATLVLGTPDASRNMLGASLVDNPAPR
FT                   HYEVSVRLDVPLSLGIVMTSVLGVYQYYGMSRISSSDLKPKSELLPWDRPFAGHYCGWA
FT                   MTVSHYSGALVVAPLALAGYSWYKGDADGHDFGAFTLMFVEAIALQNALNQIVRSTQLW
FT                   PRPYIYAERGEGRRKAESARGEAYGSFYSGHASAAFTVAVFTGEWFSEIYPNSQYKSLV
FT                   WASSLTLAAAVGALRVVAGKHYPTDVVVGSLMGTGVSLGVLKLHELCKKNISFWAIPGN
FT                   IGAIFYF"
FT   gene            345798..346703
FT                   /locus_tag="Fisuc_0303"
FT   CDS_pept        345798..346703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0303"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Methyltransferase type 11; regulatory protein
FT                   ArsR; Methyltransferase type 12; SMART: regulatory protein
FT                   ArsR; KEGG: dvl:Dvul_2348 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73915"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACX73915.1"
FT                   /translation="MELFGAISDEMRLKILLLLDQSEFTVNEIKDILDIHQSNASRHLA
FT                   KLAQCGLVKDRRDGIKAYYRLSEELYMSSRLLQIIREAYDELQDKDILKCRAAQALEER
FT                   TDKTKGQIHKLDQAGGSLKAQISLFSKLMVPFENAVDIGCGEGGDLSLMLASRCKNVTA
FT                   LDYDPKIISGFQQILHQKGIENVTPKVADMTQTGLPSNYADLVLMSQVLHHATDPRLAL
FT                   KEATRILKPGGMLALLDLAQHKEESFRTTHGHIWLGFERSQLEFFVKELNCKVVESEII
FT                   PSENEVDKKLPVICMIITKE"
FT   gene            346806..346916
FT                   /locus_tag="Fisuc_0304"
FT   CDS_pept        346806..346916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73916"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73916.1"
FT                   /translation="MGKLIKYVVIAAVCIISAFGIYSLVKTAKTDENTLE"
FT   gene            346999..349605
FT                   /locus_tag="Fisuc_0305"
FT   CDS_pept        346999..349605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73917"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73917.1"
FT                   /translation="MNFLNKKPAFFVAMATVFFAILLFVFRDFAFDSSQLMLNSDQLNG
FT                   IGSRILRTFDVILTEWDDSRLGGVPTLDALFADAYHPLVWTQFIMDPARAVGFKFILTV
FT                   WVAFMSAMLLAWNLTGNKWWGSLLGFLYAFSPEYFTYIYGGHDGKMMVFAIAPLALLAI
FT                   RKIVRDGSLPYLIVFALSVTWMILGSHLQLTYLFLWGAGLYTLYEAAFHCNTLAIRGKR
FT                   VGLAAAGLAFGLALSCFQVIPPYLYTTTQSVRGEGDHTNYGHAVSWSFHQEEMAQMLIP
FT                   GFIGVDVYEQDEKTNDLKSSSLVNITMDEYRKMAESGSQGSPFYWGHNSFKLDHNNAGA
FT                   LLTFLGFLCLFLPGKRRWASFWGLGAVVALSYGMGDHSPLFKLWYNILPGVKNFRAPGM
FT                   ALFWLPLLLVMMAGPVLKAISDESENAAKNHRALLHGTAMFVILLLLVVIARFNWTLFI
FT                   SPFGFVVCLAYAVACLGVMSLDDQGKAINVKNFMDAFKAKLPGTSRGVQAAVVIGFAII
FT                   GLFLMSGQKLLNDPVTAPYFKPLNEVVMNATASKILPSFFLILIVIGVSFAVFKWKGSI
FT                   PAKVGILAAVAGLELMTINGAFIQNVAAKEYLQPNNGVVAALKAPFKADSINQPRVLSL
FT                   SRNKAISGNIFPQYHMRNADGFHDNELASYREFRGGQGNANYLMNINEPDGAHPFLDLM
FT                   NINAIIFDTQRGTTYMPITTAMGEAYIYGESTTMEDSKAIDALKNGFAYREKVILSEEP
FT                   QNKGEGGIAQGKAKLVASPKMDTQVYQVESDRAGFMVVAGNYHPYWKATVNGKEAKVYK
FT                   AFGDLRAVEIPKGKSEVRMEYRSKPFHACLKVSLFAAILLIAFGVYVFVKNKKATT"
FT   gene            349863..350075
FT                   /locus_tag="Fisuc_0306"
FT   CDS_pept        349863..350075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73918"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73918.1"
FT                   /translation="MKVFGNMETLSNTASDLKEPLNLLPPPSENSSLQNKAASENTSIG
FT                   LFDVHVYMGQYFDDYYTPTSTGIAN"
FT   gene            350109..350921
FT                   /locus_tag="Fisuc_0307"
FT   CDS_pept        350109..350921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_03582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73919"
FT                   /inference="similar to AA sequence:KEGG:HCH_03582"
FT                   /protein_id="ACX73919.1"
FT                   /translation="MAIFLNDILKIENFADVRIRFNLQMNGNYNPIDAFDKNNLKKYID
FT                   GHYWNYPQRKSFKLNQRTLGFIPYDRKDNTWLLFHAGKVIKDLNILNGVGYDYSDIEEF
FT                   SKYCGRLIIRYKNKSRNPIFYAETCINDCEVVEILPDIYDDDVFPGYENVNISWEKLSR
FT                   VISKESWKTALQNQKGVYLITDKKTGKMYVGSAYGENMLLGRWTNYAENCHGGNVDFKK
FT                   LKPNYIKSNFQYTILEIFKSTTADEVIINRESWWKNVLMTRDFGYNNN"
FT   gene            350964..351989
FT                   /locus_tag="Fisuc_0308"
FT   CDS_pept        350964..351989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73920"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73920.1"
FT                   /translation="MALFCRKCGEEIGPIDCQIHNSLCHNCYREQKKAEEHRERLEELR
FT                   EEEVEYQRQAARDAEEARRIAGLTTFTCCHCQGTFNEERGYSAVESPIGKPVCNKCFEL
FT                   LKKCIDCNQYFWKNDPRSTPIRLIEKEYYRTKTFFDEPVIYVKDRNDYVCDNCASTAKY
FT                   ESFFEEQKKLKQEYDTQERIRREKEAAERAERERKEAEAAEQARIKAEREKEAYEAERR
FT                   EREEEEHQKAVLFNVIFGIIFTLLSAYVCYSLMSNVGLILGIILGIGVTTIRLIQLSQN
FT                   FGDFLVRVAVCIVGSAVVCWLFGLFYGFACWLFGFTDISGTTLSIIWLILTLVSVFLLN
FT                   S"
FT   gene            complement(352332..352793)
FT                   /locus_tag="Fisuc_0309"
FT   CDS_pept        complement(352332..352793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73921"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73921.1"
FT                   /translation="MFSFKSFATVAVACGMGLAYGITPNKLVSGGIPAHTESTTTDYLT
FT                   DGYLTNWKSSNAKEIVLMVGEGPKKLLTINCRRALTFIAISANIRNSSEAMVSIRILKA
FT                   VVRRCITCGRRLWLRCMLRGILAILAAQNKIRRPMFEKLRDGLKTLCRK"
FT   gene            complement(352835..353503)
FT                   /locus_tag="Fisuc_0310"
FT   CDS_pept        complement(352835..353503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73922"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73922.1"
FT                   /translation="MGIKTNNGWGEVIAGTAAKDSDKDGMPDYFEEAMGYDVNKDDAMT
FT                   KESDGYVRIEKYINWLGASHMHITDESSRNFDLRTITCGFQSVKPTYSVSAAENGTVEL
FT                   LADGYTARFTPKANFKGLASFKYIVKGDDKTEYTGRVEVLVEKGAADESTVTDPSDTPE
FT                   SSTTRIVEKLRLRGNSEAVKIFDMNGNYMETSTSNLPQGHYIVRQNIQGRVVNFLYNKN
FT                   "
FT   gene            353524..353904
FT                   /locus_tag="Fisuc_0311"
FT   CDS_pept        353524..353904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd2560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73923"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73923.1"
FT                   /translation="MRPHITAEEAKKSVQLLEECELIKKDKSGKYVLTENSITTGDRTS
FT                   KLALRGYHQHCLKLAADSIDRDPPGSRHISGLTLGISQEGYERIVERINAFRKEIALIA
FT                   EEDQNSDKVFQLEFAMFPVGGK"
FT   gene            complement(353998..354735)
FT                   /locus_tag="Fisuc_0312"
FT   CDS_pept        complement(353998..354735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73924"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73924.1"
FT                   /translation="MSKYDNDLLKLPFYKNHAYMLPFVGDDYDLSKHKKLLLVGDSHYM
FT                   PDGTIVHHDVSTWYMNPTVIHNSKEENNCATRKTWGVWRNTTFCNRVQETMDLATGKRD
FT                   AWKSVAFYNYFLRPADESEQNMQKFWSKHGGEKDDREYAIKNLVDVIGILKPNLIVFMS
FT                   RLVKDCVEGVFDDKGKRNSRYPGDYWRCFKQDFWDWTKGKNIDYIYTNHPSEPCWFITM
FT                   EKYAKAEGKRSCDFFKEWLCTNW"
FT   gene            complement(355203..356681)
FT                   /locus_tag="Fisuc_0313"
FT   CDS_pept        complement(355203..356681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0313"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: mmw:Mmwyl1_3846 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73925"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACX73925.1"
FT                   /translation="MNYFNSIPMRRQLEEIGHCRFMEHSEFSRGVEALKGKKIVFVGCG
FT                   AQGLHQGLDLRDSGLDVSYTLRKEAIEQKRQSWKNATENGFKVGTYEEMIPDADLVCNL
FT                   TPDKQHHNVIPAIMKLMKKGAALSYSHGFNIVEEGQEIRKDITVIMVAPKGPGSEVRSE
FT                   YLRGFGMPCLIAVHPENDPEGKGWDYAKAYAAGLHADRPGVLESSFVAEVKSDLMGEQT
FT                   ILCGMLQTGTILCYDKMVKEFGIDKAYAVKLLQYGWETISEALKHGGITNMMDRLSNPA
FT                   KIRATELAEKMKKIMKPLYQEHQDNIISGKFSSTMMVDWEAGDKDLLKWRGETGELEFE
FT                   KVAATDKQITEQEYFDRGVLMTAMIKAGVELAFETMCSVGIKPMSAYYESLHETPLIAN
FT                   LIARKKLFEMNRVISDTAEYGCYLFANKCVPLLADFMKNEVKKGDIGDIFNEGNTNAVD
FT                   NEELIKVNKNIRQHPVEEVGAWLRDRMSGMTRVV"
FT   gene            complement(356958..358640)
FT                   /locus_tag="Fisuc_0314"
FT   CDS_pept        complement(356958..358640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_0835 xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73926"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73926.1"
FT                   /translation="MSFDIVIGKKCIAISCLLLFLAACGGDDSNSVSAGDEPVSKISSS
FT                   SSEKLSSSGSRVKSSSSSVQKNSSSSEKAKSSSSSSVKSSSSSESIQQSSSSQIAWSWD
FT                   VPKETYLNPEIQYDTMIDSRDGKVYKIVTIAPKGHPYSETWMAENLNYADSSATPSLKG
FT                   NNRCYKNVAKNCNVGGRFYTWAAAIDSVKLANDSLDPLDCGIDKYCGLGNMIRGICPEG
FT                   WHLPSMDEWRRLFDRFSSKRLADIGFKSQSGWAKDGNGDDSFGFSALPVGLWNSRGDYF
FT                   VSSNDFTVFWSSTESCGGSELCDKGCMNGVCFVYLDANSGEMHLYDYYKNDGFSVRCLR
FT                   DNGWSWNVPKYARLNPDVTYGSMTDERDGQTYKTVVIGSQTWMAQNLNYAYTRVPYKFY
FT                   SNTSDSSSWCYDNKAKYCHVGGRLYTWAAAIDSVKLANDTINPMNCGYDKMCDFTGHVQ
FT                   GICPSGWHLPNKDEWEVLLTTVGGATTAGPKLKSKSAWCYNCNEDSFGFSALPIDVIST
FT                   HFWSSTEPNYSTAYSMILFSETENAGLLNFNKYEKFLVRCLKD"
FT   gene            358714..359463
FT                   /locus_tag="Fisuc_0315"
FT   CDS_pept        358714..359463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0315"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /note="PFAM: guanine-specific ribonuclease N1 and T1; KEGG:
FT                   cco:CCC13826_0239 S-layer-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73927"
FT                   /inference="protein motif:PFAM:PF00545"
FT                   /protein_id="ACX73927.1"
FT                   /translation="MPITNKATVTQWNEEKGFGFATANGTKYFVHISALGHPVRPPKVG
FT                   DTIIIYNFGKTEKGARIEKGILDGVASRDEQVTSPVRKNYRKTKKSKIAVIVAICIALA
FT                   FAFDIYVVYTTPDDAPRKKKVCLLKENPAEKEYTSRLHVAKYICDNGQLPSNYITKSEG
FT                   KRLYEQKTGRNFTKWNFNPLTTLGVMIGGDNFDNREGQLPQGTWYEADVDYFGNNRGTN
FT                   RLIYSSGCNIYYTGNHYKTFNKIEFGN"
FT   gene            complement(359494..360204)
FT                   /locus_tag="Fisuc_0316"
FT   CDS_pept        complement(359494..360204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0316"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oxidoreductase, short chain dehydrogenase/reductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73928"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX73928.1"
FT                   /translation="MKLFENKVVVVTGGAHGIGASIVSEFEKEGANVVYIDIRENPCFV
FT                   GDLSKKETLEKFAQFVIEKYGHVDVLVNNALPLMKGIDECSYEEFSYALAVGVTAPFYL
FT                   AKLFAPHFAKGASIINISSSRDRMSQPQTESYTAAKGGIAALTHALAVSFAGRVRVNSI
FT                   SPGWIDTDFKVYEGPDATQQPAGRVGNPLDIANMVLYLASDKAGFITGENICIDGGMTR
FT                   QMIYHNDCGWKLEG"
FT   gene            360653..361045
FT                   /locus_tag="Fisuc_0317"
FT   CDS_pept        360653..361045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0317"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: sat:SYN_01881 Cro/CI
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73929"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX73929.1"
FT                   /translation="MLEAVKMRLTSKAKNGTVFTFEGKNIPDYLVIFLKSAFPNVEEIK
FT                   SEDNEESINIMDTDWFKETEARSTPAESLKLLRTTFGYTQQQLADKAGITKQQVSAMER
FT                   GKEPIGRKMAHRLANALGTSYKNLFW"
FT   gene            complement(361067..361972)
FT                   /locus_tag="Fisuc_0318"
FT   CDS_pept        complement(361067..361972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0318"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73930"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX73930.1"
FT                   /translation="MKLFDNIFIPFIAALALTVVGCNESKNSTKDSAESKVASNFEAPA
FT                   KESTLAVEGTKTITLANGAVVTWIQDNEGKKFMPRELFSDASDSLYESLNMPAGLPASV
FT                   STFLVKTDGKYILFDAGLGAWGGQLLKRLDALKVNPDSIGLVYLTHFHADHIAGLVKSG
FT                   GTGKMEKVFKNASVYAGKVEYDAWMNNIPKNDLQKNIMALYKDSLHLFAFGDSLPHGVL
FT                   AMDAVGHTPGHTAFKISNLLVIGDLMHGYALQKNHPEINSNYDMDKEKSAASRKRIMQY
FT                   ARENKLLMAGMHLPPPGFAK"
FT   gene            362054..362608
FT                   /locus_tag="Fisuc_0319"
FT   CDS_pept        362054..362608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_2738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73931"
FT                   /inference="similar to AA sequence:KEGG:Patl_2738"
FT                   /protein_id="ACX73931.1"
FT                   /translation="MLQFFDVTRDAPWFPQVKALYESAFPANERIPIKHLLDDKIKREF
FT                   WAFFDKEDGKNAAAPKFCGFSNSITHGSITNIVYFAVVPELRSRGYGSQILQVIREQHP
FT                   DTRIVVDIEVEEDSKDAEELERRNRRREFYLRNGFGSSPFDYVWQGEHYRLLTAGGTVT
FT                   EKEFRDFWKEILKNVPGAKYP"
FT   gene            362917..363426
FT                   /locus_tag="Fisuc_0320"
FT   CDS_pept        362917..363426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73932"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73932.1"
FT                   /translation="MTRKFFFLCSFAFVFVCTSCDGKALFEGYGEFHFKKKTSDGKQME
FT                   RCVIEGKKLSVYEENVEADFWSRLYFSIGAKNLNRVYRFAYENESEKEFFGTYQFPVTT
FT                   GIGAIHENTGMVVVETSDLITIFYNKEPVDGFFIEKNPFSKKILFVFKSRLSELKRKEG
FT                   VCFYYI"
FT   gene            363645..364091
FT                   /locus_tag="Fisuc_0321"
FT   CDS_pept        363645..364091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0321"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   kpe:KPK_0868 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73933"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX73933.1"
FT                   /translation="MIIAINKDDPWWEKTRAFAKDCPWLPGRRLAERMSKNDFLDWEKV
FT                   FVAVHGEDVVGFCVLEENGNTPAQFNCSPFINLVYVGEEFRGERLSKSLIDAALDYAQR
FT                   LGYKKVYLKSEHHGLYEKYGFKKIADFKPTVGLANQLFEIEISV"
FT   gene            364167..364610
FT                   /locus_tag="Fisuc_0322"
FT   CDS_pept        364167..364610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bba:Bd2812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73934"
FT                   /inference="similar to AA sequence:KEGG:Bd2812"
FT                   /protein_id="ACX73934.1"
FT                   /translation="MKYLKMFCRGLLGLFMTYAGFSHLTIARQEFLAQVPSWFPQNPGF
FT                   LDFVVLASGVVEILLGLSMIFLYKHKGTVGVLLALFYVAIFPGNISQYVNGISAFGLDT
FT                   DQARFIRLFFQPVLIAWALWSTDGVQKLKEWRNRYCNKRKESK"
FT   gene            364878..366812
FT                   /locus_tag="Fisuc_0323"
FT   CDS_pept        364878..366812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0323"
FT                   /product="glycoside hydrolase family 44 domain protein"
FT                   /note="KEGG: ttu:TERTU_4054 glycoside hydrolase family 44
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73935"
FT                   /inference="similar to AA sequence:KEGG:TERTU_4054"
FT                   /protein_id="ACX73935.1"
FT                   /translation="MGYSNFFTVAAFGTLFAISPTLAIDITVDANAGIKKISPYLYGRN
FT                   IDKISDGDAEVTEEESAFINQMLEAGIHMLRANNGNNATRYNWRHKMTVHPDWYNNVYS
FT                   HDWAITAQKVLDKMPGVDAMYAFQLTGYAASSTDYNFPDWNWKQEHGTYATQTFDLAGG
FT                   GEVSEDGKTLIKAGDPSLYNMEWPADSTVAIIPHWKDELKFDMSRFKYWSMDNEMEIWR
FT                   GTHNDLDLPVTGDFLVERYIDVAKKARAAWGDIKLTGPVAANEWQWCSVSSYNKEDRPK
FT                   GEDRNYCWLEYFIMKVAEEQKKSGVRLLDVFDIHWYPTEKDYESRVNWHRVLFDTTYNY
FT                   PGANGIKMVGGNWDNKVTKEYIFVRINQWLEKYFGKDHGITLGITETSIIDNDPMVTAL
FT                   TYASFLGTMQDNGVEIFTPWTWGDGMYETVHLFSRYGHPNRVQSTSSNDSLVSAYSSIS
FT                   NKGDSLTVIFVNRAEKDAQEINLDLANFASDGTVKTLTLQNLQGETFVSHTSNALKENA
FT                   VEANAQGGTTTATGYSINRFKMTLPAKSITAVLLTTTTPKQIDAIAPTRSTLSGNLLHQ
FT                   ENGNWFIDNGSGKVRRINVFNSLGQSVLRIQQPARGNFRIASEVLSKGNFIVRIETASG
FT                   TQMQKITVK"
FT   gene            complement(366859..367845)
FT                   /locus_tag="Fisuc_0324"
FT   CDS_pept        complement(366859..367845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0324"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: rbo:A1I_05635
FT                   guanosine polyphosphate pyrophosphohydrolase/synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73936"
FT                   /inference="protein motif:PFAM:PF04607"
FT                   /protein_id="ACX73936.1"
FT                   /translation="MISLNDYLFSGNTVLKILHQYSNDLRNSAKETHNSIDLAHSNFLI
FT                   QIIELLEHNDFLTSQSQRIKEFYKYMTREYPFLAFTFKGRIKSLIRAEEKFNGYILEFV
FT                   YNYYKKNGVFPSEAEIKSTLNFRDLIAYRIVISMPACHIKKGEERSEVERKYLYEIANV
FT                   MPEFLEERGFTPEISRHKDGGHCDLLKDAVQPYYHDSVATPRSSGYQSLHITMYDNLAR
FT                   CYTEVQLRTKDMDDFAEIGDANHFGYEKTQETRRSKHDQIPSGECVYFDDAYERLTKLQ
FT                   ELELSKLDVNMFKAINNQLINDGCGLFRGRQILPFEHLSRFQNDLID"
FT   gene            368058..368303
FT                   /locus_tag="Fisuc_0325"
FT   CDS_pept        368058..368303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0325"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="PFAM: protein of unknown function DUF1653; KEGG:
FT                   psp:PSPPH_3208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73937"
FT                   /inference="protein motif:PFAM:PF07866"
FT                   /protein_id="ACX73937.1"
FT                   /translation="MENRELKIHGIYKHFKNRYYIVEGVAKHSETDEEYVIYRKLYGDN
FT                   AMWIREKSMFLSEVDHEKYPEVKQKWRFEEVELGQQ"
FT   gene            368356..369483
FT                   /locus_tag="Fisuc_0326"
FT   CDS_pept        368356..369483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0326"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="TIGRFAM: carboxynorspermidine decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: nis:NIS_1297
FT                   carboxynorspermidine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73938"
FT                   /inference="protein motif:TFAM:TIGR01047"
FT                   /protein_id="ACX73938.1"
FT                   /translation="MLDYSQVPSPCFVLDETRLRRNMEILDDIQKKTGVKIICALKGYS
FT                   FWRSFPLIGEYLAGATASSLNEARLAREEMNKEVHVFAPVYEDDEIDAILDAADHITFN
FT                   SFSQWQRYKDKTLAHGVSAGIRVNPEFSTVETDLYNPCGKFSRLGVTEKEFKPELLDGI
FT                   DGLHFHALCEQDADALEGVLAAFEKHFGKYLPQMKWVNFGGGHHITRKDYHRDELVRIL
FT                   KDFSARYPHLQVIMEPGEAIGWQTGELVTSVGDIVHNEMDIAILNVSISAHMPDCLEMP
FT                   YRPSVIGAAFPGEKAHTYKLTGNSCLAGDQLGDFSFDEPLKVGDRIIFEDMIHYTMVKT
FT                   TFFNGVRHPSIGKFDENGKFHLLHKFTYEQFKEKL"
FT   gene            369564..369977
FT                   /locus_tag="Fisuc_0327"
FT   CDS_pept        369564..369977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0327"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   geo:Geob_2940 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73939"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ACX73939.1"
FT                   /translation="MKFKSEDETYNWALEFAKELKVGDKVALYGNLGAGKTVISRGICK
FT                   GLGFEGTVCSPTYTILHEYPNNPPIFHFDLYRLEGGADLYEVGMDPDYLERGISLIEWP
FT                   ERLEENDAGITHVVKIQIVSETEREITVEKIAK"
FT   gene            complement(369987..370679)
FT                   /locus_tag="Fisuc_0328"
FT   CDS_pept        complement(369987..370679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2676 TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73940"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73940.1"
FT                   /translation="MFSFLNGKSPFDEAEEKLEAGETINGRPKLPQAPIMGWQDGVFLL
FT                   VLIGLIAGGYYYYQYAKQKSATMFANCDALYVAAETNAAKYVDAEACYNETWDLGFVSD
FT                   SMEILRQNRLGAIEDLRNHQKDLYADAMGAMAARDTVAAYKVVTEYNGPMLLSQGDRKD
FT                   WNNIANNDAVKASVAAAVARADSIAKEKAIADSLAQVAAELRAKAVADSIEKANKKLAR
FT                   KGKRKKAQ"
FT   gene            complement(370689..371135)
FT                   /locus_tag="Fisuc_0329"
FT   CDS_pept        complement(370689..371135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0329"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   bba:Bd1961 regulator of cysteine desulfurase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73941"
FT                   /inference="protein motif:PFAM:PF02657"
FT                   /protein_id="ACX73941.1"
FT                   /translation="MSESIVDRQEKIRAKFASFTDPDDKWKFLLDLAREHKGMDASLKA
FT                   EKFIIQGCASTMYLVPKFDGAKIHFEMDVEGGTTNPLISRGLGALALQIFNDMAPADIL
FT                   SVDPTFFQQIGLNVGLSPTRSNGFASLLKQIYLYARVFDAISKK"
FT   gene            complement(371143..372339)
FT                   /locus_tag="Fisuc_0330"
FT   CDS_pept        complement(371143..372339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0330"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   afr:AFE_2544 geranylgeranyl reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73942"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACX73942.1"
FT                   /translation="MTCFRSNSYKVVICGAGPAGLMAAYQLGKLTGGDGQILLLDKKEP
FT                   WKEPIFCAEAVSTHRLNELWPIDESWVRGSLSGIYFTSPKGYKAEFYSKDCGRLLDRSK
FT                   FHHAIADACVESGVECRFDALVKSIEKTENGWNLNVQVGKEFFSLSADAFIDASGPGCR
FT                   LTRGIPCLEGIESGDTDLEPGIFAVAEGIEHDRDHIDLLYGSEFPGGYGWIFPRDGKEV
FT                   NVGFVLSKDAKPDMPLREKLKHFIATHYPNAKVKAIYGGMIACGQSDKPLAKCGLFKAG
FT                   DAASCVNPLSRSGIVEALLSGKIVAEAVHEWLNASDDAARSRIEASVLDRWMAKLGKSH
FT                   LQIARAKPGLAKIKDEQFDKAAKRLSKLPREKQTLLRIFWAVLWSCPSVIWKMRSFLH"
FT   gene            372464..373777
FT                   /locus_tag="Fisuc_0331"
FT   CDS_pept        372464..373777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0331"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: scl:sce0105
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73943"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACX73943.1"
FT                   /translation="MNMKNVYKFGLCLLGALALNVSAQDFRGKELNTSFRDKRIDNYQF
FT                   QKARAVKGVTDFQRSAGESPDFEGANLPEVSFRNAVISGANFEGANLKGATISGADIRS
FT                   ASFEGANLEGANLYRATLLDSKFPKANLKNARLDAMKVSDECDFSKADLTQASVMDMDL
FT                   TNADFSKANLTNTNFSRSLMANSDLRKTTMEKTDFTACNLIAANFSGVKLNNVNFAKAG
FT                   LSQAEFGGATFNNVNLQEADLSLTTFNDVDLSRTQLQKAKFAQSKVKNMKFTNQDLNGV
FT                   IFDKGDVSKSSFDKTKLNKASFFDASVSKNVFNYAELMKAVFDGAYVFKDIFDNADLTK
FT                   ANFANSTIERSAFNNAQLSGANFSGAKLIKVTFLNAKMEGVKIDADTKMEDVDFSGADL
FT                   TGAKIEKFTAKKVTYNERTKFPSGFDPRAYGFRRPGEK"
FT   gene            complement(373845..375236)
FT                   /locus_tag="Fisuc_0332"
FT   CDS_pept        complement(373845..375236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0332"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: dal:Dalk_2956 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73944"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACX73944.1"
FT                   /translation="MVAVNKSKKEIEYLCTECGNTTPKWAGKCPFCGAWSSLKEHVIER
FT                   ITDGAGRTGRGLGGPVHKVVLLKDVAAEDTRRLSTANSEFDRVLGGGFAPGSLVLIGGD
FT                   PGIGKSTLVLTTLATMNAAGVKALYVSGEESACQVKLRSERLNVSGSDMMLLCETNLEK
FT                   ILEQAKEVKPQVLVIDSIQTVYKSDLSGTPGCATQLRECTLDLMVFAKNSGCITILIGH
FT                   VTKDGQIAGPRILEHMVDTVVYFEGDRNHQYRLLRTIKNRFGATDEIGVFEMTSHGLNP
FT                   VLNPSKVFLQEGVPPTPGSAVCCTMEGSRALLFETQALVNQTNFAVPQRVAAGIDPKRL
FT                   TIILALLEKFGGVTIGASDVFASIAGGMKVNDASSDLALALAVASNHLGIPLSRQTIAI
FT                   GELGLSGEVRGVSLLDQRLKEASRLGMTEAVVPASCKLSENMGSMKVVRVHSLSEAISW
FT                   LMDKK"
FT   gene            complement(375336..379301)
FT                   /locus_tag="Fisuc_0333"
FT   CDS_pept        complement(375336..379301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0333"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="KEGG: mmw:Mmwyl1_1752 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   response regulator receiver; SMART: EAL domain protein;
FT                   response regulator receiver; GGDEF domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73945"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX73945.1"
FT                   /translation="MSDAGEKKIPEGIRNELEHSEVPLAVYRFVDGHIQTILVSDGLVR
FT                   WQAPGSTREDLLKFLDTDMYRDVHREDIVFVATKAKEFAKSKDGRYEVVYRQKLYGKDE
FT                   YRTLHAQGYHRVLDDGSECAIVVYDDVTSAFDTCKNFRNEFDNSLIEFLNNDSVEPFVI
FT                   VDAKTHEIYMLSASVDKVWTPVKAFDSGITFEEYFFDPNEVQLITLEEVLEKGEVLVPN
FT                   SRTGGDLILKASLIKWHGKDAIFHRISERTDRYFDTLTGLPNMEYCRMRGESYVTDIRI
FT                   AGGTPSVAFFDIVGMKLYNNANGYDKGNEFLLNFAAALKKVFPNNLICRLANDHFTVVA
FT                   DMKNIEDKLCEVRKYVKSVVSKISMDVNIGISKIDEFETMVDANEKAKIACKVQKSSSD
FT                   SFVRYYDEDLRKALVLQNYVVNHIDEAIKNGYIKVYYQPVVRTITETFCGMEALARWVD
FT                   PQYGFLNPAVFIGALEESRQIHKLDSHVINIVCKEMRAELDAGKPIVPVSFNLSRLDFI
FT                   GCDIFDVVERALEKYSIDREYIRVEITESIMASDSYVRSEIQRFRLVGYEVWMDDFGSG
FT                   YSSLNTLKDYKFDELKIDMAFLSNFNDASRTIISSTVRMAKNLGLKTLAEGVETKEQMD
FT                   FLKGIGCEKVQGYYYGKPQPLKDTMKHMESIGMAVEDHNARVVYSKLGSLDYLVDSPKG
FT                   ILSYKDGLFKFLFVNKQFEEQISSLGFAHIEDVEKAINDPKDPAYYTLHEAEKAAYTGP
FT                   REITYAARGSYVFLSGCLIADIEGNHIYDMSLRNTHVSAFDISSSSSKITSLPTDAKTI
FT                   LLADMNPQNRAFLESVLRSNYNLLLAEDGEQVLNFLLEYGNHISLALIAADLPKIDGFK
FT                   IIQKFRGEKRECQIPFIVMTDNMELAKEGMRLGAYQFIHTPITSRDQVKSKIDGAIKNT
FT                   EVLHQLALNYMEYVPGGVILLEAVSGDILYVNGRALEIFDCDNVDDFRSLAGNKFEGAV
FT                   LPEDYAAVDETLETLFRSRSALPSQTTYRVRTKKGFVKRIYHVGRYFRDTPYGRILSVF
FT                   VSEDDMALKNYFGRKNAFKLFMASGEATHTKSYEPGYKGYLFWNLTRNSPVIRMDGISY
FT                   IPKELTGKYTYDAHFDYLVELMSKDSVNIQKTSSYTREKLILAYANKRAVPSLNLNYNL
FT                   KNGWFSIKSTFDMMADPDTGDVILKLQNENDTDVEAYKELTDAVVMNLYDQIIYLDGNT
FT                   DRLLSLSCLEGKPMYVQRTISDSMDNLCKLFQMPVCTAEKFMEIAKMRSASGETYGRTL
FT                   TLDDGHVKFVRAKPLYNGSDKYIITVSDITHAKKEFQ"
FT   gene            complement(379570..380307)
FT                   /locus_tag="Fisuc_0334"
FT   CDS_pept        complement(379570..380307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0334"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: scl:sce4818
FT                   3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73946"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX73946.1"
FT                   /translation="MIDVKGKWCLVTGGCRGVGRLIAIEMAKLGANLILQGRDKSHAEK
FT                   VIAELAPYGVQVKAVGCNLENEAEIEAALAEIDSFGVQVDLVFNNAGLMSHYFSDYTTN
FT                   TMDDFRQAMAVNFFAPIKIAYHFLPGMIKRGFGRMQLTTSGIANEPELAAYACAKAALT
FT                   KFVKDFACKLNGTDVMMNVMDPGWLRTDLGGPNAPNAPETVVPGALVSVLLDDKKSGRW
FT                   FSAQDYVGKSVADAVEAGRNVFA"
FT   gene            380611..380976
FT                   /locus_tag="Fisuc_0335"
FT   CDS_pept        380611..380976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0335"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: mei:Msip34_2845
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73947"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX73947.1"
FT                   /translation="MNYETLLLHEAIRLLIISIRQQRRHTQQSLSLESGISRQYISQME
FT                   CGKRIPSLDTLSQLAIALKTSMGSLMSEMDRIYQHLFWQSKTDQVDKNDDFSARNAAET
FT                   HNPSLEYIHRAGGLDKP"
FT   gene            381017..382090
FT                   /locus_tag="Fisuc_0336"
FT   CDS_pept        381017..382090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0336"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: dal:Dalk_4651 radical SAM
FT                   enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73948"
FT                   /inference="protein motif:TFAM:TIGR00048"
FT                   /protein_id="ACX73948.1"
FT                   /translation="MEWQRNIKTLTTDELKAWLRDVDEKPYRADQIQKWLFCQQVRSYD
FT                   EMVNISPALREKMAKQFTLCGLKEDQRSVSVDGTVKWLFETEDGHHIETVMIPANGRYS
FT                   VCVSTQVGCAMNCAFCRTAKMGFTRNLEAGEILEEIINVNWYLKDNGFMNEEGGVAQVT
FT                   NIIFMGMGEPLNNLENVHRVCCTLHNQKLFNMGAKRMTVSTSGVVPKIKELVDRNTPCC
FT                   LAVSLNSTNNEYRSSVMPVNKTWPIEKLLEAVDEYIRRTDNYVTFEFVLIQNITCTPKA
FT                   AKELIRICAPRRVKVNAIVLNDGDDPTLHAPTPEEVEDFLAAVRAAEIQITIRNPRGRD
FT                   ILAACGQLAYKKEGKEC"
FT   gene            382084..382704
FT                   /locus_tag="Fisuc_0337"
FT   CDS_pept        382084..382704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0337"
FT                   /product="thiopurine S-methyltransferase"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 12; Methyltransferase type 11; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73949"
FT                   /inference="protein motif:PFAM:PF05724"
FT                   /protein_id="ACX73949.1"
FT                   /translation="MLTQNLPEFWDNLYAEGKDYWNFKKATPALLEFFKHPSCPAEGSV
FT                   LIPGAGFGYDAEAWALRGHDVLAVDFAPTAVDELDHLSRKHKNLRSLDLDLFTLSPKDA
FT                   KRGGQQFDIIYDYGAFSAIHPGRRDEFFEVCYRMMKDDGVFICLMYPLMNGKTMQGPPH
FT                   CMSEGELMARLDGVFDIVERIKPTNSIPGREGKEEFWLLKKCL"
FT   gene            382868..383365
FT                   /locus_tag="Fisuc_0338"
FT   CDS_pept        382868..383365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0338"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   dal:Dalk_1685 sec-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73950"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACX73950.1"
FT                   /translation="MANDLCPCGSGKAYCDCCEPIIKKTTLAPSPEALMRSRYTAYAKH
FT                   EIAWLKDSLEATQRDDFDEPSVEAWSRQSEWLGIEIKQTKTEEDKNIGWVEFVARFKQG
FT                   NITRNHHELGEFHKVGGAWYFYDGRAVKQETVRHEGPVVGRNDPCPCGSGKKYKKCCGA
FT                   NK"
FT   gene            383479..384444
FT                   /locus_tag="Fisuc_0339"
FT   CDS_pept        383479..384444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0339"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: dar:Daro_1863
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73951"
FT                   /inference="protein motif:TFAM:TIGR01851"
FT                   /protein_id="ACX73951.1"
FT                   /translation="MFKVFVDGEAGTTGLQIFERLAKRNDLEILKINPELRKDVNERQK
FT                   MINESDVTFLCLPDAASMESAALCTNPNTRIIDASTAHRVNPAWTYGMPELSAEQREAI
FT                   SKSKRIANPGCHASGFILGVHPLVASGILPKSANLAAYSITGYSGGGKKLIAEYEAEDA
FT                   LSHKAGESKAIMAPAPYALALAHKHLPEMKKYCGLENVPFFNPVLGPYYKGMAVTVAIF
FT                   PNMLSKKVGPQDLTEILAKHYEGSKFVKVLPYEAAPVLFNGRLDPTVCNDTNNARIQVF
FT                   GNENIMQVTTIIDNLGKGASGAAIQNMNIALGLDETIGLV"
FT   gene            384530..384655
FT                   /locus_tag="Fisuc_0340"
FT   CDS_pept        384530..384655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73952"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73952.1"
FT                   /translation="MEKLSLVIHNYASIAEKKQIGIDCNIDLTNFKNKGSSVGRF"
FT   gene            complement(384706..385908)
FT                   /locus_tag="Fisuc_0341"
FT   CDS_pept        complement(384706..385908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73953"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73953.1"
FT                   /translation="MLKVKKGILFCLSIVTVGFFAACGDDPSSSNSATPAQENILPEEP
FT                   EKVEVSSSSVNVVPASSAEISASKPTIPSYTVEKGTMVDERDCRTYKTITIGTQTWMAE
FT                   NLKFEYKVDGKTYGNSCNPDSCETFGRHYTWAAAMDSAVVFTNDSENCGYGVTCSPTYP
FT                   VPGICPEGWHIPDSTEWVEFYKILNEDPHAMQAEDFIRSKSAIRKGLVATNASGFSALY
FT                   ETLSLVAGHTASGAFFWSSTDYITSRAYYWHVSESEARLDNNKICDKGTGMAVRCIKDF
FT                   GTVVTPSSSCVEEPPVSNVENPVDTVSSTIIKLSSSSQAVKSSSSKDKGDRMFYLPTLI
FT                   QACAYANLGNARFIECKSPNAIDCLQKINGCNFDAVEYCGCWESEDAYIYYRNKDKGQI
FT                   R"
FT   gene            complement(385963..386190)
FT                   /locus_tag="Fisuc_0342"
FT   CDS_pept        complement(385963..386190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73954"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73954.1"
FT                   /translation="MKTMARPIRETPILYGEDARRFLENMKIRRPETPEARAQRLRDYE
FT                   FMKKAYERGMAEQRAREEANGGFDPWFKKV"
FT   gene            complement(386351..386578)
FT                   /locus_tag="Fisuc_0343"
FT   CDS_pept        complement(386351..386578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73955"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73955.1"
FT                   /translation="MRTMARPIRETPILYGEDARRFLENMKIRRPETPEARAQRLRDYE
FT                   FMKKAYELGMAEKRAREEANGGVDPWFKKV"
FT   gene            complement(386721..388175)
FT                   /locus_tag="Fisuc_0344"
FT   CDS_pept        complement(386721..388175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0344"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: pat:Patl_2976
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73956"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACX73956.1"
FT                   /translation="MNKFSFTMLLVSALAAFANATSGDNDPKLVTVFFGTYVKLQNSYF
FT                   EDTEKIGSFYNIGYQSPKGMPYFEMGESENPNAIFAVAKEAIGKCPAGGKLSVTPYTER
FT                   GGRVLKYKYAIDTGCEEFASKLKYVCDAATVDLDVIEAQQIENGTLKDSRDGNVYKTVK
FT                   HKSSDLTWMAENLKYKTDGSHCLLDKKANCKKYGRLYTWNEAMKVCPAGWRVPDVGDWV
FT                   RLFLDAGWNGEFAPKKKILGIGKKLKSKNGWKQNGTDNLQFAAMQGGAAVVRKNVFVSD
FT                   IAAFWSSTDYPEGDVLAYGLRDDDDVHTMYEAKEDFLSVRCVKGGEKKQAKENKSPENP
FT                   PAKKNSDVEIGKNNSGSALSLLVTGENSKGVNSYTLSVSVKDVKIISSGNRIAKNLEKV
FT                   AQQRNPGLKHVYKKFWDMKAGFSGNVVLKLTIAPNGDVISCSIESSTTGYSDFDKEIEK
FT                   TVSRWVFDKSDANTVATISFSFSKLQ"
FT   gene            complement(388219..389262)
FT                   /locus_tag="Fisuc_0345"
FT   CDS_pept        complement(388219..389262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3567 MORN repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73957"
FT                   /inference="protein motif:COG:COG2849"
FT                   /protein_id="ACX73957.1"
FT                   /translation="MKDAKIQWMIVLTLLAVCLGACKDHDTHYEYYDKDGSKPFKVFEV
FT                   DRTTGKMDGSFKQFNRMGILVKEGTYENGLKNGVFKEYSKNGSLVLEGSYDHDLKNGTF
FT                   KEVLEHGNVVVEYTYKNDFIEGPVKVYRGGKLVSKGEIKDGRYVHTKFFTDPRDGQKYP
FT                   VVVIGSRVWMAANLNYKTAESHCHGDYEHNCEKYGRLYSWKDAEDACPEGWDIPSYAEW
FT                   VALNKFIGEEYYGVNDFFAFPSAKMLISVTGWDYTKYGIDAFGFSVLPAGKGYYIPPRY
FT                   VGGKLIYEERTVYEDHKGDKSERAYFWSSSQVNGNENKMYVEHGPAMDLYPESKEMWLS
FT                   VRCIKDE"
FT   gene            complement(389280..390125)
FT                   /locus_tag="Fisuc_0346"
FT   CDS_pept        complement(389280..390125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73958"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73958.1"
FT                   /translation="MTKLDDRIREDLKNLLKGKRICRAVNLNKKLSQKVSEKGEPSHFC
FT                   GDRDAFTVMVMLNPGCDATEADERFSKISRSWKRDDWNDESIDKFIEDYKSYKTNYADY
FT                   WPECYRYDAFDVKQAAFLKSWPDSGIDLPKDFDCIQNKLLAKRNVLLKKLQLELVPFAS
FT                   QSFKVRTEELDLLVPYFEDCLDEIFSRERKYVILCGQIFESLLRKMKEEGKLEIEFEDP
FT                   KKCDNTDKINKRCIVVHLKYDGAWRKLLIAHTFASQGLTNAYKSMEEYGLFCYKKFKNL
FT                   "
FT   gene            390247..391248
FT                   /locus_tag="Fisuc_0347"
FT   CDS_pept        390247..391248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0347"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; small
FT                   GTP-binding protein; PFAM: GTP1/OBG sub domain protein;
FT                   GTP-binding protein HSR1-related; KEGG: gme:Gmet_3197
FT                   GTPase ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73959"
FT                   /inference="protein motif:TFAM:TIGR02729"
FT                   /protein_id="ACX73959.1"
FT                   /translation="MFLDEKNIEVRSGRGGDGICSFHREKFVPLGGPDGGDGGRGGHVI
FT                   LQVNEQYTTLLDMGNTHIYKAKSGQPGGAKRCSGASAEDLIISVPRGTIVKDEQGHILT
FT                   DLTEPGQKWIAARGGKGGMGNQHFATPKVQAPRKCTPGEKGEVRQLFLELKLMADVGLV
FT                   GFPNAGKSSLVNKISSGRPKVGDYPFTTLEPVLGIVQVNGHSFVVADIPGLLEGASEGK
FT                   GLGHQFLKHIERTHTLLFVIDGFAENAYEQFKVLKEELKAFHPKLAEKNFVVALNKSDL
FT                   GIENAIKEFKKHRQKVVITSAVTGEGCAELQQALDAAVPHMHKKSIGWSKKA"
FT   gene            391281..391631
FT                   /locus_tag="Fisuc_0348"
FT   CDS_pept        391281..391631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0348"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   gem:GM21_0996 histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73960"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACX73960.1"
FT                   /translation="MKATQSNITKKEIVDEIASQTGFTQVKTKVIVEELIDAISNCVIE
FT                   GNNIELRGFGRFKNKQRKERRTRNPKTGELVNIPAKVRPVFEPSKDLIEKINNVPFDLE
FT                   EAFVPKDDQERI"
FT   gene            391612..392082
FT                   /locus_tag="Fisuc_0349"
FT   CDS_pept        391612..392082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0349"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   KEGG: dde:Dde_1088 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73961"
FT                   /inference="protein motif:TFAM:TIGR00086"
FT                   /protein_id="ACX73961.1"
FT                   /translation="MIKKESSTPVIQNRKANHLYFVDETFEVGIMLIGSEVKSIRNGKC
FT                   TLGEAWIDIDENKDELWLVGAHIDEYLFANRFNHFPARRRKLLAHTHEIQKMRKAKELK
FT                   GCTIIPLKMYFKNRIAKLEVGICRGKDQHDKRQDILVRDAKMEMARAAKAHR"
FT   gene            392142..393179
FT                   /locus_tag="Fisuc_0350"
FT   CDS_pept        392142..393179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0350"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: dde:Dde_1370 N-acetylmuramoyl-L-alanine
FT                   amidase; PFAM: cell wall hydrolase/autolysin; SMART: cell
FT                   wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73962"
FT                   /inference="protein motif:PRIAM:3.5.1.28"
FT                   /protein_id="ACX73962.1"
FT                   /translation="MESVAREIKGSFHWYPVQKTFSIVSAKDTLKFAVGIPYMTRNGRT
FT                   IDLSAAPELDNGHLWIAENDAKKISNKIEAAKPVAKPAEQKPAQPVVVKPKTPKQEIAG
FT                   TREVRTIVIDPGHGGKDPGASGKKSQEKDIVLAVAKLLRKNLADEGFNVKLTRSKDVFI
FT                   ELRQRAMLANQWDGDLFISLHCNAIDASEERKKIIQGYQFYVLRAPESEEDKAIARREN
FT                   AVATLYGEKNAKDELSPLEWFKLEARLEQYKQTSYLFTEKLLDSFDGGKIKKMNTGVGG
FT                   AGFMVLVGAMMPAVLIELGFISNEEDEAYMMTKAGQQDLADRIAQAVSKYKDAVHTYRE
FT                   TLGRN"
FT   gene            complement(393256..394359)
FT                   /locus_tag="Fisuc_0351"
FT   CDS_pept        complement(393256..394359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100198385"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73963"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73963.1"
FT                   /translation="MTIHKFIRLFSLTVASLFWASCSDSNPQFPMSPSANPDSSSDANE
FT                   SSSSELSSSAVAPESSSSDTPPQSSSSESASSSSGVESSSGANSSSSSAGYVLARDPSV
FT                   GCKQTLYPAYRYCYESCDAAKRDLETNGIISKNELERAEFGLESCRAMEYASGLLYGVP
FT                   FNPCPNPILFETAYECTNDSTYREYRLEDNLVYTNVAEYDEAHGISSSSGAQSSSSSEE
FT                   MIRNCPQEDFLPFTGILADVQKELYEIIEQKLKDDVLSETERTYLESLLDREQKTLKNS
FT                   TPHELYVYLYDSDEEVAIAIAPYSPDLLWDDYYYKIDSKNWFRGYIAKTKTCEDGTPVI
FT                   TERYKQKYDAILAECLEIIEKNSKAAK"
FT   gene            complement(394389..395183)
FT                   /locus_tag="Fisuc_0352"
FT   CDS_pept        complement(394389..395183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73964"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73964.1"
FT                   /translation="MKNIKSLFLSGLAVAFVMGLGTAQAKEWEQSFIVNLSSSDYIDNP
FT                   VWGFSKDSVVFENGKGYSVWLWDAACVCGILYGACNFTMKNVAFFEYDQNFWSVNSKDA
FT                   LKEGTTLDLNDSLAFYEERDGSWHSLTESYKHSLKNSTANDTNYFVYKKDSSYYALCQY
FT                   ITVYDTVYDWNYRVTKQGFPAYYVHQCIFQDDGTPTFSKIPSYSGELPVGKGVLPPSPI
FT                   VKPVRNRNKVKPVAKPYLVNGQSASGLTAKGVRVEGDRIYRH"
FT   gene            complement(395288..395989)
FT                   /locus_tag="Fisuc_0353"
FT   CDS_pept        complement(395288..395989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73965"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73965.1"
FT                   /translation="MGMTACSSTKDISCDDYKKYLGSDTTLSEKIISRWESALQSCGAV
FT                   KDLFREEPLYGISYGGCPMRMFVDMKCSNDSSYSDVKLDGKKFYTSQKEYDEAHGVAPD
FT                   VIVKNCPQGDFALFTDVLADVQKKLYEIVSEKFIQDIARPEAEQKYLGSLLDRENKTLK
FT                   GRLAPYTEDSGEGNDSRLRMYSGYWFDGYIAKTKTCADGAPATTEIYQEKYDAILAECL
FT                   ELIEKELKKAE"
FT   gene            complement(396391..397173)
FT                   /locus_tag="Fisuc_0354"
FT   CDS_pept        complement(396391..397173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73966"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73966.1"
FT                   /translation="MDNQKNILKSSFALALLFGLGISQAKEWVQSYVADLNSDSWQSSK
FT                   WGFSKDSIENKPGKGYSTWNVNMTCVCGIDLDHGNCYAYLDHYGFYDYEQNFWSVVSKD
FT                   ALKAGNALNLNDSSAFKDESRNILLETYVYSNKLDAENDTNYFVYKKDSSYYALCQYVT
FT                   VYDTVVYRWGETDYIPGFFAHQCIFQDDGTPTFSKIPAFSGVLPEARKIEGPTGFANPV
FT                   RKPTRVNAPRKPYLVNGQSASGLTAKGVRVEGDRIYRH"
FT   gene            complement(397321..398082)
FT                   /locus_tag="Fisuc_0355"
FT   CDS_pept        complement(397321..398082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73967"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73967.1"
FT                   /translation="MFKKILFSLAALSIYANAINCLEAYFKTKPVDYYVPEDYVLDSLY
FT                   RAPAEGADSKPWSKKYYYTPGNSLPDSLVLMDSKDTVKTVFHYTQEADTLNGMITLVIN
FT                   NDGELFGMVKYMKVADDMHPYAFYRSNSGKVDTLNGYVNLKDEETLVEYKNGEFIKVLL
FT                   DKKDPNVCHIGNPDDEKYVKITYEALGQTIHLTEEDSSTLTEMFFIPLYPQEETIGIRK
FT                   IRPAAANIKKYQYFDLLGRPAVNKHSVQIRK"
FT   gene            complement(398270..399013)
FT                   /locus_tag="Fisuc_0356"
FT   CDS_pept        complement(398270..399013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0356"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   dps:DP2908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73968"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ACX73968.1"
FT                   /translation="MSGHSKWATTKRKKAKTDVARAKAWNKLIKEISIAAKLGGGNPDA
FT                   NPRLRAAILKSKSQSLPTKNIESAIAKGTGANSGTEMTEPLYEGRGPAGIAIMVQCMTD
FT                   NKVRTVAEIRNIFNKNNGSMGESGSVSWAFTYKGVIIVDAEKYPEDQVMDLVLEAGAED
FT                   MSTEDGVHEISTSPEAFDAVSKALENAGIEMMSAELSYVPNDPVKLGHDDAVKLLKLID
FT                   KFEDHDDVQEVYHNAEIDEADMDAE"
FT   gene            complement(399053..399769)
FT                   /locus_tag="Fisuc_0357"
FT   CDS_pept        complement(399053..399769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73969"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73969.1"
FT                   /translation="MKKLLTVIFLACAMVFAQEGSIKPEFQAFSGALIKLKKAEKGFHK
FT                   FRLRVDVAPWSFLAEGEVQAPGGDSDVLITALFDRALYAVLAYIPDKIAAGSDGEEYNV
FT                   GFFDMMLYYDEEPTRIRNLSFKLLPPANDSWAQSILDDALQSGSLLGRIWSGKYEREIT
FT                   KASAVPIDKTKLVDMQQKRQAAKAAEAERKAQEEADRRAREKAEKTKLKSKKVDLDCTG
FT                   RKLTAKQKRRCKMNGK"
FT   gene            complement(399799..401412)
FT                   /locus_tag="Fisuc_0358"
FT   CDS_pept        complement(399799..401412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0358"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: dps:DP2231
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73970"
FT                   /inference="protein motif:PFAM:PF02878"
FT                   /protein_id="ACX73970.1"
FT                   /translation="MENITQIWKKIQSPEFNPATDMNLVETVKQVALTSQEPAKVSFGT
FT                   SGWRGEIGSEFTLRNLQVVGAAIVRLYKEATPELFAALGVKDFAELQKRGVVVGHDNRL
FT                   LGHEFCEVVADQFAKAGVKVYYGGEMPTPEFSAAIEMLGAACSINMTPSHNPSHYNGIK
FT                   FNPADGGPAGPEITNVITKLSNEMMATWKFEPVSKVDWEIIDSLKIYKEFLVKQGTIKF
FT                   DRIKEFIKKGRLTLVCDHVHGSTRRRPAALLDNPECLITLRNEDDSLFGGIAPEPSSKN
FT                   LEKVRKVLDESKSWFRLGAIFDPDGDRIRFYDGTREIDMNQFGAIAFHYMATWRKEQGC
FT                   VAKSVATSNFVNIIAEKLGVPVMETPVGFKNFRPWLSRNAKQKALVAFEESDGISGLNN
FT                   TLEKDAQFGLLIALEILATTGKNLGEYLDALYEEYGRFYPTRSGFEVDKSLVGEPLKAK
FT                   VNAIADIAKPGAKVMVGSNEKTVKQLLTLDGVKVIFDDDSWMLVRPSGTEPKVRIYTEC
FT                   RNPDEKDPMFEAAKALFFKN"
FT   gene            complement(401577..402446)
FT                   /locus_tag="Fisuc_0359"
FT   CDS_pept        complement(401577..402446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfe:RF_1281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73971"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73971.1"
FT                   /translation="MANENNTTKPYIVKNADGVEYLLPYYPATFRALLDDKDTIRDLLN
FT                   GILELDRDHEIVDLSYAFEKYIDVFMPGDEPMRLDVWVSTRDNRFMNIELQNREHPFFL
FT                   DRMQLYNAYLTIRGKHDYNRSEQFLAMSEKEKMAHYYEVPETVSIWLCRFPILEPKNKY
FT                   IIVDLVKFLKLRKGVNSREDFWLRLISRGPLEVPESEDPLLKNALDRLRVSNADPELLK
FT                   KMEQFMFDGMHAYDAVIAENFLKGKTEGKSEGKTEGYADAISVMQAMGLPPEKIAEAKA
FT                   RLEALKSK"
FT   gene            402915..403871
FT                   /locus_tag="Fisuc_0360"
FT   CDS_pept        402915..403871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0360"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: dvl:Dvul_1296
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73972"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ACX73972.1"
FT                   /translation="MQITNASQLTGVFPALFTPLKNDDPKNLRNSIDYKKMGQMIDDVI
FT                   AAGASGVLPAVTTGQSATVSPQQHLDIIKFTLDYVDGRVPVIAGAGSNCTRESIEMIEN
FT                   VLKIAPVAVLCVTGYYNNPPQEGLLKHYQTLSSETGAKIVIYNVPGRTSSYVHPDTLIA
FT                   LAEDKNIIGLKQAVEFGFGEKFHEDTMRVIKETKGKDFAVMSGEDGLFADLLEMGGTGI
FT                   VSATGNIPEACKTFVDLYKAFQAGDKDKAHNLQKAARDYIDATFCRKNPIPLGTLFNSP
FT                   LFQPLVSVKDTANGADAVARIMKLIDEKAQSLKKYHE"
FT   gene            403966..404664
FT                   /locus_tag="Fisuc_0361"
FT   CDS_pept        403966..404664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73973"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73973.1"
FT                   /translation="MAKNEKSVTDLVCEHIKKQKLLPIPVQTLNEEAEATRYFGGDLKE
FT                   FLAAAKTLGAKGIFVETLYLEDDEFYYDSGIDDEEYLAMNGADGSCTCGCGDNCDCKKG
FT                   DKKKSKKADDDKVDGVFLEPEDLDGLDLSLLRPEIAKFLDRVGECCGVRLTVPGVDHLE
FT                   VEIFADWYDEFAELVDEASEIIEEDPNGALEQVEAMFKEAEKAAKEEDKSVKKISAHPP
FT                   KKTASAKAKK"
FT   gene            complement(404964..406790)
FT                   /locus_tag="Fisuc_0362"
FT   CDS_pept        complement(404964..406790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0362"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PFAM: glycoside hydrolase family 11; KEGG:
FT                   scl:sce4005 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73974"
FT                   /db_xref="GOA:P35811"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35811"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ACX73974.1"
FT                   /translation="MKTFSVTKSSVVFAMALGMASTAFAQDFCSNAQHSGQKVTITSNQ
FT                   TGKIGDIGYELWDENGHGGSATFYSDGSMDCNITGAKDYLCRAGLSLGSNKTYKELGGD
FT                   MIAEFKLVKSGAQNVGYSYIGIYGWMEGVSGTPSQLVEYYVIDNTLANDMPGSWIGNER
FT                   KGTITVDGGTYTVYRNTRTGPAIKNSGNVTFYQYFSVRTSPRDCGTINISEHMRQWEKM
FT                   GLTMGKLYEAKVLGEAGNVNGEVRGGHMDFPHAKVYVKNGSDPVSSSSVKSSSSTDAPK
FT                   SSSSKGNGNVSGKIDACKDVMGHEGKETRTQGQNNSSVTGNVGSSPYHYEIWYQGGNNS
FT                   MTFYDNGTYKASWNGTNDFLARVGFKYDEKHTYEELGPIDAYYKWSKQGSAGGYNYIGI
FT                   YGWTVDPLVEYYIVDDWFNKPGANLLGQRKGEFTVDGDTYEIWQNTRVQQPSIKGTQTF
FT                   PQYFSVRKSARSCGHIDITAHMKKWEELGMKMGKMYEAKVLVEAGGGSGSFDVTYFKMT
FT                   DKAHPLAQPEPESSSSEAKVESSSSTVALHAAPKMELKSGNFQVFDMQGRFLGTVKLDA
FT                   GASVAQVLKANFKNAGIYMVKQGNFMQRVAVK"
FT   gene            complement(407047..409758)
FT                   /locus_tag="Fisuc_0363"
FT   CDS_pept        complement(407047..409758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0363"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gur:Gura_0005 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73975"
FT                   /db_xref="GOA:P35810"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35810"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACX73975.1"
FT                   /translation="MSEEMVPGSQFKSLVEQDMQDCYLRYSMSVIVARALPDARDGFKP
FT                   VHRRVMYSMHKLGVVPNKGTVKSARIVGDVIGKYHPHGDVAVYDTLARMAQDFSLRYPL
FT                   VFGQGNFGSIDGDSPAAMRYTEAKMNNLGALMLEDLEKETVDMGPNYDESLEEPLVLPS
FT                   ALPNMIVNGTSGIAVGMATNMAPHNLREVGAAIHALAENPDLTGEDLMEYVKGPDFPTG
FT                   AIVCGRSGIREAYLTGHGRVRVRARTEIETDAKGKPRIIVTEIPYMVNKAELCKKIADL
FT                   VRDKRIDGITDIRDESSRDIRIVIELRRDAVGEVVLNNLFKYTQLQTTFSIYNLALVNN
FT                   LPKLLTLKDLLQVYIDHRLDVITRATQFDLKKAAARLHIIEGLRIATQNIDEVVKIIRQ
FT                   SKTTEIAKQSLQDRFSLDEIQSQAIVDMRLAQLVGLNIEKLEAEYNELIATVADLKDIL
FT                   EKRERRVAIMLQKLDAVVDKYGDERRTTIGEAIDDSDDEDLIAEEEQVITLSKEGYIRR
FT                   LPIDTFKAQNRGGKGIIGAGLKDEDNVEQIFTASTHSYLLVFTNKGRVYWTKVYRLPEG
FT                   ARNGKGRPIVNFVALTEGEKVQAIVPVRKFGGYFCLVFATKKGIINKMDLTLFSRPRKA
FT                   GVNAISLDEDDELVKVQLVGMSAEEYEASKNASDDDSAEAVENAAEAQAAEAAIAEESE
FT                   SGDAEDFANRPIPKDLLMIATKNGQAVTFPISCFRAMGRGTHGVKGITLAEGDEVISLL
FT                   WLKAGNKILTITEKGYGKRSEPGSYRVTRRGSKGVRNLNVTDKIGAAVFVESVADDYDL
FT                   IITSKDGQVIRIKAADIRLTGRNAQGVKAITLRDGDVVKDATALPSVEDIEQDSADAKE
FT                   TFDKVKGVEVDDDSVVKDDAEKQEIGPTETEE"
FT   gene            complement(409773..410594)
FT                   /locus_tag="Fisuc_0364"
FT   CDS_pept        complement(409773..410594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0364"
FT                   /product="stationary-phase survival protein SurE"
FT                   /note="TIGRFAM: stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE; KEGG: dde:Dde_2340
FT                   exopolyphosphatase / 3'-nucleotidase / 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73976"
FT                   /inference="protein motif:TFAM:TIGR00087"
FT                   /protein_id="ACX73976.1"
FT                   /translation="MEQLRKTRVLITNDDGVGSVNLHALALALSEVSDVYVFAPEDEQS
FT                   GVGHAFTIRRGLRVQHVESVPGKAKLPYEVYSVSGTPADCVKFAVGHFANYGLNDNTIV
FT                   PEGFDVCFSGVNVGENSGVSSLYSGTVAGAREAALWGVPAVALSLRGLKGNLLQVAIDF
FT                   ARKIVSENLFKKISKGVFWNVNFPKIKEDEFLGFKACTMDRGMFTDHYDHKDGLWFLDG
FT                   EKLWSMAPEGSDDNLLDKGYATITPHRIDQTDEESLEVISEMLGSDDFTSH"
FT   gene            410706..411458
FT                   /locus_tag="Fisuc_0365"
FT   CDS_pept        410706..411458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0365"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   bba:Bd1732 putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73977"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACX73977.1"
FT                   /translation="MYTEPKFLAMKEPSKFKRLAELLRVIILQLGDDVPRARREFETYT
FT                   EWLHLPESERLTGKNQAQMIDLYKTFRTRAGLGFERDVYLEQEPGDREVANEKPIQFAV
FT                   LVHNLRSAFNVGSIIRSTDCFGLEGVHLSGYSCSPDHVTVKSAARGCQEWIPIKRWDSP
FT                   FDCIKWHKENGYEIIALETGEDIPSINNVKWPEKGLIVLGNEELGIAPEIMAEATMKVT
FT                   IPMAGRKASMNVAGAFAIMAFCLRSNAK"
FT   gene            411659..412549
FT                   /locus_tag="Fisuc_0366"
FT   CDS_pept        411659..412549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0366"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73978"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX73978.1"
FT                   /translation="MFKSVIEYQDYHQYILDYYTERKRCSAFTWREFAKIAGFASGSYL
FT                   KLVSDHKTRLVQEGARKTAIAMGLLGYEYDYFMLLVQYENAKNDQQKKKCFEAMQEITS
FT                   AHKIKLLGSESYAYYESWLHSVVRELAPNMPGAKPLEIAKAIRIPVTAAEINDSLNFLL
FT                   KNKFLTVDENGNYHQSDKLLTTGRLNFVSIPVHSLIRQMGEFALQAFDDLPISERFFSG
FT                   LTMGVTEKSYKKVIEELKECRRKIFTAVSAEDETEKVCRLNIQLFPLTKNIKKRASENP
FT                   KQADENAETTKGTEV"
FT   gene            412552..414216
FT                   /locus_tag="Fisuc_0367"
FT   CDS_pept        412552..414216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_3475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73979"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73979.1"
FT                   /translation="MKYFSLKFLSSLTLIASICACVDRNVAGGISEETEGVVAITDKTI
FT                   AGVSQKGPFAKGSNVYLKETKDDGSLTPTGKEFYATIRNNKGQFKIENINLESQYALLT
FT                   VEGYYTRESTNMFSSCAISLNAATDLSKRNSTNINLLTHFEYQRILNLVESGATFAKAK
FT                   AQAEKEIFAAFGYEKPDRTAEDLDITGESEEDRILHEISVMVDNGLDNSYTPSCEKSKA
FT                   LIDTIANDFATDGIFSDSLTAAILEFSYQKNTSNTLRILKQYAGLGACSPVEAGNTYKM
FT                   QRTVFVGGFGYDYAICTGTSWSLLDSDEYNNATAAIQHKTGIMTDPRDGKTYKTTSFTT
FT                   NGKNYEWMAENLQYAEGKYTWTEAMAIDDSLVNKPNSSSILKDDSVHQGICPENWHIPG
FT                   FWEWKDLLKYVGSPNKLYSKNWNKIYFTGFQLEDNMDFNAEPTFFEPYIDCDGCNSPYA
FT                   NFITYTLEPITLDRATTIYQHYITDYYYTYIPTKVNDYAEYADQIVKAISKGTLNIVSA
FT                   LFASDYDASDPYIPYPYFTIIVSTKTNFEVNVRCVKN"
FT   gene            414226..416286
FT                   /locus_tag="Fisuc_0368"
FT   CDS_pept        414226..416286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_3475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73980"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73980.1"
FT                   /translation="MFIKPLNRSLWACSSLAASLLMSACSSENSVSIVPSSTGSNLETP
FT                   PQPGDNTEPGYDEVVLSGTISGVSQKGPFINGSTVKLYELDEKMHQTGVHYSTTIDNNK
FT                   GKYHIDSVVITKPYAWMVANGFFLNEFTGKKSSKEITLNGLVKVEKGKDININVLSHLA
FT                   FNRINYLVQQGSSIEDAQKQAEAEVLKAFDFDAEETSFKNMDIFANGEGDAKLLAVSLL
FT                   LLNRKPENEYDDENDVAQAIDLMAQISYDLETDGKWDDTNLKQEIKEDLVYFTYRYDSN
FT                   GDNIISKARRQMQSMTTKSIPNFEKYIKKFLSPDTIWGSCTNENEIQRNRYSDRYICQN
FT                   SKWTSYNPLIEEECNAENEGKVKSVWVSSSGNPRFRYIGHTEYYRCEKGSWESRGIWVT
FT                   CDTAGVAIGDTCSKDQCLAGIGCTISSYAYEGNGNWKLLGSTPALYNVTPGCQKEKTFV
FT                   GDTCSVMQSEGMEYYVLNKDSTWEKCNIDPNLGACPLEANHYYSQLFNDYNGKYYYCHG
FT                   GEWTEVKLVPHQYTDPRKKGLTDEEYDILDLPKDASVGDRASGLLEICYNHPDIAEYFY
FT                   DSLFCMPRYYYRYRENGTWTLETEEDRSADNRFNLPECTIDKEGMVQKKLPEPADEAGV
FT                   YVEPGVVVKCVIEKMCNGGYQLTKDEPCPQGDKGRIFPAYRHVEYIFGRTE"
FT   gene            complement(416380..417591)
FT                   /locus_tag="Fisuc_0369"
FT   CDS_pept        complement(416380..417591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0369"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   acp:A2cp1_1717 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73981"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACX73981.1"
FT                   /translation="MNMKKFALISAIGFLAASAFAAQGAPMGASVDPTPEEQKALDALK
FT                   GKIEGAIVWATSRANPHHDIWIMNADGTNARALTKSNNVDWFPRIAPDGSKVLFNRSKG
FT                   GWVPENDANYPEKWDLWTVGIDGTNETKIVENATWGTWRPDGKSIVFSRAGKVFTMDLA
FT                   SKKETLVLDGEKVFKKAGVILQEPNMSPDGKHLAITLRGSMRETGVWDLTKNVWTKSGD
FT                   GCQIDWNFDGTKLYRVNPTGNGGTAAPSEILWFTAKDGKQVEKVGFFGIPKNVKLMDLP
FT                   GRRSHEYFPRLSPDGKWLVWGATDKGHDHDLFDYELYIWKIGEPVETATRITYNSGNDR
FT                   WPDIWFGKVPVSATPAATAKAVETAANATAAAIAGGVSDAKMDELIKAIDRLTEAVKAL
FT                   APQK"
FT   gene            417796..418167
FT                   /locus_tag="Fisuc_0370"
FT   CDS_pept        417796..418167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73982"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73982.1"
FT                   /translation="MKLPIFRCLLLAGILAAAWNCSESAATQDSASNKTSNLQIPQNLV
FT                   VSEPSYFYQLGTTYYIIAPKTMTVSDGSGNVIGTFNTSTGAIMSLSGEIIAINLDLSKL
FT                   PMVSPTVPSKDLIAVDLDT"
FT   gene            418188..419702
FT                   /locus_tag="Fisuc_0371"
FT   CDS_pept        418188..419702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0371"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; KEGG: dat:HRM2_49180
FT                   putative N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73983"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ACX73983.1"
FT                   /translation="MSDALEKRIKKHIIGKPHRFLAVSPLGFEQTLSRELEIILGESAT
FT                   EQPHATGDGKVEFTTKLTEAWKVVAVSRTANRVLMEIANFKAENFRDLEKKASEIPWEL
FT                   YFDKKTGNALQTRDESIIPSNSKLVTSNLPHIHVTCKHSRLYHSDAIAERLYKIIEGVS
FT                   LPLASADTASATPSAGTPRNAPAQNENRSIQQNLYVNFLDDRCTIWLDLAGEELYKRGF
FT                   ERFVNDAPLKETIASAMIFEAFYTASLTTNHQPQTTLIDPMSGSGTFSLEAACIANKII
FT                   PGTCRDFALKHQPAFKEATWNFLIRQETRDDKCVGRVSRPCLHEHDRVQHLGLERSDNP
FT                   KTNSETAAIAKIITSDISERAVSIIKHNIECCPLASISPAPIAPQQKDFFSYTAKEIVD
FT                   ACGDTSPILVLNPPYGKRLDFDAPKLYTQIGKKLTELARDLHNFGKTLTVAILAPKDDT
FT                   RNGAKYTCTANLLRECAALSPEQSPTAKVIQTSHGGFSLNAIFATI"
FT   gene            419809..421665
FT                   /locus_tag="Fisuc_0372"
FT   CDS_pept        419809..421665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0372"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: nmc:NMC1090 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73984"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACX73984.1"
FT                   /translation="MPKLRSLKTMEGREMAGARALWHATGTKVEDFGKPVICVVNSYTQ
FT                   FVPGHVHLKDVGQVVARAIEAAGGVAKEMNTIAVDDGIAMGHDGMLYSLPSRDLIADST
FT                   EYMANAHRADALVCISNCDKVTPGMLMAAMRLNIPAIFVSGGPMEAGHVTTKDGKDRAL
FT                   DLIDAMIDSADNTISDEEVADIEANACPTCGSCSGMFTANSMNSLTEALGLSLPGNGTI
FT                   VATHAERKKLFEAAGKRIVELCHQYYDLNDESILPRSIATKDAFENAMRLDIAMGGSSN
FT                   TVLHLLAVAQEAGVDFTMKDIDRLSRNTPCICKVAPTVHNIHVENVNRAGGIMGIIGEL
FT                   DRMGLIHKSAKTVHAATMGDALEANDLKRNPTAEAKQRYLAGPGRKYNIEAFSQNFMYP
FT                   DHDLDRANGAIRDGEHAYTKDGGLAVLYGNLAIDGCIVKTAGVDESIWKFTGPAIVFES
FT                   QEEAVNGILGNKVKAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSRHLGKSCALLTDGRF
FT                   SGGTSGLSIGHASPEAANKGNIGLVHTGDVIEIDIPNRTINVELTDEELAARRKEMESR
FT                   GAKAWKPENRDRVVSKALQAYAAMASSADKGAVRDLSLIGVK"
FT   gene            complement(421886..422182)
FT                   /locus_tag="Fisuc_0373"
FT   CDS_pept        complement(421886..422182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0373"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: dat:HRM2_41220 RsbV"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73985"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ACX73985.1"
FT                   /translation="MKIEKNVDGSSTSFALEGRLDTMTAPLLESEIQGKLDGVTDLEFD
FT                   FAKLSYISSAGLRVLLSAQKIMNKQGKMTIKNVCDEIKEIFEVTGFSDILTVV"
FT   gene            complement(422220..422633)
FT                   /locus_tag="Fisuc_0374"
FT   CDS_pept        complement(422220..422633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0374"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: sfu:Sfum_4032 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73986"
FT                   /inference="similar to AA sequence:KEGG:Sfum_4032"
FT                   /protein_id="ACX73986.1"
FT                   /translation="MQNWVKEIVVDSKFENVKTLTDFVESSLEPLNPSPKAIMQIGVAI
FT                   DELFSNVVRYSGSSNMKLILNVNEDVLTAKLTFIDEGVAYDPLKKTDPDVSLPAEDREI
FT                   GGLGIFLVKKIMDGVEYKRDGEKNVLTVVKKLG"
FT   gene            422722..423243
FT                   /locus_tag="Fisuc_0375"
FT   CDS_pept        422722..423243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0375"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: xfa:XF1262
FT                   7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73987"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACX73987.1"
FT                   /translation="MCLKANNSIFSRMINTTLCYIEQDGKYLLLHRIKKKNDINKDKWI
FT                   GIGGKFEEWESPEDCIHREALEETGLTLIRPKYRGIVTFISDGMDQTEFMHLFTATEFT
FT                   GSIKDCDEGVLEWVDKQKVKELPHWDGDLIFLALLERGEPFFSLKLTYKGSTLTEALLN
FT                   ETPVTLQDFL"
FT   gene            complement(423403..423957)
FT                   /locus_tag="Fisuc_0376"
FT   CDS_pept        complement(423403..423957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73988"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73988.1"
FT                   /translation="MALRCGVFFYIVIMLYHKFISRLFVALMLAMVVSFFSGCYSFTAS
FT                   TLPSHIKTVNIHEVEDKTLDPVLANNIHTAVVDMFKRNAGGVRLVNSDANADFEITLLS
FT                   YSNKPENYNSNSDVETYRVTIRVEVKFYDNVKERIIYESKSLSADGVYDVQANETEDRH
FT                   GQTRAVEKLQDLIVSNALAKW"
FT   gene            complement(423988..426681)
FT                   /locus_tag="Fisuc_0377"
FT   CDS_pept        complement(423988..426681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0377"
FT                   /product="fibro-slime family protein"
FT                   /note="TIGRFAM: fibro-slime family protein; KEGG:
FT                   hch:HCH_06493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73989"
FT                   /inference="protein motif:TFAM:TIGR02148"
FT                   /protein_id="ACX73989.1"
FT                   /translation="MKLYRWITLGALFGCSVATFAQTQDVRTLDIVIRDFQPNHPDFEN
FT                   FSEESVNHLNEIYNYRTSTGAAMNLYGYDAVWYANVPYHNTCGNMNTFQPGIVGAEIGT
FT                   DGFPRQVNPYLPAYLQTVSAGPVLEYGECSQKSTQGWTQRGYKNAQNDVSGYKCPNGGT
FT                   NWSNPVIYTPGMVNPYLIFAAPGADGKIDMYDGVVISKMNERCDNQFFEQWYLDVPGQN
FT                   KRVNTTMDIPKDPAGTKYYIYDYNYNNGGYSPLDSINPVTREWVMNKPCNASIQPNGVC
FT                   DQYDPQTLSIFCPPYNYQYAKDQADFLNQNTAKLCQDWLNQGGPRAVENGSGHSAAWQA
FT                   AVMNGSLGLQHLRNYAFTMMGYASFKYKTTNQTPSHEVFEFAGDDDMWIFVDGVLVVDL
FT                   GGTHLSAPGKVDIEVLARNNHGCHVGEPLSGYTNCSGASDATGWADDTWHHLHFFYADR
FT                   QSDGSNIYIRTSLAELAPSRYGQPTVSDVVVKVDENGISHNSMYMNVPLADSSLIAINN
FT                   PNVPSMVVLREVTDANGQKVTMVYGFYVTSMTGPIDKGADGQMYQFEGVVKDLNGNVVE
FT                   GGLLGDDRLAFNVPYSQGLNDDGNGGNYTAQEWAQLMAWSQKVTFYVASSSGKHVEGFD
FT                   EREKWGKISYTAVATTPVVPDDPAYDRPDFTNESQALTDLAGSGTIPTDMTADLVLTPI
FT                   PAVNNVDPLKWAKDSAKVLMTSGAQGATTVPVGTGVVYGAGQDANKTLCYNDGSANVPG
FT                   KKSNESCTSWSFPTTQPFHVNIRVFDHLGHFVNQYSKRVTQEEFENALNGLRSSTKSAG
FT                   VKVPGCGETPMYGSTGAMLATIKMYPVTDKGRLLATGPYVYQMTVVKEAYSYCYASNGN
FT                   NPTIMTMPFQRTTETIRRGYRRTQKK"
FT   gene            426885..427544
FT                   /locus_tag="Fisuc_0378"
FT   CDS_pept        426885..427544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73990"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73990.1"
FT                   /translation="MNWSIVFFVIMMLLLLRILRLRIRANSTRSESFKRLPPKDQLAVL
FT                   KECLLNNPSEANLKNLAEFSERTSIKIDVESYRPFLKSQLEIFGRKDAIAEDNELYAKE
FT                   CEWMDKITPIEFEEAESFRQANETQKYIERTLEGIARLYSDEAILETLAKIAPDYPHAS
FT                   ELTESYKQLMQARDESGADDKSLEALRKQKNAWEEDLLNVKLVDSRKLAEPSPLRS"
FT   gene            complement(427602..427949)
FT                   /locus_tag="Fisuc_0379"
FT   CDS_pept        complement(427602..427949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73991"
FT                   /inference="similar to AA sequence:KEGG:EDI_199210"
FT                   /protein_id="ACX73991.1"
FT                   /translation="MSIAEFSKKFHADKRGNCAMAVAYGYARATGKSEEEAVKAAEMFR
FT                   AFGGGKAPDGLCGALYAAKMMQPDHAESIEDVFKRGAQGCTKCQEIRPNKIIPCNRCVE
FT                   LAGEALDFLEK"
FT   gene            428078..428242
FT                   /locus_tag="Fisuc_0380"
FT   CDS_pept        428078..428242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73992"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73992.1"
FT                   /translation="MPNKNNDIQNLDLDQLIGNMSSINSEDYWFTKVSKIEEYDESAPQ
FT                   KPDSESHQR"
FT   gene            complement(428342..429598)
FT                   /locus_tag="Fisuc_0381"
FT   CDS_pept        complement(428342..429598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0381"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: PGK1;
FT                   3-phosphoglycerate kinase, catalyzes transfer of
FT                   high-energy phosphoryl groups from the acyl phosphate of
FT                   1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme
FT                   in glycolysis and gluconeogenesis; K00927"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73993"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACX73993.1"
FT                   /translation="MAKLSIEDLELAGKRVFIRVDFNVPQDKVTGEITNTKRIEAALPT
FT                   IQYALEKGAAVVLASHLGRPNGEKNMKYTLAPVAKKLEELIKKPVKFLPDCVGPEVEAA
FT                   CAAIKPGEIILLENLRFHIEEEGKRKIKNADGTETKEKADKEAVKAFRASLTKLADVYV
FT                   NDAFGTAHRDHSSMTGVELPQRAAGFLMNKELKAFDQVLNNPPRPFLAILGGAKVADKI
FT                   QLINNLLDKADKIIIGGGMAFTFKKVLNNIEIGSSLFDEEGAKLVPDLMAKAKAAGKEI
FT                   ILPVDYIAADKFAADAATKAVSDAEGIPAGWMGLDVGAESTKLFVNAIKSAKTIVWNGP
FT                   AGVFEFEAFEKATKAMADAIVEATAAGAITVIGGGDTATAAKKYGADKKVTHTSTGGGA
FT                   SLELLEGKVLPGVAVLTDK"
FT   gene            429902..430948
FT                   /locus_tag="Fisuc_0382"
FT   CDS_pept        429902..430948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73994"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73994.1"
FT                   /translation="MKRSFLLALCLSAAAAFAGVYDIADFTAKDAVMSDNQVFAANGGQ
FT                   ELSTASVDEAAAVPSGNIVLRQKFAQESGLNAYQLYIGQVGDVSSMTALSVPSTVSYKN
FT                   VIKSKLYVRRGMKPGDDAEKVYFDGKYVYIPGATSAITFVNGIATELKSEAPAASASSA
FT                   PKQECDEFDVSCDEDIIAAKNSKSYDVSGDLNSTNSRADSRDYSASAAAQDVKDRFGIA
FT                   DEVRFWSAVALSAVAAGSAVVGVLQQMKASEADKAYKDLEKVANNVEGKIKEVCSSINN
FT                   FDRCVKWYKTEATPETKAFMIDGWSYIDLQNRMKINKDTKDSYAMGRNIWFGVTAVSLT
FT                   AAIVLFAW"
FT   gene            430948..431310
FT                   /locus_tag="Fisuc_0383"
FT   CDS_pept        430948..431310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0383"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: tcx:Tcr_1812
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73995"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACX73995.1"
FT                   /translation="MEQGRIRLKDVQFDCIVGILPYERENEQPIILNLTLWLDFAKAAE
FT                   TEDLNESIDYAKLAEELKGFIRLSCFKLVETLVVKTAEYVLEHYPKATAVEVSVAKPQA
FT                   VPGCLGAEASVKISRQ"
FT   gene            complement(431347..432876)
FT                   /locus_tag="Fisuc_0384"
FT   CDS_pept        complement(431347..432876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0384"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: gsu:GSU0489 Mg
FT                   chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73996"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ACX73996.1"
FT                   /translation="MFRRIRSYCLFGIKAVSVSVEVDAAQGLPGFTLVGLPDNAVRESR
FT                   ERVVSAIRSIGKVVTGFRTTVNLSPADLRKEGSALDLPLAIGLLVSTGEIEIPQLERYV
FT                   FVGELSLDGLLKPVRGVLSIAMNLSTERKCILVIPRGNVQEASLVEGIHFVCADTLGEC
FT                   VEILTRNSCQDVKVAKGIASYRVDVDDKVPDFKNVVGMDGVKRALEIAAAGAHNFLLVG
FT                   SPGAGKTLCAKCLPGILPEMTEQEILETTRIHSCARSAGDSDEFKPVLARPFRSPHHSA
FT                   SMVSLVGGGTRLLPGEASLAHNGVLFLDELPEFNRSVLEALREPMEEGEISVSRASGTV
FT                   VWPARFMMGAAMNPCPCGYSMDPKRECTCLPEARKRYREKISGPLLDRIDIQVSVPPVD
FT                   AAMFAIKGRGESSADIRRRVCAARVIQRERFRNLTFKSNAEMSSEYARKFAAMTPAVES
FT                   FAVNAAAKMELSARGYFRLLKVARTIADLRGASAVDIMDLSEALRYRAFRG"
FT   gene            complement(432889..433179)
FT                   /locus_tag="Fisuc_0385"
FT   CDS_pept        complement(432889..433179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0385"
FT                   /product="Uncharacterized protein involved in the
FT                   regulation of septum location-like protein"
FT                   /note="KEGG: afw:Anae109_0126 regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73997"
FT                   /inference="protein motif:COG:COG2088"
FT                   /protein_id="ACX73997.1"
FT                   /translation="MSPAFDCLAVTNVQVFPFKEGANLGHMKGLATIVLNDQIQIRGLR
FT                   VMDGENGMFVGYPIDTFYKGEDYRTVCLPITRQLREHIENCVLEKYQAAVA"
FT   gene            433459..434007
FT                   /locus_tag="Fisuc_0386"
FT   CDS_pept        433459..434007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_08770 GGDEF domain protein
FT                   (selenocysteine protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73998"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX73998.1"
FT                   /translation="MLLKPNMQWTANQGIIHPMVTAEFSQTTNSVVVKFTVEEPLDCYR
FT                   AAVQEDNGRSWEDSCVEIFLQNPANPAEYFNFETTSRGFVLAARGIDRNNRQTLPLDTI
FT                   AKIKRSGTTPCIQDDSVYWTMTIEIPAEIFGIKSFQAPLRGNLYKCADKANKPHYLSAF
FT                   RIETEKPDFHRPEFFQVLG"
FT   gene            complement(434047..434802)
FT                   /locus_tag="Fisuc_0387"
FT   CDS_pept        complement(434047..434802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0387"
FT                   /product="acyl-ACP thioesterase"
FT                   /note="PFAM: acyl-ACP thioesterase; KEGG: dat:HRM2_18760
FT                   acyl-acyl carrier protein thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACX73999"
FT                   /inference="protein motif:PFAM:PF01643"
FT                   /protein_id="ACX73999.1"
FT                   /translation="MIDIYTLAKNPLVFQKPRTITSAYIDVSGKMGLAQTVLMVQDNIT
FT                   ENFGAMKMDNFVVKEKGGFWVVYKAKFKFLKRPYWRDKVVTTSFPADNQLIRLNENTAI
FT                   TTVEGEPIIFAKQEMCCLSLDRHRPMRLSDVDFPTEGFPDAFMTDEFDRFNVKPEEYEE
FT                   VYQQKVLPQHIDMSHHMNNIEYVKLALNVFSASDLELCIPSELEVHYLGESEEGQTMRV
FT                   FRADHNGATYMRILDENDRAVFEMKLRMM"
FT   gene            434837..435388
FT                   /locus_tag="Fisuc_0388"
FT   CDS_pept        434837..435388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0388"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: maq:Maqu_1760
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74000"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACX74000.1"
FT                   /translation="MSTVIIFNKPFGVLSQFTPEAGHPALDSFGFPPGVYAAGRLDHDS
FT                   EGALLLTDNGKLIKKLLDPKYEHPRTYLAQVDGQITEEAVCKLAKGVDIKGYHTKPCKA
FT                   EIVEAPEWIWERNPPVRFRANIPTSWVKLTLIEGKNRQVRHMTAAVGFPTLRLVRVQIG
FT                   NIPLGKLKPGEWRIVTDKVI"
FT   gene            435502..437232
FT                   /locus_tag="Fisuc_0389"
FT   CDS_pept        435502..437232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0389"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="KEGG: similar to alpha-L-arabinofuranosidase; PFAM:
FT                   Alpha-L-arabinofuranosidase B catalytic; Carbohydrate
FT                   binding family 6; SMART: cellulose binding type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74001"
FT                   /inference="protein motif:PRIAM:3.2.1.55"
FT                   /protein_id="ACX74001.1"
FT                   /translation="MRYTTIKVVALLAATAITVYANEGPCDIYARAKTPCVAAHSLTRA
FT                   LYSSYSGNLYQVRRADGQTKDIPVEEPGGFVKSSVQDDFCAGSKCTISIIYDQSSYKND
FT                   LKKSPPVYWLKEGAKEADANRAPIYISGRKAYGFYRDAWSATGYRNNNTKGVATGDEEE
FT                   SMYMVVDGRHYNDLCCFNYGNAETTGNDDGPGTMECIYFGSDKDWGGPGQGNGPWVAAD
FT                   LEDGVFKGNDAGWQWGKTHTTPWPNALSIEADYVTAMLKGPNDGTFKLKGGSAQKGKLN
FT                   TMWDGPRKRGYSPRKLQGAIVLGNGGDGSDGGAGTFFEGCMTIGNPPDSIDDKVQANIV
FT                   AAGYGSKIELKKPDPIEPFKDTLTIPGKIEAENYDKGGNGQGFLDTDIENENSLYREDN
FT                   AGLDSAGDAIIYGWGYANDWLRYTIKVSKNDSLDITARVSSPSDSTFFSILVDDKDIAK
FT                   IMVPNTSDWKNFETVTTTVPAITAGDHVLKIQIDKPYFNLDWIEFTAAKEKTALPQFSL
FT                   RTNSSQIYSVYDVLGNRVTSFQASESSMQNIWDKARVDLPGGIYVIKTNSKTIRISNTK
FT                   "
FT   gene            437339..437968
FT                   /locus_tag="Fisuc_0390"
FT   CDS_pept        437339..437968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74002"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74002.1"
FT                   /translation="MKKILSISLIFAVLVLSGCAILTGTRMRPIVLGQMLIYVRVSTAK
FT                   AYIATEMPEKLEIDTPYNVNFPFYYKNAVHDTTKGIASVTLFNEDLEMGFILASYSKAV
FT                   QNNPEVFQNDISDSLKTTRIFTAYDEFFKDCTNENLIDADYNSEKKYTHRCYKITHDDG
FT                   TPEETCIASRLTPKGNIVVVFMRSLTFDTNVRTELFDAIESIEFKD"
FT   gene            complement(438049..439686)
FT                   /locus_tag="Fisuc_0391"
FT   CDS_pept        complement(438049..439686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0391"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="KEGG: ecz:ECS88_4623 anaerobic class I fumarate
FT                   hydratase (fumarase B); TIGRFAM: hydro-lyase, Fe-S type,
FT                   tartrate/fumarate subfamily, beta subunit; hydro-lyase,
FT                   Fe-S type, tartrate/fumarate subfamily, alpha subunit;
FT                   PFAM: Fe-S type hydro-lyase tartrate/fumarate alpha region;
FT                   Fe-S type hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74003"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ACX74003.1"
FT                   /translation="MAFKYEATVQHGEDTTEYVSLGKDGVSVAEFEGKKILKVSKEALT
FT                   KIAQAAFEEVEFCLRPAHTAKVAKILQDPEASDNDKFVALTMLKNACVAAKGILPFCQD
FT                   TGTAICVAHKGQQVWTGFDDAEAISEGVYNAYTTKNLRYSQIAPLTMYEEKNTGCNLPA
FT                   QIDIHAEEGAEMKFLFVAKGGGSANKTYYWPMTKALLNPKSLEKFLAEKVKTLGTAACP
FT                   PYHLAIVIGGTSAEMNTHMVKLASCGYLDDIPTSGSEGGRIFRDLEMEEKVLHICQKTG
FT                   IGAQFGGKYLVHDVRVIRAPRHAASCPVSIGVSCSADRNIKAKIDENGLWLEKMEHHPE
FT                   NYIPAGNAVNLAPAIEIDLDRPMKEVLADLTKYPVKTRLSLKGTMIVARDMAHAKIAEI
FT                   FDKQERGEELTDEEKTVLKVVSDHPIYYAGPAKTPAGMPTGSFGPTTANRMDPYVMRFQ
FT                   SKGASMIMVAKGNRSQDVTDACKKYGGFFLGSIGGPAAILAEQNILSNDIVAFPELGME
FT                   AIRKITIKDFPAFILVDDKGNNFFEGLI"
FT   gene            439916..440617
FT                   /locus_tag="Fisuc_0392"
FT   CDS_pept        439916..440617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0392"
FT                   /product="mucin-associated surface protein (MASP)"
FT                   /note="KEGG: mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74004"
FT                   /inference="similar to AA sequence:KEGG:510377.134"
FT                   /protein_id="ACX74004.1"
FT                   /translation="MKKILLATMISAAMVFAAPAAKKVSKAATAKKAVAAKVEKAAEAP
FT                   AAVEAKAAEATAAAQTQAADATTAAQAQATAVADSAKAQATDAAAAAQAQAAATTEAAQ
FT                   AQATAVVDSAKAQATDAAAATQAQAAATADSAQAQAQAVVDTAKAQAAEASEVLEAKTE
FT                   APVDSAALAKAEEEKKAAEAEAKAKAEEEQKVAQETSGTAKSAVMDNPWEFIAVSAAFI
FT                   ASVLVIIFTGD"
FT   gene            440942..447331
FT                   /locus_tag="Fisuc_0393"
FT   CDS_pept        440942..447331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0393"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; SMART:
FT                   Fibronectin type III domain protein; KEGG: hch:HCH_02464
FT                   cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74005"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACX74005.1"
FT                   /translation="MSIKKYLLALCAATSVMAAQQEQPTPYDLIRPTFPLTWDSTVFDR
FT                   FDTTVTKKHNMVPRNRTPAAYAPNALIPDTLNQAYLDAINVRMSPIRVNQAGYLESDLE
FT                   RQFYYIGNASSFEVVDVNGKSFSPAVMGSLTPSGQSISSDWTIIAGTNAATNDQKRYQV
FT                   DITGQAGKLMIGHIPQGVPTDTRLRIKVGNDISSTFIISNKVYSMVKDAALKFYGINRS
FT                   GDGDSWFHAASHMKDGAGAVVTGAEDVRDQYNAALAGTLQGGYYDCGDHLKESQTQMYA
FT                   FMVAAVLAATNADADEDHYAFNHGETVNTDGMPDMLREAKHGADYVLRAYIRAKGVIDD
FT                   MALSVGNFGSDHGWWGRPENSDKLPVDGSAAATDRGGPMSRTVRLGEIGANIGGETAAG
FT                   LALVGKLYSEYPEHKAFADSCLKVAKEMYDFAKSMAQGKVYKNNTEAAGWSSPAYNGNN
FT                   EYFDDLALASVALWYATGDSKYGDDAIRSKTLGTTVPQSFMENCVGCFDGGWFVTDNKG
FT                   FLKNVKNTSWANAYAYATYALYKLILADENKAINEFGMTKEERLNAIEDCIMSMIHNLS
FT                   DVSAGTATITLPRKDPSNYMVQDIGWKGNEVKYDPIWYSMQTDQTWIYNRYQAGNIFEV
FT                   LAYADVAKDIEKQNLSLPNLGTPNWKADEMFQLGINQLNYLLGVNPWDVSYILGIGDKN
FT                   DAHPHHRAANPEGKNQPGAAYKYNPPVGALYGGVTPGTTNSMVPDNKSWEDYHKSETCI
FT                   DAAATLVSSGMIASAKFDRTAAPDISVEIRHVSMDSAIVMIKLTQRGTTVISYGTTEGQ
FT                   YTLNAVDSVAGIQHEMVLRGLTPGTTYYFYVTGSNAYKPENSKTKFLVDSTQTPFTFTT
FT                   LSTIENANIANVTVCNVSADSAEIMWYTPNGEYESKIYWDTIPHSKAEEFAFNTGTGNA
FT                   DVSGIPTQFHYVKIGGLKEKTTYYFMVESNGVQTNVDDKGNLLKFTTPVGWYDFSVRAY
FT                   QYEFGGTEFLNLNIYNNEARAFDSLTLRMYFSAKPEEVEKCATLIDSDICQAYDEAGFN
FT                   KPCENDRELRDLMRAALPVRLDDTYNPTTGKYAYYFPVPLGSSIIKSQSRLRVDLTYSS
FT                   GISNDGYKTCETLRAPAKKHMDKTTGDWSWAPHEFLVDGADYDGMPQEDKDYGDLDNDI
FT                   PVNPYIVVYRKNEFIWGFSPSKSEMETKKANYQMDVTFDPPFNVSNGSHIDIDQTSSTV
FT                   HVTGYAHITEGGYVTKIWANGVQISGEAFADGTDRWLLNEAGTEIIAKYNMTTDMWDLD
FT                   IPVKMGIGSNKIDITIFAGPNPTCEKCSEGGGCAFENRNYYINFSKGDATASTLVIKDA
FT                   AGNPITSPANTDGTVFFIDLMDKDKIKGNVQTLEVQVLNNKKNDVLKVTLTADAANPGH
FT                   FVGGPITAVSHSKETRNAASEISFFAGDTIQVVYTDPDDEDDVSKQTFYAESKVPSPQT
FT                   VLAEDSNCDNKADQLRIVFTNKLSADYPLDSIRYFIEGMSDTVSVPLVAANYTDKNEIL
FT                   IALDTSLIPTNANPSGKITTYVADRGVANAESAKITDGILPTLVSVSILEKSDNDDSGL
FT                   DTVMIAFSEPVIFSNMNEWPLVIAGTTSAPTLAAAPTTTNNGKSWQLIISGNVNNSLVP
FT                   IGALASARTTGGFTITDQNFNQINPAGCNPSVPVTLISRPVPVYHADMIDKEGDGVPDV
FT                   VYIVFERKLKPKDVFDSIVTVWGNPGITRSFITTADTTGGVIVPKESYWTIRDTVSAPF
FT                   TIQIDSVTTKDSVNTYSIIEITIPATHAYPYGSTSGDRDGNGTVSPLKGAANGFFETNY
FT                   TLYDKCAPVISTARMIKNGLLTVNISEPVTVLDAGKYIQRERDEFIPSQAPQGMGKSFL
FT                   FTYNEKDNVFHAGDRVRLVPNILGSAYVDKNSNTPTIANPYVRITGDDNIRFSVTLSKP
FT                   VSTPKAGAYMGRPESVSNDAFVTSAVINGKHNFINGDGTVIGQVDTAAYFGSGPNFEIE
FT                   VMMPSASFTTHEGLPMYNFHLKIVTDLYDNLGQYINTYKLDIPSEKFQSMRNLIDNGTL
FT                   KLNMEWAAKDNEAPVAKKGNKIGTGAYIAKFDFTAESYCAAKFDESSNDYKAKCTEIGA
FT                   RAEKASDSKTKTLGFKRRK"
FT   gene            447405..453260
FT                   /locus_tag="Fisuc_0394"
FT   CDS_pept        447405..453260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0394"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; Fibronectin type
FT                   III domain protein; SMART: Fibronectin type III domain
FT                   protein; KEGG: hch:HCH_02464 cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74006"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACX74006.1"
FT                   /translation="MKRLLSIVSLLAMFCMDYAEAELPNIDRTCTTCSRRYLDSLNVYN
FT                   RRPIRMNQSGFRPQDYKYAYVADPKEMTFKVIDANSGKEVPGGGNLSLIKKGATKPNIW
FT                   INGAFNSMESIYEFGKQDSISTEKEDLYRADFTTLSTTGEYFLVVGKDTSATFHVHPSI
FT                   YNSILENSLQFFGIQRCGNTDSHFHKPCHLKDGSKVGHDLTGGWHDCGDHFKVSETLGY
FT                   TAYVLSMVYLTYPNKAEDRYGHSYADTVFTDGIPDILYEAKIGADYILKLYKASKEDGL
FT                   IAQNDMYHSVGVDEKDHSFWDLPERQDAQPESKGGPDRVVLTGIGANTSGMFVAALANV
FT                   AAGYRVYDPAYSDTLIEAAKDIYKNVMMPLFDYGNGNEMGKTTSFPGFYTGGGPRYDDG
FT                   AAAALALWYATKDTTYRYDLYKNTNIFNNPTNSRFNLDYFKAGFLGNESGFSPGGWATD
FT                   YQNIHTYVLFAFQNLILKSSETAAEFGLTEIERDSLSMRTMATFRKILNDATNQGDSTV
FT                   LVNPGVNSNEKSEAHEGPTDLKVITPYNLVWTSFDWGVIRYNLGTAVSIFLMYELTKDE
FT                   RYLKVALDNMYYALGANPWDISLLMGAGDKNPQHPHNRSANPDGFNTGGMPYQYRCPKG
FT                   ALMGGRDPEKTLIEDWSKYTSTETCIDFSAQFLFPAQSLAETLPPDNEGPIFSNIVGTP
FT                   ITDSTAIVSWDANEVALVTVFYDVVPNSANPKSVQQTTASKGGSVTLTGLIPGQTYYFF
FT                   LEGMDTKRNITTDDNHGYWYSFTMTPKMTEIKGVTICQVDHRSAKIYWWSTDRLNGVVN
FT                   YGKAKGAYTETQNASGSAVLFHEAELTGLEAGTTYYFTVSSGAKTSEEYSFTTENHATY
FT                   ADLDISLKPSSYGGEAACSQWQDCHAFIMSLSNNDTVPFEDFEVRMYLKDQNLSALGNC
FT                   HQNFGGDGQMGKPINVTFGTAQADGFGGYYLPINVKGKLEVSGQLIIQIIFHNYDPNVK
FT                   TVKFSDIDNSWSLRAHTEETDPEHFEGIDLTQAPYFKGSETTFLEYNSRGEKVVAFTRD
FT                   PYITVYYHGKHIYGYGPDYTPENGPQVKRTIETTFTSPFVSPRYSVEKEDPLTTYAATS
FT                   KVTPTGVLDAVEMNSNPYKFDYPNPNRTDSIAFGTDTTLVYGNNYMEWVTWHNRNANQK
FT                   TENKYDCACAVVRSNVEIDSITKPLEKRYLTFDKLQIEGYKDKFIEVQISLLDSSLAVI
FT                   KDEKNLNVELVSDDPNVQFYTDPTATIPVTTITLYDGVATIYVSSKVAVTTNIYATHGN
FT                   TADYAYTPATAVLNIAELPPWPIIDVAKIVDLNCDHIPDAMDITLSSEYAENQSFTSIS
FT                   FTYGDKTYTSDKVKSLNGKSLVVEINVPQEIVTNATGKITLTSNIQGTTKTVDDSYGDG
FT                   IAPALLSATVLERQDTSTTDHVYLQFSEPISAPGTIFPLILYGTDGVTLAATPTVLSAK
FT                   LYNEAKNIWDFEISFGAGNVSLVTAGMWGQLNPAGTITDLNGNGVAGLCTPEKVEILLK
FT                   ILPVPMTYAVITDKLQNGYASHVDVTFAKALDEKHTPEKLEIIFGIAKPETLTVEKGKF
FT                   TLIGENLSIDLEKPFQFGNTAGNYEGTTPGGKMLSHAGLVTQYLGTGAATETNEILAED
FT                   KVGPVFVSAKINQTNTTDIVTITASEPLIIADSSQQLYRHKRSDKQSNVFTSGVSSWNF
FT                   VPNNNSLTLLYNGDLMGQVMEGDYVRMGSMMTSVFKDANGNYPEFEVPWVLVNGNGAPR
FT                   IKFDVKLREIVTDLTPSNRTKIDVNETMRFYIKNPSTNKFDLIQNGKITLAGIDSADIG
FT                   GAIFDAKLTVPRGVSMADECAWENLLVKFKIPIYSNLGNFVNRFHNSFNVDPKLYLSPN
FT                   NQVEFAIEWANKAPSGIRSKDDRAVGTGAYIYKAEIEAIFSPNMNIPEVKNDAKIIQNF
FT                   SSKTSFDQTKTFGIKRTK"
FT   gene            453285..455663
FT                   /locus_tag="Fisuc_0395"
FT   CDS_pept        453285..455663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0395"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   dat:HRM2_28690 Faa"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74007"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX74007.1"
FT                   /translation="MQESLFTNSPYVIALTVVALIIVCYFPIMLGQKTSVKQLPRSIHQ
FT                   LVIISIFWQASNLIGDIFFSGDNFIAGTKAYTARQLIFCTSALGWIQLGNAIQHTAEIS
FT                   LKIKRKNGWKLMNIFGALAILLSTYAFIKDPSYIPDMNFFGYRPFAERPVFHFYTLLFC
FT                   LFVVPNIIVTGYIMLRNIVHSSDTTLPHQVSIYMLTSFVFFVTLAALFDFIIPISTKFN
FT                   NYDQFLKWSQFISVFLAVLSGQYFTSVSFKNKSASWFLDKLKDRMVDGIIYYNYKGEIQ
FT                   LANPAALSILHTTQEALHNKKITSIFPQIQDPARESTYNKIRIKIDNEDHIFNVSIFEI
FT                   RQSLTTNYNAAFFSDVSNTLHYQQIIKNRDEQFKEYQLDQIRYQERLNIWKKKVDESKY
FT                   FLDTLISTLPFRFWSKNEQGVFMTQNQNDIKNRGNLLQTSEPDNKILPQELLARNEGEP
FT                   QSFISYERIKKTLNENNEEEEDIEILKQDDYNMAVRKGVAKDIMIFNNMFIPIMAPRKP
FT                   YKIIGIKIDITKEMRLEKERDMLQEQKHIHSRLEELGTICGGFAHDYNNILGSQIGFCD
FT                   LALEVLDKDNQAYMFIQEARKAATRGKESLEELLNTIRGKTSEKDKLTEFAPYMIIDDV
FT                   VKKLWITLPPNVKVKAEKLDKNIRIVGNVSALDRIISNLANNAIFAMKENGGTLTIALK
FT                   REVLTEPLITPYAPQIEAGTYAKITVEDTGTGMDTATLERIFSPFFTTKAPGEGLGLGL
FT                   SSALRLLKEGNAGYTVQTTLGEGTIFNLYWSIRNEKMEA"
FT   gene            455663..456037
FT                   /locus_tag="Fisuc_0396"
FT   CDS_pept        455663..456037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0396"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: dal:Dalk_0306 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74008"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX74008.1"
FT                   /translation="MSTILIIDDDAQLNLMLKSALELKGYTVDTASNGKKAKTLYQKNT
FT                   YDVIITDIIMPEGDGFEVVLDLRRMGMSDRTIAISGGGRTSAEDYLATAQHFDVAAIFS
FT                   KPLDLQQLRNKVDEIIKAHS"
FT   gene            456046..457602
FT                   /locus_tag="Fisuc_0397"
FT   CDS_pept        456046..457602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0397"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase;
FT                   KEGG: gbm:Gbem_2805 two component, sigma54 specific,
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74009"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACX74009.1"
FT                   /translation="MMNILIADFDRKFVEELQRNWSIAGTNLLVCSDEKTLMPLIKKTS
FT                   IDLAFIEVPFLMLDNMDLISYLKERQPGVEIFVLCDDRNWQGAASAITRGASSFLKKPV
FT                   TLSLLESTTSKIQAQQQNKSNTQLMESQVLDSLLGDTPEMRKILKTVYKVAPTNSTLLI
FT                   TGESGSGKEFLANVVHRYSKRANEPFVPVNCGAIPENLVESELFGSKKGSYTGSTADKK
FT                   GLFESANGGTLFLDEVGELSLATQVKLLRFLQSHEIRRVGETEARYLDIRIIAATNRDL
FT                   QKSMHEGRFREDLYYRLNTFHLQLPPLRDRKPVIPNLIRYFILKNKEAQGKEIHDLEPA
FT                   ALYALTKYPYPGNIRELENIMEHAIVLSEGGVIKLEDLPEYVQVEAREKAVAIPHIKEA
FT                   GGLKESASEPVFDNAEDAEENEKSVENPLGKPIHFEPISGKTDRAGLLTHNPTKFITHN
FT                   PAPEEEEILSLDEMERRHILHALSICKNNKTEVCKKLGISRATLWRKLKELKIEMDGGE
FT                   E"
FT   gene            complement(457649..458620)
FT                   /locus_tag="Fisuc_0398"
FT   CDS_pept        complement(457649..458620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0398"
FT                   /product="SAM-dependent methyltransferase-like protein"
FT                   /note="KEGG: geo:Geob_2340 SAM-dependent
FT                   methyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74010"
FT                   /inference="similar to AA sequence:KEGG:Geob_2340"
FT                   /protein_id="ACX74010.1"
FT                   /translation="MNYKYSDLLKSALSKRAQLFDVTDALRIVNGAADGFPGLTIDKFG
FT                   DRYQMQFFGPELLTSKTEIVEALAALFNPVCVVSKERLSSSGKSLENAPMDVVIGTRED
FT                   AVGTVREGNAQFHVDLLDTINPGLFLDMRHVRLEVEERFRAMSGESLRFLNLFSYTCSF
FT                   SVHARLGGAAVATNADISGKILDKGRENYALNGLDLRPGEFFRGNAIEYVHWAQKKGLR
FT                   FDGIVLDPPSFARFKGFNFNVREHLMPLVADCATILNSGGFFMVSSNYSEFNLSAFARD
FT                   VLAAVSSVHPNAKTSWKKSQDVDFVGSGSTKDSCLVATLVEV"
FT   gene            complement(458773..459216)
FT                   /locus_tag="Fisuc_0399"
FT   CDS_pept        complement(458773..459216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0399"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: sat:SYN_02369
FT                   transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74011"
FT                   /inference="protein motif:PFAM:PF03477"
FT                   /protein_id="ACX74011.1"
FT                   /translation="MICPFCKNDNDKVVDSRVSGSSIRRRRECCACGRRFTTREYIEVQ
FT                   PLTVIKRSGEREPFQREKLQRGIMNSCKKRPVSMDDIEQLVTRVENSLQMSEGFEVSYD
FT                   QIGNLVMQELKKLDAVAYVRFASIYREFKEVGEFVDQIKTLDK"
FT   gene            complement(459373..461448)
FT                   /locus_tag="Fisuc_0400"
FT   CDS_pept        complement(459373..461448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0400"
FT                   /product="Transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: dal:Dalk_2752 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74012"
FT                   /inference="protein motif:PRIAM:2.2.1.1"
FT                   /protein_id="ACX74012.1"
FT                   /translation="MQDSLVTKAADNVRILSAAMVQKAKSGHPGGAMGAADAITLLFAE
FT                   FLRFDPDDANWMARDRFFMDPGHMSPLLYSELVLTNRLTLEDVKNFRQLGSRTPGHPEV
FT                   DVALGIENSSGPLGIGHGIALGGAIAERFMVERFGSILEHKTVCLVSDGGLEEEIAYGV
FT                   GRIAGHLKLSNLIFFYDANQVQLSCKTEDVMDHDFVKQYESWGFRVIECDGSNIAELRK
FT                   AFKAAWAETEKPVLVYGHTTMAKGAIAEDGKSYEGAVSTHGQPLNAAGASTSATVKNLG
FT                   GNPDDPFQVFDDVKAGFEARANELRKQVAEWKKAKAAWDKANAEKSATLNEWLSGKGLK
FT                   IDLSKLNIKEGVATRVTSGTVLGYLAENYHNIICSSADLSNSDNTQAFLDKTGIFRAND
FT                   FKGAFVQVGVAELTMGAIANGIALHGGLYPICATFFVFSDFMKPAIRMAALMGLPVKYV
FT                   FTHDSFRVGEDGPTHQPIEHETQIRLLESLTKASGKAEMLVLRPADAYETLAAWEMAFE
FT                   NNDSPTALILTRQVVNTLPGENRYEAAKACRQGAYIVSDNTAAGKKPDLTLVANGSDVL
FT                   LEHQAAELLRDEGKSVRVVSMISPALFLKQPKSYRDSIIAPWTPVFAKSSGLPLLFAQV
FT                   VGGFGKVSGLERFGASAPAGVLEKEFGYVPEAVAAAAKEYLAEYAKNVEDFKKANA"
FT   gene            461643..464204
FT                   /locus_tag="Fisuc_0401"
FT   CDS_pept        461643..464204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0401"
FT                   /product="Glycosyl hydrolase family 98 putative
FT                   carbohydrate binding module"
FT                   /note="PFAM: Glycosyl hydrolase family 98 putative
FT                   carbohydrate binding module; SMART: Glycosyl hydrolase
FT                   family 98 putative carbohydrate binding module; KEGG:
FT                   slo:Shew_2289 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74013"
FT                   /inference="protein motif:PFAM:PF08305"
FT                   /protein_id="ACX74013.1"
FT                   /translation="MNIKDAILRLFKNLAHPTGIFGTLVAIAIPFLIYLAPNINHRETI
FT                   RKMDLNWPLPLFAIQFILGIILFCFLSKDFREWFKGILPTKSVSIMTLVFAVAISIFAG
FT                   TQIEARHRVQSDESVFMSVAQNMYYNHESGTCNQGEFDNGSLKCKATSNSFKTKGLSFL
FT                   YRLGMPLFGTDLRWIFTAEFVMLPLSFLLMFLAIVAWTRQPLLAFLASLLMALQPTVLF
FT                   QFRAMSVEPLYIFLSALALFVFKWAYDRNTVMHWTLLALILAFFAQTRQETIFCVFAFV
FT                   LFALPRLLDKKDEKAPVFFVTLSLFSVPALLTISYFQGFGFQGGEFEAHGHFFEDLAKN
FT                   WEVMTAKLDKNGNLTNPFLSYFNYLFAIGGIYLLFRAINDARKSDFTYLKILGFLLLYH
FT                   VQTYVILENVSGDFSIEINQRYSLVMLPSMAFVAALPITHMIQYFTTPTGNKDLNGKGA
FT                   ILGVLIVALAFTGWTFHYKKNFNDNIMYNRNHLTIEEHEILKWLKEQPQADRFFIYGRP
FT                   WHFVGYGMSSLHYDNARKMSNSEMKDLIDKYKGEVYYIRGLDCWDSHTYHKKAVEHRIA
FT                   TTCDVFEREMDLTGVKNILITNNYWVQIAKFNGRKNYNPEKIIAINELEVAPADSIATK
FT                   PAMLKVHYELKEQGQAAAKWKFALLINDKIIEQGDYKFGSYDQEVDLASLQPGFNQVRF
FT                   LVQDLATKSKLADVSKFYFEKGNGAIALTDYPIESHNQEWGNMRKNKSIEGNKLSVNGQ
FT                   SFISGIGMHASSTTVFDVGQKFTTVRFSVGLDDESLCSDGVAVEVIGDGKSLAKTPFFR
FT                   NGELHKVEANVAGIQKLTIRSFPKEGINCSHVDIINPVLIP"
FT   gene            464331..465242
FT                   /locus_tag="Fisuc_0402"
FT   CDS_pept        464331..465242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0402"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   geo:Geob_0317 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74014"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX74014.1"
FT                   /translation="MLLSVIIPVFNEEEIVAETYRVLEEELKDIEHELIFVNDGSKDRT
FT                   REIVEGLLPGNPNNKIINFSRNFGHQAAFSAGLDHAQGAAVVIIDGDLQDPPSLIHEML
FT                   KKWREGYQVVYAQRNKRKGETLFKRFTAFCFYRIIGKLTSIDIPPDTGDFRLMDRCVVD
FT                   QLKNLPERSRFLRGLVCWVGFKKIGVKYDRAERTAGTSKYPLKKMLRLAFDGITGFSSA
FT                   PLKISFYMGFIATIVGFALLVWSILEKFLSPATTVPGWASLMTAIVFFAGVQLLTIGIL
FT                   GEYIGRIYDEVKQRPLYIEDKK"
FT   gene            465385..465945
FT                   /locus_tag="Fisuc_0403"
FT   CDS_pept        465385..465945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0403"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: nmc:NMC1579 guanylate kinase; TIGRFAM:
FT                   guanylate kinase; PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74015"
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /protein_id="ACX74015.1"
FT                   /translation="MKNKLFVMSAASGAGKTTLKDLVIKDFPDIKYSISATTRKPREGE
FT                   IDGVHYFFKTKEEFEQMIKDDALVEYNLVHGNYYGTPKSFVEKTLAEGNRVLFDLDVFG
FT                   KVNFDKVYPDATGIFILPPSDEELERRLRGRGTDSEEVIQLRLANAKKEIEFAKTKGKY
FT                   EYTIVNDDLQKAADELRAILSQK"
FT   gene            466158..467432
FT                   /locus_tag="Fisuc_0404"
FT   CDS_pept        466158..467432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74016"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74016.1"
FT                   /translation="MKRYELDTIGQIYGAIISKTWSPTFRMQATLHETITPELLQQAAD
FT                   DLRIRFPYIFVALRKGSCSYYLEENDEPLKIKHDSEGILAYYGMDKAAHHCFRILYGEK
FT                   HIALEVLHTLTDGHGARIILLTLVHRYLELKHDLPEVPANIQHDLVYSLKDRPSDEETG
FT                   NAYAKNAGKNPVDLKEPKPYRLQGTLLPSDQKIITIGTINSEPLIAQAHHYGATVTTFL
FT                   ATIMAEVVNDLQNKTPNQKKQPIAIGIPVNVREILASKTMRNYTAQKNLTLRPEQLDFS
FT                   LEQKCNLMGLQLKDFRQDKDLVRNLTAAYVAPLENPLAKYTPCVIKNRLISYLYTKEAD
FT                   AVMSTQISNLGDTDLPEEMRPFIDSVYFILGKEKALPNTCSAISCNGKTNISFTRYIQE
FT                   STFEDEFFRRLRKLGLNVEIQDPSK"
FT   gene            467465..470653
FT                   /locus_tag="Fisuc_0405"
FT   CDS_pept        467465..470653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to dentin sialophosphoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74017"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74017.1"
FT                   /translation="MCCKETVFFFTALALFFCLDACENANSKNFVAKESSFDEENSAEV
FT                   FDSTHTQTYDSMIEVYHPELLFFIGTDKASAKASEKPQMGAKLNYKFYMDVHEFTCGDY
FT                   KKLNKEFDRLKPDCANDSLPLTDITYFDAVLIANAKSKVSGLDTVYTYTNASFDEENHC
FT                   TDIEGLVTHLETEGFRLPTEAEWILSAQLSWDHKNSWNNSNSDYKVHPICSKGFDGAGF
FT                   CDFSGNVTEWTNDWLGILKDTTITNFTGSTDGGELGERIIKGGNYNSDKANSNLYSRGD
FT                   VYSVTSSTMAKYVGFRLALGVIPKPAWFTSSGQISESKIEPIASTATLKSYTGSYNMKL
FT                   AFRNDLTDNLAFIDYNNGNLKVSEIHDTLNVYHPEISPNGKFVAFCTKPEGILGESKLY
FT                   VRELSEESSTPIELQVKSAAIPRWRILENGDTTIVYVTDAGNNSDETSWLTQSTWQVTF
FT                   ANGKFGTPQKLFDGTFHGGIAKDNSLAVTGARRLRVHHGQINDIWYSQEQACNVSLAQD
FT                   GSKRTAFLDFGGKTGQDFVGSHYATHERILIADSTGKLIQSIAAPNGYTFDHTEWVSST
FT                   SNLVATLTNANGSHKKIVLVSTADSTLIDLAEGEELWHPSLWVQPKKIIPKPKSSSSSF
FT                   AQSSSSNAPAQSSSSSVLAESSSSSTPTLNSSSSIYPQSSSSSETQQSSSETAQSSSEI
FT                   AQSSSSEKQAPSSNSEQINSSSSSLLAESSCSKVTSSSSEVSLQSSSSIASSSSESSSS
FT                   SVPYQIDFELDTDSAGIYYKAGQAQVFAEARYKMELLWQYKDKADVVIIGSSRALHGVA
FT                   PMELSEQFFGVNLAFIGNTLSGSEFLYDNYIIPHMSKVKYIVSSIDIDRGFNTFSSSFF
FT                   NGRAKTCPGFVYDKDHNYWKDGYPEGLAELTYDSPGMSSYANKYRHTRGLDSIPEASVW
FT                   EDMPQVDSDSNLYRMSPGSYRTNFNSLKKMVETAHEKGFYFIGVVFPQNPNYKKTGAFG
FT                   RYGIPRSEAPILLQEIAELSKTYPNFILFDENKMGDHDYTGDMAYDRDHLAYPGAIHFT
FT                   ARLDSLLKELPALK"
FT   gene            470655..471563
FT                   /locus_tag="Fisuc_0406"
FT   CDS_pept        470655..471563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74018"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74018.1"
FT                   /translation="MKIFYHLPGLFEFYELYKAFLPLWREHRDWFYDWCEIGSIYGAPS
FT                   DCIWGGGRVGFGEAEPRKVANLMQEYGISARLTFSNSLIREEHLADTQCNKLCKMFERY
FT                   CSGEMRAVQNGIIIHSDLLLNYIKTQYPGFYFVSSTTKVITNFEQFKAELNRKEFRYVV
FT                   PDFRLNKQFDKLTALTDAQKQKVEFLCNECCWFGCYDRKKCYENVSQKSLGENSEDHVC
FT                   VSPTAKRGYRFSDAMKNPGFIGIEDIQNIYAPAGFRHFKIEGRSLGSALILEFLLYYMT
FT                   KPEHQLKVREEIYLDSTLDLF"
FT   gene            471588..472496
FT                   /locus_tag="Fisuc_0407"
FT   CDS_pept        471588..472496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74019"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74019.1"
FT                   /translation="MEPTDALFMIIVNIVLFIIFAIIPLLLGIFANISTKHPRTMFIAG
FT                   QTVSILLTIITVISLSISVIYAINEQDSTQRPYIFAWCICWLLIAIFPLSTFDLTTSQK
FT                   TKKQKTCYLTISFITFFLILSGSEFLYNRAFGYVFQTERFELSINDFYSNHPEADKNSD
FT                   INIFASIQNGEDEFTANISVYKDSITLKATELRYISSEIISSEKSQKDSCYRNDLPRDL
FT                   VQDIIEEITYYQPEIEYTWVGDLCFHPFAFVELANNKNATTIILKLPDIDEYHPNAQRL
FT                   AKKFASLVNDLKINPTKGCSN"
FT   gene            472550..473392
FT                   /locus_tag="Fisuc_0408"
FT   CDS_pept        472550..473392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_4243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74020"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74020.1"
FT                   /translation="MTILIIIASLILLLVIWFNIPYSPVKTQFRNDVEARLQSSAALAG
FT                   TLDSASIASLPPLIQKYLETSGYIGKERRTHLTMEYKDVDFGMGVNKPRLKIDYTHVDF
FT                   ADSPNRLAFIDSKMFGIPFQGYDYYKNGKGGMKGVLAKLVTLFDQTGPAMDKACLITYL
FT                   AEAFFLPEALLKDFITFKQIDDHTVEASITNKGVTATGIFHFNDAYEMTSFTTNDRGQI
FT                   SPDGTIEYTPWEAQCENYKTYSDGIKRPTIFRAVWKNKDGDFVYFDGKISKVNGAEVK"
FT   gene            473394..473660
FT                   /locus_tag="Fisuc_0409"
FT   CDS_pept        473394..473660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74021"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74021.1"
FT                   /translation="MIHKLATVFSILLLIYSGVKTASYKNVSGIFFNFYGSSAVVYGFG
FT                   LIILSSVWLICWHTNAFKFTSDKNWPYLLFCNYLVAIIVKIIM"
FT   gene            473705..473887
FT                   /locus_tag="Fisuc_0410"
FT   CDS_pept        473705..473887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74022"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74022.1"
FT                   /translation="MTLLLGILFLALFISAIVRGKFTYGQADYDFHEHPIQFVIVLIFI
FT                   LGVSALCFYRFIVEL"
FT   gene            473953..474651
FT                   /locus_tag="Fisuc_0411"
FT   CDS_pept        473953..474651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74023"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74023.1"
FT                   /translation="MSEEKITSGCNAEDVKAITKRCAESWMKRIRNFAGFLGMILPWIA
FT                   LAGAAIIAKVQPAKISDDFWTTLSISATYYLTPALAGILTTAAVVLICYKGYDWRDELV
FT                   ATASGIFGLMIVIFPCDCSAADGKIVGFFQLPIAVSNIIHLTSAVIFFILLAINSLFLF
FT                   TLGESDTKQKRIRNIIYRVCGIGMFCTLFLLVLPIQFPAKIFIVEAIALTFFGVSWLVK
FT                   GQIFGLLKDK"
FT   gene            complement(474655..475206)
FT                   /locus_tag="Fisuc_0412"
FT   CDS_pept        complement(474655..475206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74024"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74024.1"
FT                   /translation="MRLFLFAVLLVFANMSFAQSVWDKYPPKGSTPVVKEEPVRTVEEP
FT                   VNSAPVKEKIEWSLGHWYAGYRKLSESEMEAIVSTNPEAAAELRVGKSLYSKALVLSAV
FT                   GGAALGVGIAYWSKEGSWGKPLTIGGGAVALFAIVLGGISGTHTTAAVEIYNKSIGYDT
FT                   SLQIKIAPTPQGGAALAFAF"
FT   gene            complement(475255..477273)
FT                   /locus_tag="Fisuc_0413"
FT   CDS_pept        complement(475255..477273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0413"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: dps:DP2206 primosomal protein N' (PriA);
FT                   TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74025"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ACX74025.1"
FT                   /translation="MVKERCNSALLSRFCEVYIPLSPSVFTYGVPEGADIQRGSVVWVQ
FT                   LARRKPTLALVSRVHSEKPSFDVRYACPHESGYVFSERYMESLEWVSKYYISSPMRTLN
FT                   VFWPADFDKFLDALLAEKSEPRGEAPSNGPEMEVCSDLPPLTGEQETALASLVEDLDKD
FT                   GFRGTLLHGVTGSGKTRVYQELVREALKRNKRVLILVPEIGLTPQTASRFEDYLKVPVV
FT                   VLHSALSAPQKRAGYLAVLDGSAKVVLGTRSAILSPFDFDVVILDEEHDSSFKQQDPAP
FT                   RYHTRDLAFHLAQKYGALVVLGSATPCLETFRNAKAGNLKLLTLKNRATAAPLPEVKVI
FT                   DMGKVRQQKGVLMSPALREALSDCIAGGDQAIILMNRRGYSKIRVCTKCGETLYCKHCH
FT                   IPLVYHKQYNALMCHYCAALYPVDTPCPTCGAETYEFVGGAIEKLEEEIHEWVADAKVI
FT                   RMDRDTTQNVGAVEKILTSFRNREYNILLGTQMVAKGHDFPGVKLVGIVGADSGLGIPD
FT                   FRSTERLYQLLSQTAGRAGRAGSGGRVFIQTLNPTEPVMQYAIRHDFDGFAETESSNRQ
FT                   MAFYPPFCKLVEISCGSRDENLLRDTVNRLESILRKESSMTVLGPVDAFVPKVQNVFWV
FT                   KLYIKTQNLAAVRKVLAPILNAPKAWVAGVEIKVELE"
FT   gene            477440..480349
FT                   /locus_tag="Fisuc_0414"
FT   CDS_pept        477440..480349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0414"
FT                   /product="protein of unknown function DUF349"
FT                   /note="PFAM: protein of unknown function DUF349; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74026"
FT                   /inference="protein motif:PFAM:PF03993"
FT                   /protein_id="ACX74026.1"
FT                   /translation="MSIFDAFKPKWQNSNPAKRKEAIADLDELTSQDIVERVALSDDNV
FT                   EVRMAAVKKLAIIKTLQDISTKDSDAGVRRLAESRAFEEIVKKLKNFNESALNSEVLGY
FT                   IEAIKDTRYTEDVLKATDNVNLKRELVKQCSKQSLLAQIATRDSSEEIALQAADRVTSE
FT                   SLQADLIKNSKHTSVRKKISDKVRAKKEAEDNGRKAAELLQSKREALIKQAHFLAAQKD
FT                   AFATKPQFEDLMNEANALGMGESAATLNEIYESFNKFYDEANAAKKAAENAEAEKQAKI
FT                   ARLTESLAELEGLLEAGTTEENADRVNAIIQEWNEGKSLMDAALIKRFNNAYFKSQEAK
FT                   KIEIPTAESENASEEEIAIRKSLLERLQALSETEIDENTGKHLHAIVREWEKLALLEGD
FT                   DPILQAYNALRTKLSELISAFNEKTQKVIEENSKKLRGLIERIQNIDENQEFREIHKIL
FT                   RDTYQEWKEIVGDQKFKYHDLWQEYKIATSRFQEMQQWENWHNEKDRDTIIEEMDALSK
FT                   ETPSQAVLAKFRELCGKWREIGPISAAKFQDYRDRFQALVDKVKENCAPFIEEQNAERQ
FT                   KNLVDKEALCQKVEELVANAEIFWKDKFKAVQEIQENWKNIGMVPKEAFAALNKRFKDA
FT                   VNAFYAQHKENVKHEDESREANYEKKVALCIEAEAIKDSTDWNATSTKLKQLQDAWKAT
FT                   GPVPKSKSDEIWTRFRTACDSFFEKKRNHFEEMDAAKQKNLEQKQALCEKLEALDIANI
FT                   TPEVIEAYKAIDAEWKTIGMVPKDAVESINERFNAIVNKIVAKMAESDPELQAKIADIK
FT                   KKKQEMIEKVRQFAESAGSNQLADAVRDIQKEWVTLGSCGNDDDELRKAFRDVCDDFFT
FT                   RRRDQLDIQEQARQNNLQKKILLCEQAEDLLTDLNESTVVASMNKVKHFRRLWKEVGAV
FT                   PREHSEKIWKRFNSACDQVFAFGRKDEKKEEAPAATTEA"
FT   gene            480377..481372
FT                   /locus_tag="Fisuc_0415"
FT   CDS_pept        480377..481372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0415"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain protein; KEGG:
FT                   eba:ebA110 putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74027"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ACX74027.1"
FT                   /translation="MAEKPSFFYFWVMKFPPWTSVSEAARLLKEGEVVAIPTETVYGLA
FT                   GNAFEPKALAKIFAAKERPTFDPLIVHIADIAQLTDIAKDIPDSAYRLAEAYWPGPMTI
FT                   ILPKKDCIPDLCTSALPSVAVRFPSHPIAQAIIKESGLPLAAPSANLFKHVSPTTAEHV
FT                   AAQLADRIAGIVDGGPCSVGVESSIISLVGEPTVMRPGAITPEMFKAILGEVKIKESTS
FT                   KPGQPMLAPGQCDTHYRPQVPLYYGEVPAGYALPEHTVRIAFGTQQGPVPATVNLSATG
FT                   DMVEATSKLYAFMHDLDDPKFDLILVDPIPNTGVGMALNDRLKRASIKSL"
FT   gene            complement(481436..482164)
FT                   /locus_tag="Fisuc_0416"
FT   CDS_pept        complement(481436..482164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0416"
FT                   /product="peptidase M15D vanX D-ala-D-ala dipeptidase"
FT                   /note="PFAM: peptidase M15D vanX D-ala-D-ala dipeptidase;
FT                   peptidase M15B and M15C DD-carboxypeptidase VanY/endolysin;
FT                   KEGG: cvi:CV_3935 D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74028"
FT                   /inference="protein motif:PFAM:PF01427"
FT                   /protein_id="ACX74028.1"
FT                   /translation="MARFFFVVIFIVSTFFSFAHETDSLFVPPKPAKPLRYCSSAKQWV
FT                   DYASHDSNLVEITYMRGLRMDLRYATFNNVTGHDMYCGIQRAFIHKDGLPKLKRALSII
FT                   AKELPGYSLVIFDAARPMYAQSVLKQSVAGTPYSHFVSSGKTGGLHNYGLALDLGIADS
FT                   TGNLLDMGADFDSFERCAGFVGEADALKSGRLTQQQIDNRNLLRNIMKRAGWVMLSSEW
FT                   WHFNAFTRAYTKEHYPLFPI"
FT   gene            complement(482234..484585)
FT                   /locus_tag="Fisuc_0417"
FT   CDS_pept        complement(482234..484585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74029"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74029.1"
FT                   /translation="MNFRLFFSFVLFIVVGVFAASPTTVIGVVLEAESDLPVKDVAITY
FT                   QSGKRIGETDSRGRFELTVDSKNASLVFKKEGFDSVFVDLQDYADLLDMVITLSTNVTN
FT                   LGASTIIGDGEPIKWEVERTVKLEKLEDAAGMRFDLTEHLSQMPGVSGQKDFSSALYYD
FT                   GSRASDVAYHLGRLRIPNMRHLDVGFPGNLSIINPHTLSGIEVHDHYGQGPVGQGLATS
FT                   IQYIPEQTKGEWGLRGSAGLTLQEVVLDAPFFIWDSFRFAFRRLDGDMLKNLGEKFFTE
FT                   FRKRGDDCSGDCKVKSSDPFDLSAFDIYAQLNGSDSLGNKTWALRALYSSDEYTISQDT
FT                   SSTYGAINSIDIIDGSQSYLVIGAEYASKFGASFHAGLVRESLSDTLRDTTGFRSGKLS
FT                   DESARTFIDGYSQTHTTLSAGADKDFHADIFGAGLRGAVLYEHHLVERSFPVTGGEESS
FT                   DYQTGVLSGAVTLDWKDNYSEHMLSVGAVADAMDHKALPTASFDMERNLSKTDSAYWRL
FT                   FGNAAYRADWKHYFDDGDLTGRLESGTSLKLGFGYRSKYLVAQFSGFGRFYFDPLLPLP
FT                   KAFANYNDVTPVDYAWVSGASGSLEWKTSHHFSMAMNASSVYGEYELENGKSLPWEANS
FT                   RFDIVSHFRYYPRKDSIVSVILTHHAAWHRPLYYYAIKPASNGKGGTRELKDYNEFTDL
FT                   YRTDVRVNLDLTKTKGFFRNARFYLELDNIFSKLDVAALKFLGSENGRERSWVARDNDK
FT                   NTANGYDLVPFIAKGMGLYFQFGVEVQLGI"
FT   gene            484652..485449
FT                   /locus_tag="Fisuc_0418"
FT   CDS_pept        484652..485449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0418"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pca:Pcar_0112 putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74030"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACX74030.1"
FT                   /translation="MLKVYLVQFDSAKGNKTENLARAKKMILDAKPNAGSLVLLPEMFA
FT                   TGYVPADLDKAAEDFSSNCTGETARTLSEIADETNCTIMGAGITRASTGFYNHVSIYKP
FT                   NEAQEFRGYNKMNLFFPEKESFKAGSEINLFKFNNWSIASFICYDLRFPEIFREVTKKG
FT                   ANLITIQAAWPAKRRAHWETLLRARAIENQVYIAAVNAVSESNAQKLPLAGTSLIISPN
FT                   GDILAEGPTQSETVISAELDLQAERDYRKSFPVLEGIVPPEFL"
FT   gene            485681..485818
FT                   /locus_tag="Fisuc_0419"
FT   CDS_pept        485681..485818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74031"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74031.1"
FT                   /translation="MATTSKIDEAKELIKAGLKRELILKITSISEYEYSLLQRELLATA
FT                   "
FT   gene            485956..486183
FT                   /locus_tag="Fisuc_0420"
FT   CDS_pept        485956..486183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74032"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74032.1"
FT                   /translation="MYPSDNFPWTEFIEKLLAAWQLCDYSDVPEAFKPIKQIPPFVIEG
FT                   LPREPVPQQLKVLASLRTQGYFAPLQNPGK"
FT   gene            486381..487565
FT                   /locus_tag="Fisuc_0421"
FT   CDS_pept        486381..487565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0421"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   eba:ebA7001 putative alpha amylase/trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74033"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACX74033.1"
FT                   /translation="MNLIKYFSKQRWFMGKNRTILRADTLDSTEAGNTRIRLIKVSFDD
FT                   GESDIYTIIDDENAVGKILEDAFLDGSQQSVFAGDSGFFSFRITSPFSRAALTSIKPVS
FT                   KEQSNSAFCTPGKFFFKLYRRLEPGLHPEAEILEAMNKADSSRVPRLYAVCNYKAKGGE
FT                   VYTWGILEEHFPNALDAWSEFCKNMDSTDAFQLGMSTAQMHESLKRLSGPKYSGIEPPF
FT                   DRLTQLLKNSTDTEYAPKLREKLPELRIRYSDLLRETFSDKTIKKQRIHGDYHLGQVLI
FT                   TQSANGTKHFEIIDFEGEPTRSLDYRRTIRSPAVDIAGMLRSFAYAGAVAKTDPTEAQK
FT                   AFVTGYSKVSGISTEEIEKESKPYILAKAIYEACYELEFRPDWFWIPAKALLEL"
FT   gene            487620..488408
FT                   /locus_tag="Fisuc_0422"
FT   CDS_pept        487620..488408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0422"
FT                   /product="Serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="PFAM: serine acetyltransferase domain protein;
FT                   transferase hexapeptide repeat containing protein; KEGG:
FT                   spe:Spro_4814 serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74034"
FT                   /inference="protein motif:PRIAM:2.3.1.30"
FT                   /protein_id="ACX74034.1"
FT                   /translation="MTPEEMEQLLRKDAAELVKTEPFSKLMLEEQILNRKNFADMLGVT
FT                   LACQLAGEVIDRAELEKMFRVMYEKYPQLLICATKDLHATVLRDPACTGPLEPLLFFKG
FT                   FQGLQAYRVAHVLYEEGRHFPAKMLQSIISRKFGMDIHPAAKIGHGLLVDHATNIVIGE
FT                   TATVGNNVSFLHGVTLGGTGNEIGDRHPKIGNGVMLGAHAQLLGNIHIGDGAKIGAGAV
FT                   VLCDVPAHTTYAGVPAVQVGHPHDDMPSFNMQQDFTRDKN"
FT   gene            488441..489073
FT                   /locus_tag="Fisuc_0423"
FT   CDS_pept        488441..489073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0423"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: sde:Sde_2604 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74035"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACX74035.1"
FT                   /translation="MNKATKIKFISDKLDELYPSPPIPLDFTSPFTLLVAVVLSAQCTD
FT                   IRVNQVTAVLFKEANTPAKMIKLGVDRIAEIIKPCGFFNTKSVNIFKLSQALVEKFKGE
FT                   VPHTFEELESLPGVGHKTASVIMSHIFKLPAFPVDTHIHRLAERWGLSDGSSVEKTEAD
FT                   LKKAFPKEEWEKRHLQIIYFGRNYCKARGHKDEECPICSTIRRKTRD"
FT   gene            complement(489105..490142)
FT                   /locus_tag="Fisuc_0424"
FT   CDS_pept        complement(489105..490142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74036"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74036.1"
FT                   /translation="MFKKTLKYVLPLVFLLAGLANAQTRYTPSELDTLVSTIALYPDPL
FT                   LVHVLDASTHGDDLPSASAFATANRHLKGDDLAAAIERAELDYDESVIALIPFPDVLRK
FT                   LAKYATWANQLGEAVEMQKADVMDAVQRMRKVAHKNGYLHSDDKIAVTVDENVSIQPVR
FT                   EEYVYVPEYDPRVVYYVVSDGNIRLRYVNGVWTGAGLVYWGWDPFYYDWVHRRPHYRRP
FT                   HRYAPPPRRHVRPRNDRPRYDRPAPRRFDNPPPPPRPHSNGWRPSAPPPSPSSNVLKKS
FT                   ALSAQASSNNSRPAPPPPPNYKRPAPPPPQASSSNDDEDRWQSRRSERHHGSHSVPPPP
FT                   PSRRR"
FT   gene            complement(490218..491210)
FT                   /locus_tag="Fisuc_0425"
FT   CDS_pept        complement(490218..491210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0425"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /note="SMART: Tetratricopeptide repeat; KEGG: SLEI family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74037"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACX74037.1"
FT                   /translation="MKNKILVWLCVFVSLSFAEVENPLKTAMDLVNESKTLYSLKIVDK
FT                   PFPVPDRSQLINFPVYREKKGDSYDVKAIKATGEAKKLLDKAENYFGSHQYAKARDAYT
FT                   LALQEDPKLYSAITYIGQTYGIERNWDKAELWYKKAIEANYVDFLAHWLLADVYKVKGQ
FT                   KEKALEEISIAKVLNRNNPRLEALRKEIYGLNGLNIKNWTFNPQVSIARDSATGNVNMQ
FT                   SDSIWTYYAFVQAAWLYEPYYKEKAKKVLMPQTMYRECLMGLLPFMENKSLKESVEVLR
FT                   RLDKALNADKLSEFVFYEILLLDYPTASFQLDKKQIEGLKDYLIWANQK"
FT   gene            complement(491397..493064)
FT                   /locus_tag="Fisuc_0426"
FT   CDS_pept        complement(491397..493064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0426"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="KEGG: gbm:Gbem_3799 glutaminyl-tRNA synthetase;
FT                   TIGRFAM: glutaminyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   anti-codon binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74038"
FT                   /inference="protein motif:TFAM:TIGR00440"
FT                   /protein_id="ACX74038.1"
FT                   /translation="MEIPESSNFIQDIIVNDLQTGKRDHVLTRFPPEPNGYIHIGHAKS
FT                   ICLNFGTAKKFGGFTNLRFDDTNPTKEDVEYVDSIREDVKWLGFEWKEEFFASDYYDQI
FT                   YAFAEKMIEMGKAYVEDLTRDEMQEYRGNDAGKPSRPSPYRDRSVEENMKLFHEMRDGK
FT                   YADGEKCLRAKVDLASPNMNMRDPVIYRIKHCTHHRTGDKWCIYPMYDFAHPISDWIEG
FT                   ITHSICTLEFEAHRPLYDWFLIELGLQNRPQQIEFARLNLTYTMMSKRKLLELVQTKAV
FT                   LGWNDPRMPTVCGFRRRGFTPSSIREFCSRIGVSKADSMVDVNLLYFCIREELNQTANR
FT                   VMAVIDPVKLVIDNWEAGKVEMIEVENNPNDPNAGTRKVPFSGELYIEADDFMEEPPKK
FT                   YFRLKPEGEVRLKGAYFVTCKSVEKDDDGKVKVIHCVYDPLSKGGESPDGRKVKGTIHW
FT                   VSAAHAVDAEVRLIDNLFTLEDPAQVPEGEDWHDYLNPNSMVIKQAKVEPALADAKLED
FT                   RFQFMRQGYFCLDSEDSKPGHLVFNRTVGLKDSFNPTK"
FT   gene            493218..494132
FT                   /locus_tag="Fisuc_0427"
FT   CDS_pept        493218..494132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0427"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: asa:ASA_4037 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74039"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACX74039.1"
FT                   /translation="MANIGYSFLMVLAAFLWGSTFVAQIEGNDVGPFAFVCMRNFIATG
FT                   VLFGLAKVLDKFNKSPRKPKTKEENRALWIAGLFCGLTLFFAMNLQQTGLFLGCSAGKA
FT                   GFLTACYIIFVPILSTFFGKKISPKIWLCVAITLEGLYLLCIKEDFTIQPSDIILLLCA
FT                   LAFAAHILVVGKYGPYMDNVRLSAIQFLVVATLSIFPMFFVDLKGSFAGFGTVIEVYSH
FT                   FKPWIPLLYAAILSSGVAFTLQIVAQNKLRPTIASLLMSLESVFSVISGWVMLGERFTL
FT                   QEAIGCVLMFTAVILAQVKIRRR"
FT   gene            complement(494140..495660)
FT                   /locus_tag="Fisuc_0428"
FT   CDS_pept        complement(494140..495660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0428"
FT                   /product="Na+/H+ antiporter NhaC-like protein"
FT                   /note="PFAM: Na+/H+ antiporter NhaC-like; KEGG:
FT                   hap:HAPS_1122 Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74040"
FT                   /inference="protein motif:PFAM:PF03553"
FT                   /protein_id="ACX74040.1"
FT                   /translation="MEQATNTIMAYGTFWALVPALVAIILALVSKEVYSSLFVGVIVGG
FT                   LLLCQGTGSGFFDAVFKNGLIAKVADPYNVGILVFLVMLGAMVALMNRAGGSAAFGNWA
FT                   KAHIKSKVGAQIATICFGILIFIDDYFNCLTVGSVMRPVTDRFKVSHEKLAYLIDSTAA
FT                   PICIIAPISSWAAAVSGFVEGEDGLTLFIKAIPFNFYALLTILTLFLVVVWNVNIGPMK
FT                   KHEMHTNAVGGNMEDLNFTSTKGGVLDLVMPIASLIVFCVLGMIYTGGYFASGDAAKGF
FT                   VDAFASSDASVGLAIGSFGAFVFTVCFYMSRRVLRFSHSMACLPDGFKAMVPAILILTL
FT                   AWTLKGTTDALGAKEFVAGLVKGGAAGFMNFMPAIIFVIAAFLAFATGTSWGTFGILIP
FT                   IVVAAFGGVDYSLMVISISACMAGAVCGDHSSPISDTTIMASAGAECNHVNHVNTQIPY
FT                   VLVVAAISFVTYIVAGFTRSAVLSLLFGLVLTFGTLVLIKKRSKKKGE"
FT   gene            complement(495664..495837)
FT                   /locus_tag="Fisuc_0429"
FT   CDS_pept        complement(495664..495837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74041"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74041.1"
FT                   /translation="MSEKEMNNQRAIYALSDLRMYASSHSLDAIDYAIEVLQKLENAGI
FT                   KNPLESLKSEEK"
FT   misc_binding    496089..496189
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 37.43"
FT   gene            496176..497792
FT                   /locus_tag="Fisuc_0430"
FT   CDS_pept        496176..497792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0430"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: ppf:Pput_4798
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74042"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACX74042.1"
FT                   /translation="MSESNGFFKPFPQSRKIYVPGKIFPDLKVAMREISLDDPKCPVLP
FT                   VYDTSGAYGDPDKTIDVKKGLERIREPWIRERLEKDGAHKTQMQYAREGVITREMEYVA
FT                   IRENQKMDEIFGSNGDAITPEFVRKELAEGRAIIPANVNHPECEPMIIGRNFLTKINSN
FT                   IGNSSVASSIEQEVEKMVWSVRWGADTVMDLSTGKDIHETREWILRNSPVPIGTVPMYQ
FT                   ALEKVNGIADDLTWEVFRDTLIEQAEQGVDYFTIHAGLLLKYIPFALERTTGIVSRGGS
FT                   IIARWCMVHKQENFLYTHFDEICDILAKYDVCVSLGDGLRPGSIADANDMAQFSELDTL
FT                   GELTEIAWKKGVQVIIEGPGHVPMHKIRENMDRQIEMCHNAPFYTLGPLTTDIAPGYDH
FT                   ITSAIGAAMIGWFGTAMLCYVTPKEHLGLPDKNDVREGVVTYKLAAHAADLAKGHFAAH
FT                   FRDDALSRARFSFRWNDQFALSLDPERAVEFHDETLPGNNAKSSHFCSMCGPKFCSMRI
FT                   SKDIQEYVKTGKLDPNSDPLK"
FT   gene            497834..499615
FT                   /locus_tag="Fisuc_0431"
FT   CDS_pept        497834..499615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2820 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74043"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74043.1"
FT                   /translation="MENGKKILNDFVKSKFADQNELKKALFQAGVAALDEGWTFMDATF
FT                   QLGGKARDEGLSADDVEKILRNAFSEEKRRTEREAEQKAAAQAAQAAAQPAQAPQAQAA
FT                   QAQPGMASGYAAMGPTVISPISATMMQQMIALGLDNQSLELLQNFKIDPEALSIPWPAP
FT                   DWRKDFAKLLAATFKPDETVEFKISNTPSGSREIVSKIIAQDEALKKIMKQLDGPDGAL
FT                   LTINAVKGGADATDESWHYRYVVVDNPKMTLAKQLAYYKALNLPCAALVNTGANSVQAW
FT                   IKIEAHDQEEYKERVDFLFQTLESQGFKVDDGNRNPNQMVRMPGVLRNGKQQYLIALEQ
FT                   GAKNFTEWREWAEYSLDGKPLVELASDSEEAPKKDVTIIENVLRAGEFFLFTAPPKSGK
FT                   SLALMDMALSICHGEDWLGNTTNANDVLYINLELTKSVFLNRLFLLGEKRNLQPNTPKF
FT                   GFLNLRGTALTPLEIAQLIAKRIQGAKKLENHDYKVVVIDPISAVLHNPKSSRLSGSPH
FT                   QILMQMVDSIIALTGCAVVTSTNIGEYPYLESRADSVISLTPVEGSLNTYQIKGSFREF
FT                   PKTLARECSWIYPRFIV"
FT   gene            499637..501031
FT                   /locus_tag="Fisuc_0432"
FT   CDS_pept        499637..501031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hap:HAPS_0935 23S rRNA 5-methyluridine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74044"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74044.1"
FT                   /translation="MYKQNNRFSRRSEGSIARNTMGNRIGKPLAGGKFHASRKSDVRKD
FT                   DELEEKKAKAEKPVVRKILSFDDIKTQVAAWMENDRIPGKLQAWFTAEATPENSDWRII
FT                   KEYHGVQENLVIDAPSRDMKPLELVKRILEQLHKEHLRIFKKALRQIWFRATGDGRFAL
FT                   LVQVNVKGKISAHGYKTFVDFIERSCPEVISCHQIQCLPDRLFDPADAQGMKVESKCSF
FT                   GSSFMPIASTGFSMHVLDWTPRIKDAWLNLPVRIKDAIHPNREDRFFEFCSGPSYVSAS
FT                   LAPFFKQVEALDCRESAMQSSKLNIRNLATQNMRFHRSHLDANFVSKFFSKSDNAEGRW
FT                   TFYLNLGINDTINSEMVQTLAGSRPERILLQTGNLETASKAIKAFRNEGYMLRKNIPLY
FT                   MEPGRGTFEILFLFVPDRVGILGQNPALAHRSRNIQRPKERPTRSNSSDIPHFVQKTPT
FT                   FKQRKD"
FT   gene            501071..502228
FT                   /locus_tag="Fisuc_0433"
FT   CDS_pept        501071..502228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0433"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; KEGG:
FT                   sbn:Sbal195_0032 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74045"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACX74045.1"
FT                   /translation="MRFLKCASICLGLSALIASAYVVKKGDTLWDLSAEFLNDPFAWPD
FT                   LWENNRHIEDPHWIYPGDSIYLGEGIKDDGYRLPKTKPCEGAVADSNLPKGIKSVGCDE
FT                   RDARNGDFENMLGNLRDKDKKHKKKKAADTYLYQKRPAPKIFNGYYQILAPEIYSLDSI
FT                   KKDQRFFSIRTGEKKEPIIHIPESEVIVGIGRKTNASLKKGDLVEILDARAIEVPSQKG
FT                   KSYDNYALVRLTGYAKITAIGDTLSRAKIVQSFREIKLDHAKARLKQPLNILNVSGYTA
FT                   VPEAKIEDMAMIRYTMDPMLIIGAYAYILVDKGAKQGFNTGDAIAIWEEDTSDAGLPPR
FT                   LLGRGIIARATENESTVLVREVYSNSRRIEIGHKVSITHQANLAQ"
FT   gene            502356..504404
FT                   /locus_tag="Fisuc_0434"
FT   CDS_pept        502356..504404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0434"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: mxa:MXAN_1350 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74046"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX74046.1"
FT                   /translation="MRISRSNLLFLSFFAGGIVLPTAILSFLSVRNIQNEAYLAQKNYS
FT                   ESTATFREQCESTISKEQNKIFQEIKSASLYLYEQPHSLLDFGNATQFKTVNGIEAMFL
FT                   YNNGTLIYPDISSKHFSKTSDYSNSIASQIEKMLFREEVTSAMPQPASLSRSARQLRFS
FT                   FESIDDHIQNILGLVRIAYKTKDYDEALRLLNILEEHPHQQGYLHSDLTRSVNLLHFEI
FT                   LVAQKKHKEAEDYTIAVLNQFLQSENIENLPSARFFFETAFTQILSFENLSQEKREAFW
FT                   NLRENFNRQLGYMDIFFNNKDIVQALLNKETTSKSGIDIMSDNKSTFIKMSYPILSGDQ
FT                   VVLAKVNIDEYRELMRSKLKTSSQGWKSIPFSITEGPDKTLILGHVSDSSAVMTQVVLD
FT                   KVISWNLTLYEKGLSEIKRETRKRMFLMYGLLSFSLITVLLGSIVMFRFLTQEHKLLAM
FT                   KANFLSSVSHELKTPLTSIKMFAEMMARGRVQKVEKVQEYSGLIGKEATRLENLIGAIL
FT                   NYTRMEHGKGGFHWEKLDFSACVQKVFDNVEDIGVEKGLMFNTKIEPSMFVVGDYTALY
FT                   SLVQNLIENAIKYTNAPGDITITVAPDEDRVVFSVADTGIGIPSSEQKNIFNDFYRVGD
FT                   EMTRSTKGSGLGLAIVKRVAETHKATISLTSKPGKGSTFTVRFKKAE"
FT   gene            504407..505123
FT                   /locus_tag="Fisuc_0435"
FT   CDS_pept        504407..505123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0435"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: afw:Anae109_4159 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74047"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX74047.1"
FT                   /translation="MQQHRILIVEDEEIIRLGLQDNFELENYEVETACDGEEAIAKTDS
FT                   FQPHLILLDVMLPKKSGFEVCRIIRKKHPECIIIMLTAKTEETSKVAGLDMGADDYVTK
FT                   PFSILELLARVKAFLRRIDLQTQANPTKQLASVDAIDFADIHLDFKKFIATKGGVPLEL
FT                   STREFQILKYFWQRRGEVVLREDLLQDLWGYTPENMPSTRTIDNHIVNLRRKLEDDQAN
FT                   PKIILSIRGAGYKFDA"
FT   gene            505116..507647
FT                   /locus_tag="Fisuc_0436"
FT   CDS_pept        505116..507647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpf:lpl1484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74048"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74048.1"
FT                   /translation="MRNIWQKENVFKAWVFAILALCSLFSSQALASKMASQLQEAIYLF
FT                   EMKGEVDESIRLLEKISRQGDADDKESAFFYLGKIYDLANNKAQANHFYSRSQAFTKNT
FT                   SKSYWLASRDAATSFAPVRLLQKTIPLRSPIRKFFEGKKANILFENGHIAKIESGMVIE
FT                   IASKLNENDHLLHIDSEGMWYQNSTRDSVFYRPHNSPNQETPYNIKDLSQFTAANGYAI
FT                   AITDKGFYILDRKGTITKGSVDYTSCQIQNDLFISDNFIVNCPDNALHFISANSAAEAF
FT                   IIAQYDIIQQTFVLKDKIYLISGNELFCYTLQNPKTPLWKAAVGNIETLQAFEKNIVTL
FT                   EASGKVTLYDQQTGNINASIRVNASNVYQLAQGTLGLFSNEGSVITVDTLLRPLWNFNF
FT                   AKSPMTAPIVKRRFIYIPYEDKKIYAIDSHYYGQRPLYTSKLAAQAILQAKQDHWENIP
FT                   PLLDTIIKNEPGNAEAHFLKALNLEKQEAPEKNRQRAWAEAVRLSVGGSPQIASTILSH
FT                   YSDVIGASFASPLNISPKTMYPQFLGAKKNLYTVDPATEQLICINAENGEQRWSKYIGK
FT                   IGNAPVIQSDENAIVISTGYQMNVYDMNKDAFNKPLQLPGKAFNFTMTSDYIYASTWNG
FT                   FLLKISRANNSIVWSRKVYSMPFHVVKLPKFLQLCNLDGALMRLNDDNGSTQEKSSNRV
FT                   PVNITAMEGIDSTLVLVSNTNKLFLQNTKKKDYSPTQVLMEYPIISMQVFRDQNEDKII
FT                   ISLSDQSILLYSNIGTPLWKYQGKKSIFSKPFIYDGKAWIDQGNEIIALSIKTGKVVKT
FT                   FNTPGGAGTPFILNHTLFSASPKRVLYAFPL"
FT   gene            507740..509521
FT                   /locus_tag="Fisuc_0437"
FT   CDS_pept        507740..509521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0437"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: scl:sce4302 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74049"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACX74049.1"
FT                   /translation="MSVHIKRIVSLSYLSIAVAFMLTGCKEDVSKTPKTAVSDYPRNET
FT                   LYVGGFDWSPPATFNPLDPDPNFPADGNIRLMYESLLAYNQLTGGLDPMLADSYSQTDS
FT                   TITVHLNPRAKWNNGETLTTEDVLFTFKLDSILPTAHHNNWKYIKAISADSDNFISFYM
FT                   AANRNPLMVLNAIAETSILPKSVFEPLLKSAKTGKSYNMEKILEFKNDAQPVASGPYTL
FT                   ANYSPDQIVLKRSENYWRSSNYGGRKPAPKYIIHPIYDKNDNFNNAMSRGNLDVSSIYL
FT                   PRIWEKAKDSIRSWSREEPYQLPATITALVVATTKEPFNNVSFRRALAHSIDFDKIKAR
FT                   ALSNYTPAVQPGFILPFGLEKKYFNKEDADEFGYSYNTEKAREILQEAGYSWNADGKLL
FT                   DKKKKLVRSISIECPQGWNDWIEAINVVVESFAEIGITATPKIVDYAMWDSDLRRGTFD
FT                   LAMKTPPTEHSVANPWNRFYQMLSTLSYKPVGEETFVNQGRFQNPEINDILANIPTIAN
FT                   EDSLVLAYRELNKLFMETVPVLPLMYRPSTFYQFSTKHWTNFPTAENPYAPPSNLIVAA
FT                   GVSALWEIVPVDKADNQ"
FT   gene            509582..510379
FT                   /locus_tag="Fisuc_0438"
FT   CDS_pept        509582..510379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0438"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   wsu:WS0623 phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74050"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ACX74050.1"
FT                   /translation="MGKLRFVLPNTFTSLNFLLGVFSICWTTGAFGSFSTADQIRMGAY
FT                   FVMLCALFDKLDGFAARLVNASSEFGAQFDSLADLVAFGLAPAFCVFFTYKIYAPEWFQ
FT                   NHGLLMTVALAVYVLCAAMRLAKYNACDSDTYHHHFSGLPSTFAGMVNATLIVFLMTKG
FT                   VFADSSTFLFWLPIIVFVITGFLMVSPLFLPKLQPRKNKAFNIFQIVLILLTYVAGILF
FT                   YNPKVPFILEYLLILGSSYMVIGFAVGLIYRKQIIKEAKAAKK"
FT   gene            complement(510484..511182)
FT                   /locus_tag="Fisuc_0439"
FT   CDS_pept        complement(510484..511182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0439"
FT                   /product="murein peptide amidase A"
FT                   /note="KEGG: eck:EC55989_1490 murein peptide amidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74051"
FT                   /inference="similar to AA sequence:KEGG:EC55989_1490"
FT                   /protein_id="ACX74051.1"
FT                   /translation="MNYSPESRGIIRLPSLEYGRSVLGAPLLYYPCKSECKLLVMAGIH
FT                   GEEPETTFLLSRVLRAFDEPFDSIAFILCANPDGAALGTRGNANGVDLNRNFKTQNFST
FT                   EKVGSRSILEAPRDTLLLPGAFAGSEPETQALVALIEKLKPASVLAMHAPIACVDAPQK
FT                   TSLVEGVMNAFNLPWLPDIGYKTPGSFGTWCGERNLECVTLELPRMSLEHLFDRYGRAF
FT                   AEFLERFVSR"
FT   gene            complement(511273..511953)
FT                   /locus_tag="Fisuc_0440"
FT   CDS_pept        complement(511273..511953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0440"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: cja:CJA_0520 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74052"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ACX74052.1"
FT                   /translation="MTDLSQDLLPYGLGTPDLVEFQPGYFVDREIVDDLRALSNEVKVN
FT                   GFVLRIESAYRSFEKQLSIWNRKARGELKLLNEKGEPMERPKDEEELMYAILTWSALPG
FT                   ASRHHLGTDIDVVDGAACPEGYEVELTPAECSGMFAKFHAFLTSRMEADTSFGFSRVFI
FT                   PGCGKIKPEGWHIAHLPTSRKRLEHFSLDTLRSIYERSDMECKRAVLVNLPQLAEDYIY
FT                   PYFI"
FT   gene            complement(511950..512519)
FT                   /locus_tag="Fisuc_0441"
FT   CDS_pept        complement(511950..512519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0441"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: scl:sce5077 Holliday junction resolvase RuvC;
FT                   TIGRFAM: crossover junction endodeoxyribonuclease RuvC;
FT                   PFAM: Crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74053"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ACX74053.1"
FT                   /translation="MVILGIDPGSITTGYAFLKKTGNQIQVLEYGTFHANATKNLEDRL
FT                   VHIVTELEKRLDHYHPDALAMEGVFFAKNVKSALVLGHIRGAILVACHRRGMTYEEYPP
FT                   KVVKQAVTGNGAASKEHVANMIFAHLGIVGGDLPLDASDALAIAWTHANPAPLAQSLLG
FT                   KKSKPKKKTTVQQWKDLIEKMGGTIQ"
FT   gene            512610..514493
FT                   /locus_tag="Fisuc_0442"
FT   CDS_pept        512610..514493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0442"
FT                   /product="zinc finger CHC2-family protein"
FT                   /note="PFAM: zinc finger CHC2-family protein; SMART: zinc
FT                   finger CHC2-family protein; KEGG: ppd:Ppro_3050 DNA
FT                   primase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74054"
FT                   /inference="protein motif:PFAM:PF01807"
FT                   /protein_id="ACX74054.1"
FT                   /translation="MLIDQEHAEYMRTKAHPRQLGIPLSRWGRNLIACCPFHAPEETSL
FT                   FFYDALGYWRYRCLQCGAEGDLVDFLMKSRFNGVDEQTARSEAFEFLGALDKDLVNNQD
FT                   SEHPWVKEVGGEKSKVLECFVRYCHWAACKSPSSAKFLEARGWSIGQAQLYGLGYYSGD
FT                   PEPFISYCMLSGIERHQISFYLDNLEAYHEPRITIPARNSKGFIHSVYGRLIDDNEKSH
FT                   TYITYASGPTVIPFNIQADSENPIIVQGFFDALTADLAGIPGVVSTMFQELNVNHLYKL
FT                   KACGAESFTVILRREEDRRNQELKIQKYLKLAEQMHMSLKSIVLPKDESVDTFVRKNGA
FT                   DQLIDLIANTEVDTIHSHRRSMLLQDIKENFDTAMACPPDQSVGYKLSTFPKLTKEIDG
FT                   VQSGCFFVSSQPFGLKTFLLSSLTLDLIESNPNLKVIYVAYETPRRQIFDRFVSMLIGE
FT                   SILNVRKQNADNEINKKITEATRDLMAYVRNNRLEIWDDMPSLDFNDLLKTLSQELKDH
FT                   PDLILVIDGIDHMKITDRPELPDIHEKRSSIMLDLYKALDIPIFLGGELIDSNMGLLGP
FT                   RAYLRDSDAIYWLTEKDGALNLSVDSKRMGTSRVYEDKILIDPQSSRMKEA"
FT   gene            514493..515692
FT                   /locus_tag="Fisuc_0443"
FT   CDS_pept        514493..515692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0443"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   maq:Maqu_3920 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74055"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX74055.1"
FT                   /translation="MFTIVDFNNFWSPSGGGVRRYHLQKMAFYERQNEVRSVFVMPSAS
FT                   TYTETRSDGLIIEHVEAFRFPGNWEYRFMWKSKQIRPILEKYKPDVIEVGSPYILPSAV
FT                   RRIAKKVVPNAALFSFWHADFPVTYVGRPIAKKFGTSVGVLSRRIAFWYAKQEFKNYDC
FT                   VQASSKEAMARLKKNGLPDPRWIPLGCDIETFSPSRRDEALVNELKDGDPNRLTIFFPH
FT                   RHCNEKGIDLVLGAYDILTQKLGHEPAIIFAGTGPSLPLVQEAAAKYKHVNYIGFVNSI
FT                   DEMARYYASVDMGLALSGWETFGLSILESMASGNALVGAAAGAAFEHVSESGAGTILKE
FT                   RTPEALADAIVELYHSDLTDKKIKARKYAEKFSWNDCFKRQLALYKEIAEKKGIGYKPR
FT                   "
FT   gene            complement(515742..515818)
FT                   /locus_tag="Fisuc_R0005"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(515742..515818)
FT                   /locus_tag="Fisuc_R0005"
FT                   /product="tRNA-Pro"
FT   gene            complement(515936..516670)
FT                   /locus_tag="Fisuc_0444"
FT   CDS_pept        complement(515936..516670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74056"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74056.1"
FT                   /translation="MMSRIFKSLFVAALSFSATAMAEDIIRFVPDPYPIGYADQGDVRH
FT                   IVIKGANITNKEIVLETVMGQGIGMSNFKYPTKIAPNAPVTIEFDMDFAGMDGQINPVV
FT                   VMVDNQGKSYAAQLDGYVKNPIFFGEKLFDTGYYAPNEKREWTFYVWGTDKKTRPDLAL
FT                   DETAQKEFKLKTKNVMLNVDDIGKIKEGGKVPGIKVTLSTAGLTRTGWELKQKSIRKIV
FT                   GFKSKKFPKATPEVLIIGYWKD"
FT   gene            516705..517538
FT                   /locus_tag="Fisuc_0445"
FT   CDS_pept        516705..517538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0445"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: nam:NAMH_0926 phosphoglycolate
FT                   phosphatase, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74057"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACX74057.1"
FT                   /translation="MTSLDEIKALIAQKELFIFDLDGTLFNTLGDLAPAVNYAMTQFGL
FT                   HTHSNDDVRTFIGNGSMNLIRRAVAANFIPVASTRDMEKVAETLARENYSDEKIKEIHK
FT                   VYSEYYWEHCTKNTEPYKGVVELLQRISNRAENFNRNEDCAECDKNGAQPVNCVATKSA
FT                   KVRCTAMLTNKPVAPAQKILKKFGLENSFATYLCGDTTPERKPSPAGIYEILRQTGIAP
FT                   EKAIMIGDDTPDVLAAKNAGIDCITLFEGFGKTENLLPLEPCYTAGHIKDFAEFI"
FT   gene            517580..518701
FT                   /locus_tag="Fisuc_0446"
FT   CDS_pept        517580..518701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0446"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase class V; KEGG: cbu:CBU_1182
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74058"
FT                   /inference="protein motif:PRIAM:2.8.1.7"
FT                   /protein_id="ACX74058.1"
FT                   /translation="MSYFDYTANTPACEEALQRFCEVERRFIGNANSNHEAGHAAKAFL
FT                   AQVTDSIAKLLGVNPDEIIYTSGASESNNTAIRGIVQAKHHVGKHIITNPLEHSSVSAT
FT                   LTALQEAGYEIEMVKIGTDGKIDLEDLRSLLRKDTVLVTVNAVDSELGTVQPLESISKI
FT                   VREFPNCSLHVDATQAIGKTPINLNLADTASIGAHKFYGLSGSGFLYKKSGIVMEPLIY
FT                   GGASTTIYRSGTPTLALDASLETALSLAMEHFEERFARVKELRKILQEKLCGYPKVRIN
FT                   SPADAVPHILNLSVAGVRGNIFQKALSDKGIYVSVKSACSVDALPSRAVFAVSRDRKNA
FT                   LNSWRISLSHLTTEKEINEFMAAFDSCYKELCK"
FT   gene            518722..519582
FT                   /locus_tag="Fisuc_0447"
FT   CDS_pept        518722..519582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0447"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: gme:Gmet_3336
FT                   PP-loop protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74059"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ACX74059.1"
FT                   /translation="MARELSFVQSVERSISKTYRERLWTPFITAIKNYKLIEEGDKIAV
FT                   CISGGKDSMLMAKLIQMLHRHSDVKFDVEYLVMDPGYNEINRQKIESNAKLLEIPITVF
FT                   ETNIFDVANNTERSPCYVCAKMRRGHLYHKAKDLGCNKIALGHHLSDVIETTVMAMFYG
FT                   SQLQGMMPKLHSLNFGGMELIRPMYCINEQDIINWKNYNGLQFIQCACRFTESCTVCDN
FT                   GGGGSKRQEIKALIKRLKRENPNIERSIFNSLHSVCIETFPGYKAGGELHSFLEDYENR
FT                   EPQKG"
FT   gene            complement(519597..520292)
FT                   /locus_tag="Fisuc_0448"
FT   CDS_pept        complement(519597..520292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74060"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74060.1"
FT                   /translation="MVKNFSKFLGKIALMTAAALWSACNDSDKKAEDPKSDTKPIVNPI
FT                   KLKKVEVSKIYRDSFPIKAERPNLDGLLQTVALYGVLPDVVHKGGDGKVIPRCRIKPLS
FT                   AKNVVVEGRDIDVQTFLKVYRQRVHGLRFIFDKNVRRRSDLASEFEGRIVLTLKIASSG
FT                   EVENVQIKLTTIAENSPFSAINEDVKESVSHWKFPKTKNGATFSFPISFYMMLPQPSMF
FT                   DDSSSIKNK"
FT   gene            complement(520315..521586)
FT                   /locus_tag="Fisuc_0449"
FT   CDS_pept        complement(520315..521586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0449"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: ppr:PBPRB0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74061"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74061.1"
FT                   /translation="MTSFFSKYLRKVELMVTFALLLAACSNDDNGFVSVNPVGGESCAA
FT                   IEESSSSDYALSSSVVASSSSADGLVSISTTVMEDTLEIFAFGGVKIDVVADSFLTKFD
FT                   YGDVVTVMIAGYDTVDVPVVAGYGYVFPGEFFLYVSEGLNYIKLEARYGQMAEVVGLGR
FT                   DLKFPIDVIVQMKEKGGYVDHLENLKSLSIANYPGAYPDLSIEEFANFRMVRTTGMGEG
FT                   VLYRSSSPIDPAIYRNAIADSLAEVAGVKTFVNLADELQYAEEYKGFAESYYATQNVVY
FT                   LNVEPAFANTPFKEGLVKGLRYMVEHEGPYLVHCTYGMDRTGFTIAVLEALMGATADEI
FT                   KADYATTHKNFYNVVDGKHVDLTTKQVELLQAIIVRLMQNSFKTAGVDISDFENADLAS
FT                   ATEKYLLALGMEKSEIEVLKSRLK"
FT   gene            complement(521579..522655)
FT                   /locus_tag="Fisuc_0450"
FT   CDS_pept        complement(521579..522655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74062"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74062.1"
FT                   /translation="MICPKCGDKYEDDMPRCLWCDALNPNFGQVDVQTECSEQFTPELQ
FT                   ECQLETVLKQSQDDINGFTFLDKNDELDLAKNPDGYIEYKIARPSLVECILVMFFSIVA
FT                   LLFITVEVLFVVGIESLWPIWLLSSFVLTCAIYICSKTVFAVEWFKGKFILKTFFGPKE
FT                   FLFNKSFTCCCDESGRGGFSVFLKKGKQTFVLRENAFPDVVKMLCQINGCSTDKTIKAK
FT                   GAEYITYKPLGRRCSMLTVLWQGIIGLLLTVVCLFNGINGNVDSDWFCCLCLAILFWVE
FT                   AYRNSKQIFEIRWFKDKFIFCTRYGEKTFSFDKSELQKMKRNDKGFRRFVFEKNGISFV
FT                   VDEHDFPQVVEMMGKLYD"
FT   gene            complement(522677..523330)
FT                   /locus_tag="Fisuc_0451"
FT   CDS_pept        complement(522677..523330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ank:AnaeK_4115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74063"
FT                   /inference="protein motif:PFAM:PF09997"
FT                   /protein_id="ACX74063.1"
FT                   /translation="MSMKICIIPTMNNIAKSHLFLLAFVLLTMLWSVVGVEDTYLTWIL
FT                   EAAPAIVGLLVLVFTYKKFRMPTYLYVVMAFHMAVLLVGAHYSYAKVPLGFWMQDWFGF
FT                   ARNNYDKIGHLMQGVTPGLVMIELLRRTTPIKTAGWTGFLSVCVAEAISALYEIIEWLA
FT                   SLSNPTDTEAFLGTQGYIWDTQTDMFMCLIGATIAVIIRLRVLRLPTSGRLLNH"
FT   gene            complement(523345..524178)
FT                   /locus_tag="Fisuc_0452"
FT   CDS_pept        complement(523345..524178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_1405 exodeoxyribonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74064"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74064.1"
FT                   /translation="MQSFECLSPDILLLSLQNRAEELLRVVERTKKSLKRAPQGHLRLA
FT                   KRGNQFYGYHLTDAKSLKGEYIPKDNVSQMSKLAQKDYDEKALREMEHELSLIDGFIAK
FT                   YSPEELTNIYNRMNEVRKSLVEPILLSDEEYARRWLAVPYKGKHFEAGVPDLRTAKGER
FT                   VRSKSEVIIADTLGRLGIPYKYECPLKLADGGRSVYPDFTCLDLRTRKELLWEHLGMMD
FT                   NPEYASLSVKKLSSYLQCGYVPGKNLIISMESSEKPLSQTEVRLIIQGVFRVNGK"
FT   gene            524680..526002
FT                   /locus_tag="Fisuc_0453"
FT   CDS_pept        524680..526002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0453"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: bpr:GBP346_A0638 tRNA-I(6)A37 thiotransferase
FT                   enzyme MiaB; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM: Protein of
FT                   unknown function UPF0004 ; Radical SAM domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74065"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACX74065.1"
FT                   /translation="MKKYHLATYGCQMNEYDSAMIAQELDMCGCVETNNQEDADIIIVN
FT                   TCSVREKAEETAIVNISKLKYLRKKNPDVKVVVCGCMAKNRGPELLKRLKNVNYIVGPD
FT                   QYRKIPELLFGDAQSPLHKTHHKMFIDEDRDENYLGEYAKLQNDVSAFVAIQRGCNKRC
FT                   SYCIVPYLRGPEKYRDMDDVLTEVKRAADKGITEVMLLGQTVNAYKTPNADFTTLLTKV
FT                   SEIGGIKRIRFTSPHPRHYTNELIDVLLNNPKVCHYAHIPLQSGSDAILKKMRRQHNME
FT                   QYMTVIEQLRSKDPYYAISTDVICGFVGETDEDFEQTIKAFEACQFDTAYMFIYSPRKG
FT                   TESFNEAEILTPEEKSARHSRLVELQNAITLKRNQMMIGRTEEILVEHGSTRDKTELVG
FT                   KTDNFKKVIFKPEEGRIIKPGDYVKVKIDDIRGWTLRGTLV"
FT   gene            526139..527110
FT                   /locus_tag="Fisuc_0454"
FT   CDS_pept        526139..527110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0454"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: sml:Smlt0965
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74066"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACX74066.1"
FT                   /translation="MAKYFIHNLVITGALCAFATTASFAEAAPTLATAQKAYVNGNWKV
FT                   AAAAYEQVCPNEPENTRTECYLWNVLALSQTGIAADFSKAGKRLDSLIDKTNPQQAIYA
FT                   DLMMTKAQFQMYLGRYNKAAESLVHAIETSQPHQVTVLQKVCVAVQDRAHSEELNEACK
FT                   NLGNPEAQKLAAAQKEQAKAEQANAEQVASTAPQASTTPATNNDAAKAAESKVAAPATA
FT                   VATAEPAQTKAPETKPAEAKSAWQLQLGAFGVKSNADLLVDNLKRRNIACTISQNTLES
FT                   GKVLYIVRTGPFDTKESAVDYGAKKLAPLNVEFRPMLVKQAL"
FT   gene            527228..527311
FT                   /locus_tag="Fisuc_R0006"
FT                   /note="tRNA-Leu1"
FT   tRNA            527228..527311
FT                   /locus_tag="Fisuc_R0006"
FT                   /product="tRNA-Leu"
FT   gene            527337..528068
FT                   /locus_tag="Fisuc_0455"
FT   CDS_pept        527337..528068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74067"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74067.1"
FT                   /translation="MSNMFKVLSAVLFAGSLAFAQSDDLFSDDFQDAATADSIAQANAE
FT                   ATNQSNIGNAQAVGGQWEGFKYEDMGLTQWEYQQAKEQGVTREKLTKLVELGIRPTEYL
FT                   QKPWNRLGVSEEDWLSQRAEGMEDADIDRSYRYRSGDQKSAYISLLIPSYYQWKTKQTA
FT                   KATFMDVLEIGSIAVTVVFKVQDKSYWWYGFLGIAAAHLWSFADAFISTQWDSNPDANR
FT                   FSFGVIPTPDQGVASFFNVKF"
FT   gene            528075..528431
FT                   /locus_tag="Fisuc_0456"
FT   CDS_pept        528075..528431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0456"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: nam:NAMH_1689 aspartate 1-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74068"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACX74068.1"
FT                   /translation="MQLELLKAKIHRATVTDANLNYEGSITIARDLMDAAGILPFEKVG
FT                   VLDVNNGSRLDTYVIEGKAGSGVICLNGAAARLVQPGDLVIIVAYATMSPEEAKTWKPT
FT                   VIRVNGKNEIIEKI"
FT   gene            528560..530074
FT                   /locus_tag="Fisuc_0457"
FT   CDS_pept        528560..530074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0457"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74069"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACX74069.1"
FT                   /translation="MPDNILYIAIASAILLLIIIFVMSYIKAAPDEAIIVSGIQKQPRV
FT                   IIGRAGLRIPFFERADHLSLQLIQIDVKTGSPVPTKDYINVSVDAVVTAKISDNPDRLK
FT                   SSAQNFLNKKPEDIRAMIVDILEGNMREIVGRMQLVDLVGDRKQVSELVLENAIPDLEK
FT                   LGIVVQTFNIQNFEDANGVIENLGVDKTSAIRKAAAISKANAERDISVAQSQAKKEAND
FT                   AAVAAELEIAQKQNDLAVKKANLQKISDTEKAIADAAYEIQKQTQQKEINVAQAEAEVA
FT                   KQEKEIEIRERMVMVTEKELKAQIEKKAEAERQAQIQRSEAELFQQQKDAEAVRYKEEQ
FT                   RAKAIKQIADAEKEKAFAEAEATKAKALAEAEATKAKGLAEAEAIKAQGLAEAEALNKK
FT                   AEAMKLYGDAARQEMQLKTIEKYFEQMPQIAAAIAKPMEKIGNITMYGEGNTAKLTGDI
FT                   TKTLTQVTNGLTDSLGIDLRTVLGSMFGAKLAGVTKSDDSKTDNNK"
FT   gene            530146..530724
FT                   /locus_tag="Fisuc_0458"
FT   CDS_pept        530146..530724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74070"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74070.1"
FT                   /translation="MRFVCFTVLFLTVFTFAASPAKADSAELSETLVAAQDTIVDTIYV
FT                   IQESGIPWNRENFDPERLVRHDTFDPALKVAYTYSVSFIGGSFGSFAQQSFMAHFAYEF
FT                   TPNLHLYANVGLWMPLYSSIHFGNRIAREDVKQGNVGLLVPDIALEYKPNDKVSLKVMY
FT                   INERDAFRAYGPHRYFYDGCPWSNPRYCW"
FT   gene            530962..531549
FT                   /locus_tag="Fisuc_0459"
FT   CDS_pept        530962..531549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74071"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74071.1"
FT                   /translation="MKRIILSALCISTLAFANVTTNIKSSEMATQVIAETSVSTSDKTE
FT                   ANYEFRNDGIPWNREFDSDRMVRHQTFDPALKVAYSYSLNFVAGSFGSFANQSFMGHFA
FT                   YEFTPNLHLYANIGLWTPIYANISNGSRIAREDLRQGNVSVLIPDVSLEYKPSENTLIR
FT                   ISYVNERDALKAYGPRSFFHSECPSRSSVLCQ"
FT   gene            531624..532061
FT                   /locus_tag="Fisuc_0460"
FT   CDS_pept        531624..532061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74072"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74072.1"
FT                   /translation="MFHNYSKALHLNFAVGVSSAVFAVFLFAGCEEEKPAPVVREVRSI
FT                   KGEVEVLNSCSMKGAATKMRTFLRDNGFDVVHIENERLQNYDETVIVLRNPEWEGAQAL
FT                   AATLKTKNILVLLNKNATVDAVVHTGRDFQQIIEPDQREKK"
FT   gene            532058..532477
FT                   /locus_tag="Fisuc_0461"
FT   CDS_pept        532058..532477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0461"
FT                   /product="Iojap-related protein"
FT                   /note="PFAM: Iojap-related protein; KEGG: ank:AnaeK_0226
FT                   iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74073"
FT                   /inference="protein motif:PFAM:PF02410"
FT                   /protein_id="ACX74073.1"
FT                   /translation="MTATNNQDFSETVKLGAGILFELRAQNVQLIDLRGVKNEADYFLI
FT                   ATCESEAQMQAILNELTKEFKARKLHYVGVEYKEGVRWAIFDAGLDLMVHLFEEEKRNE
FT                   ISFDRLYADGKLMNLDEHDFIREDAKKSGDDNELI"
FT   gene            532464..534176
FT                   /locus_tag="Fisuc_0462"
FT   CDS_pept        532464..534176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0462"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: arginyl-tRNA synthetase; K01887 arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74074"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACX74074.1"
FT                   /translation="MNSFNAEIAKALAATGAFDEEAALKLISVPPDTSHGNYTIPCFSL
FT                   AKTLRKAPKLIAEDLAAKVQLPAGLSKVEAVNGYLNFFIDRGFLAKSTLNEIAAKGLEY
FT                   GHAASNGKVVCIDYSSPNIGKELAFHHLRSTMIGNSLARIYKAAGYKVERINHLGDWGT
FT                   AFGKLIVMYLREKLPTDEATLNALTVKELNILYASFSKASKEEPGLEDEARAAFTKLEQ
FT                   GDEFYRKLWTAFRAATLKELMRIYDMMGVGFDHYTGESFFEDKIPAVLDELREKNLLVN
FT                   SQERDVVMLDEFDLNPCLIRKSDGSTLYATRDLAAAIYRKKEYNFDKCLYVVDLGQALH
FT                   FKQVFHVLKKMGREWYKDMYHIPFGVILQMVDGKWEKGKTRTGTASLLRDVIEAAQKKI
FT                   LEFIDEKNPGLENKELIARQIGISALTFNDLKNSRLKDVRFDWDAVMSFEGDTGPYVQN
FT                   AHVRLCSIMRKAGYTVPVADVDYAQLTDDAAYSLINILAKKGEKILAAVKDDEPSVLAQ
FT                   YALEIAEAAHKFIHEDRVLGSAEEKSRLFLVQSTQIVLENVLDLLGLFPIRQM"
FT   gene            complement(534360..535481)
FT                   /locus_tag="Fisuc_0463"
FT   CDS_pept        complement(534360..535481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74075"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74075.1"
FT                   /translation="MERIKLFRLGIYSVLALSVAQVFAAPPKTWDAIFNAEGQGDYAAA
FT                   KIDGNIRFGEYTHYKNVQPVSFRVLDDKFDFSVAGNMTVPAKMVEDPNFYENCRNTMEA
FT                   WISYFDKPRHFGNEDLIINIAGVDFACGNDLFNVHDLRIKFTNPQAQKAWVAELEGRQK
FT                   YKREQLSAFRVAEQEHRAEIRDKSTSFTDPRDGQVYRIIKVEGREWFAQNVNYNVEGHS
FT                   WCYEDKDSYCARSGRLYDLEGARKACPEGWHLPRDREWSDMLKGLTGCYDGVDKCGNFA
FT                   TKMKATTGWQGGGGTDEYGFTIFSSGYRKVLGKATIRYEDMGEYAGFWSAQNGRNETIW
FT                   LWAMGRMSDQMVRQLVPATAKNNGYSVRCINGN"
FT   gene            535582..536427
FT                   /locus_tag="Fisuc_0464"
FT   CDS_pept        535582..536427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0464"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: aeh:Mlg_2099 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74076"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ACX74076.1"
FT                   /translation="MSMTRYILQILCPDQKGLIAGTTQVLAKAGANIIDLQQHTAKDIE
FT                   TFFLRAVFDIEADGIPEVKRHLETIAPHLQLNWKLFDTSKTERVAIFVSKTDHCLYDLL
FT                   LKRRDGDLPCEFSCIVGNHPDLGPVGGSFGVPFYYVPSNPDKTIPENRFREIIEETKTD
FT                   TIVLARYMQILTAQFTEEFKYRIINIHHGFLPAFKGAKPYHQAWHKGVKIIGATAHFAT
FT                   EDLDQGPIICQDIQRVPETASIDELVELGKDIEKRTLSQALKLWLEHRVFVHAGRTFIL
FT                   "
FT   gene            536437..537039
FT                   /locus_tag="Fisuc_0465"
FT   CDS_pept        536437..537039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74077"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74077.1"
FT                   /translation="MSEEIKNEVPAQEPTATADSEVKTEAKAEVHQTSFESTEELVNPL
FT                   TGEVISPAKPKEPKSNSPYKQFKPETFVNPMTGEEEQTTIGSQVIIKKDRGLAYYVGFA
FT                   LLVVMSIAFFFLPGIAITFAVSRLVDLNTSAAWIFSSILSFGVWLIFKLKIKGFEKSFH
FT                   SYLVLCVICLVAMFAIQFITDYNVISEVVALLIGAKA"
FT   gene            537049..537720
FT                   /locus_tag="Fisuc_0466"
FT   CDS_pept        537049..537720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0466"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: tcx:Tcr_1895 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74078"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACX74078.1"
FT                   /translation="MNNTDTFVHFLVESGALKFGNFVTKSGRETPYFINTGEFRTGASL
FT                   SKLAEFYAAAFMVHFDGKAQNLYGPAYKGIPLCAATAMKLSDVYAQNLTFTYNRKEVKD
FT                   HGEGGSLVGYKYSEKTNVVIIEDVITAGTSVNETMQALSQIENANVVGLLISVDRKEKL
FT                   ENGKSALQTVQDEYGIEAHSIVNINDIIAFLENEENRKAINAPEGILERVYAYREKWGA
FT                   V"
FT   gene            537745..538440
FT                   /locus_tag="Fisuc_0467"
FT   CDS_pept        537745..538440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74079"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74079.1"
FT                   /translation="MTFKKSVLSIGFAICMLTGCADSYHWTTSHPSYHKAPYGGIAVTG
FT                   IENAFVITRSNWFAKRLEIGTDSIQIKGTLHCRNTFETEMRKAYGNLIVLPDSANTKFP
FT                   EESLKLDERIFIKGHIPEQGITLKDSAGNVPPVVLILHEFIIGTDLKRENFFDYALIHN
FT                   ESGSIRKPDNVSAIFSYTLWDNLKQRPLFSAVDEIQQPITTYKLSNLTNLIQLAVQKIR
FT                   KNLYEGVIK"
FT   gene            538437..539693
FT                   /locus_tag="Fisuc_0468"
FT   CDS_pept        538437..539693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74080"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74080.1"
FT                   /translation="MKKLLAIIMFLVAWASAADVYFDSRFTLWKDATILIWTLNGESPI
FT                   SANEFCLSLRRFNTGIGEPKCRELGEWERDTIATRYGTWLSNNLEKGLPSSYLRARHPG
FT                   MAAKIQALEDNIVLFLAPQGKFIQVAVFDETTQEPKAAGIVKANTDKVALSDEIASAFF
FT                   DKRTKRRLTKEERLKQQTEPDDLYKEVPNLNVWAGIGIGYSQAHFPLTPDNWTSSHTRS
FT                   RVKNYRATKDSVSLWNFIDDADPFLSLYAGITWHGFIGVEFMYRYSNRDMKTDNSDTVY
FT                   RELDHWDFGQHDIGLNVLLSMTYPITPWLDITPLFFLGFQYTFYVENIELKSDVKKPSR
FT                   SYQYRIKFEDVYKGALLGIGGQFVFKKHYGLDLRAGISSRGRDIYEAPSPDAGAAPTTI
FT                   GKSTIDCFVSLGFEYHWTL"
FT   gene            539841..541232
FT                   /locus_tag="Fisuc_0469"
FT   CDS_pept        539841..541232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0469"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: dds:Ddes_0362 DEAD/DEAH box
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74081"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACX74081.1"
FT                   /translation="MSDEIKEETKERVNPFLTPVKIIEPKNKLPDYTFDMLPEEQKAIL
FT                   REHGWTELMPVQRKSIPYMLAARDMLVQSKTGSGKTGAYALPLLQVIVRDHPYPQALIL
FT                   VPTRELCIQVQEEFEKLSKGTGIKSVAIFGGVSYEPQIKALRSGVHVIVATPGRLMDHI
FT                   QRGNVDLLSIRDLVLDEADEMLSMGFYPDMQKIRKYLPKAISCTMYSATIPQTVKSLAR
FT                   EFQRPGADFLSLSYDKVIANNLEHRYYTCDVMEKDSMTIKVLEYYNPESCMIFCNYKRD
FT                   VSYLEQVLSGYGFEVGALSGDVAQSLREKTLNAFRDKKLKILICTDVAARGIDVDHVTH
FT                   VIVYDHPADHEVYVHRSGRTARAGRSGLCISLITPVEEIDLRQTAVDFGINFIKMDPLT
FT                   NEEIAKKVSERTKVRLEEVRKHFGGQKATERISRMLPLVKELANGTTDDQMLLAYLLDK
FT                   FAWRK"
FT   gene            541418..542179
FT                   /locus_tag="Fisuc_0470"
FT   CDS_pept        541418..542179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0470"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: efe:EFER_0190 methionine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74082"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ACX74082.1"
FT                   /translation="MAKIKVKSAKEIELIRDAGALAAETLIRAGEMCKPGVSTLEIDEF
FT                   IGDYTRQHKGISACMGYHGYPRYACISINEVVCHGIPNANTILKDGDIVNIDITTILSG
FT                   YHGDTSAMFCVGKVSDIARELVDTAKFCMEEGIRAAGERGAHWNDIGCAIQDIADEHGF
FT                   SVVEDYCGHGIGRGFHEEPTVYHFRNYERCPFIEVGNVFTVEPMLNVGRPGTKTLSDGW
FT                   TAVTRDGSLSAQWEHTVVKTKDGIDILTLPR"
FT   gene            542284..543969
FT                   /locus_tag="Fisuc_0471"
FT   CDS_pept        542284..543969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0471"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   scl:sce3220 endo-1,4-beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74083"
FT                   /inference="protein motif:PFAM:PF01270"
FT                   /protein_id="ACX74083.1"
FT                   /translation="MLYNSILLSPISKISKKNNFVDMKTTKLSAFPLSLLFSATLATAA
FT                   DFTGNFFDADGAYYGPDCDKEKNYSGAYYTGNYESPFKTILGKTDEEIQEKMDQLWNHY
FT                   FKGDNNSKVYYDKGSEAYILDVNNRDVRSEGMSYGMMIAVQTGHKEEFDKLWNWAKNHM
FT                   WHKGGGWDGYFAWQRNESGSGGDDNCAPDGEMYFMMSLLFAANRWNDSKYMDDAQYILK
FT                   KMWDNGQHSLFNPQHYVITFQPQGNENNFSDPSYDLPAYVDLFARWSTSNQDKWSKAAK
FT                   ATRDHLYKSSNTKSGLFSDYNNFDGTPHGVSYNGNAEKYMYDAMRCAMNFGMDYYLFGA
FT                   DSARQEEMARRIIDFFEKDNYKHARFNWDGSNPQEQYTLGETGANAVAAMALINDSKYN
FT                   DAVKKNLKMAWDANLMTGQYRYYDGLVHYLAMLHLSGTFKIWKPKPEVTEKQVTANEHN
FT                   GVKIESDTTFYSFESCKLYKVNAKPETNAISAKVKLNNAVRVWSTNSAIVIENAAVGTK
FT                   FAVTDVNGRVLASSKTSSAMQEVRINSRGNFLVIVGNKTYKVVK"
FT   gene            544143..544478
FT                   /locus_tag="Fisuc_0472"
FT   CDS_pept        544143..544478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74084"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74084.1"
FT                   /translation="MSFLSNARDKAIEMFFRRNDFINRFGEIQNIEIDSQENQANVTIL
FT                   LHGEFIPTTICAHYCFEDTDQETLIVINKVECERTMIHELVSWWIKDHPIKKALPKGTG
FT                   FFAKILF"
FT   gene            544499..544786
FT                   /locus_tag="Fisuc_0473"
FT   CDS_pept        544499..544786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74085"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74085.1"
FT                   /translation="MEEQLQKVLNNVSFNVNAGKQTMDLTVLPHGETTPISFHLNYKLV
FT                   EKGDETEIFIQNIASDRLWVDEIVKMWLEKSSFNYKIPQDLAGIIKMFLK"
FT   gene            544804..545490
FT                   /locus_tag="Fisuc_0474"
FT   CDS_pept        544804..545490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74086"
FT                   /inference="similar to AA sequence:KEGG:Rfer_2035"
FT                   /protein_id="ACX74086.1"
FT                   /translation="MLNFNEFKKDESSSIQEMFNSVVFNLITDIPDSLLCPNRDPDARA
FT                   EILIKQAALKAAAVSTSLSIPAGFTGVLTSIPDIAAVWRIQAQLVSDIACTYGKFAMLS
FT                   REAMVWCLFRHSAASLLRDVAVRTGSRIVVQKLSLAALQKLLQRIGVKISTNFLGRIAL
FT                   RAIPAIGAVGNGAYTYFDTNEVGKTAKSYFKALEGVEKPELVENSIDKDPDSSEAAAEP
FT                   ASEENV"
FT   gene            545683..547812
FT                   /locus_tag="Fisuc_0475"
FT   CDS_pept        545683..547812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0475"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: scl:sce0644 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74087"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACX74087.1"
FT                   /translation="MKDIQLHRNIGISAHIDSGKTTLTERILYFTKRIHAIHEVRGKDG
FT                   VGATMDSMELERERGITIQSAATFANWTHTKTGEKDSINIIDTPGHVDFTIEVERSLRV
FT                   LDGAILVLTGVEGVQSQSITVDRQMRRYHVPRVVFVNKCDRSGANPLRVAVMLKEKLNH
FT                   KPCVMQIPIGLESNLKGVVDLLEMKAYYFEGDNGDDMIEKEIPAELVDQANEYREKLVD
FT                   CCADYSDEVMEKAMEGEYGVDQIDKNLLKKVIREATIRLDITPVFMGSAHKNIGVQKLL
FT                   DGVIDFLPCPTDVENKALDLDNNEAEVILKSEDNAPLVCYAFKLVNDRYGQLTYVRVYQ
FT                   GTLKKGDMITNMATGKKVSVGRLVRMHADEMVDITEAGAGDIVALFGIDCASGTTFTDG
FT                   KNHYNMTSMHVPNPVIELVIEAKNRDDLDNMSKALNRFTKEDPTFQVEVDKESGQTIIK
FT                   GMGELHLDVYIERMRREYKCDVTTGAPQVAYRETITRPAKFDYTHKKQTGGSGQYAKVV
FT                   GEMRPMAVEGDQEKVYNFVNSVVGGRIPKEYIPSCDKGFQSCMEAGSLIGFPVVGIEME
FT                   VQDGAFHPVDSSDMAFQVAARMAFREAFAKAGAQILEPIMKVEIQTPTEFQGGVVGNVS
FT                   QRRGSIVGTSEELGMTTITAEVPLSEMFGYATDLRSMTQGKAEFTMEFCKYLPVPKNIQ
FT                   EELIKKYGDKVKARA"
FT   gene            complement(548113..548910)
FT                   /locus_tag="Fisuc_0476"
FT   CDS_pept        complement(548113..548910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0476"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: hip:CGSHiEE_00690 nucleoside
FT                   triphosphate pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74088"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACX74088.1"
FT                   /translation="MKYTFKDLVDIMARLRSENGCPWDRQQTTHSLLPYLVEESCEFID
FT                   AAQDGDKEHMCEELGDVLFQVIFHSQVCKEQGDFTIEDVIQGLCEKMVRRHPHVFGDAK
FT                   VDTANDVSRRWERIKAQEKNNLKHAGESIMDKVSKSMPTLARSQDIIRRVAKVGFDWGE
FT                   AAPVFDKAQEEFAEFRAEMEKISPENANVDRLEDEFGDIMFSLVNVARHCGFNANIALQ
FT                   RANNKFEKRFREVERRVKEQGKEIKDVGLEGLQKLWKEAKLSS"
FT   gene            549072..549944
FT                   /locus_tag="Fisuc_0477"
FT   CDS_pept        549072..549944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0477"
FT                   /product="SMF family protein"
FT                   /note="PFAM: SMF family protein; KEGG: afw:Anae109_2694 DNA
FT                   protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74089"
FT                   /inference="protein motif:PFAM:PF02481"
FT                   /protein_id="ACX74089.1"
FT                   /translation="MEMKLSPENYPLALGASKYSPKQLFCIGTLPSTDKIGIAMVGTRR
FT                   PSASAEELCRRLIGSLKATNAVVISGLAQGIDSFCHRAALDAGIPTIAVLAQGLGTKIE
FT                   GERGILAKRILDAGGALLSEYEGDTPAYKGNFIARNRIISGLSQSTLVVQSRKKGGALL
FT                   TAQFCLDEGKQLLACPGNFDCELYSGTNTLLDSGHAKAVFIPESLRAVAGIPLLEGAKM
FT                   EQLTTYGVQLSDGAQKIFERFNGFRKTFSELQQEFDFKPPELLAILTELEISGLVTSKD
FT                   NFQFYFNGA"
FT   gene            549949..550227
FT                   /locus_tag="Fisuc_0478"
FT   CDS_pept        549949..550227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0478"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   dat:HRM2_27150 FtsB"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74090"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACX74090.1"
FT                   /translation="MHLRYLIVIATIIAFAFMVFHLLFGKDSFPEQRRIAREIELYQAE
FT                   IDSLNKVIEERDKLIQKLKTDSLYKEEILRTRYGMSREGEKAFQLVK"
FT   gene            complement(550346..553402)
FT                   /locus_tag="Fisuc_0479"
FT   CDS_pept        complement(550346..553402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0479"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   tmz:Tmz1t_1816 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74091"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACX74091.1"
FT                   /translation="MSVSQLSVRRPVLMTVMALVILLLGFFGLSSLGIREYPNVDYPLI
FT                   QVRTSYPGANAAVVEAEVTEILEASINSASGIKALTSTSRDGFSYISIEFETGMDLEAA
FT                   ANEIRDRVSRVRRRLPDDVDEPTVYKSDSDSDPILMVSLVSDKFDPMEVSEIANNHVKE
FT                   RLQTINGVSEVAIWGEKRPVVRLWIDPVRMQALGVSGAQMAAALKQGNLELPSGSIEGS
FT                   ETTLSIRTLGRVLDPKSFGNIAVRTAEDGTVIRISDVADIHYEPKDTRTGFRRNGKNSI
FT                   TLALMAQPGSNHVEIANEFYKRVEDIRREIPEGVELLYGRDTSINIRASIKEVVETIFI
FT                   AFILVIAIIFAFLREGRTTFIPMVVVPVSVIGSFFVLYLCGFSINVLTLLAMVLAIGLV
FT                   VDDAIVIVENIYHKIESGMTPKQAAIAGTNEIFFAVIATSVVLMAVFIPVLALGGTTGL
FT                   LFREFVAVMIGTVFLSTLCALTLSPMLCSKFLKHQKKGAFFKLTEPFFDWLNGMYSRLL
FT                   GGFLKWRLLLFPIVAALLFGAYYCFNNMSSEMAPTEDSNAVMVNMSMPEGVNLSRTKRM
FT                   ADEFVDEVTSILDSNEYTEFQAGAWNAGNSRMRLFLNDDKKARRPQSEIARAIQVLGNE
FT                   YPDLRVMVFEPQSISTQRGGLPVQFVLQAPNIEVLRDLVPKFEEAASKSPVFSVVNSNL
FT                   RFTKPELHIEILRDKANEEGVSVNDIAQAVQLAISDQTYGDYYKDGRQYDIIGAVGYQY
FT                   RDSPENLSMLTVKNGKGELVSLDNFITYKEQSASPSLPRYNRFSAATIQAGLVPGKTIG
FT                   DGVEEMRRIAKKLLKDYPSVSTTLSGSSKEFEESSSGLYVVFLLALALVFLVLAGQFES
FT                   FRAPFVIFFTVPLALSGALVSLFVTGQTLNIFSEIALILLIALVTKNGILIVEFANQIA
FT                   ENTGCSKLEAARMAAERRFRPILMTSLSTVLGAVPLILTGTPSRIAMGVAIVGGLTFAT
FT                   FMTLFIVPAAYSFFAGKVECTNTDASKMA"
FT   gene            complement(553402..554493)
FT                   /locus_tag="Fisuc_0480"
FT   CDS_pept        complement(553402..554493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0480"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tgr:Tgr7_0703 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74092"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACX74092.1"
FT                   /translation="MKHLLLIALSSILLVACGSKDDSAKGAPAGKGNGGKKGGAQRVLN
FT                   VEGYVAELGLLGKNFQTMATLVPKNSVSLSAATSGRLVSLKAKDGAIVKKGTLLAKIDD
FT                   SELRAQLKQAQSNKMLAEQKEQRVRSLFEKNGATKQDLESAEASLKSAQASVELIQAQL
FT                   AKTEVRAPFSGKLGFVDVSVGAWLNSGTPIAELSEVDRLKAKFSLPQRYASVIKVGDKI
FT                   SLKDSERNVEKFGVVSALDAVISESSRTRRVMVDVDNAKGELIAGSFVSVNVAMEASNV
FT                   QSFTIPSEAMILDREGAYVFVSQGGKAKIKHITTGLRTPMSVQVLSGLDVGDTVIVSGI
FT                   VSLRPGVDVKIKGLRHSINYEVE"
FT   gene            complement(554613..555320)
FT                   /locus_tag="Fisuc_0481"
FT   CDS_pept        complement(554613..555320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74093"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74093.1"
FT                   /translation="MRIILAILLASVAAFSQIVVSVNENVYKNSDKNVFLAVGASALLP
FT                   GMGELYLNEKKMVRPFLWTDLGLWVVTVGAYVVGDRYVTSAHNYAVRHAGFTGKKNVSL
FT                   LNTVGSYRSRSGVFGQNSSPDMNEDYNQAMIRSGKKVDEEFSNEVQWDWGSSDNPETTE
FT                   HIEEFKSRMRHYRISRIVFQVSVGALILNRVVSMLDSWRIYRATSNKSFSSRVQFEPEF
FT                   YDDGAALFMNVKF"
FT   gene            complement(555320..556831)
FT                   /locus_tag="Fisuc_0482"
FT   CDS_pept        complement(555320..556831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proteophosphoglycan 5"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74094"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74094.1"
FT                   /translation="MRKFALLPLFLGLSLAQLSFGQVRDLFAEFEEEAAAPATPATPEA
FT                   KASAAPASSAAVAPASSAAKAPASSASKKSKAKSSSSKAVSSSSATPLSSSSVVLSSSS
FT                   VVVEIPASSAVLSSSSVAPVESSSSVEAAPAVAIVDTSVLDSAARDSLMREEAIAEAER
FT                   VRARADSSRKADSIAQSAVAGLTNVSSSSVAESSNSMSRRDLLGPVKVSKVHGIDEMKG
FT                   RYKNPRKALFLSLLVPGAGQMYVGGTTATYVRGGVYMALEVLMWSAWGYFSVYKYNQQV
FT                   DKYKKFAKEHYSIGRYESAMYDLYHNMGGNVYSTTFINRYMGTRKSFCEAIYGDATYGK
FT                   CYQESSLYDDDLTHRNNFNDKNKSLGDEMKGLRHSINNESELFQLISEGVYVRGWDDAT
FT                   EVSIDNLHLDEEDYETVPLGESEHLNKYRSMRRDANDYADMQALFIGGLILNHIVSAVD
FT                   AALTANAHNKVLYEEDVSWYDRLHFDSGVSFKDSFGWTVRANWGF"
FT   gene            complement(556921..559758)
FT                   /locus_tag="Fisuc_0483"
FT   CDS_pept        complement(556921..559758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_5271 hemagglutination activity
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74095"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74095.1"
FT                   /translation="MIKKIAMFALAVSMAFSGAFADSTCTVAITPSLGIFSGNQIKPTV
FT                   TRVMCDDVELTDFSVTYGENINAGANAGTVYVTVKGNTDPIEKKFDIEQKPIKILIDNA
FT                   EKEKGTKDPVFTWKLAEVKNVNAKELANLQAGLEEFIELTRNAGEEVYTYPITLADGIY
FT                   DGLKKKFPNYDFSFTSGEFTITKTKVTVVVTSTAKVYGQDDPEQFEYTIHGNIEKSDYT
FT                   KLGDIVLSRPKGEDVTADGYLISVTVENMETDDYYVETVPGTFVIQPAPVNVVVDDVEK
FT                   IYGDATPEYTYKVTGLIGSDKLKDVTISCAKCVSTGLENVGEYAVTASVKAASNPNYKV
FT                   TTKSGTLTVTPKAATVTMNNAEKTYGEKDPKFTYEAEGLVTASESLASPTIARAKGENV
FT                   GTYKVSVEFAEGANPNYTLTVKPGTLTINQKAVTLVVDNITKKYGEKDPELTYTVSGIA
FT                   SFDGVKDELKGVALKREAGEDAGDYAITATVDDESNPNYIVSTKDGQLTITANDDKIVV
FT                   TITGHVDTVEYDGKEHSVKGYDISSNSEAYSLKYVEYSGESAVAGTDAGKYTMGLSAAD
FT                   FKNTSVNYPNVTFNIADGVLVVNPRALVVSANADTITYGDETPTEFTWSVDRLLEGDEL
FT                   DNIHVSLNKTGLLAAGDYELTFDKKSPTNTNYEVTKYETNTLTVKQKIVTVTVNDTSKF
FT                   YSEADPEKYTYTVSGLLDGDELPELYMKRQQGEDVLLDDETYSISGTFVEAFDNPNYIV
FT                   KIRQGHFTIKPCTQRITVAIYGDNVIAKYDDGNEVTALKSFDVSPMRIPGEPWLPEEFA
FT                   YKKEFVSYKGDSSMTATELGVYPMGLVASDFVNISPNFENVNFVVSIDGTFKITDEEIS
FT                   IAAVKGRKAFGISSMNRRIQVNGSTVGKRFAVLDLQGRVIRKGSVESSNFEIPVPSAGV
FT                   YMVRVGSSAQKILVK"
FT   gene            complement(559949..560395)
FT                   /locus_tag="Fisuc_0484"
FT   CDS_pept        complement(559949..560395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0484"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: Ribosomal
FT                   protein L9-like; KEGG: ade:Adeh_0116 50S ribosomal protein
FT                   L9P"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74096"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ACX74096.1"
FT                   /translation="MEIILKANVPHLGKMLDVVKVKDGYARNYLFPRKLAVRATKEAKL
FT                   EIENNRAAVEAQFQKELAAAGDVAAKLAQVSVNLERRVVEGERLYGSVTAGDIAEAITK
FT                   AGVKVSRAQIDLAEPIKQLGVYTVTVKVFSDVEAQVKVWVVAEK"
FT   gene            complement(560412..560663)
FT                   /locus_tag="Fisuc_0485"
FT   CDS_pept        complement(560412..560663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0485"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: dat:HRM2_18630 RpsR"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74097"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ACX74097.1"
FT                   /translation="MAFEDKKQATRIRRKKTCWFTENNVKFIDYKDEKTLRRFISERGK
FT                   IIPRRISGTSAKYQRMLNEAIKRARQMAILPFVSDSMR"
FT   gene            complement(560663..561034)
FT                   /locus_tag="Fisuc_0486"
FT   CDS_pept        complement(560663..561034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0486"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: tdn:Suden_1660 30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74098"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACX74098.1"
FT                   /translation="MRQYETMVIIDAMISDDAIKAEVETIAANITNGNGEILRRDDWGK
FT                   RKLAYTINKRQHGYYVIFYYKAEASVVANMEAALKLNENVLRWMTLADYPMSEIVYDQT
FT                   QAQSTEEIIPVDAEEGEAE"
FT   gene            complement(561171..562295)
FT                   /locus_tag="Fisuc_0487"
FT   CDS_pept        complement(561171..562295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100013487"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74099"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74099.1"
FT                   /translation="MRILFLVLLLILNVYAEAKDSGTTRSSSKAKKAKSEVVAKKSTTS
FT                   KSAKSRKTASRKASKKSANLDSASPESTSQSDTTDVSSNFANPAISATSVADTADEPIV
FT                   VRDTIVDTIYVVRPELTKSESKPQSYNIPLPHQSAYLKEGFSVGLGAGLFNASEDCDCL
FT                   GVWQGQLEYHYRDYVTGGFDVRFFGGTLDRDVMLMYQRYRLNVKFHKSFTVADFYAGAV
FT                   LGLETTDLSEFRKELKDGVRRNRSDEVDSSKIAELDSLSDASEISQNSVYDKNCEKMFS
FT                   LDGFTLGVEVGMGVTLSHYFGLMGSASYEFNFSWAQLVSFSPGVAFNLQKIWPWGRNNL
FT                   RSTWVSFEMIFQRYFNRDVNEWAVAGFLGLQFGI"
FT   gene            complement(562315..563292)
FT                   /locus_tag="Fisuc_0488"
FT   CDS_pept        complement(562315..563292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74100"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74100.1"
FT                   /translation="MVETSQFLYQLWRDFSYWFCRIDKLADFAIYIFLPFFWAFVFFSL
FT                   RKNSPRKKLWLAVALIYPVVLLVGFTISQAIFTNPLHCILIFIPYFVGVALGSLFSVSK
FT                   NLHWILVPILPLLTYSAVIFWDVYPPVFYPFAEIVDEPMQDVELKIAQNADYEIEMILE
FT                   DAWWNDTRIIAVRERNDSVFYRAAYRMCSAENIDDEGYKHRIKPNIDSVQWTLLSPEKS
FT                   LIAKSLKNSIEKYKQEYHSDLVWDGYSVDVSLKDYKRKTSRRLDLSNASILGMQGAMAI
FT                   EKMMLDLMPPRETFTTLSYDKVSKKCAEIENARIQQIEASRNSK"
FT   gene            complement(563466..564461)
FT                   /locus_tag="Fisuc_0489"
FT   CDS_pept        complement(563466..564461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0489"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: scl:sce7394 hypothetical protein; TIGRFAM:
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74101"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ACX74101.1"
FT                   /translation="MRKISLTGIKPTGTPHLGNYVGAIRPALELTKTYDTVYFIADYHA
FT                   LTTVQNGAEMRANIYKVAATWLALGLNPEESLFYKQSDIPEIFELSWALSCFTPKGFMN
FT                   RAHAYKAKVEANTAAGVDVDSNVNMGLYCYPCLMDADILMFSADIVPVGKDQKQHVEFA
FT                   RDIAIKFNKHFGEDVFTVPEPVFQESTGVIPGLDGRKMSKSYDNYIDIFLEPKALKKRL
FT                   GKIVTNSQGIEEPKDPDTCNVFKLYKLFATPEQTEALAARYRAGGMGWGHAKQELQNVL
FT                   EEHLGAAREKYFYLLDHTDEIEKILAYGKERARAKAKVMMDRVRHLLGTY"
FT   gene            564588..565748
FT                   /locus_tag="Fisuc_0490"
FT   CDS_pept        564588..565748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0490"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: 3'-5' exonuclease; HRDC domain protein; SMART:
FT                   3'-5' exonuclease; KEGG: dal:Dalk_1956 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74102"
FT                   /inference="protein motif:PFAM:PF01612"
FT                   /protein_id="ACX74102.1"
FT                   /translation="MIKDEKYILVDSEESLANLLADLELYDMAAVDTEADSMYHYTARL
FT                   CLIQITIGEHHYIVDPLCGLDLAPLFKARAMQTLIFHGADYDLRLLWQTYGFSPKSIFD
FT                   TMLAAKILGEQHLGLADLVKEYFGDELKKENQRADWTIRPLSLDMCEYAIHDTFYLHEL
FT                   CAILAEKLQQAGRMNWLTEQCNTLIEHARTPNAPKKDPWRITGSSIYSPCALNILKHLW
FT                   EWREKQAEELDRPPYKVMQSELMLAIVNAQNSHFPEVSETFLPKLPRNFKGDRLDSFLN
FT                   MLRTAVAVPECDWPMRLPKAPPPPVIPHSDLLNALKTWRDEKAEELKIDAALLANKSQL
FT                   IWLAAPGNIPWEKRYEEAHLMHWQQGLWNEILRDKLPTAKRIGDEE"
FT   gene            565772..566356
FT                   /locus_tag="Fisuc_0491"
FT   CDS_pept        565772..566356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0491"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   5-formyltetrahydrofolate cyclo-ligase; K01934
FT                   5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74103"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACX74103.1"
FT                   /translation="MAASIVIVILVLLIFGSSPIVEMILKMRRMKKGDDIIKEPWQEIH
FT                   DIPGYHDARNIAAFYPMKGEPNIMPILEELATEGRLLLPKCEGDGIMHFYKIANLKKDL
FT                   VKGHYGIMEPREGIEKFEGDIPVFLVPGVKFNWDGSRQGHGKGYYDRFLAKYPNAFKAG
FT                   IMTPAQLSKEPLEQKETDVKMHTVIACREKY"
FT   gene            566441..567556
FT                   /locus_tag="Fisuc_0492"
FT   CDS_pept        566441..567556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0492"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: dps:DP2859
FT                   tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74104"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACX74104.1"
FT                   /translation="MSFNNDDSRRGFGNDRKRHFGRTARPTFDEAKFNREHPDEPERAP
FT                   ERREFSQERRGGIGSQAHLRRDRDDFANRPSRFDSDRPSFGDRPKRIEGERNFGERREF
FT                   DKSRANQENFVPAVGDADAAPQVAVGGIKEVEELLNKNPLQVHRVLFMHKSGNPKLYEL
FT                   QKLAKRAHVHVQQVDSKILDSYARPNHGVVALMNEKELLNWMDVREEFFKARDTGEKKL
FT                   IAVATNIEDPRNLGACIRSSLALGVDILLLPAKGMCGITPSVARTSAGALEKLRICRPD
FT                   NLEGAIGELKMAGYQILGLDADTETNLAGFDFADHVVLAVGGEDVGLPPFIKKQCDAVL
FT                   RIPMKPEAHSYNASVALSLGLYEYARLRIKA"
FT   gene            567730..569523
FT                   /locus_tag="Fisuc_0493"
FT   CDS_pept        567730..569523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0493"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG: scl:sce0771
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74105"
FT                   /inference="protein motif:PFAM:PF08757"
FT                   /protein_id="ACX74105.1"
FT                   /translation="MSLAQTYDLPIVFVDTKGKCLDKNVTEKIPATMRVLDGEKNSVAD
FT                   SAKGTLYDIGIKVRGQSSALFPKPGYGVEVRDEKGEGLDVSLFGLPPADDWVFHGPYVD
FT                   KSMMRNALAHWLFRQAGHYSPRTKHFDLYINGVYRGVYVLIEKIKRGKYRVNVSKLKET
FT                   DIAGDSLTGGYIWAFDKTGTNTGGAGSGPIEKEGFNTSDGLNVILHYPKKENIQKQQED
FT                   YLKKYLNDLEGLFKNGKNGQGYENYVDMTSALDYVLHEEVTNNADSYWCSFFLHKPKDK
FT                   TDKNGVKTEGKVTLGPAWDFNLAMSNGSQPENGGGNNGGGMWGGGFGGGFGGGGNGFGS
FT                   SGTSGWQIENSQKSGNGGMWGMGSSLKAPNWLLGMWKDSHYQSELKKRWAELRSGVWHT
FT                   KTLDLYLDSMKTYLKNAADRNFKRWPNLGKSSGQNDADPQPMKYCNSSSGGFGMPMGGY
FT                   NATTWDGEFEHLRKKMKERMQWMDEQLGFKEPASPIAMAPVDPSIHEPDWQNDGKDKDS
FT                   IPMGIRYDDLSRLSPTNFFVVIGNYLEIHTDMGGKFALVDLNGAVLYKTQIKAGTTNIE
FT                   IPSKARNKHWIATLNGKMLSK"
FT   gene            complement(569627..570547)
FT                   /locus_tag="Fisuc_0494"
FT   CDS_pept        complement(569627..570547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0494"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase A; cysteine synthase;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: gme:Gmet_1558 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74106"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ACX74106.1"
FT                   /translation="MAIYNNILETIGNTPLVRINKLNKGDAEVYVKLEMFNPLGSAKDR
FT                   VALNMINRAEQEGKLKPGALIIEPTSGNTGVGLAYVGAVKGYKVVLTMPDSMSMERRML
FT                   LKSLGAEVVLTEGAKGMAGCIAKANEIAAANPGSFIPQQFDNPANPEAHYLTTGPEIWR
FT                   DTDGKVDVFIATAGTGGTVSGTAKYLKEKNPNVYVIAIEPDDSPMISKGVAGPHKIQGI
FT                   GANFVPKNYDPKVIDEVYLTSTEKAGNAARAAAAEEGIFVGISSGAALECALTVAKRPE
FT                   FKGKRIVAVLPDTGERYLSTWLWNT"
FT   gene            complement(570618..571907)
FT                   /locus_tag="Fisuc_0495"
FT   CDS_pept        complement(570618..571907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC689787"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74107"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74107.1"
FT                   /translation="MNNVIKFTMVASVLALMGCTDSNVSGAAIEDNAVAQNSSSSKANG
FT                   SSNSMNGPSQIVFSTKATEVLNVDNADISVYGEENGAEAGCTADGKSFEAKLKVNDGLV
FT                   ENSIEMKNFGSSCDSVLAEFVASCQSRALVFNGSNNKESCDENGDVTAYCFDDRAVAMT
FT                   KCTNNVPGTCSTKPAKTTIDFNELFKDFSKFSGEVCNAISKGASSTTGRFTTPSSTSRD
FT                   MSSSSTEPPDPDTLNVIAIPRDTTPIDTAAFTLDKYTVQFTDDPSELSFDEHVLAYNGG
FT                   LPSTAYLDEDIEQNRSGINPFLKEINVSDIGNYFPMTASIVGNRTPKENCKTFLVLSHD
FT                   GAQPTGHVLSKISKGSIEISSVNPGGPCMQTAMYFPIAFLVEDCDGLLDENTELSYNRF
FT                   TSKTWACETLGSPTKKARAYGEWYRADLAK"
FT   gene            complement(571900..572733)
FT                   /locus_tag="Fisuc_0496"
FT   CDS_pept        complement(571900..572733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0496"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74108"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX74108.1"
FT                   /translation="MKPITEYKDYRLYMQDFYEERKRTSAFSWREFSKLAGFKSPVYLK
FT                   LVCEGKSSLSFVKMEQVAHAMGLAGHEFAYFTQMVKFGNATKDSVKKEALLEMQKIARE
FT                   HQVRVVDAESFEFYESWKNPTIRELAPMMPGKRPLEVAKACHQVISAEQVRDSLAFLVQ
FT                   TGFLKREAEHTYVQTEKTVIGTKESLPIAVRGMHKEMASLARTAIDKFPIEERHFTGAT
FT                   LGLCEEAYARISQELDAFVRKVANIAAEYENINQVYRLNLQLFPLTKKVEEETNE"
FT   gene            573031..573570
FT                   /locus_tag="Fisuc_0497"
FT   CDS_pept        573031..573570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0497"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: gbm:Gbem_2313 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74109"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACX74109.1"
FT                   /translation="MANKYAGTQTEKNLEAAFAGESQARNKYTYFASRAKKDGFEQIAA
FT                   LFQKTADNEKEHAKLWFKELEGIGDTAQNLKAAAEGENYEWTDMYEGFAKTAEEEGFTA
FT                   LAKKFRMVAAIEKMHEERYRALLKNVETAKVFEKSEVKVWECRNCGHIVVGTKAPEVCP
FT                   VCAHPQSYFEVHEDNF"
FT   gene            complement(573652..574692)
FT                   /locus_tag="Fisuc_0498"
FT   CDS_pept        complement(573652..574692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_3918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74110"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74110.1"
FT                   /translation="MNKYAFFLLCASAAFAQTADTVSFVNFENREVGVYGNAEAKEDFK
FT                   RNTTDKSWWYAMDKNNGENSKIVYDGVAHGNVLQLKYPKGCVGPNDNDTPACAAQIIQP
FT                   LVKTADTMWSAYDIFFEDGFEFQLGGKLPGLCGGKCYTGNAMPETGDGWSARIMWRKGG
FT                   NAVQLIYFMGQKSEYGDDFKWDLGGKNPQAQFTIGKWHRIVNKVSMNTVKTPGAGDKNG
FT                   RVQAWLDGELVLDVDTLRLRDYDTLHVDKFYLSTFHGGSSAEWAPTHDNFIRFDNFTVS
FT                   TDSIAVSLDNAGGVGLNKRLWRENRRADSKPVEIYRVNGSRVGRGLHTESKTLPLKNGR
FT                   LVKVVQ"
FT   gene            complement(574709..574897)
FT                   /locus_tag="Fisuc_0499"
FT   CDS_pept        complement(574709..574897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74111"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74111.1"
FT                   /translation="MLQKLWNKCKKCGCDKVEDSEKLCESCKEKRREFWSDIKKIVGVG
FT                   GAAFLVLIAGGKMTKKS"
FT   gene            575609..576883
FT                   /locus_tag="Fisuc_0500"
FT   CDS_pept        575609..576883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0500"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   dvm:DvMF_1535 saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74112"
FT                   /inference="protein motif:PFAM:PF03435"
FT                   /protein_id="ACX74112.1"
FT                   /translation="MARALIIGCGAVATVAIKKCCTCSEVFSEICIASRHRENCEKLAQ
FT                   ELRPNTKTVITTAAVDADKAENVSALIREYKPDLVMNIALPYQDLAIMDACLECGVNYM
FT                   DTANYEPENIDDPEWRKVYDKRCKEKGFSAYFDYSWQWAYKEKFEKAGLTALLGSGFDP
FT                   GVSQAYCAYALKHQFDTIEEIDILDCNGGDHGYKFATNFNPEINLREVSAPGSYWDTDE
FT                   NGKGHWVEIPAMSIKREYNFAQVGKKDMYLLHHEEIESLAQNIPGIKRIRFFMTFGQSY
FT                   LDHMRCLEDVGMLSTQPIKFQGQDIVPIQFLKALLPDPASLGPRTVGKTNIGCIFKGKK
FT                   DGKDKTYYLYNVCDHQECYKELGSQAIAYTTGVPAMCGAMMVLTGKWNKPGVHTVEEFD
FT                   PDPFMEALTKYGLPWNEDFNPVLVD"
FT   gene            577048..578946
FT                   /locus_tag="Fisuc_0501"
FT   CDS_pept        577048..578946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0501"
FT                   /product="arginine decarboxylase"
FT                   /note="TIGRFAM: arginine decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; KEGG: mxa:MXAN_2742 arginine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74113"
FT                   /inference="protein motif:TFAM:TIGR01273"
FT                   /protein_id="ACX74113.1"
FT                   /translation="MKKWRIDDSRDLYNVKGWGVSYFDINDKGHATVSPIKNGGPSIDL
FT                   YELVQELSLRDVSTPVLLRFPDILDSRIEKIHECFTKATTEYGYKGGHYSIFPIKVNQQ
FT                   RAVLEEVVSHGSKFNIGLEAGSKPELHAVLANMENPDALIICNGYKDEDFIELALLAQK
FT                   MGKKIFIVVEKMNELHLVVDLSRRIGVRPNIGIRIKLASSGSGKWEESGGYHSKFGLNS
FT                   SELLEALDYIKEEKMEDCMKLIHFHLGSQITNIRHIKNGLREVSQFYVQIRKMGMGLEF
FT                   VDVGGGLGVDYDGTRSSNASSVNYSIQEYANDVVYAMFEACENADVPHPNIIAESGRAL
FT                   SAHHSILVFNVLETAGQAFFDESVHEISDDAPEALKDLYGIYKSLSPKNLLESWHDAMQ
FT                   INDDTLSGFKMGDVDLQTRAMSERLFWSIARKVDLLARDLRHPPYELSELPRLLAEKYF
FT                   CNFSLFQSLPDSWGVDQVFPIMPIQRLDEEPTIETTIQDVTCDSDGKIDMFVRGGEVAR
FT                   TIPLHPIKKDEPYFIAVYLVGAYQEILGDLHNLFGDTNAVHIVCNDKGGYDIDKVIDGE
FT                   SVEDVLDYVNFSDKALVRNMENWVTRSVKEGKITLQEGKEFLNIYRSGLYGYTYLE"
FT   gene            579064..579930
FT                   /locus_tag="Fisuc_0502"
FT   CDS_pept        579064..579930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0502"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   aci:ACIAD0074 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74114"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX74114.1"
FT                   /translation="MIKNNYKIAVLLATYNGGKYIWEQLESLFQQSCKQFHLYVRDDGS
FT                   SDDTMKIVEQFHGMFPDRVTILKDSQKHRGAAKSFMYLLENVDSEYYMFCDQDDIWMLE
FT                   KIEKTLARMKEIEKAVANAPKEVMGGTAEKNVPILVATDLGVVDEQLNLLSESFNKDLK
FT                   IDVFRKHPELISVRHVVTGCTMMFNRAAKLAALPMSPRATMHDEWVALCVHFKGGVISI
FT                   LDDATILYRQHTSNTLGADQARKGFFARAIARAGQKQFFQVAKLLHKDFGLSYLKFLMY
FT                   KILYSWF"
FT   gene            579951..580634
FT                   /locus_tag="Fisuc_0503"
FT   CDS_pept        579951..580634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0503"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tbd:Tbd_1875 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74115"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX74115.1"
FT                   /translation="MATYNGAKYIKEQLDSIIPQLREDDELIVSDDASKDNTLKIVESY
FT                   NDPRIKIFHNENHGVAHNFENAMREATGDLIYFADQDDVWLPGKLDKMEKFLTEGGYDT
FT                   ILCNCSLVDANLNVIKERHYDEKWPMKKSLLRNIINNCWLGACMCFTKQVKDACMPFPP
FT                   KVVAHDLWVSYYAQKHFKCGYQDEVLQLYRRHENTVSFTGGKSTNSLYFRIAYRAYLAW
FT                   HILWR"
FT   gene            580644..581585
FT                   /locus_tag="Fisuc_0504"
FT   CDS_pept        580644..581585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0504"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gsu:GSU0631 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74116"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX74116.1"
FT                   /translation="MKICITLATYNGEKYLAQMLDSLVAQTKQADVIIAVDDGSKDSTC
FT                   EILERYKDKLPLEITKFEKNRGHRASFSTALEKASKLLADDDLIFLADQDDIWLPNKLE
FT                   VMSQKIDDNSMIFGDAEIIDGDGVVTDSSWRKKACIVEHLSQQALLTGYTNVTGCMVAF
FT                   KARLLKTVLPIPQDVPVHDQWITLCATAENGYRAIADKVIQYRIHGNNAIGEGNKTWSE
FT                   KLQTNLQWAKAVRGSSVFEKLPDESRRFLDKFVQFLELRFSHAFLSPLWFVWIVRNARN
FT                   IYPQVHSAPKMIARILFSFVGVSTAKKFFNKK"
FT   gene            581593..582423
FT                   /locus_tag="Fisuc_0505"
FT   CDS_pept        581593..582423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0505"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; Zinc ribbon NADH
FT                   pyrophosphatase; KEGG: sat:SYN_00716 NTP
FT                   pyrophosphohydrolase containing a Zn-finger N"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74117"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACX74117.1"
FT                   /translation="MIHEIAPHKLDNEFKDITPKPTDYLIIFNGEQTLFKKAGDNYEIP
FT                   RVSEFPQCECHYLISIDSDAYFLCNSNLPEIPEGYEFRGNRTFRTLESHLERLGGATSA
FT                   HIAKWESLNKFCGKCGCLMMRGLKERSMICPSCKNTVYPKISPVVIVAVHNGNELLMAR
FT                   NLDNPDKTRMFLISGFVEIGESLEQAVKREVLEEAGVRVKNIKYFGSQPWPFSESLISG
FT                   YTAELDGDPTIHMQEAELACATWVKREDIPEYDTSVSISSCLIENFRSGYTIKE"
FT   gene            complement(582460..583086)
FT                   /locus_tag="Fisuc_0506"
FT   CDS_pept        complement(582460..583086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74118"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74118.1"
FT                   /translation="MQNLKFKSVCGVVALVCLVSTNIAWSEGGSKRGFFDSFVNFFTPS
FT                   GSVQGEGPIFDELKGVETQIDKIEVQYSRERRPGNKTRYRKQLDSLRNVRDSLITVIEK
FT                   MPSGVNVAQSSAALSSAAQSSSSVLLNTAGSSASKPILSAAVPASSAANVVCSRDTVFV
FT                   HDTLVVRDTVVVHDTLYVVLANKPEAASKASPNKAKKKAEKASEK"
FT   gene            583158..583233
FT                   /locus_tag="Fisuc_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            583158..583233
FT                   /locus_tag="Fisuc_R0007"
FT                   /product="tRNA-Gly"
FT   gene            complement(583267..584061)
FT                   /locus_tag="Fisuc_0507"
FT   CDS_pept        complement(583267..584061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpa:BPP2922 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74119"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74119.1"
FT                   /translation="MRIRLSCVVAICFLAVSAALAANVAVQTYEAQSSCNYYDSYINVD
FT                   YPVGDSSVVEPLKEWMDSTLYCNGKIGVGENPIAGCFDKCNVKYAMLREDFDFWEIEDF
FT                   SGGYDSIWVIYKSQTPSTITYEVQTNGYNFGAAHGWFDHPVYVLLKGHAKPLTYEDIFT
FT                   TTRAEMIEYLSYLARVEPSNQRDCGVRWTIEEIDRVYPSADGIVFLWHTYAVNCGACGN
FT                   VEFVLPYERFHGMFRPEFEKIMKEIKWRYGWNVNFGVPMYWE"
FT   gene            complement(584137..585105)
FT                   /locus_tag="Fisuc_0508"
FT   CDS_pept        complement(584137..585105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0508"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: maq:Maqu_3261 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74120"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACX74120.1"
FT                   /translation="MDKFETEIYLRYKQIIQSSVALAPKECMPETRHVHMADLLDRYDA
FT                   FCFDGYGTLYNRGSFVYPGAMDWFQMLRRVGKHLRLVTNAASDIDEVLARDADKRGFDF
FT                   STEETISSGCLLRKLVERLRRVECADGNAAKPLELREVYYIGRETGRNVLKACGITAVA
FT                   MDAEPAEPIVAISSAKDTPETYARAVKILQRPGAILLVLNSDAWAPKIPDENGVTVRES
FT                   VSGALSERLRRDSICDANGGEGCKTYYLGKPFPQIWERVKASLPSGSRVLMIGDTLGTD
FT                   VFGAKVAGFDSALVVGRNVPAAELEADESALGIRPDYYLEP"
FT   gene            complement(585111..585755)
FT                   /locus_tag="Fisuc_0509"
FT   CDS_pept        complement(585111..585755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74121"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74121.1"
FT                   /translation="MAENEEELKSITGEESLSSFMELVQKLKDEPWTSRLNDILDAFED
FT                   FLTIRPEPPQSWQDNYAASGKKFDYYQIVLPEDFQDPYEDDLGNINRLRGEFARVPSTM
FT                   ALEHELVSRNYFIFENGHAEPIPAPRPILMLESKDRADDEEPQEGDITWDCCISIFADG
FT                   SYVAYNLDHDDEEELGEDFKVVFEKHIDTLSKLQLVIPVEGRDYGILRSDA"
FT   gene            complement(585869..586771)
FT                   /locus_tag="Fisuc_0510"
FT   CDS_pept        complement(585869..586771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0510"
FT                   /product="Aspartoacylase"
FT                   /EC_number="3.5.1.15"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: similar to
FT                   aspartoacylase (aminocyclase) 3 ; K01437 aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74122"
FT                   /inference="protein motif:PRIAM:3.5.1.15"
FT                   /protein_id="ACX74122.1"
FT                   /translation="MINTIVIAGGTHGNERTGVSLVEKWKAHPECYNTLCKSATVDVVL
FT                   ANPEAVRLNRRYCDHDLNRAFAQTCLDMSVEPAQYEFRRARELNKIYGPKGENTRTDLI
FT                   LDVHNTGSNMGYCLILSTRDPFTMKASAVLTQEFEDAWIYYQPEERSASPYFGTVAKAD
FT                   VCIEIGPQQHGTLNAAIFERSEKLVKRYLELAEEWNRGELQKRAPIKVEVYTQLRDLGY
FT                   PKPQGGGAIQAMIHPELDGHDYRELRQGDKLFRTFDGKDILFDGEPDGRSVYPIFINEP
FT                   AYYEKDIAMSLTVKTVEEW"
FT   gene            586832..588865
FT                   /locus_tag="Fisuc_0511"
FT   CDS_pept        586832..588865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0511"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: swp:swp_4846 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74123"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACX74123.1"
FT                   /translation="MRIIRKKSPYIVSSLLNIAFFTIFSNMIQNFLNKIKDLLAPYKNI
FT                   AYISLAVWCTHIVLRILLLFRNNPYGFPFVSKPDWYIFHAITLDFLWICNSLVVFMIIG
FT                   AAFQAATKKRVTAAKTLTIIYAVFHSILLIATIFDHELMRFLGCHLSFGLANTYKDVSS
FT                   FRMFWDYSANDNSIPFIQFFMFALVIPITYFLYKLYLRKFTSVKKFSIFMVIFYVISYL
FT                   FINVIWTGHGRLKKLRPVVSTVYRELFEIQKKTEFSDGELLAYGKMYQELWQRLEGDSL
FT                   WEFSSAKESNGLPLYRIPKQELLQSEQLKQQRSLKPNFILILMESERGLNVGCLNPNLK
FT                   PSPTPFIDSIAANSRLWERMHTSGLPTTGGVLTTHLGISDHSTLSAATDLVQQNLPSFA
FT                   STLTDSGYTTHYMSAADPAWDNLGVWMSKWYTAQHYDRSREDDSTFIDHAISFIRDTLG
FT                   SQEKPFLATLMTRSNHYPFNFAAGMTEEQKQKPLTERINYTMAYADRQVSRLIHAIENK
FT                   DWYQNTYVIIMADHGFPLGENGSSTMTGYAFSNATWIPFLIHGKGIEPARDTATASQMD
FT                   IAPTILELAGIAVPNIFMGHNLLRGHGEGYSLGAYTGVKAIGLDSYRLISKPSTEEKWL
FT                   FAEGDTRQDKEVSKEHEDVVKRLRGKLDSLVKLADYSLEKGL"
FT   gene            complement(588862..590787)
FT                   /locus_tag="Fisuc_0512"
FT   CDS_pept        complement(588862..590787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0512"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: tau:Tola_1274 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74124"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACX74124.1"
FT                   /translation="MLRYYWFFFALILALGRFAQLCALYMMDTPLGGPLVSNFNRFLWY
FT                   ALYSEIGLVMAVALVFWGVSKIVRGKGYTVVKVVSLVLAFLYLVLSATNDEIMRWISQR
FT                   LTLSYIRTYIFAFTDTGLVSTIFAGSAFHFVLSALIVVAFMVALILYVKKYDLAEASSL
FT                   PFDKKSAGAVALIFVLAVVGCTSHLWFNPSSRRWDRIRPVAYTLVENVFETFEMSDPGE
FT                   HYREGIIALGGNPDQKYPFWKEAKDEKASMEFFKAKPMEERPDIIVLTIESLRGWALDM
FT                   RIEESCNRFRNLCKLARGGAYYPNTHSVGFPSIEGLLGIMQGVFSFPQGIFLNSYPNTK
FT                   MRSISEILSEAGYYTEVLIGSEPNFDNSLVWFQKWFDFYEYNAENENDVALAKRFVELY
FT                   RERPADKPLFFHWMSRSMHTTFDLPPDMGPKPEDLDEAYLKATAYMDSSLGIILDEVEN
FT                   GTRARNTLFVLTGDHSLLNGKQSLLTEKLGQIFDGFTWVSLIFNGPGIEPAVIENPVSQ
FT                   ADLAPSLLGYLDISASNHFMGVDLLGKGMPAVGAFPPVFSFRFGDMAMRRDSLTYLLPQ
FT                   CTISDSVMVFKSYLKPTWNTSSLVAGYGTGMPFAMDAAMKSEIGRTMQAAAIAWRYIVY
FT                   SNLLMP"
FT   gene            complement(590797..593406)
FT                   /locus_tag="Fisuc_0513"
FT   CDS_pept        complement(590797..593406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0513"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: mxa:MXAN_0441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74125"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ACX74125.1"
FT                   /translation="MTTKKTFVERFSNWYIPLICRHQYKALTFYLLLAVLLSVLILYKP
FT                   GLKLDADLSHLLPEDTPSVKALQESFTRFGSTDRFTIAIQSEDMNLVLALQDSIAAYIH
FT                   NNWQGDFVSTQVDNNNQFFKDNALLYLPVKHLENIRDNLDDLQLELGRKNGPLVVDLLS
FT                   DPSGDSLQENAPKKERVWFDANLPQELGLPEEAVGAFDAFFKKDKKDSVKVAGNATEWN
FT                   PKSTIPDSLKSRLIGSPQPDSTGKILFNGIVNAKLIKPSTDYEFVTHILARTDTLLQHF
FT                   RSKTYSSPMRFAVDGTYEGLKEVDEVANDSVFSFGISLVLIIFLTMFFFRSVKGPILVT
FT                   LSVLYACIPTLAFTALFYGKLNPFTVFVASIILGIGIDYSIHILGTSQKLMHQFASLEE
FT                   VLEAAQRRMLKPFILASFTTVAAFLTLLAAHFRGFYEFGVVASMGVIFSMLTSVLVLPV
FT                   FIKCMGGIPAAPQNSLLPNSWDDAKITKFFKVLACIGFVLGAVSLYYAQDVDFEHNLKN
FT                   LRRVQSAKVVKPRGISTKVTRATNKAVTSTPAAVMGSTPEQLDKLYDTLMVRLHVEHDS
FT                   TLGSFLTLKSFVPPADSQEKRLEVIEEIRDLVEARVFDRSEGEDSVNVATLRKLAQVEK
FT                   TFTAEDVPAWTIDLLREKDGSYGKIGFIYGDFPSWDAKALHRFQERYAHWNFDGEELRT
FT                   FSSQFILSDVIESVKQDSFRLALVIILVIFGTLVISFRKPKYFLAGCISFGMGTLLTLG
FT                   LLGCLTHFFEFGKISIYNVIVIPMALGIGIDSTIHFVTSWTSKSNKDMTLRQLFDTTGR
FT                   NVMASSTTTIAGFVGFLFTTHRGLKGIGDLACISIAMFLITSVIFSMYLCGSWLKKK"
FT   gene            complement(593430..595334)
FT                   /locus_tag="Fisuc_0514"
FT   CDS_pept        complement(593430..595334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0514"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: vch:VCA0802 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74126"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACX74126.1"
FT                   /translation="MLVLFYTLPDPLGLSLTELFEGKIFWQVLMAFGTILFVSAIFAFL
FT                   KAPRALAIFFGFYFVLATADYEVFRFSHQRLSFSFLRTYFHFSNITDATTIGTLGGDLK
FT                   GTILYISLALAGVVASIVFCVVYTMRKRAARGVLTGLFLSPEKHARKVPVVFISVGAAF
FT                   LLLPLIFFACGVRGDLYLPITHTHINLRMTLGKYTLTAPVLHIAVQETFEFFYDNEKIT
FT                   DEIRKDMESFLPENMVANRSNVEDFPVYRSAAKHEYRAKQPYNIVFIMGESFKGRIFNR
FT                   MLEGDTTLAPNLWNLATGKMFTNGGGGLWFKNGYSGGYPTVRGTMATYLGFPSHPNRDL
FT                   PSFYSSNHFTGIPEYLKNYHKFYITVSNPIFDHTLPFVERFYKNNWSFPQNVTDGTIID
FT                   SVGVDMVISHLPKLPTDSSWFIAFNTITSHIPFFEYPDDFAPKPDDAMARYYNAIRYTD
FT                   KQLGRFFEKLSSRPDFERTVIVVLGDHDTPVDSVDYAVPQPLGVSVSRIFMGIFSPDSN
FT                   LFNGLTVREDVASQLDMGPTVMDLAQVREPNHFWGYDLLTEERPAEQPSLFFSQNAYFL
FT                   GFRDHVLTGGLDNEEVYSDIDGSFKEVKDAVSLTWKKRAVSTSKVLRSLLRNDNMEPR"
FT   gene            595582..598122
FT                   /locus_tag="Fisuc_0515"
FT   CDS_pept        595582..598122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0515"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: dps:DP2281 DNA topoisomerase IV subunit A;
FT                   PFAM: DNA gyrase/topoisomerase IV subunit A; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74127"
FT                   /inference="protein motif:PRIAM:5.99.1.3"
FT                   /protein_id="ACX74127.1"
FT                   /translation="MNQETPDTTLGLSNVNHLERLYDGWFLDYASYVILDRAVPYFEDG
FT                   LKPVQRRILHSMFENHDGRYQKVATIVGRTMAYHPHGDASIGDALVGLGQKNLLIDTQG
FT                   NWGNPYTGDRAAAPRYIEGRLTPFAVDVVFNPETTEWIPSYDGRSEEPVTLPVKFPLLL
FT                   AQGVDGIAVGLSTSILPHNFRELCEASIACLRGKKFTLYPDFFTGGIIDVSDYNDGQRG
FT                   GKVKVRAKIEKVDNKTLAIREIPYGTTTVSLIESIVKANDKGKIKIKHVDDNTSQGVEI
FT                   LVHLQPGTDPQVAIDALYAFTDCEKSLSPCTCVIIDKHPKFVGVSDILKLNTEHTVKLL
FT                   EWELANELKHLEDKWHMTTLEKIFIEKEVYEVIKKAKDREQIIRLVREGLTPYLKRLHR
FT                   QTVTDEEIGKLIEIPIRRISHYDREKADQLLQELEENIAKCKYNQEHIIDYAVNHFKNI
FT                   LKKYGEGKERRTQIAEFGKVNAVHVALANQKLYVNRKEGFVGTGMKKEEYLFDVSEYDD
FT                   LIVFKADGSFKVVKVSDKDFVGKDIILVEKFNKDDERHIYNVIHQDGKDGYAYIKRFNV
FT                   GGVTRDKDYYMGKNKPGSKILYMSSNMNGEAEVVEVILKPRPRIKLNFEVDFSEVEVKG
FT                   RGAIGNIVSKYPVKTVKRLRKGVSTLGARVLYFDAPSGIVSTQKKGDCLGEFGENDKLL
FT                   IIKQDGSARVHTMADPILVGSNIKYLHKYDPAQVFTVLYFEGSNFNYMVKRFNLEGCPM
FT                   TTEFSVVSDHKDTKLIELFATDDARELMEYQVGREVQKEELDLTEIAEVKGYKALGSKF
FT                   TAKKIKRVSRISPADPFSDGSGESEGSNEDPSLF"
FT   gene            complement(598201..598842)
FT                   /locus_tag="Fisuc_0516"
FT   CDS_pept        complement(598201..598842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74128"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74128.1"
FT                   /translation="MKRFVFLFCLVVFCSQAFCEKEWAGGFFGIDASFWEKKRIDDRVF
FT                   SRDDMIFSIESGQSILKKLSLNSEFGVHFISDRRDTSHLEYRVSVINSLVTLGFLPYIL
FT                   MHGDGHYEDEIPMKIFLGTLFLMNPTVEFFFWKGWVPVSVSAGYKMDWFAFSPGHKFYF
FT                   RPHADLNINLMLLRVSASYAYVATNTYDIKRGPRFYLKVYFGWLNRNFNE"
FT   gene            complement(598868..599557)
FT                   /locus_tag="Fisuc_0517"
FT   CDS_pept        complement(598868..599557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0517"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: gsu:GSU1775 cell division ATP-binding protein
FT                   FtsE; TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74129"
FT                   /inference="protein motif:TFAM:TIGR02673"
FT                   /protein_id="ACX74129.1"
FT                   /translation="MIHFTHVTKSYEANWKALNNVTFRINKGEFVFLTGHSGAGKSTVL
FT                   KLIYMDERPDEQRGGQVMVKFSDNILYDSKNTPDDRIQALRRKMGIIFQDFKLLPDRNV
FT                   FENVALALRIVGTPSNKINAAVFDALALVGISQKRFAMPYTLSGGEQQRVAIARAMVHN
FT                   PYLLLADEPTGNLDPKNAEEVFCIFKEINARGTTILMATHNPDFYLNSPFRRLELSHGE
FT                   LLNRDIL"
FT   gene            complement(599559..600842)
FT                   /locus_tag="Fisuc_0518"
FT   CDS_pept        complement(599559..600842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0518"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: eic:NT01EI_0698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74130"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACX74130.1"
FT                   /translation="MISNRIASLVFALSVGCFAEPVLMEGIAAVVDGKPIMRSEFMNNL
FT                   YRFQDTPEAASMTEQQQKEAVLNRMIEEKVLLSRIDRDSIVISENEVDQRVTSHLQSIA
FT                   ASQKIDMATLEKAVRAQLGLSMIQYREQLGKQIRSHMEISRVRQLHVGTIHPTKKEVDV
FT                   FYKDYKDSLPRQFNCVLLSHIQLPIKPDSMIVDSVKHVAEALIDSLNLGIKFELLAQRH
FT                   SQDSTAAKGGDLGYFKRGLLDPAFEKAIERLKNGHYASTPVKTDLGWHIARVLGRKEDG
FT                   VRSAQILLRTIPTAKDSAAVLALADSLRNNIKSKDEFAKAAKKFSEDKSSNFQGGLLGW
FT                   FQRNEMEPAYVDPVANLNVGEISEPVMIDGAYHLFRLDDSRQVRELTLEEDYGKIELMA
FT                   ATHLENEKLQKLIQKWRKEVLVEIRMTE"
FT   gene            complement(600842..601696)
FT                   /locus_tag="Fisuc_0519"
FT   CDS_pept        complement(600842..601696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_3712 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74131"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74131.1"
FT                   /translation="MEGFKYSLGLEFAKFVAMKSLIRILLVFSLVLMAGCKTKDPVIVT
FT                   VGDSKLHQSELYTYAPDWDSWGDRERILFLQHWIEEELVYQQAVKAGALKDSVLIRMIE
FT                   RTKRKIVADYFMQTFLDTMIVSDVEKIDFYHKNQNLYLNGKTSVSGAILTFADWKSAVL
FT                   YYKEFKNTKFESIPPNHRLVKRMREFDGVDMTPDPCMIPSIRRAVVGRITPMKVCDGAA
FT                   KIAVVTNRLDSADARPLDEVIEDVSMQAWMEHQNVVLKRLKDEWKTGIPIITKINVFSE
FT                   KEK"
FT   gene            complement(601683..605729)
FT                   /locus_tag="Fisuc_0520"
FT   CDS_pept        complement(601683..605729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0520"
FT                   /product="helicase-associated domain protein"
FT                   /note="PFAM: helicase-associated domain protein; protein of
FT                   unknown function DUF1605; helicase domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein; KEGG:
FT                   mmw:Mmwyl1_2519 ATP-dependent helicase HrpA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74132"
FT                   /inference="protein motif:PFAM:PF04408"
FT                   /protein_id="ACX74132.1"
FT                   /translation="MQLTDLKIEYPELPVVEHREEFFDLLEKHQVIIVKADTGSGKSTQ
FT                   LPKFLLEWFIAKTRDEGRETREAAAHTSKGEARAHTSEHEVRLFKIGVTEPRRLAAISI
FT                   ADRLREELKDEELVSTKIRFWEQGTNEAPIKVMTDGILLQEFRKDRLFRQYNAIMIDEA
FT                   HERSLNIDILLGIFKTVLSRRPDFKLIVASATLDAKLFEEFYDNSCVMEAEGRTYPVDV
FT                   EYYFSDYGSASALRDISGKGDSGLIEEARDAILDLETRHRDHLLCFLPTERDIQDLMGE
FT                   LAHELDAATFDVLPLYGRMSPDEQRRIFKHTGKTRVVLATNIAETSLTIPGIAYVVDTG
FT                   MARISRYNAQARIQGLPVEEISKASARQRTGRAGRVKPGVCIRLYSPENFEKRDEFTEP
FT                   EIRRSNLANVVLQLRSLGLELENFPFLQSPPHSAFRGAYKTLFELGALTADNSSGYVTK
FT                   LGRDMTRLPMDVSLSAVLLRARDLGVLQPALIVCSALSIQDPRVVPNDEPERTRIRQLH
FT                   RKFCGHKSDFLVYVSMWNAFCTDWDGKSWNKLRKFCDKNSMHFLRLREWVDLYEQFSRI
FT                   LEVKFENKVCPFDSFHRDNLHIALLSGFLGGIAHRDIENGCYRLVSGRETHVFPGSDLY
FT                   AKSVEWLFSAEVRETSRTFLTKAAEIKPEWILQVAEPFCTRRWFEPTWNKERGFVEAVE
FT                   EVSFRGLVISRGHRVDYARVNPEDCAQIFWREAVVMGEVARPFDFMKHNDHVVENLHAL
FT                   EARKRQFGLAPSEDALVEYYTRIAGNVNSIKTLKSYIYEHTDQFLKFDEKYWLDLLDER
FT                   TLAGSLQTKDERGFGTKLSDFLPKQSQTSKARSADPIAPTLGGSIEHFRIGERVVTGEM
FT                   VFDATRDCDGITLSLPYDLLTEISPAKFAMSIQQWREWMIESVIREMPKSVKKLLEAKR
FT                   TAIDDEFFAALDNFPHKAPLLLLYEVLSNTKEIRSGANGASIDVPTVNPDKENHLRLHL
FT                   VVSKPGFPEPYKLEISPEWGSYRMFLAVRPALVTFGIDFPLEGMRFGWRLGQSALMVSD
FT                   ESRFWQAFRKRVEGARLEKALHLETAAHPAPQKTSFSEEKKQLIADRLNLLEMGGVFAD
FT                   NFETALKIWVAKSLAADSLDATRCVRFTGLEFSRGKKIRDFKSLAANTRSEDEEIRLSL
FT                   VRATYESGLIGAEAFVKNWNLLKDFSVEMRSGNGKSTVKNKTIIAIHTAYQKELILFER
FT                   LRVLAELFNIEFPFGASHNSSASRDSSASLENTELSANTLREYFRPYLKARYLKDHELK
FT                   NARELLGKIDRTPTDDPEFAELYLQAKALLEDFEILKYKRKGNDAEDIVEEDALARLKG
FT                   RFGRL"
FT   gene            complement(605743..605883)
FT                   /locus_tag="Fisuc_0521"
FT   CDS_pept        complement(605743..605883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74133"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74133.1"
FT                   /translation="MEEKKTYREVMPGELPCEVPECDGVMVVDPDNSYKLTCDKCGHIK
FT                   E"
FT   gene            605945..606430
FT                   /locus_tag="Fisuc_0522"
FT   CDS_pept        605945..606430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0522"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   cbs:COXBURSA331_A1417 thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74134"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACX74134.1"
FT                   /translation="MENAKTVKQSQVETRDIVHPSDVNAYNFVFGGHLTSLLDKAACIA
FT                   ACTHSRRKVTTVSIDNVRFFKPATVGTILTIKASVNRAFNTSMEIGVKVLGIDPQVSWQ
FT                   PQIICHAYMTFVALDENGRPTPIPSIIPETEDEIRRYEEAGIRREAKKKLATALENK"
FT   gene            606567..607901
FT                   /locus_tag="Fisuc_0523"
FT   CDS_pept        606567..607901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0523"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: hch:HCH_06824
FT                   Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74135"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACX74135.1"
FT                   /translation="MKQIDVKDRSLISLSWPLILTFAVSMIQPMMDSWFLSRTSETAAA
FT                   GVGAMLPILGALFTALHAFSQSGASIVSQYIGAKQNSHASSTQTMVLFGSILLGIALTL
FT                   IIYPLSGNIPQWMGLTEAPAEYATQFLSVVSFGFAFRALQTILTALIATHGLTIWNFVG
FT                   NTLTIATNAALNVVFLEGLFGLPKMGVHGVALATALSWLISSGILWLVLKFKVHHHSKI
FT                   RDWKRTRVLLPDWIRIGLPAAAEPISFQLFQVFITAMVVYIGTTAMTARVFAGNFAALS
FT                   VILGVGLGSGNQILVAHLVGAHDYVKANRRVHQTLAVGITSGFLLSVAVALLGEHLLRL
FT                   YTDNPEVLRLGKICLWCDVAVQPFKAVNFIVTTSLRAAGDSKFPALVGSGMMWTLGLAT
FT                   SLILAFVVGLDLPGLWLGMAADEFYRSFANIWRWKSGRWKSKAVV"
FT   gene            complement(607958..608464)
FT                   /locus_tag="Fisuc_0524"
FT   CDS_pept        complement(607958..608464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74136"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74136.1"
FT                   /translation="MIEKAFLFVPFLLVSCSDDSGDDKLTSNVFADSAESCSYVASEAS
FT                   CQNTLAKSVLEDSIEIIKQKDGSFVLRKTLIAECPEVASVSKVSIESKSDTLFVSIDYD
FT                   YVPADTIITVNDSLGTVDTTYLPIRRRCVCFSNFEINIPVKFSDAKYLTFGKSEGTVFN
FT                   IVYRE"
FT   gene            608645..610813
FT                   /locus_tag="Fisuc_0525"
FT   CDS_pept        608645..610813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0525"
FT                   /product="DNA primase"
FT                   /note="KEGG: gbm:Gbem_3695 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: DNA primase catalytic core domain; zinc
FT                   finger CHC2-family protein; TOPRIM domain protein; SMART:
FT                   zinc finger CHC2-family protein; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74137"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ACX74137.1"
FT                   /translation="MPFYSDEIIQELKNQADIALVIQQFLPLKKSGVNKYVGVCPFHDD
FT                   HSPSMSVNSTLGIYKCFACGAGGDVFKFIQEHEKLDFKGAVEWVANFVGFALPNLGNNV
FT                   NTEVLEERTMVRKLNELACEWFEQQLTLSPKALEYLNKRHVSPETRKQFHIGYAPTGRE
FT                   GLIGYAARNGFSPRDCVKAGLAVEKENGGIADKFRDRLMIAIQNLSGVVVAFGGRDLSD
FT                   PASHNGIKLAKYMNSPETALYSKRDILFGLNHSRNAIMKENAVIIVEGYFDLISLYQSG
FT                   VQNVVAASGTALTENHASILARYAKTAYLVFDGDAAGQNATRRSLEIVLPKGLSPKVFA
FT                   LSRPDGTKIDPDNFVNEQGPDAFRRALRTAEDWLSYLGRTMPNNSPEDRAAFITQAKTL
FT                   IKSIENPELRNQYLKLVSERYSTTRSLAGIKVAHPKREKAPTAEQPAAPQVSVPWELLS
FT                   PIEVRFANLLFRNPTLLDRAAEYFDMDFAASGIQIFDSPLIDEFIQSILAQYAETGAFS
FT                   PRVLYESLSPQLQLFLEQLPDETWKTPNEILEFYDTLAVLTLNLCDRYKKLIPLDSEAG
FT                   MRLRMQLNKFTQGIQTISRKRKISAITPDVFAEQIIQSKTPLIELYTEINELAMNGGNA
FT                   AQFSQQVPAQFAAPGAQFNDAPAVQSAFQQPEMPPEMEAPPPFDGDEQFASSEPPEEAP
FT                   YDPNEEPYVPDDEPYVPDDDFGAMDDFG"
FT   gene            610846..611595
FT                   /locus_tag="Fisuc_0526"
FT   CDS_pept        610846..611595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0526"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="KEGG: rfr:Rfer_1861 FeS assembly ATPase SufC;
FT                   TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74138"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ACX74138.1"
FT                   /translation="MLSIKNLKASIEDGTQILKGINLEVKPGEVHAIMGPNGSGKSTLS
FT                   KVIAGHPAYHVDGGSVELDGKNLLEMEINERANSGLFISTQYPTEIPGVNNVEFLKMAL
FT                   NSKRAFLGQPEMSDEDFKKLCEEKMDLLEMDERYRERGVNDGMSGGEKKRNEILQMAIL
FT                   DPKVSFLDETDSGLDIDALRIVANGINHIMSPEKAVILVTHYQRLLDYIKPTYVHVLRH
FT                   GKIILSGGPELALKLEDQGYDWIEEAK"
FT   gene            611611..612645
FT                   /locus_tag="Fisuc_0527"
FT   CDS_pept        611611..612645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0527"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: ara:Arad_2536 FeS
FT                   assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74139"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ACX74139.1"
FT                   /translation="MNAEFIQNLPTAEQAIARLRELGMPRRNNELWSFFPVAKIPTPEF
FT                   MDTDFAAAPTTFPAAAPANQETDFAALLPIANQARPMIREIVPGAAEMAMLKCNNDFGH
FT                   TVLDIGKGAKVSLEILDNKVTHDIAAERFDINVGENADVEIFFANPACDLPLRFRHFNI
FT                   NQAAGANVRFSSICKDTAIGRVSVECHLKGEGANFDYRSLHVLDGEASQHSRLTIYHEA
FT                   PRTTSTQLARNLLSGSARVSYDGSVIVGYDCTGVNSSQLVNTILLSEDASVSVKPVLKI
FT                   YHDDVECTHGNTVGELDAEQMFYLVSRGIPKKAAQEMLMRSFAQETFLPLPDSPAKKRL
FT                   MAEI"
FT   gene            612856..613704
FT                   /locus_tag="Fisuc_0528"
FT   CDS_pept        612856..613704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74140"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74140.1"
FT                   /translation="MKKFILIIALGALNAFAIDCLRSTLDIFIKDYPTSTEPTILNYKN
FT                   FLVDSIYSQQGYSSQPQKYENYKYYYTGSYVDSARVYTKKKGSDDWEIKVQDHESLNYG
FT                   ALDVKITITQEGDFKIIRKEGKGNPPIIEYVVYEDKDSVFFVKSYVEKNGEKTNSYLYN
FT                   YYISNDTLYQFNDGRNTFIVQDSTNESKCYEYGSSTESDFQVSYEYEMRGDTLTATEKK
FT                   HGDNQRTITIFLVPSEKYSSTVSSPITSATRRLKLNPAKSRDFDLLGRPAKNKHIAIFK
FT                   H"
FT   gene            complement(614050..614178)
FT                   /locus_tag="Fisuc_0529"
FT   CDS_pept        complement(614050..614178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74141"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74141.1"
FT                   /translation="MGYWEENQYTDEDPKRTAFEEFVVNFVVAFSGSALLFLVNIM"
FT   gene            complement(614340..616244)
FT                   /locus_tag="Fisuc_0530"
FT   CDS_pept        complement(614340..616244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0530"
FT                   /product="sulfate transporter"
FT                   /note="TIGRFAM: sulfate transporter; PFAM: sulphate
FT                   transporter; Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease; KEGG:
FT                   dvu:DVU0279 sulfate permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74142"
FT                   /inference="protein motif:TFAM:TIGR00815"
FT                   /protein_id="ACX74142.1"
FT                   /translation="MSDIHAKESVKQYLTGVVSTITPEIVRSIKRGYTRKDFTSDLMSG
FT                   LIVGILALPLAIAFAIASGVGPEQGLYTAIIAGFIISLLGGSRFQIGGPTGAFIVIVYG
FT                   IVSQYGYDGLASATLLAGIFLVIFGLAKFGAIIKFIPYPVTVGFTAGIAIIIALGQVPN
FT                   FFGLTFAGADPADAVGKIKLYVSSFGSMNVYSVIVGVVALAVCILWPKITTKVPGSLIA
FT                   IIVATVMVKVLGWDDPVNGHGVVTIGMKNHIPSGFPVPHLPNISLEMMQKVFQPALTIA
FT                   MLGAIESLLSAVVADGMTSTKHRSNTELFGQGVANILSPIFGGIPATGAIARTATNIRN
FT                   GAVSPISGLVHAVVLLLIMLVLGKYAEMIPMAALAAVLFQVAFNMCGYRSVIKMFKAPK
FT                   SDVTVMLVAFFLTVIIDLTVAIEVGVLLAAVLFIKRMSDVAEVEAVSSALKDDDDEAAR
FT                   NTLGRQVPKGVLVYELAGSLFFGAVDKFKETMNRISEKPKILILRMRSVSSIDAAGINM
FT                   IEDLLKRCKSEGTQLLLSGVHAQPVVALTRAGVLAQLGEENALGNIDAALNRARELLGL
FT                   PIVDASQEEQKAPTVSWEKSLDKPWMPEESNAAVAEETPEVIAERMMDEPIKKIEDRK"
FT   gene            complement(616334..616675)
FT                   /locus_tag="Fisuc_0531"
FT   CDS_pept        complement(616334..616675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74143"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74143.1"
FT                   /translation="MGLFDNRFASKNAAMSRAFSIDSEKDKQKRNTAREPAAPKMGICD
FT                   KCHKEALLRSYRSREMSVSDGAASFGTVVKHLCEDCAPRSKRFEDANVPAMDKKQVKNL
FT                   MRSAKKGLL"
FT   gene            complement(616678..617268)
FT                   /locus_tag="Fisuc_0532"
FT   CDS_pept        complement(616678..617268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74144"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74144.1"
FT                   /translation="MENRVLVIGDELFGPKGEAANRFVEAVLCREPSRPIQFSVNVPVA
FT                   VSLSQIKARLSSDVIGKNAGRIIMGLGLRELNHGGTDGASIALLYETLVNELVNKTQSR
FT                   LFLLTIPPEMFPIAVSEVEYLNTMIREFCAANAPRTKLLDFAEFAETFKEKQMERGKFG
FT                   RSLFMEDGSATSLCCMLLALYLQDKLVEDLKEM"
FT   gene            complement(617278..617826)
FT                   /locus_tag="Fisuc_0533"
FT   CDS_pept        complement(617278..617826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wsu:WS1004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74145"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74145.1"
FT                   /translation="MQKMADERKKNLTSPIARWIDANRETAGFTESLRKLLMYACVEWI
FT                   RRGTSALLTPEEALSKIVCCGLSEFPVGEWAENPENYTEEIADFCEKAKILPLPATLQG
FT                   EIPSLLDLRGVKCPLNSVRSRIVMSGYPAGRTLKIWLDEGSPIENVPGSLIADGHKVLS
FT                   REKKGNYWEISVVKSDSKV"
FT   gene            617981..619534
FT                   /locus_tag="Fisuc_0534"
FT   CDS_pept        617981..619534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0534"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mxa:MXAN_5740 glycosyl transferase, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74146"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX74146.1"
FT                   /translation="MSTILLYAMFVVYVIAGVGLVIYGFSCYYSIYLFLKNSRKTRLSD
FT                   RKAILKYYREHSLADLPQVTTQLPVFNEANCVERLLEAVCAIDYPKDKHEIQVLDDSTD
FT                   ECYEVTKKKVAELAARGYDIKLIHRTNRKDFKAGALKEGMAVAKGEFLAIFDADFVPEK
FT                   DFLLKTVPYLVMDPQVGLVQGRWGHLNRTESGLTLAQSIGIDGHFVIEQSARSWGKLFM
FT                   NFNGTAGVWRKDAIYGGGGWEGDTLTEDMDLSYRSQLAGWKMKFVFDVIVPAELPNDIN
FT                   AFKAQQFRWAKGSIQTAIKILPKVLRSKVPLRVKIGAILHTTHYSIHPCMLFTALCAWP
FT                   LLAFFEPVGHLPTWAYTVGFAFIFLAAIAPSVLYFVAQRCSGYTGWKIRLLSLPILMAL
FT                   GVGIAVSNSRAVFAAVLGTKGSFVRTPKSGGAKKKAKSHYAQKFPWMALIELLVGVYCI
FT                   FGLLEYINASKYIIGPFLALYAIGFLSVSVLSFMHYISNIFEVRKAIKCSECVEEQATN
FT                   "
FT   gene            complement(619626..619904)
FT                   /locus_tag="Fisuc_0535"
FT   CDS_pept        complement(619626..619904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74147"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74147.1"
FT                   /translation="MNLALPKTSRHGFTLLEMLVAITVAAILTTVSLNVYSMFHHGVVA
FT                   TSDNYVHFATGKAQELRCRTRFVRGLPPCDTTSGESRASRGAIRARF"
FT   gene            complement(619929..620234)
FT                   /locus_tag="Fisuc_0536"
FT   CDS_pept        complement(619929..620234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74148"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74148.1"
FT                   /translation="MTCSRQGFTLPEVCVALTVFLVGTTALLGGWNFFNREVAGERKRL
FT                   EEFYDVLSSMESLVANRPDCADSLSVRLIRVPGCSHLAWAVVASEHYSLKRLVRCR"
FT   gene            complement(620231..621196)
FT                   /locus_tag="Fisuc_0537"
FT   CDS_pept        complement(620231..621196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74149"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74149.1"
FT                   /translation="MRSKCGNVLPLVLGLLLVLSILVTAMLKMPGALRRNVSLVAKETQ
FT                   EMYFAESAVLAKLYGFPDGYFAELPIVESRILGPWTEWRVRNKFQFMLGLEYGRFSTSE
FT                   WARCAVVLEQNLHERILHSVGLKNLSGNRRFFKLDSSDGLSAERMMAINVSAGDLTLDL
FT                   GESRAFENSQSSRKSIRSFMANVEGDVKIRGNVHFDTLRIYATGSVSVQGNVTADFAEI
FT                   FGLASVTVSGNVSMAGALLSKQNIEISDRAQMNFPSVALAVGYRENRLSLLEKSVFEGL
FT                   AIAPSGTVERDSSAKHLDSTQALLPFCMDTRNVVFSRRRL"
FT   gene            complement(621177..622376)
FT                   /locus_tag="Fisuc_0538"
FT   CDS_pept        complement(621177..622376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74150"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74150.1"
FT                   /translation="MFFWNKRIAPVAARMMTWEVTTAFDGMPTETELRKRFDEDFRDVF
FT                   NAGFADGECAVFFWQLVSFNASDGRKHRYLVAVADEPLENYRKTFDRCLPKQIALYAIA
FT                   DKILRGERDGENCLKCDEACAECGGECAEVAENGNLLFVAFWGHCLYILVFMEGRLCHW
FT                   SEEYGYGEVFDDACRERVARFKEFLKADELFAKMNDVGEFGEGSPKVDELFQVAVRDPF
FT                   WRGKDLDECDSMKPCERRRWIMSVVALFVFCACVFAMSGGSLNLLCAKFYDDEFHNSFV
FT                   NVAPVELSQPAARDLEMLAWAEGHRDLLPAKWTLGRAGFVDGVASRSWRTSRGTCDSSE
FT                   FSLLGIVGGRVALVKTSAGETKTLSVGDSLSRYRVKRIGMNDVVMRCGRKEVRYALKMR
FT                   "
FT   gene            complement(622422..624233)
FT                   /locus_tag="Fisuc_0539"
FT   CDS_pept        complement(622422..624233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0539"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein; NolW
FT                   domain protein; KEGG: pha:PSHAa2716 type IV pilus
FT                   biogenesis protein PilQ (cytoplasmic ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74151"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ACX74151.1"
FT                   /translation="MLLRILGISLLTLLLSSSVAGARSVEKPKSVRTSPGAVTLDFVDV
FT                   SLAEVARTLSLAYGTSILTDDAGDVRVTFHLEGVSLFEGLTSLCASHGLDLVLEGRVYH
FT                   IRRARVQNGTIALTDSGVVIDVKNMNVREFVKEFGLNTGVNVLADYDVDGVVSGNLRRM
FT                   VPEMAFRVLMESNGFKVRGERGCLRVSRAKTGNALNGSSDGAEVSVERAGDLYSVDLQS
FT                   VSLKAVLKAIAEEAGLNLAVYGDLNETVQMSFKDVSLPELLASLFRGSAFTFRLDSSSL
FT                   WVSEEGAKALADVRVFSLKHVSPEKAMAQLSKFMKGSELNVSEYREQNALVLGGSPRAI
FT                   ARAEELLKMVDVPQMQVTLACVIVEFRKGRSFAIGVRSGATRNVGERDIQARGFFDFLG
FT                   KDISKSGAFGKIGILPDRFELELSSMEENNEAKVLARPRVTTLNGNKAELNVTNTVYYL
FT                   VSQVSADGYPITDYRSFNDGISLELTPTMTQDGLITLSVSPEIKTAGRSTGDGPRDISS
FT                   RNMKTTVVLRDGETLCLGGLIRKNKTEVRSAVPFLGSIPILGRLFSYTSEEEDESELAI
FT                   FITPSVDVRRENGSASLQTRGKIDGKL"
FT   gene            624594..625493
FT                   /locus_tag="Fisuc_0540"
FT   CDS_pept        624594..625493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74152"
FT                   /inference="similar to AA sequence:KEGG:TVAG_028600"
FT                   /protein_id="ACX74152.1"
FT                   /translation="MKSKFIAILTISTLAFFANASAKSDASDMKSVKAEITAEISEEVQ
FT                   AEVVDKVDFKKMREESKEARKGLLDKIKLDKDEAKVEAPKPPKPEIEPPTPKTEEELQA
FT                   EREAHKAELEAKKAEREAKKAEEEAKRAEREETLKAEREAKKAEMEAKRAEEEAKRAER
FT                   EEARKAEREAKKAEMEAKKAELEAQRAEREEALKAEREARKAEMEAKRAELEAQRAERE
FT                   EALKAEREAKKAEMEAKRAELEAQRAEREEALKAEREARKAEIEAKKAEIEAQRAEREA
FT                   LKAEKETVKEEKTVAQVE"
FT   gene            625571..626017
FT                   /locus_tag="Fisuc_0541"
FT   CDS_pept        625571..626017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74153"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74153.1"
FT                   /translation="MKNANKIIALLTSSVFVAVPFAQPESDIATPAGRSEISQDAPDLG
FT                   QKQKEDWQRLREERKQARQQILSDIKANAHAEIKDIQQDINLQKTSNNALNENKNIAKE
FT                   NIINKEKGQIEKNRDEWEKQHPENPPFDVPRPNEHVPFPKGPKF"
FT   gene            complement(626098..627489)
FT                   /locus_tag="Fisuc_0542"
FT   CDS_pept        complement(626098..627489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: EGF-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74154"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74154.1"
FT                   /translation="MKKNHYVKAMSLAVVAATSFAVVACDNDTLSGPDFNAGNGGTSSA
FT                   VEQPAPQSSSSEVAVSSSSDIPLSSQCAALLPECGYTVEQLCEMGQTYFCVSSSSFSQK
FT                   PLSSSSVESCPNGHWTTHCNGIWTQEPVCCEEKTVETCRHITDYDGMTEKGNCVDQNGR
FT                   TAVDCVTGANYECQNNNWQPVTCLNVKPDECKPGMGGCGYRLCQPDGIKEIADCGSGAI
FT                   YVCNGETWEVKATDNNKLCAQGKLEYCEACFKEGVFNGHYKCEGGKWREYGMGDEICEH
FT                   ITDVKCDDNRPGCGFCGVEKRFAFDCETGEEFVCDQGYWSLNVKDCEPGMDGCAVPVCN
FT                   ALAPECGYSEYELCNKYGIDRYCNDKWLSEPCDGSESSRDLRIVESNNSFRIENYICVN
FT                   NKWVERFKYYECGEEVDCDRPSLRCQASPVIGTACENEGESSDIDGCVFFCSAGQFIYA
FT                   PPPTW"
FT   gene            complement(627507..628397)
FT                   /locus_tag="Fisuc_0543"
FT   CDS_pept        complement(627507..628397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: serine-rich protein C30B4.01c precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74155"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74155.1"
FT                   /translation="MKKCSLYELITLTVIFSLSFFAGCSSDKIAGTSEETNEFAYKVSS
FT                   SSEEESSSSSAKSSSSSKAVSSSSRTISSSSVKSSSSSYMESSNSSLPGATSSSTGVDV
FT                   NNNSSSSEKPNEGTAKPDISLDYYLKLLNQASDSFDSGVMATAIDLNTDGDPQNPNPPM
FT                   ATEFDTPWPHKIVKQNVELLQEYFPMAFSMYPQIISAIKNETLDENCGLYTFNVYSDGL
FT                   TAAYIVAEITENTIKVIDIPAGECKALSLTQMSRFLFYYCGELNSHAETEHIKVDVDLS
FT                   DNCPNLKTGNEWVKL"
FT   gene            complement(628384..629217)
FT                   /locus_tag="Fisuc_0544"
FT   CDS_pept        complement(628384..629217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0544"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74156"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX74156.1"
FT                   /translation="MKPIVEYTDFRMFMRDYYEERKRCSAFSWREFSKNAGFSSPSYMK
FT                   VVCDGKSKLSRIGVERTGAAMGLAGFEMDYFRAMVKFGQAETEESKKAAYEEMLSIAKT
FT                   YKVRTIEGEFFKYYDTWHNSVVRELAPIMPGATPGEMAKMCYPQISAAEVRDSLDFLTK
FT                   SGLLKKDEDNFVQSETSIRGTTDATRLAMRNMHRQMSRLATSALELPKEIRNFSGVTMG
FT                   LSRESFHKIECVLNECRRQIIAIAAEEKNIEQVYRLNLQLFPLTKNVKENENEEV"
FT   gene            complement(629360..630049)
FT                   /locus_tag="Fisuc_0545"
FT   CDS_pept        complement(629360..630049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0545"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: dal:Dalk_4759 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74157"
FT                   /inference="protein motif:TFAM:TIGR00035"
FT                   /protein_id="ACX74157.1"
FT                   /translation="MKTVGLIGGMSWESTITYYEILNKEIVSALGGFHSAKILMNSVDF
FT                   AELEANMSNGNWDGNAAILADAAKRLECAGADFIVIATNTMHKLVPQIEREIHIPILHI
FT                   ADAAATSVIRDGFTKVALLGTKFTMTQDFIKDRLKGAGLEVIVPDAPDIEIVNNVIFNE
FT                   LCLGKVLDASRAEYQRIIESLKERGAECVILGCTEIGMLISAEDSVLPVYDTTIIHAKE
FT                   AARQSLG"
FT   gene            complement(630174..630317)
FT                   /locus_tag="Fisuc_0546"
FT   CDS_pept        complement(630174..630317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74158"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74158.1"
FT                   /translation="MDAIQVARERLKLIKLLAQNGRDMAMGKVISQKDVFKSLDREIAT
FT                   LP"
FT   gene            630566..632410
FT                   /locus_tag="Fisuc_0547"
FT   CDS_pept        630566..632410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0547"
FT                   /product="DNA topoisomerase type IIA subunit B region 2
FT                   domain protein"
FT                   /note="PFAM: DNA topoisomerase type IIA subunit B region 2
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   SMART: DNA topoisomerase II; ATP-binding region ATPase
FT                   domain protein; KEGG: dps:DP2280 DNA topoisomerase IV
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74159"
FT                   /inference="protein motif:PFAM:PF00204"
FT                   /protein_id="ACX74159.1"
FT                   /translation="MAATKYTEDSIKSLEWHEHIRLRPGMYIGKLGDGQSPDDGIYVLV
FT                   KEIIDNSIDEFVMGAGKKIEINIDDHAARVRDYGRGIPLGKVIDCVSKINTGGKYDSEA
FT                   FQKSVGLNGVGTKAVNALSTKFIVKSYRDGRMKQAEFSRGVLVQDYKECATNEKNGTEI
FT                   YFEPDADIFKNYRFLPAYMEEKVWNYAYLNNGLQLVMNDKVYTSPNGLLDLLNKHVDDS
FT                   IRYPVIHFKGKDIECAFTHGNQYGEHYYSFVNGQHTTQGGTHQQAFREGLVKGARDHFK
FT                   KDLDPQDVRNCVIGAISVRIQEPVFESQTKTKLGSTTVAPGGAQLRSWVVDYVASEFDN
FT                   FLHKNPETEKALLNRITQNERERKEIAGIKKLANERAKKANLHNRKLRDCKIHLTDVKN
FT                   ALNRESMIFITEGDSASGSITKARNVQTQAVFSLRGKPLNSFGMTKKVVYENEEFNLLQ
FT                   HALDIENGLENLRYDKVIIATDADVDGMHIRLLLMTFFLQFFPELVEQKHLYILQTPLF
FT                   RVRNKQVTKYCYDEAERDKAAKEIGKTGLEITRFKGLGEISPEEFGQFINEDMRLETVS
FT                   IPPDASLGKMLEYYMGNNTPMRQEHIVLNLRAEAVEEL"
FT   gene            complement(632548..633873)
FT                   /locus_tag="Fisuc_0548"
FT   CDS_pept        complement(632548..633873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0548"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; SMART: CBS domain containing
FT                   protein; KEGG: pca:Pcar_2212 CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74160"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACX74160.1"
FT                   /translation="MGDTNTIAIVLLVFFLLVSASFTLIKAVFAAIYAKREDHDRTDRE
FT                   AKIAKIVENRGYNETVSIGRIFSDVGIGVFGFYLFSNAPWQWTHDFWLLGIMAYMLCAC
FT                   AVIYIVTIFFPNLIGNLKPDTLSVVLVPLYRLIRMPFVPVGRVCHTIYLKLLNALGYDA
FT                   KLSFLPEERRDAVQADLSDSSLSEGEGLEKEERQMILNIFDFVETPVREIMTPRVDMCA
FT                   IDVDTSLEDLVKVLNNERHSRLPVYKETVDNIVGILSNRDFLEWYTEHHEEPFDLMKLV
FT                   MPPVYVPYHKKIDDLLTELRKTGNQLAIVVDEYGGTAGLVTLEDILEEIVGEIRDEDDM
FT                   DEDEDVQKLKDGRYILDPLMTLSDLEYELDVELKPPENSHVETLSGLIQATLGIIPSPG
FT                   AEVKIQGYTFRVLRMDGTRMEKVMMILPAGVKGPKTQTLHKV"
FT   gene            complement(633866..634351)
FT                   /locus_tag="Fisuc_0549"
FT   CDS_pept        complement(633866..634351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0549"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   pmu:PM1045 putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74161"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACX74161.1"
FT                   /translation="MPDPASKKKDYTIDFLCEGNIESFPWKDKFEAMARKLLAEEGTEN
FT                   NVNIVLCTDEFVREMNKNYRGLDKVTDVLSFEWHEEIPGEEEMLGEIYIARDQVKRQAP
FT                   QYGNSFFAEMKRVIVHGLLHLSGYDHIKAADRKVMRARECEFLGLDPYKDKESMENG"
FT   gene            complement(634351..634641)
FT                   /locus_tag="Fisuc_0550"
FT   CDS_pept        complement(634351..634641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_0606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74162"
FT                   /inference="similar to AA sequence:KEGG:DvMF_0606"
FT                   /protein_id="ACX74162.1"
FT                   /translation="MSAEVEDLTVEYTDEETGEVVIKELSKEVLSKGAWPTVMFFYQDR
FT                   DPKTGEFSEPKVSLRRYRKMQGTFKPQGKFKITGKAQAEAIINVLKKWYNI"
FT   gene            complement(634703..635470)
FT                   /locus_tag="Fisuc_0551"
FT   CDS_pept        complement(634703..635470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0551"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_2734 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74163"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX74163.1"
FT                   /translation="MSAIDIKDLSFGYGKSPVLTDVNLSIDENDFVAIIGPNGGGKSTL
FT                   MRLMVGLLKPTSGTVRVFGEKVPTKKVAIGYVPQNTNKNIDFPITVGECVATGKTGLSP
FT                   KSDEVKAALERVHIGTFLDRRLGELSGGERQRVLIARSLVCNPKILFLDEPSNNIDVAG
FT                   IEALYSMLAEFSETMTIVIVTHDLMALSHKVKSVVCVNHSVHYHEGANLTEEMLHSTYG
FT                   CEVDLIAHGVPHRVLGSHDHTHGGCCEHHHHEV"
FT   gene            complement(635470..636342)
FT                   /locus_tag="Fisuc_0552"
FT   CDS_pept        complement(635470..636342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0552"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   dvu:DVU1343 cation ABC transporter, periplasmc-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74164"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACX74164.1"
FT                   /translation="MRRIARLLFLLVIVPAILWAGEDRITVAVSLQPYATLVKMLGGDR
FT                   VNVVTLLPPGADPHNFEPKPAVIKAFSVAQVYFTDGSGLDKTWMPRFLGANKNVQVIDV
FT                   SKGIEWMKLEHEEHGAHGHHHEEMDPHIWTSPTRMRFLAQNIFQELKRLDPKHTIEYVN
FT                   RASSVQDELALVERQLNEAVISMPKDRRSFIVFHPTYGYLAKDFKLKQYTIEVNGKEPK
FT                   PRDLANLVKLGRKNNIKNVFVQPQFSKRAAETIAKDLGAVVVETDPLAADFIGNTEKFV
FT                   KALREASKK"
FT   gene            complement(636342..637136)
FT                   /locus_tag="Fisuc_0553"
FT   CDS_pept        complement(636342..637136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0553"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: dvm:DvMF_0599 HAD-superfamily hydrolase,
FT                   subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74165"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACX74165.1"
FT                   /translation="MKKPIKAVVFDLDGTLYLSGRPYPGAVETVNRVAKHVPVYYLSNN
FT                   TSKSPVFYENRLKVMGLPLADDSIISALYLSLDAIHERKIKNVFFFANPEVYEWFAAQD
FT                   PSLNLRPSVEETELVLVAYHNSFDYRELCELSFRVQRGIPFWVTHTDFVCPDERGPVPD
FT                   IGSFMALLKTAYGVEPEMSFGKPNPAMLSGLLKLYRPEEILFVGDRLYTDFELAKRSGC
FT                   RFVLPLCGESKMADVEKLDVKPEFIVNNVSEIDFNAFLEGKK"
FT   gene            637172..637897
FT                   /locus_tag="Fisuc_0554"
FT   CDS_pept        637172..637897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0554"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   aph:APH_0794 16S ribosomal RNA methyltransferase RsmE"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74166"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACX74166.1"
FT                   /translation="MKTPDSRFYCPLISVGTIILDENESSHAVRVCRAVNGEILQLCDG
FT                   LGHYADATITKADAKACEVRVDTVEDAPLKRPRLNLGIACLKDDALEEVVFHAAQTETD
FT                   SIIFLRTDYSQEPKNSDLKKTVRRAELKSLVSLKQSKKPWMTRIEGPIEFDKWLKDYQG
FT                   DLILCDIDGERKLDINEGAAENSNATPVTLLVGPEGGFSPREIEAIKTFKNGKVHLLNL
FT                   GNTRLRARTAAIIALGKVL"
FT   gene            complement(637937..641761)
FT                   /locus_tag="Fisuc_0555"
FT   CDS_pept        complement(637937..641761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0555"
FT                   /product="cell wall/surface repeat protein"
FT                   /note="TIGRFAM: cell wall/surface repeat protein; PFAM:
FT                   GLUG domain protein; KEGG: tdn:Suden_1008 GLUG"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74167"
FT                   /inference="protein motif:TFAM:TIGR02543"
FT                   /protein_id="ACX74167.1"
FT                   /translation="MKRFLFLALAAVAYAARTIVPSEPTLDSDGCYAISTAEELYGYAK
FT                   IVNESEVKTECGKLTKDIVVNEKNVKDTAFWTPIESFHGTFDGQNHTISGLICTDTSAY
FT                   NVGMFGYVGAEIRERLSGEPWEVLKKAVVKNLGLINVSFVGKGAVGGIAGGAWGAVITN
FT                   CYVDGAVYSNLYTGGLVYTGGLVGNSGPLEITNSRNLAYVGGYYAGGLVGNYDGSEPLT
FT                   IVNSYNAGTISSNGTYGAFVGFSVGKLIISNSFNVGEKSLSREKLLVVGHHGRDTLIVD
FT                   NYFYVDSWASSKYGINIDEKELKDGTLAQRLRNYNKDGIDGSVWGQWLGVDDIPQLSGK
FT                   FVVGSSTLNIVAKTPSVVDGCYQIGTAEELYGFGFIANASLYSETPVCGKLTKDIVVNK
FT                   NVLAKDTLNGNGGNFIPWFAVTNFAGTFDGAGHTISGLYFNDSLLRDAMGLFATVYAPD
FT                   ESRQVKIENVGIEDSYFYIFGSVGSLVGSVKTKSKTVTIKNCHGSSYLYGGAGGLVGSH
FT                   AGDSLGIEDSYFDGVLESNNSSIGGLMSWATGKFYIVNSYSVADLKVNPDFMGSYNGSL
FT                   VGTNNIESNSYVVNSYGADPLSKKESREAYPLVGLASAGSIEFINSFSEKTGTEIFCFN
FT                   CGSEKDFGIIQVDADKFTDGSVAKLLHDYGESGINGLLWGQHVGYDAYPVFSGEVTTNF
FT                   ETSELKLVTFPEDTVKYSNSYIEGIKLSLPTPVRKDYVFKGWYASDDFSGEPVKSVPAD
FT                   AKGTQTFYAKWWHYPQMVGDCYELGDEGELILFSSFVDSLYRYSVNRPTLCTKLTNDIV
FT                   LNKNVLVDGKLDSSKISSFVQWFPLNNYQGVFDGNGHTISGLYGYKGFFGKIESGNLII
FT                   KNLGIVDSYISGGNDVGGFVGEMYGKSLVIANSYFEGVVKGYENVGGLIGYTDRSQTLV
FT                   LSSYHRGSVEGYADVGGLVGLSYEIYGSLMMMYSYNEGSVSSIWERSVGGLIGGEMTDF
FT                   LHLSNSYNVATVTSKTSVVGGLVGSLKNDSAFIYNSYNLGNVSGTDSIGGVCGFKKDYV
FT                   DLHLDAAYYLEGLQEGLGGTAVAAEDFANKNLLKRLQSYRDHGLDGSAWTQSDSDKYPV
FT                   LNNKVSDKFIDSLLAVVTAPRSSSSSSVSSSSSSSSATEVSSSSAPQSSSSSVKSSSSS
FT                   VPQSSSSSVKSSSSSVKSSSSSNVPKSSSSGKVSIASAFVASPVAIRTQGRMVEISGLR
FT                   VGDSYALMDLQGRLLQHGQANGSTVMLQVAKSGRYLLRVAGRNRIVNVR"
FT   gene            complement(641844..643028)
FT                   /locus_tag="Fisuc_0556"
FT   CDS_pept        complement(641844..643028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0556"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: pmu:PM1053 phosphoribosylglycinamide
FT                   formyltransferase 2; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74168"
FT                   /inference="protein motif:TFAM:TIGR01142"
FT                   /protein_id="ACX74168.1"
FT                   /translation="MAEIGTPLSSTATKVLFCGSGELGKEVIIEMMRLGVEVIAVDRYA
FT                   NAPGMQVAHRSYVINMLDGKELRAVIEKEKPDYIVPEVEAIATDTLVELEKEGYNVIPT
FT                   AKATKLTMNREGIRRLAAEELGLKTSPYRFADNYEDFKAAVKEIGIPCVVKPVMSSSGH
FT                   GQSVIKTEADIENSWNISQTGGRTGAASRVIVEGFVPFDYEITLLTVRHVGGTSFLEPI
FT                   GHHQVGGDYQESWQPQPMKPELLEQAKVIAKKVTDALGGRGIFGVELFVCKDEVLFSEV
FT                   SPRPHDTGMVTLISQDLSEFALHARAILGLPIPNIAFHGPSASKAIVVDGNSDHVKFSG
FT                   LEDVLAEPDTGLRLFGKPELKGHRRMGVLLARRDTVEEAKAAVMAMREKVKVTL"
FT   gene            complement(643124..644842)
FT                   /locus_tag="Fisuc_0557"
FT   CDS_pept        complement(643124..644842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_03469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74169"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74169.1"
FT                   /translation="MKKYLLPLFGMAVYFTACEDELTPVSGNSAETVTAFSDLSECNKD
FT                   IIGKFVYVSDSVKVYACTDNGWAAVTGAAVSGSNGSDGHDGANGKDGTNGKDGKNGTDG
FT                   KNGKDGTDGKDGADGKDGKSCTMTAFKDGSGFDVICDGKPIGSVKNGTNGKDGAPGTNG
FT                   KDGTPGTNGKDGTNGKDGTSCSVAKAADSDDVVVTCGDKSVTIHNGVDGKQGEPGTPGT
FT                   KGADGTNGSNGADGVSCKIASDENGIVQIQCGEGKDATSTKLYKAFCGSKPFDPEKSFC
FT                   MADGSVYPLCNGKTYVPDTDECVDGVVVQFIKSCGDELYNVHKKFCVNDKTYDLCGGES
FT                   YDIELEECVEGKKTVVYEKCGDEKIKIADADHLFCAEFENKTTEEKTYQVYKYTTIEVK
FT                   DKDYSETWMAENVNYETENSRCYENKESNCEIYGRLYSLAAAKNACPNGWRLPSLADWE
FT                   GLIYAVNELDQNSDAKNNAGEVLKSSEMWGDAGNGSDLFGFTALPGGVNFFDEGTYHEG
FT                   GLGSDAYFWSSRNSGKCVHLVHKSYLQYIVREASIEDFSTNSQLSVRCIKNAESN"
FT   gene            complement(644925..646892)
FT                   /locus_tag="Fisuc_0558"
FT   CDS_pept        complement(644925..646892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74170"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74170.1"
FT                   /translation="MKEKFFTVAGAVLFLILVACGGTKPESNEVNATSGNDLSPSRESA
FT                   DSIADSGMHMMDSRDGQIYKIVTIGSQTWMSENLNYEMANSTCYDGFVSNCYKNGRLYA
FT                   WKAALESCPVEWHLPTQSDWHVLFSALGGKVSAAIALKTSKNWGGGSRGHKTATNASGF
FT                   SALLSGYEKSNGEFSSDGETFFWSSDYYNDSLAYFMGLRSESDEAFLLGENKDNKYSVR
FT                   CLKDDSLTKNEFIGKRTLPFGETSNQFVDIRDGNVYKMVTYGKQTWMAEDLAYKAEHDD
FT                   ECLRYYCGDYGSYTWKIAMGDAYSQKNRTRPVRGICPIGWHLPDTTEWNTLISVLGGKT
FT                   AACDIFESKADNGFSMVANGNSLLCTEDGVESVCAESAFYWSSDKGNEDDYALGMRLDV
FT                   YVNGKKEVGIDSGLKREDMPIRCVKDEATQESASNDGLQTKVERIGKTAVMDSVVDSRD
FT                   GQTYKTTKIGNQVWMAENLNYKTAGSFCYHDSTQYCELYGRFYTWASAMDSVGAFSVNG
FT                   KGCGSGTSCPPNFPVRGVCPEGFHLPTLAEWKSLVATAGGEYDAASKLMSAKKLEKGFD
FT                   WVEEGTDDYGFSAYPSCNMERDGTSGFCNPPVNYWSSIESSTDEAYHMSLQNSNNYNGK
FT                   GIQFSGIEKHHAFTIRCVKD"
FT   gene            complement(646907..650155)
FT                   /locus_tag="Fisuc_0559"
FT   CDS_pept        complement(646907..650155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74171"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74171.1"
FT                   /translation="MSKRVAFLFVASTLVLALLAACGSTRNSSVDAENPLRDGVKYGTM
FT                   TDNRDGQIYKIVKIGSQIWMAENLNYETKDRAVDMDLDLLGPRAHKFHRSLRKQKPKKA
FT                   SRKSEVSYCYDDHPINCLRYGRLYPWSSAVEVCPAGWHLPDTTEWNTLFATVGGAESAG
FT                   MALKFTDGWRNDGNGTDEYGFSALPVGFLYELDPQSNPNEYASFWSSTDVPKKGAYGMF
FT                   LNYYSNGAKLGMDSYDVALSVRCLKGSKLSSSSSATATSSSSSQETSVGADSSVATETG
FT                   TMVDSRDGQTYKTLKVGSWTWMAENLKYKTSDSYCFGDKDENCEKYGRLYKLDAMKDTS
FT                   SLNLKQNVCPVGWHLPSQWEWDRLIDAVGGTLLAGKRLKKLMGWFGDSAKADDGVGFSV
FT                   LPAGIRFSDGGYSRDGLYSLFWTSDEYGVFFNYYSPRIKMMVELSKLGASVRCIKDLAI
FT                   GTLVDHRDGQTYKTVKIGSQNWMAENLRFKSPNSFCYNNADSNCTKYGRLYLWTAALDS
FT                   VRLYKDDDEDCGYCKPCPPKFPLRGVCPKGWHIPTETEWETLFETVKPGTTSGLALKSE
FT                   TGWTRCDYDHRPFERVCRSAGNGYDYFGFSALPAGHWNKDGGKGIGESAMFWSSTGYYK
FT                   SSPNYMSLRADKEYPDFEHCGGDYKNDGMSVRCVEDDAEEENLKSDADSLPSVSSVVAP
FT                   FSSGNFLIDRRDGQTYRTVTIGEQTWMAENLKYKTEFSTCHKDPDSCAKYGRLYEWGEA
FT                   YNACPADWHLPTEEDWNTLFATIGAKYRKYDGFLGAGEKLKSKSGWLGNGNGTDEYGFS
FT                   ALPAGTSNYYSEVIQSPDVHQGVGEKAYFWSVSVNPSFSNAYLIMESGTKRAYFAVGRD
FT                   YDAISVRCVKNKPLQNKTSSATVPVSSVVKDSLVDNRDGQVYKTVKIGSQTWMAQNLNY
FT                   ETNDSRCYKNDYHNCSKYGHFYTWIDAEKACPAGWHLPDTTEWNTLFASVGGRPTASKY
FT                   LKSKSGWKTCKNWCWANGNGSDDYDFSALPVASWGERSEFGSEGEGAVFWTASKEDRNA
FT                   YYIYLVAKYSYTIYFNKNYDNYSRRSVRCVKDSD"
FT   gene            complement(650232..651755)
FT                   /locus_tag="Fisuc_0560"
FT   CDS_pept        complement(650232..651755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74172"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74172.1"
FT                   /translation="MAVAALASAENVSEKPAEKVGYFQIGTDFNFGFNGGPTDPTFAVD
FT                   TAENYGGNWRGLRIPLETARNYEERINPFFTLSFRAGYKDFHFLMEAPLRKDLEAWYNN
FT                   DLKTNFTYKPSELDINVPINAYAKWDNSIGFVQFGRFNPEDLKISKNDIFLGGLPYHDG
FT                   IHWKLNIGIFRYDFLLSSLNAWLFNDVINHETGCPPEGSEAYAQKCTPRGKQVSNQRNR
FT                   TYTENVKNMVFHRLGVDTKKFWIYLVEQSVIGGKSLEFRSFNPFMYWHDNYATGYTSAA
FT                   TSVEFGYKTSNGAKFYSQINMEDIASPVGEDKKMGTNRSIINYMVGYYHELETRNYGKF
FT                   SWRLDVVKTDPAANNSRLPLLKYTGRRNYRSNFREQGDRDYADAYFVDYPIGYRRGGDA
FT                   LDLWFDMNWKTSRRSATLTFAWLRQGDKELYTDYDVALKPENALSGVVETQFVVDALYE
FT                   ETVTDWFKYYVGGGFRVYRNLSHDKREDGSDAWLRSGVKFNFNPVDLKF"
FT   gene            652192..652371
FT                   /locus_tag="Fisuc_0561"
FT   CDS_pept        652192..652371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74173"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74173.1"
FT                   /translation="MFHITQELSGHQKDHPGRETRVIPCVVVGAHSRTRVCVFFLGGVF
FT                   ENFERTRSNFVIAM"
FT   gene            complement(652391..654064)
FT                   /locus_tag="Fisuc_0562"
FT   CDS_pept        complement(652391..654064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0562"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ, 2-layer sandwich domain;
FT                   KEGG: plastid division protein FtsZ (AB032072) ; K03531
FT                   cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74174"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACX74174.1"
FT                   /translation="MSDFANINFEAMSRITGDDTPTRNAKVKVFGVGGAGGNTVNRMKQ
FT                   MNIEGVEYYAINTDAMALDQSLADHKILIGEKSTRNLGAGMDPEMGRKAVEENIDDLKK
FT                   AMMGADLVFVTAGMGGGTGTGAAPIVATVARELGILTVAVVTKPFRFEGNVRNSLAQNG
FT                   VRALREAADTIIVIENKKLLNLIQNTNKSATVDEAFKMADEILGNAVQSICSIMFRHGL
FT                   VHVDFADIRKVMLKGGSALMGTGTAEGEGRGVAAADAALSSPLLEDIDIQGASGVLINV
FT                   SHGENYSLLEHNEAMEHIYDAVGEEGNPNIIVGDITLPELGDKVCITIIATGCGGSNNA
FT                   AAVNYAGIGTAAYQMNQTQAQYQAPAAPVQAATPRPTTNFLALAGRNTAAMPTSAMPAA
FT                   PTVATPAVTQRVVPATAPAAPSYSAQSYTAPQNTYAQPAAARQAAPVNTAAAMFAPASS
FT                   FASPSFDAKASYTEETIAPKSIRETEEMPGAAEADPLSNGHYASTFKQDSRPAQTEQVN
FT                   TIDYSTPAIMRNQKASEDALKDRDVDYDLPAFMRMNSDLY"
FT   gene            complement(654096..655337)
FT                   /locus_tag="Fisuc_0563"
FT   CDS_pept        complement(654096..655337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0563"
FT                   /product="cell division protein FtsA"
FT                   /note="TIGRFAM: cell division protein FtsA; PFAM: cell
FT                   division protein FtsA; KEGG: gsu:GSU3064 cell division
FT                   protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74175"
FT                   /inference="protein motif:TFAM:TIGR01174"
FT                   /protein_id="ACX74175.1"
FT                   /translation="MDDNKQIVKKEDYIFGLDIGASKVNLFVGISEGDSVRVVECGDFP
FT                   LESSDEYDSVVETLQKAVHTLESIAGVDVRDVYVGIAGKHVSSYSYKGLVSLPTNEVRE
FT                   EDIINVQRLASTLPDKAGEIIHIFPGDYTLDDTTGIRNPKGYTGRRLGVEVQVVTSRPN
FT                   ALQDIAKCVNRAGLNVAGFVLEPLAAASAVLSNDERELGVALIDIGAGSADIAVFVKDS
FT                   VRYTASLDIAGNVITSDISKCLKVPVSLSKAEELKKKYGTCSLNNLIEDETFPVPGVGD
FT                   RGEVLCSRKLLAQIITARVAEIFKLLAKDLEKHHLDTVIDGGIVLTGGCCNLAGIEEIA
FT                   TKVFKKPVHIGKPKGMSGIQDAYQNPSYATGIGLLYYANKKHRERKQRDTDTQLLVTVK
FT                   KGMQRLRDIIKTYF"
FT   gene            complement(655330..656151)
FT                   /locus_tag="Fisuc_0564"
FT   CDS_pept        complement(655330..656151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0564"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   FtsQ-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein FtsQ-type; KEGG: dds:Ddes_1116
FT                   polypeptide-transport-associated domain protein FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74176"
FT                   /inference="protein motif:PFAM:PF08478"
FT                   /protein_id="ACX74176.1"
FT                   /translation="MFGRRIGYNERKRRRKRARMRRMRIANAVRWYKRKGWVLTLLLVV
FT                   ATVALWQSRFYLHQINPLELRHLQYIEIEGNRMLSWEDVVQSAQVETGMLMSELDADSV
FT                   KKSLLQIPLIHSAEVESKFPSSLYIKLQEASPILSVLDGGKGTVYSERGLSLPMSMMTA
FT                   LRLPILEKESEGKVKQVAQFLFTMRNEDKPLYDRVSQVGWSEKDRAFEVFFKDAGYRVM
FT                   FPDSNWNRDLFALYDAIGKGFRKDLLCAGEVDMRFHGFAYIKNFDKRCING"
FT   gene            complement(656169..657551)
FT                   /locus_tag="Fisuc_0565"
FT   CDS_pept        complement(656169..657551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0565"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: gem:GM21_0509
FT                   UDP-N-acetylmuramate/alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74177"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACX74177.1"
FT                   /translation="MQINDCKRVRRLHFVGIGGAGMSGIAEVLHENGFVVTGSDMGEGA
FT                   VIDYLKGLGIRIDPKHEAKNVADADLVVYSSAIPFDNPELVEARARRIPVIRRAEMLGE
FT                   LMRLKYTLSIAGTHGKTTTTSIVGAIWEEAGLDPTIIVGGIVKGKCSGAKVGHGDYLIA
FT                   ESDEFDRSFLSMMPSSAIITNIDADHLDTYENIDAIKDAFTQFANKIPFYGQVIVCLDD
FT                   PNVQQILSHLKKPVITYGFTRQAKYRVENLVFVKGYPQFEIVCDVKSLGQFKLQIPGRH
FT                   NVLNATAAVALAVEEGISIEVARKAVAAFEGVKRRFEFIGEKNGVMVFDDYAHHPTEAT
FT                   ATLLGFREAFPDKRIIVAFQPHLFTRTRDQHEAFGSAFSNCDVLLVTDIYPSREKPIEG
FT                   VTGAMVANSAADRGHRDARFIGDVNNLIPVCKELLKPNDVIVLMGAGNIWKLGQTILEK
FT                   SI"
FT   gene            complement(657551..658621)
FT                   /locus_tag="Fisuc_0566"
FT   CDS_pept        complement(657551..658621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0566"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: mxa:MXAN_5604
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: Glycosyltransferase 28 domain; glycosyl
FT                   transferase family 28; UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74178"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ACX74178.1"
FT                   /translation="MKKFLFVCGGTGGHIFPAVAIAESLKKMGVTQITFAGRKDSMEER
FT                   LVAKNWPYEYISAVPLHRGPFLKNLALPFNLTKSLIRAKSVVKKVAPDVVIATGGYVSL
FT                   PIVLAAGSMGIPVYLQEQNAVAGIANKVGARYAKTVFVTSEEAMKGFPIEKTRILGNPI
FT                   RDLPSADSLARPVEFREGRKAVFIVGGSQGAAGINNKIEESIGRIAAHEDISVVWQVGA
FT                   KNVDDINNRLGILPNVAVRGFLDNIYAYMKHADLIISRAGASGLAEILAFGKPSILLPY
FT                   PHATANHQEHNARVVEKAGAALVELDDEPNDLWNKVEALLYDPERLEKMGEAAKTLGMP
FT                   DAADQIAKIILDMERT"
FT   gene            complement(658618..659790)
FT                   /locus_tag="Fisuc_0567"
FT   CDS_pept        complement(658618..659790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0567"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: glo:Glov_0671 cell division protein
FT                   FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74179"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ACX74179.1"
FT                   /translation="MSNTQSSGMNKLLLFVTLALMCFGIAVVYSISAPVAVSKNLSPEY
FT                   FLMKHLYKVVASVIIIGVFYKIDYALWKDSSRVIFGVGALLTFAAIISGGEVKGASRWI
FT                   FGIQPSELMKFGFICWICAKLSNAGDEIKSIKCTIIQPAVPFLISAILLALQPNYSMLL
FT                   MFCALLLTLLIIAGANYKYVLISFLSSLPLLAIALLCKSHTRKRIKAYLANDGSMKESK
FT                   HQLVHSLEALGNGGLLGTGAGMGEQKLGYLPEAHKDVVYAAIGEEYGFVGTFLVLVAFA
FT                   ILFSQGYNIARGATTRFGKYMAVALTTSLFLNFIIHVCVCVGLFPTTGQPLPFLSFGGT
FT                   NLLLSAAFIGILLNISRPTSGRSIREPYMNNTVSFNAGSAMNFGARRSSI"
FT   gene            complement(659811..661196)
FT                   /locus_tag="Fisuc_0568"
FT   CDS_pept        complement(659811..661196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0568"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: pca:Pcar_2206
FT                   UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74180"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACX74180.1"
FT                   /translation="MLKLDLTIGEMLEILETEAVGVPARTLKRKVNLCMDSRESAKGVV
FT                   FWPIKGARFDAHQFVSQMEKDGALMSVVNQTAIDPNFKMYAPVEDTTKALLKLAKGYQR
FT                   LFKLKKVAITGSNGKTTTKEMTKAVLSMKYNTHATKGNFNNHIGVPMTLFQLKHSHEAA
FT                   VVEMGTSGPDEIRPLSLATEPDIAVITNIGASHLERLGDLDGVFNEKINITAGLKENGT
FT                   LIVNADDERLCKVKATKHYKVVTFGVRRGVVKPEKLKWTENLCADFYVGRTHFVLNVPG
FT                   DHNLYDALAAIAVGQALRIPKGDIAKALAGFTSTSMRMEIKNANGFKVISDCYNANPSS
FT                   TKMALQTLGNMRVEGKRIAVLGDMLELGKESGNLHKQIGALVPEMNFDMLLAVGKDAKK
FT                   YVEGAKSRGMKNVQYFETVPEVISMLGEVVAEGDILLVKGSRGMHMEQVVEALLHMVPV
FT                   FKV"
FT   gene            complement(661183..662604)
FT                   /locus_tag="Fisuc_0569"
FT   CDS_pept        complement(661183..662604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0569"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   gme:Gmet_0407 UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74181"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ACX74181.1"
FT                   /translation="MISEGLMQKLSVTGLCDDSRRVKPGNLFFSIPAEGYEAFARSAIA
FT                   AGAVAVVGETMAPEGLTSKWIQVPDVKAARLEAAKIFYKDPFSKLICHAITGTNGKTTS
FT                   AFLMNAMLEAEGRKTALLGTIKNKIGDKSVPASLTTPGLLDLYEFASRAVAEGCTDLVM
FT                   EASSHSLHQGRVAGIRFRSGLFSNLTQDHLDYHKTMDAYFEAKKLLFTKYLAENGVAVI
FT                   NIDDAHGEKLFNALDCRKVAVSRLGKAKADVKPFGEIKSTEDGLEFTLPMIATDKFETP
FT                   LCGDFNVDNLLLVLAWAHALCVPEDAMRKAITTVRVPGRFEKVWSKDGKHVIVDYAHTP
FT                   DALERVLNVARSLCRGKLSTVFGCGGDRDKTKRPIMGGIAERIADKAWLTSDNPRTEKP
FT                   ADIIADVRAGMTTDKFEVVENREEAINRACAELKSGDWLVIAGKGHEDYQIIGKTKHHF
FT                   DDREIAVKAMTDAEA"
FT   gene            complement(662604..664490)
FT                   /locus_tag="Fisuc_0570"
FT   CDS_pept        complement(662604..664490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0570"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: geo:Geob_0774 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase; PASTA domain containing protein; SMART:
FT                   PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74182"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACX74182.1"
FT                   /translation="MNKYSADPLVILKSLVLCMIGVLIFQTFNIQVLNRDVYQERTKST
FT                   VTQTKNLYAERGSIMDRNGVVFAESMRDTNNNLGYSRLFLQGSLASQIVGKVGYNGSGS
FT                   MGMEQIYNDSLRGDEGIRVSIQDAAQREVLSRSTEVVQAKSGLNLVLTIDRNMQEIVEK
FT                   ALKDGVAEFSAKSASAVVVDPYTGEILAMASYPTFDPNSKNQGGDRAGKNEIVSMSYEP
FT                   GSTFKVITAAAALENNAVSPNKIFVNEGRCWQWNPRSEKICDTHVYGDMDMSEAMVQSS
FT                   NIVFAKIASEVGAMGMYRMARAFGIGERAFDNYVGEENGRLLKPAELTRDDRTLKTMGF
FT                   GHAVSVTPIQMVMAYAAIANGGKLMRPQIVKEWRNSNGDVVKKVKPMEIRRAVSERTAA
FT                   TIRKMLYRVVNSGTAKRVASQKLPDVLFGGKTGTAEKYNRETRSYDRNSQVASFIGLAP
FT                   AEDTRYVCLVLVDDPQGKHVGGLTAGPIFRRIMEAIYYHPALSPRAHNLKQVHLGSPCD
FT                   KDFAGMQVSAAKDYAKKHKCPVRFEGKGRRVISERLDAGLVNGKTLLLGDAVASKMPDL
FT                   QGLSLKDALEVMGNIRMNVEYTGKGRVVAQEPKADETLQRGAICKLTLKEKS"
FT   gene            complement(664483..664800)
FT                   /locus_tag="Fisuc_0571"
FT   CDS_pept        complement(664483..664800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74183"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74183.1"
FT                   /translation="MIDNVQNETEKTGKHSVMGFVLMLVAVASLVFMVPVYMQNCVNSL
FT                   YGTLYGLKEKSSLLHREILLKDYEINKLMSMDHLAKFAERTGLGLNDVPVKIMITGESR
FT                   E"
FT   gene            complement(664797..665810)
FT                   /locus_tag="Fisuc_0572"
FT   CDS_pept        complement(664797..665810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0572"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: sat:SYN_01737
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74184"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ACX74184.1"
FT                   /translation="MADNNLRKSVHVNEISEAAVAGVQGREFYHDPVMLKECLEGLNIK
FT                   PNGTYSDCTLGGGGHSYAIAQELNSEGTLHAFDRDDEAVQFATKRLAGVAPKFIVHPVP
FT                   FSELGNEIEPNSLDGVLYDLGISSHQVDDSSRGFTFVGDNPLDLRMDRRENVSAQEWLR
FT                   SVSEDDFAAALRKNADMDRAFKLATRIKEKVGEITTEGRDVLPSDIKAVVEAVFPDKRR
FT                   EANSLLARVFQAIRMEVNGELKQIEDSLRAAVDCLKVGGRLVVMSYHSVEDRCVKETAA
FT                   EFEKACICPENLPVCMCGGNHQRLKKVNRKPILPSADEINRNSRARSAKLRIYERV"
FT   gene            complement(665800..666273)
FT                   /locus_tag="Fisuc_0573"
FT   CDS_pept        complement(665800..666273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0573"
FT                   /product="MraZ domain protein"
FT                   /note="PFAM: MraZ domain; KEGG: tgr:Tgr7_0760 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74185"
FT                   /inference="protein motif:PFAM:PF02381"
FT                   /protein_id="ACX74185.1"
FT                   /translation="MDFTSFIGQAQTAIDGKGRTSFPREFRRQLAESEGKEFVVTRGPD
FT                   RTLRLFVLPEFEKFMADLDSRSDRRQADLVRRGLCPTVVEMDGQNRILLPKILLEYAGL
FT                   KDEVLYVQASGKTLELWNPERYNEKYGLQTNEAIDAFDAAFYGEGLTEGDNGR"
FT   gene            666611..667594
FT                   /locus_tag="Fisuc_0574"
FT   CDS_pept        666611..667594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_3456 flagellar biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74186"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74186.1"
FT                   /translation="MLLRVPAFYDSFHCIAGKCTDTCCIGWEIDIDPASAKRYAKVKGD
FT                   FGEKLRQNIEDGHFKLLPGDRCPFLMRDGLCDMICHIGEDYLCDICREHPRFVEVYGDI
FT                   MEKGIGLCCEEGVRLLLECKGSATSPIAFVEREIDDVPDDIPDDAIEARDAIFEEREHL
FT                   FAILADHSKPLNARLIKLLDYAVETSGIEIKESDISNNIYQSWFGILGKGESYGPAWDN
FT                   AYKELKERGWQTKTIFTDSDGEKIIAYLLFRYYEKSLFDGNSLTKVEFAIYFWIMVQKI
FT                   QGTKIDAIKLLSKQTEYSEEIMEIFEQEFMENPAFSPTNFKRILAE"
FT   gene            667739..668281
FT                   /locus_tag="Fisuc_0575"
FT   CDS_pept        667739..668281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0575"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3484 redoxin domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74187"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74187.1"
FT                   /translation="MFKRLFSLIVFAAVMGFAQFAPEPQVADIKLMMDPKTEKPMIMDF
FT                   STHLSGISDPGILFAHFSNRPLLIYYFSPKCPHCQKHFPEIQNLIKEYESKGLTGIAIG
FT                   LNGGIKKNDIRLFIDQYHAVIPVFQDTDSKFGPAYGTGYIPVVYLVQKDGTFYRYETLN
FT                   EANMNHLRATLNKILKK"
FT   gene            complement(668357..668430)
FT                   /locus_tag="Fisuc_R0008"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(668357..668430)
FT                   /locus_tag="Fisuc_R0008"
FT                   /product="tRNA-Arg"
FT   gene            668650..669540
FT                   /locus_tag="Fisuc_0576"
FT   CDS_pept        668650..669540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0576"
FT                   /product="Methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /EC_number="1.5.1.20"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   cju:C8J_1146 5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74188"
FT                   /inference="protein motif:PRIAM:1.5.1.20"
FT                   /protein_id="ACX74188.1"
FT                   /translation="MKIIDILKQDKMSLSFEVFPPKKETSFENVKAATEAIAKLNPAFM
FT                   SVTYGAGGGVSQYTLEIAKNLKYNFNIPMLAHLTCISSTKETIHQRIEDMKAAGIKNVM
FT                   ALRGDLTPELIANGRGDCDYHHAVELIRELKAADADFCIGAACYPEKHPESPNQAEDIK
FT                   HLKEKVEAGADFLTTQMVFDNNLFFSFLYKLRDAGVNCPVLPGIMPITNANQVERAIKL
FT                   SGSFMPQHFKSLVDKFGSDPEAMKQAGIIYATDQIIDLYANGITNVHVYSMNKPDVAEG
FT                   ILKNVSAILGKNFAG"
FT   gene            complement(669673..671943)
FT                   /locus_tag="Fisuc_0577"
FT   CDS_pept        complement(669673..671943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0577"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; Thrombospondin type
FT                   3 repeat; KEGG: noc:Noc_2532 OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74189"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACX74189.1"
FT                   /translation="MKKLTLILALAQAAVFAQTGLLGGKTGLHQQDANTLGFFHFRLGT
FT                   GGTIATDNWGYTRGALFTDRHGRTQELDVWDARMEKGRIDGALAGNFNFAFGLRDDLDI
FT                   GVSLPIYYDHAKDYSGEAIRAHMGKGGLGDLQFYAKYRTPHWFGPDYMKTAAVVDLTVP
FT                   TGWRGVGIRPRHAWFLDNEGGPTYAYTANSVMLGLTGVVSVNYNKKGVPLVWNSSLGLM
FT                   IGFGDASNTLVYSTGVNLEINDYIQPFLEFSGEMRFGNDAYPFSPITDPMVLTPGINVK
FT                   IPFFNIDFAAGIDIGIGNLVDGYDRKDAMDNCKDFQIKFKGETGYRASYCYVAQPLIAG
FT                   IAKLTWTFGFDGDDDNDGVKNRKDKCPETFPPIVVDEDGCGIDTDEDKVFDGLDKCPDT
FT                   PKGVAVDSVGCPLDTDEDTVPDYKDMCPETPKGVKVDSVGCPLDTDEDTVPDYKDMCPE
FT                   TPKGVKVDSVGCPLDSDKDGVFDGPDKCPDTPEGVAVDADGCPLDTDKDGVPDYRDKCP
FT                   NTLPGIQVNKRGCPLRRKEDLDYLKKGIQFEFDSAKLLKSSYPTLDDIIALLEKIPEVK
FT                   LEVQGHTDIVGTEDYNQKLSEDRAHSVTDYFQSKGIAADRLRAIGFGTRMPLADNVTDE
FT                   GRAKNRRVELIPFGYYTEGDSTVAAPSDSLLNDSTAVPPPTKSDVKPESKPEVKVKLKA
FT                   NAEKKVRSASKAGLKRLKNMRDRAEKAVVEMKSEAAAAAKPAETPKPVETPKPAETAPT
FT                   PAQ"
FT   gene            complement(672342..675845)
FT                   /locus_tag="Fisuc_0578"
FT   CDS_pept        complement(672342..675845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74190"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74190.1"
FT                   /translation="MNKKTIKFGLAVSAMALYFAGCGDDLLYSQDVNQFTTVSSLNDDD
FT                   CSEKTEGSMAFVKSKATMYVCSEGEWVAMNDHEAIQYRCESKELKDKSGFAIVCDGGDT
FT                   IGVVHNGKDGADGKDGTNGKDGADGKNGTNGTNGTNGKDGADGTNGTSGTNGSSGTNGK
FT                   SAYEIAKDNGFTGTEKEWLESLKGEAGKDGTNGTNGKDADMDKIQKDIDSKFSSASAKS
FT                   QSEIDEALKNLSSASAKNQKDVDDALKNLSSATDKFGEDIDNKFSDAYSSWNAELEDKS
FT                   CAIVDTVRDNEKAIITVTIKCGDAETKMEIPFTVVNENLAKVYKKHVVVRFPVQANKET
FT                   KTDDIYEEIWKNLKGGDNAELTVTDLDEKFVPSGKVFMQDLFASANKSFVTIEETNEKA
FT                   VEYKVARLEGDLDITNLTTPVVKLRVKLNLSNNAFGAFGGFGSNATDVIYNAYADLSDA
FT                   SDTVVIDFLTDYKAARVKKLVDDGNGFGVANEQANKDLAHALYLENSEEYPSFEHYAPD
FT                   QIGLAENFNSIVWVMALIDQKDKTPGFNLVYNAFRNVFAENGNFNTAVNTTYAGKEHSM
FT                   FFVDYLALLIDANFFKWNQMQHGDYTAETNVWSGTDAVYYKILQNGFVEAYKLKVEDAK
FT                   VFNDPSGYSSKVYKSDVEGGYFRYFEYIENEQVWYPVTLWAVGVATVEKACDADAVNST
FT                   FFYSFEGLDENAVCVCDNGKCYWQDTENVCLGRNKGDKGSAFFDGEIQEYECAEVECNP
FT                   SASSCVGFELGPVSPNSSNSVASSSSAASGMTPEEQANNPESKLYLGECSATVNEGKEK
FT                   LFDYKNAELATTTSKITFVCDGSKWRQKDYHDEKYGICSKTTMEKGEVKEENGSEHYKC
FT                   DYLDKQEKYEWIATDWQDVYNEKACHYGYVNKKMVTGSGYEYVCEENSEYTDNWGNHSH
FT                   EWRETTVDEYCVGDRVEATVQKVEDEDLGESTFNEKCSYHGSTYARNNTASGAKKWVYY
FT                   GNFTNESTRNSALLLLNGYKDNIIYACNDWVNIYCEPVSVETVQSKIASNMPEVEKQKW
FT                   INVLCNYGDYKRASGYADGIAFEVNVTLKSGENPKTFVASAKRDDWHEPTFEDIYGKCD
FT                   EDKMRNQTKVAVYGGENTSVTTFLEVLPADTTLGLKQAIWMKTLRLEFAREIDQKKKMS
FT                   L"
FT   gene            676143..676667
FT                   /locus_tag="Fisuc_0579"
FT   CDS_pept        676143..676667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_1632 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74191"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74191.1"
FT                   /translation="MLSYQDAYKIAESVHQGQQDKAGGPYIDFLQNVADYLKNKGESED
FT                   VQVLAILQDSITSATKKTPDDMIKMGVPADMVDLIQKMTYHKNQAWIDEYSCHLMEKGV
FT                   PAEDATYDAREKDFVRFVETLKDNPTAAKAKSAILNVLMDDKYIHRQERRELKTKFRLK
FT                   KYKAAIQALGV"
FT   gene            complement(676857..681317)
FT                   /locus_tag="Fisuc_0580"
FT   CDS_pept        complement(676857..681317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0580"
FT                   /product="GLUG domain protein"
FT                   /note="PFAM: GLUG domain protein; KEGG: pnu:Pnuc_1095 outer
FT                   membrane autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74192"
FT                   /inference="protein motif:PFAM:PF07581"
FT                   /protein_id="ACX74192.1"
FT                   /translation="MLVRVKSAFLWAVCCFSSFSFAAWDGTAEVPSARDTVIFYDYEDF
FT                   HYEASLPLYHISTPEQLAGLAQLVNTVEPAENPEKATENIPWRGVVVLDNDLVFGKDEN
FT                   SVSEHPWIPIGKNEKRIGEMIFDGKNHTIYGLDLTTQSDSIFGLFGFVEHTELKNVTLA
FT                   NYKVLMKADPTYRAGDFYGGSLVGYAKYSNIHNVHTRGGAIKIEVLQKTMIKDEEKGDY
FT                   YVGVDEVSIGGIVGLLKGWIDSSSNASDVDVTFFESQNVGGIAGEILRQTEGSYDSVTY
FT                   CSNSGNITSKSPELYNDARVGGIAGLSNAPVAYSQNTGAVSGDVGMMGGIVGTGGGYGD
FT                   IAYCENSGDISTKKLYAGGIAGYGSKVRNSVNKGRVEGIFAGGIIGNAGPVTLCINEGF
FT                   VKGQVVGGISGMTDRGLSQVINRGTLEGDTVGGICGRNLGVISSSYSYASKVTAKDVVG
FT                   GVVGYNQGTIITSAFDSTLQPSVKLVGVEGEGNRVKESFALSTKEMQSVEFADKLNEAD
FT                   RDDGKSRIAYDEAEHPRLTWSYDGGYPIFSDSTHLPVYRIDLDDSVFVSYALTDAKGHI
FT                   VDLPSAYSTEGRYFDSWVDSTGKTVTKTTVFNAPSTIYAKYSKTIKDPSLVVNRPDPTT
FT                   IGWNGELSVPKWRMHLDTSLYVAIFTPSELAWYLSTGASFTQRAALVNDIVMGKDSLSV
FT                   MTRELKTISEYGRYIKGYVFNGNGHNIYGLNGALFGTNYGTIRDVHLVNYLVTGHGAFV
FT                   DTNRGTISKSSLRKGVMDQMDEIRISGFVSLNYGYETGFSIIDSCVNYSNYDLSAGNNP
FT                   VSVAGIAYENRGTISNSRNLGNIKVQGSGSKITNVAGITLINGTTGNILNSTNEGDIEY
FT                   DGTISVRLAGIVTDNRADLIKGAKNYGKIYARVGDFSFRVGSSSPAYVAGLAIGANGID
FT                   SCANYGDITVVVVANELSGGINFGGILAGDYLRTEINVKNSLNKGAITFVDSSSSKLEN
FT                   IRFGGIAARANVLSGKNEGSVKFVQSNPSKKYDSSKDVLVGGLVGEAKTLKDCVNEGYV
FT                   VGAGSVGGLAAKADSIVKGVNYARIDGLTTGKWSQLGGVCGECGYLENAFNGGSVSLDV
FT                   AESNSVSYLGGVAGSLGNGRMIANTGSVKAVGNSGEIFVGGLLGMMGSNIVLDDAYNWG
FT                   EVSSEVAAGGIYGLASKAHSSVAGFDHSYLVTNIAFKNVYNAAPVKAPKANPIAVMDEC
FT                   ANATEPEFAVLVYNDSAFTQERGCIEIDEVLGFEADEYYKINFVLTSPLSTKYMQSDEF
FT                   VELLNTSGKTVENRHVWKKSDTYPVFDEVAFGMSYSVEPSSSSSAVSSSSSATSSSSSS
FT                   NAILSSSEGSSDSKWSSSAVNSSSSSNVIKSSSSTAKSSSSSVKAPSSSSKKADSSSSS
FT                   VKSSSSSAKTSLPVIAHQRFRMAVQGRTITLHASKGRTVQVFDALGHHVMSKAIPANGE
FT                   TSVTLQESGAYIVRVDGMSQRVVLK"
FT   gene            681509..682615
FT                   /locus_tag="Fisuc_0581"
FT   CDS_pept        681509..682615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0581"
FT                   /product="Phosphoserine transaminase"
FT                   /EC_number="2.6.1.52"
FT                   /note="PFAM: aminotransferase class V; KEGG: ppd:Ppro_0735
FT                   phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74193"
FT                   /inference="protein motif:PRIAM:2.6.1.52"
FT                   /protein_id="ACX74193.1"
FT                   /translation="MANKVYNFSAGPSVLPEQALKEASAACIDFENSGISILSMSHRSK
FT                   PIENMFAQTEQYLRELMGIPEDYDIVFLGGGCSLLFCMLPMNFLDQNATADYALTGVWA
FT                   NKAYKEAKQFGNALAACDTKSETYSRIDKNLKLSDNATYLHVTANNTIYGTEWHNFPKP
FT                   KSGFLMADVSSDFLARKINVSDFGVVYGGAQKNISCAGVTVTIIKKGLLGKVNRTIPTM
FT                   LNFQTHIDAANMFNTPPVFAVYVMNRTLKWLKDFGGVDAIEKVNRSKAALLYSALDNSK
FT                   VFVGTAAKEDRSIMNVPFVFNKDVVAADKADDLAKEFLEFAKARGLQQLKGHRSVGGFR
FT                   ASIYNAMPVEGVQALVDCLGDFEKKVLG"
FT   gene            complement(683355..683690)
FT                   /locus_tag="Fisuc_0582"
FT   CDS_pept        complement(683355..683690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0582"
FT                   /product="Sporulation protein YtfJ"
FT                   /note="PFAM: Sporulation protein YtfJ; KEGG: rfr:Rfer_0173
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74194"
FT                   /inference="protein motif:PFAM:PF09579"
FT                   /protein_id="ACX74194.1"
FT                   /translation="MAIEKLAETLLEKLRFITKAETVIGEPIQAGETTVVPVSRVSVGF
FT                   GFGGHQNKGDTSASGGGASVDPVAFLVIKGDDVRIMPITKDSSLVSKIMDIVPDITNKF
FT                   AKKPADN"
FT   gene            complement(683862..684737)
FT                   /locus_tag="Fisuc_0583"
FT   CDS_pept        complement(683862..684737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74195"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74195.1"
FT                   /translation="MLNFKSMNRFLSVLPKFVCVCACAATFVLCACEPKEEESVDYTEL
FT                   CYNDRWPMDEIRIDDNPNDDIKALVKRVDLRYPMNMTGDTLDVTILEFKSDVYALDYYM
FT                   NSGRFQGIVPILRGSFLEQSIRSAARIFIFKHDSFRRYERSDLENYVRQFPNPRHGGFP
FT                   QEFLSLPFEHREPGHTSILTKYFIGVKAYFPVLAQSYRDSDLQWNVARSWDLVEENDFI
FT                   AWGRQLNIVQPKGIYRETSTLYFNAGEGVNGMATRLPGGRIVAVWGYLDWTDLERKFFT
FT                   ASDRVYGARY"
FT   gene            complement(684741..685571)
FT                   /locus_tag="Fisuc_0584"
FT   CDS_pept        complement(684741..685571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74196"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74196.1"
FT                   /translation="MVSVKRFIHDEPALFKASKAFVALLFKCADPIVYVAQKMPTANEQ
FT                   IAWTLLGTVLFQDRSYPDILRLLVKLHERFPCDKLWSLPVPKGGEIEEVVEQTFNSRNW
FT                   TVFEHVSGIFWSVGLFVRHHPDLTAWVRERTPEEMWRDLGEIYFMGRSNPRPKACAAIY
FT                   RLLAPQPLGLGLTCRDNSRMPHLPLTMGARRFLAMLGPAKESNFAELEPAIKQKLANEY
FT                   FIALAPENPYFAAHSLQFFLENGSEGFICRELTSHCAKCPLYEYCNYAEVRKRD"
FT   gene            complement(685572..686429)
FT                   /locus_tag="Fisuc_0585"
FT   CDS_pept        complement(685572..686429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0585"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: ank:AnaeK_2358 phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74197"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ACX74197.1"
FT                   /translation="MNTPFYVFMKLLPKNAASRIFGAFTRLRIPFLSKIARNAFASYYK
FT                   LDMSESEYPLSHYKNIGELFIRKLKPGMRPVADGAEIVSPVDGVLSQTGTFDGDDQNLI
FT                   QAKGKTYTLKSLLRSEELAERFKGGAFATIYLAPFNYHRIHSPVKGDLVLSSYCPGTLW
FT                   PVNPGSVERVEGLFSINERLTSELRLADGSEVLVVKVGATNVGRIGVVYNDSILTNAGK
FT                   LPRDKKRLDWIPNQQFSFDRGDELGRFEMGSTVILVVDKKIRERHPDLFKSRLGQAVKV
FT                   GEAL"
FT   gene            complement(686505..687341)
FT                   /locus_tag="Fisuc_0586"
FT   CDS_pept        complement(686505..687341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74198"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74198.1"
FT                   /translation="MKKNRSSFIALLFALTLFIACAGSRDSAPEGGDMADAPCTECGTQ
FT                   GDIVLKITDEKFYREWNQVAFSRIDSNAVVGVFPALKVTATRPEDCKMCHSFSADALDF
FT                   DLARVEDSLFAKAFPKMQRDLMIVGMRVPDADSAYVDSLSVKLLAEKFVEGKRLDDVTP
FT                   WEERDGVEQTIARQLPFKLKELLNGIASRYELRYLTIPLVLNVEMDPDLGKKGGFTWQI
FT                   VWSMWDARYGELVALTYSKFTAATTTRVAPEKEWATPFASRLWKLLNTDVAHFENH"
FT   gene            complement(687369..687806)
FT                   /locus_tag="Fisuc_0587"
FT   CDS_pept        complement(687369..687806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0587"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: ppu:PP_5027
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74199"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ACX74199.1"
FT                   /translation="MKFLIQRVTKAQVDIEGQTVGKIDNKGFLVLIGVGEGDTREIADR
FT                   FIKKMLALRIFADENGKTNLSIKDVGGSLLLVSQFTLYANCNKGNRPTFNGAGNPTLAN
FT                   ELYEYIIEQCKKEVAIVETGKFGADMQVSLVNDGPFTIMLE"
FT   gene            complement(687850..688827)
FT                   /locus_tag="Fisuc_0588"
FT   CDS_pept        complement(687850..688827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0588"
FT                   /product="Asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: hhe:HH0662
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74200"
FT                   /inference="protein motif:PRIAM:3.5.1.1"
FT                   /protein_id="ACX74200.1"
FT                   /translation="MKNIVILATGGTIAGAGELGKNIGYKSGSIKAQTLIDAIPELKNV
FT                   ANICVEQVCNINSDDVTSEIWIALAKRIQELLLRDDVDGIVIMHGTDTMEETALFLSLT
FT                   LGGSAPSAAEIAAKPVIMTGSMRPATAAEPDGPANLLFAVKSVVEMSAKNDATVYVAFA
FT                   GKLMDARLVQKIHANDLDAFAELSSRTSFRDRHLVNAKKSFDISNLRELPRVTVLYFNA
FT                   DADAELVRFAAERSAGLIIAGAGAGEFSRAWADAITDAVAEKNIPVVISTRINRGSIVP
FT                   EQLLVPETIAAYDLPPAKVAVLLRLALTVTNDPAEIQKIYQMYT"
FT   gene            complement(688824..689834)
FT                   /locus_tag="Fisuc_0589"
FT   CDS_pept        complement(688824..689834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1932 peptidase M, neutral zinc
FT                   metallopeptidase, zinc-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74201"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74201.1"
FT                   /translation="MAQKKSNWKRRVVGLLLMYVLMFVGYQYYEKKVEERFRYEDMIHE
FT                   TNECLRVGDWKCAENNVRELLKSEPNDTNLQMHMAGILFEQERYKECINYVETLNFKHQ
FT                   DLDYLVKKSKALEQEMENLGVEKSMHFRLEFDGGPSKKDVMEALAVLEVAYDSISNLFD
FT                   FLPENKMSLVLYQEKEYQGGTRPEWVAAVFDGKLRVPVNLMAYREVYRPVLFHELTHSF
FT                   VRAMTHANVPCWMNEGIAQVVDGSHNDDPRPIGSYPSLKSLTEPFVNEPNTDKAKKLYW
FT                   FAMRMVQELLWRDGGGADAFRNFAKCLQDLHELGTDGALKKHYGMTARDLLESVK"
FT   gene            689965..690795
FT                   /locus_tag="Fisuc_0590"
FT   CDS_pept        689965..690795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0590"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd2625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74202"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX74202.1"
FT                   /translation="MAEIFDYDDYRDMIKDYYLEHKKHNSLYSFSTLGKTLGLDSSHAY
FT                   YIVQKKRNLPVHAVPAAKKMLGLDGRGAAYFDLLIVASRTKSEKTKAEILQKAFQLRDV
FT                   KRHLLKDNELKYLSAWWTIVVRALIEVKHGNVDIPEIASSVIPPITEEQAQESIEILKS
FT                   LGFIQPINNNSKVRLADPHITVQGAEKAEAIRSFHSKVMQFGIRSLNEIPPENRDISTI
FT                   TMAVDSKGFEDLKKMLKEFRKEIQIRVDKCIVPDRVMQLNLALFPVALNKKKEK"
FT   gene            690797..692332
FT                   /locus_tag="Fisuc_0591"
FT   CDS_pept        690797..692332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0357 putative transport protein ExbB2"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74203"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74203.1"
FT                   /translation="MKNFNKLLYLVPFGLLAACTASNDTAGNTTEIENAIAIRVFDDGM
FT                   PAANVRYQVLPSWYVADTTETGAVNYTYEGKTDTNGWVHIDGHQNGSYTINFTKGDSSI
FT                   VLQYTLNNLNHEYTLDSASLEAVGTVKGLVDLPDSANYAWVAVQGVNTIVKTDTLGQFV
FT                   IQKAPCGNVTVSAWDSEDLSSIGGTSAVVTSNDTIDLGLIENPNKVVPENAIRFMPSDL
FT                   ISDWMRPLSFPTVLVLRLTEENFDFSKAEKDGSDIRLYDGGNNLIPFEIDGWDTSINSA
FT                   TLNIRVESAADTVRPWMLMWGDKKAKKIEDVKVWDGLSDSLVKALNSVEVLNFEAGTDL
FT                   NALPAPLNYNWYVQPHDSATVKNNLDQKPTNGIEKADSTIFGKNMLHVQYQANKLGRYV
FT                   VIGTRIAAHQHDLSRLDSVEVWLKGSGDFEVFLETIVESDTNYKTSYKGSVNEEWTRVA
FT                   IKPSDFTNPDKKSYHGWDVTRNKITRFTIFVYNGTDIWIDNVRMYGINLDDLL"
FT   gene            complement(692656..694005)
FT                   /locus_tag="Fisuc_0592"
FT   CDS_pept        complement(692656..694005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0592"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: smt:Smal_1160
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74204"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACX74204.1"
FT                   /translation="MATDALKTNMDMLNGPLGRKILRFAVPLAATSILQQLFNAADIAV
FT                   VGQFAGDKALAAVGANTFVINMLINLFVGISVGVNVVVANSIGAQSYRAITRSVHTSVI
FT                   VSFISGILLSFIGVFFARPILSAISTPTDVLDLAVRYLQVYFAGIPFVMLYNFVAAILR
FT                   GKGDTKRPLYVLLATGAINVLLNVLFVAGFGMSVTGVALATVIANALSAGTLFYFLLHE
FT                   VGPFKLEFWKLKITPVFLGRIMRVGLPAGLQGVVFSFSNVCLQSAINSLGSATVAASAA
FT                   ALTYEFIVYYWLNSFSHACVTFVGQNYGAKNLERCRSAVRWTILLATTSTFALSMLCCY
FT                   FAKPLLSLYTSDPEIIATGSIRMYVVVGVLFINVFLDVFSGALRGMGQSLAPALTCVVG
FT                   VCGIRILWVIFVFPQYRSFASLMVVYPVSWIVTIMVLAGIYIYRVKHTHF"
FT   gene            694147..695244
FT                   /locus_tag="Fisuc_0593"
FT   CDS_pept        694147..695244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0593"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: Protein of
FT                   unknown function DUF933; GTP-binding protein HSR1-related;
FT                   KEGG: gbm:Gbem_2765 GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74205"
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /protein_id="ACX74205.1"
FT                   /translation="MGFKCGIVGLPNVGKSTIFNAITNAGAESANYPFCTIDPNVGMVS
FT                   VPDARLDELVKVYNPKSIVPAVTEFVDIAGLVKGASKGEGLGNQFLTHIRECEAIMEVV
FT                   RCFDDENIIHVNGSVDPIRDVEVIETELILKDLDTVEKRLATEAKSARTGNAEAKARLA
FT                   ACELLKTTMEEGRAARTVMHDSEEMEGIVKDLGLLTAKPLFYCANVKEDDILTGNAYVD
FT                   QLKEYASKHGHDVIVISGKIEEELSAMEPADKIEFLKELGMKESGLDSVVRKGYEILGL
FT                   RTFFTAGEKECRAWTFHAGFKAPQCAGVIHTDFERGFIRAETLSYADFLKHGSWNAAKE
FT                   AGLVRTEGKEYLVQDGDIMYFLFNV"
FT   gene            complement(695373..695960)
FT                   /locus_tag="Fisuc_0594"
FT   CDS_pept        complement(695373..695960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74206"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74206.1"
FT                   /translation="MSNNSSKEMKLFKKLTALPYLLVLLALLMPLANVSCSAKDDSKPI
FT                   AQMTFYQIASGVDLDESISEPALGQMHRMIKENPKVQDHFKAQMPNFPKMEAVPHLYGI
FT                   IAAVVLAAVFSWIVPLASTVMGLLSMISLWSLLMKLSHIGGTLGIPLLKVEGGVGLYCA
FT                   SFLILIGTAMNIATLVRPMVVARRERKKAKKG"
FT   gene            complement(695960..698407)
FT                   /locus_tag="Fisuc_0595"
FT   CDS_pept        complement(695960..698407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0595"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   glo:Glov_0228 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74207"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACX74207.1"
FT                   /translation="MTFSRLLPLLLLVPALTMADEDRNFKLSSENFKVGNALEHATNFA
FT                   IVLDSSVAISQEPVFPLLPNRLYLRHKNSAKEYLWFSGEAKAEEYKKLHAYNLKENHLG
FT                   AREVLGLRLYASRQYKAFQDEADIYFDTEYIYSPRVSKLLFMKNGKWEVLKESVHPGMV
FT                   QILSDEKNLEIVSLSAKMKPGTRSLYPVNPGTYVFSFNAPDQLPYADIGNLQSGEVLTF
FT                   NVKFPAPDTSVAVTVDSNAAASSSAVASSSSAAVLDSGAVSSSSADSSNSVIAIPDFDA
FT                   PASSSSVVPVSNVAEAKTAPVVPSVTIEQVQALQTLEETEALYDAFSAEVDKNFKRVDT
FT                   TEFSKFYPAIKPADSLGLADSGKVYRGYVAHYNLKRSEAQNLWRQKKLGVVSNLYKAFH
FT                   AKLDSLQALPFQINMMPVAIEKIMKAPDTTIVIDSSKSPADTIMKIVESNKIDSLNLSF
FT                   GAERERVEVSWKGVVESFPMDSLVTLLAEGNTSLVTTLFLVNNKPVWVFKEGDLVGRYQ
FT                   YRYEKLGFRMGDSLYFGKGEFKLPKHILVEKEVEEWLKRGPESSSSVAPSSSSAAPDTV
FT                   KTEPVFNVVEHASRGTVALIDSGSFRYRGKVVSMSPFAIHTTEVTQEFFHKIMGLLDST
FT                   KRYPDKSAFKGPNKPVQNITWENAQYACKVLGGDLPTEAQWEFAGRAGSNDGYLWTSDD
FT                   AMGVNKYAVFAGNSFKKGKKDADYGPHDVASKAPNAWGLYDMSGNVAEWTRDNYFAITF
FT                   SIESSNPTGSFWGTSKVLKGGSWKDKEKKLNMTARDDEDPRYWSDGIGFRCVFTLDKII
FT                   QGK"
FT   gene            complement(698477..703792)
FT                   /locus_tag="Fisuc_0596"
FT   CDS_pept        complement(698477..703792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0596"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: azo:azo0088 putative excinuclease ABC subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74208"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACX74208.1"
FT                   /translation="MTKSIEIRDAHEHNLRHVDLTIPRDSIVVVTGVSGSGKSSLAFDT
FT                   VFQEGQRRFVESLSAYARQFIGRMKHPDVESVRGISPTISIDQKTVNRNPRSTVGTVVE
FT                   ILDHYRLMFARLGVPHCPKCGKVIQAQSVDQIVDNLYASDENKKILVMAPIVQERKGEY
FT                   RKELAELKENGFVRVRVDGTIYRLEEVPLLVRYEKHTIEVVIDRLTLERKNMSRLREAI
FT                   EGALKLTDGKLVSFLLTSQEAGSDAAADASQGAAAKEEYRLQGTQLACPKCGISIPELE
FT                   PRFFSFNDPKGQCPACKGLGESCEFDINLIVPNPNLSLKEGCLAPQKKDDGCIIFSDFG
FT                   WRNLRTIANEMHFSLDTPWNKLKKAQQDAVLYGTPSGSERGVVTIMQELWDMWHIYHFR
FT                   KYMQIGVCPECHGTRINRIAAAVDFHGHNICEMTEWSVEKSVEFFDKLKLSSKEQRIGR
FT                   EVLKEIRGRLGFLKAVGLGYLDISRKASTLSGGEAQRIRLASAVGAGLQGVLYVLDEPS
FT                   IGLHPRDNDKLLEMLERLRAQGNSLLIVEHDEDTMRHADCVIDVGPGAGVEGGRILAAG
FT                   TVDELEKNKSSLTGAYLSGRKSIEIPSQRLKIDAKTPKLKICGACENNLKNVDVEIPLG
FT                   GAFTVVTGVSGSGKSTLINQILRRELARVFYNSEEPVGKFDHLEGLENIDKVIEIDQTP
FT                   IGRTPRSNPATYTKIWDDIRDLFAGMEESKVRGYTKSRFSFNVKGGRCDACEGAGVKVI
FT                   DMHILPSVQVTCDVCDGKRFNEATREVYFKGKNISEVLDMSISEAAEFFKDIPKIAEPL
FT                   KLLCEVGLGYLTLGQPSTTLSGGEAQRVKIASELRRPGTGKTLYLLDEPTTGLHFEDIR
FT                   RLLECLNRLRSLGNSVVVIEHNLDVIKCADWIIDLGPDAGVNGGRIIATGTPEQIAKCK
FT                   KSETGRYLAPVLAKKHGENKHFERTDEKGEDYSLDIEVHGARKHNLKNIDVTIPRHKLT
FT                   VITGVSGSGKSSLAFHTLFSEGQRRFVETLSTYARRFLGRPDRGSIDSISGLAPAIAID
FT                   QKSASKSPRSTVATLTEIYDYFRILWARVGTAHCLHCGKPISSYATGDLMQHAFDRDLN
FT                   KMVTILAPFEIKDEIKLSKILTEKGYRKAYLGKKLVELPLPKMPTREKQLLAVVDSVVV
FT                   KEENRARLVEAFERGYRDGNGILYVDCDGEERLSASEKPGCPECGWYMDSALNPKHFSF
FT                   NTHWGACETCLGLGHFKDGEECPDCHGERLKPEYLAVRILGKNIMDVHHMSIAEARDWF
FT                   AKVDFANEENATSATIQSKTTIASPLLREIIGRLDFLISVGLGYIGLDRAGDTLSGGES
FT                   QRIRLASQIGSGLEGVLYVLDEPTVGLHESDTAKLLDTLYRLRDLGNTLVVVEHDLKMM
FT                   QAADHIIDMGPGAGDFGGEVVAEGSPAELAKPYALQQFPRSETVKFLTYSTPVANQLEP
FT                   VRITDDTEFYEFKNLKANNLKNLSVKFPKKAVSVVCGVSGSGKSSLVVDEIFPALKKQF
FT                   QARGRKKQSGEVLLVDQSPISGTPRSTPASFTGVFDDIRKLFAKLEQSKMKGFDYGRFS
FT                   YNLARGRCPACEGRGAVAVEMHFLSDIWETCEVCGGKRYNQETLTVTFKGKNIADVLDM
FT                   RVVEACEFFKDQPKILPKLECLRDVGLPYVKLGQPVTTLSGGESQRLKLAAELCRRPAT
FT                   EMVYLLDEPTTGLHLKDIQILWNLLRRLSARGDTVIVIEHHPDIIRLADWKVELGPVGG
FT                   AKGGYLLEMGANSSK"
FT   gene            complement(703922..705754)
FT                   /locus_tag="Fisuc_0597"
FT   CDS_pept        complement(703922..705754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74209"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74209.1"
FT                   /translation="MTKFNRTNVFCLGLLGALALTACSDDPVASKSYGTTEEKNAFWNE
FT                   TANLKDWNVMKGSDIKLENTKSALLGRVSLKKSGDDLARAGIAYDVSSPDGSPADLSQG
FT                   GDGLCVSYKSDFVVEVRLDTEDYASSSVDKDVPFVSLNMKDSGSESHCASWEDFKMKKS
FT                   DDTDGSDVVKKVRSVQLVFVGESGSTGEFSIQRLTPYVRSDMWIGKDGKSRVETGFEKG
FT                   DKGTSGELTFFENSSEAYFDWDGEGDFSDMAERIYYSEGLYGNVVFEGSSSSPDVGLEF
FT                   LVAGKTTKNDKDFIYTADVSGLWKGLCLEYESQMDIVMELVPGDSSTGTLEKSVKTMTL
FT                   AKNDDMEKNCAVFADVLNGSDDILKHLAKVRLKFAKENKAGTRFGIRRISALVPENLSV
FT                   KESGEFEEVKPTQSSSYKSGKSFLWDASVDGDHVDLGISGATAGGVWTNSPDEMDTYSF
FT                   GFPDDVEADDNGNVIASLLNKHHKFTAYVKSDDFLYNLDSVATIGFNTVSSNNEPADIS
FT                   AWDGFCIHYSTYNFIRIALVTDAAANKYWYTEVEYSDDMTWGKVSWKAFKNIDEESSEK
FT                   IEDVIGKITSVRLQFPVDGEFVVDKFGSYDQCGN"
FT   gene            complement(705756..706589)
FT                   /locus_tag="Fisuc_0598"
FT   CDS_pept        complement(705756..706589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0598"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74210"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX74210.1"
FT                   /translation="MKPVTEYRDYRCCMQDFYDERKRTSSFTWREFARLAGFTSPTYLK
FT                   LVCEGKSSLSELGIERVAAAMNLGGFENAYFRNLVRYNQAKDDETKKTAFANMRNIADA
FT                   NKIRVVDGDAFTYFESWKNPVLRELVAMMPGATPEDVAQMCWNPITADEVRNSLDFMVR
FT                   VGILQRKSENVYEQTDKALVGNSEVMPLVVRSMHREMAGFAQKAIDQFDVHDRDVSGVT
FT                   MGIDRETYEQIVRELDSCRRKIVAIANTSKEPCQVYRLNLQMFPLSKNTHKKDEG"
FT   gene            706769..706847
FT                   /locus_tag="Fisuc_R0009"
FT                   /note="tRNA-Asp1"
FT   tRNA            706769..706847
FT                   /locus_tag="Fisuc_R0009"
FT                   /product="tRNA-Asp"
FT   gene            706986..708710
FT                   /locus_tag="Fisuc_0599"
FT   CDS_pept        706986..708710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0599"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein;
FT                   histidine kinase HAMP region domain protein; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: sat:SYN_02359 serine
FT                   phosphatase RsbU, regulator of sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74211"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ACX74211.1"
FT                   /translation="MKNIHKYILIVLICGLIFFILGYPCRELFRISSTTEVRIVAALPL
FT                   LFGISFGFAGVLGCAIANLIADIISGYDAIIFIPGFFVQIIYGYVPAVIWNRLRKNDKN
FT                   KFKLDKVYKNVQYMLIVIFDSLATAFMVVSVIKLKYDEQYFSMLSANIFFNQFITMVII
FT                   GIPYLICASLFRQRKIRKKQKKSTKFIFSFSLNEKFILFFLVTSIVISVAIGITSYPSI
FT                   ALKYGEDNLNLWSYVYFYIGAILNIGIWVSLGFLYYMERTVTKPIESMSEIAKTFGQNT
FT                   DIYERIHNTLQKCQQYIYFTSEVGKLARSYEEMATELDEYVKHLTEATAKQQKVHTELS
FT                   IATTIQRASLSKPVEVDGFDNYAMMRPALEVGGDFYDNLMIDDDHLALVIADVSGKGVP
FT                   AALFMMVSKIVLRHNLQQGLSPAEALNRANDELAEHNVHDMFVTCLCGVLNIKTGHLVY
FT                   ANAGHEKPFIKHENGDFEVATLKSGFVLAGMEGYKYKEFEAQLKPGDTIFTYTDGVPEA
FT                   TNEKDEEFGMERLQKVLNDSKDDSIRLLCRKVRMAVKEFAGNAPQFDDITMLAFKMK"
FT   gene            708800..709957
FT                   /locus_tag="Fisuc_0600"
FT   CDS_pept        708800..709957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74212"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74212.1"
FT                   /translation="MNTIKLTAMAFGLAVANVFAQSATEATTTEQKGPEFNISGKAEFD
FT                   AYANAQTGDNQKINHSYASTIDVDFNVKFNKNWSAFAEIEADGDDEAPLVTYKKAYVQY
FT                   NRGDNFTLRVGVYNYDDAGIYAAGMREHDIRGLDLQLYGLQFGVGFGRGNNDVSCLNSE
FT                   SFPCDYGESKSYDVHLAYQFDIAGQTFRPFVHYKSWQIKDANELHAGLHTDLLLGPFDI
FT                   HAVYGLHADRLKKSYPNATHALLAEPTLNLGRVFIKTGIFFAFFDDDMDKATIHETSAT
FT                   YYEIPEYKFAYGEVDFKALDVFTVGLIGEWHTNTLDNSKELGSVNFGTRLYFNPVKNLD
FT                   MTGFVKAIIPVGDDWKKDGHEKWVSTNDYNNDVTFNIGLETVFKF"
FT   gene            710036..711808
FT                   /locus_tag="Fisuc_0601"
FT   CDS_pept        710036..711808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0601"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vsp:VS_1643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74213"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74213.1"
FT                   /translation="MTVRADVTPDNPSRAEIDFSRIANLLDDNWLVWMNRSWYFDNDTT
FT                   GSVLREVDAVLYHRKYGLLLVECKAGKISARTQNQTGNVVWMQSGKSMAKPPHMQVASL
FT                   IAPLHEYMKLLLKAPQNKEFYRVRVQWAVCFSDMENMEGIPLSEIPRKRALLKPDMQDV
FT                   NKFEERLIEILQTPEESHGGRPYPNDYLDEDAFFALRNFFDGIGDMQTAADALREDSYY
FT                   SEQATEMQQMMMDSISRNNRVRIEGVAGSGKSRMVVWEALRLSKIGKSVAIACYNDLLA
FT                   EELREEVESALAKERKIVTAKYGRDGGVGFGKIEVNVYADWCKKYAKAVKELPKMGADK
FT                   SQYYDKELPKAFTNAQTKLFKDKKQREKMFFDAVIIDEAQDFASEWIDSLIGLLRDKER
FT                   GYARIFYDPAQRLYAKRNGIENAQVKAMPVMVLKRAFRNTKKILEWIYKNTNIRLQSYN
FT                   NTPQGYPVKEYRYRDSSEQEQLLLNSYNELVRKYELKPSEILVVSMHSEARSGIKNISN
FT                   DTFAWNKVGGKKLIQDKVNIVSAYRIKGLDTMAVILVDVEEPTETSKREDWKRLLLVGA
FT                   TRAKKLLTVIRKKA"
FT   gene            711934..712527
FT                   /locus_tag="Fisuc_0602"
FT   CDS_pept        711934..712527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0602"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sun:SUN_1158
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74214"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACX74214.1"
FT                   /translation="MSTKEKILETALTLFAKNGYDGTSVEQIAQDVGIKAPSLYKHFKG
FT                   KEDILNSLIDIAETRYEESFGSAKKVGTIPESIDGFIREMLKRIRFTMSDPIIKKMRVF
FT                   LVQEQFRSERLAEITTRHQVDGLQQMYQKILETLMTAGIIVKDDPEMLATEITAPVALW
FT                   ISKVDRQPKCEKEALKFIEKHLQHFFKTYANGNR"
FT   gene            712514..713035
FT                   /locus_tag="Fisuc_0603"
FT   CDS_pept        712514..713035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0603"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sml:Smlt2135 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74215"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX74215.1"
FT                   /translation="METDRFLLRPWRESDAEALFKYASDPDVGPRAGWEPHKNVEESLQ
FT                   IIRTIFGGDHMWAIELKETGEPIGCIGYLLKGESNINVGENEAEAGYWIAKPYWNKGIC
FT                   TEALKLMIDYCFNEKHLDVLWSDFFINNPASGRVMEKCGFRETGEMRYCENLYGGSKRP
FT                   VKVMRLCRNG"
FT   gene            713067..713690
FT                   /locus_tag="Fisuc_0604"
FT   CDS_pept        713067..713690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0604"
FT                   /product="chloramphenicol acetyltransferase"
FT                   /note="PFAM: chloramphenicol acetyltransferase; KEGG:
FT                   dps:DP2058 chloramphenicol acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74216"
FT                   /inference="protein motif:PFAM:PF00302"
FT                   /protein_id="ACX74216.1"
FT                   /translation="MAKEIDPKSTTRAKAFEFWMQAPNPMVTFFKTLNVTRLVKVSKKH
FT                   GLKFNMLMDYCIGKAAASVKEFYMLPVNGKLMQYDSIAVNTIIKNDEGEVSSCDIPYSE
FT                   DLATFNRNYLKYTKIVAESCQDWDLSENSMVIGTSAIIDTEIDGAVGMNSGIFNNPFMI
FT                   WGRYRKRLFRYELPVSFQFHHTQMDGAHAGKFLANLQQAIEELR"
FT   gene            713756..714985
FT                   /locus_tag="Fisuc_0605"
FT   CDS_pept        713756..714985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0605"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_1123 NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74217"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74217.1"
FT                   /translation="MTIKMTLVLNTLESGDCSEQIKALFADKNEEIEIINTADLKIMHC
FT                   MGCNNCWLKTPGVCSIKDDYEIILKKMVAAENFWVVADTKFGFIDYRGKRVLDRIVPML
FT                   NMYIEIRDGWERHQLRYHPLNFGFIYKGNGNRELLEEWSMRVARNLAGRSLGVISLDQN
FT                   GSCENTAEMPSDSAAAPIKTAAPAADEHVIIINGSPRVKKNSNTNKIVHAFAEGLEKAG
FT                   ITHKLYSLSNHAEWDEAREAFMTNDNIIIAVPLFVECLPSLLLEFLSTLPTERKQPAKL
FT                   SFILHGGFDEGHQLRLGEKFLQSLPAQLGCTSGGVLVKGGSFLLRNRENSYIKKMTDKI
FT                   LASYTTMGQSFARNGSFSSSEAKKFTGFEKNPKIGILLFNLIFKRIVKKNFERIAQEWG
FT                   CSEPLDAKPY"
FT   gene            715147..715779
FT                   /locus_tag="Fisuc_0606"
FT   CDS_pept        715147..715779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0606"
FT                   /product="Protein of unknown function DUF2174-like protein"
FT                   /note="PFAM: Protein of unknown function DUF2174-like;
FT                   KEGG: hhe:HH1060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74218"
FT                   /inference="protein motif:PFAM:PF09942"
FT                   /protein_id="ACX74218.1"
FT                   /translation="MPFDFKKEYKEFYMPKGKPEIVTVPKINYIAVRGKGNPNEEEGEY
FT                   KKSIELLYGIAYTIKMSKKGDHKIKGYFDYVVPPLEGFWWQENLDGIDYSHKENFQWIS
FT                   VIRLPDFVTKTDFDWAIEEATRKKKIDFSKVEFLEIEEGLCVQCMHSGSYDDEPATVAA
FT                   MDKFIADNGYENDISDTRRHHEIYLSDARKVAPEKLKTVIRHPIKKK"
FT   gene            715790..716377
FT                   /locus_tag="Fisuc_0607"
FT   CDS_pept        715790..716377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74219"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74219.1"
FT                   /translation="MELKFCQSCGMPLTPEILGTNADGSKNDEYCIYCYKDGAFTGDFN
FT                   MEQMVEFCSQFVDEFNKNTGKNLTREEYKAELRKYFPTLKRWKSSDAELPHANSPIKQK
FT                   LIEEVNALNIKDMPTIDNLFVLQGSFINQEYKINGNSVKLLDDNASYWGNQVEKQNAEG
FT                   RCYGIACDERYILVSEYGKNGADAEIVVFKRR"
FT   gene            716489..717250
FT                   /locus_tag="Fisuc_0608"
FT   CDS_pept        716489..717250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74220"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74220.1"
FT                   /translation="MFKKLAIVAALATSASFASWDMYPVLEQHKGEVSVGVNYSTDENT
FT                   KELSVPVGARFSVIQNLELAFMLPYRIFTHDKNGNDIKRDGFEELAFMARYKITPTTSA
FT                   FADIRTPIGDGSDYEKKTWIAATGAQYSNSINPFIRFGSEIGLTTYFVRKMNLTTFSLN
FT                   ASTEFEFKVTPQFTPYVGANLGVLLGSITEDGYRFNSAGDGHVDARIYVGAKYAFNDMF
FT                   EVGVNAGIWFGNCFYKDNTEKSIGTYGRFKF"
FT   gene            complement(717261..717731)
FT                   /locus_tag="Fisuc_0609"
FT   CDS_pept        complement(717261..717731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74221"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74221.1"
FT                   /translation="MNKMKTILASLLLSSVFTFANEQNPASGWGSSAPAEPEWPRARFF
FT                   LHAGLADVGLGAKIRFSSENAIYMTIDLRYQVWQFQYIRIPALFYLGGNNLHFVAGFTL
FT                   LNAVSSSDASGEVGVGLNCDFGKHFGIDALAFTPMGASSTGASLLLDFRYAF"
FT   gene            717825..717897
FT                   /locus_tag="Fisuc_R0010"
FT                   /note="tRNA-Ala2"
FT   tRNA            717825..717897
FT                   /locus_tag="Fisuc_R0010"
FT                   /product="tRNA-Ala"
FT   gene            complement(718015..719262)
FT                   /locus_tag="Fisuc_0610"
FT   CDS_pept        complement(718015..719262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74222"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74222.1"
FT                   /translation="MVRWFGLIMLVLATALFAETQEEAYYRAMKAEEAGDIPAALKAFE
FT                   EAVALPGEYTEEIQGIIRDYKSAMGVEDDDASSLDNASNPWEFHIAGELGLYGMHYKET
FT                   GLEDAEKGGDLFLNVNPYFDYTTATWSHTFAASVQGDYFLNNDEMSLLDTNDWNLVLGL
FT                   EYTLMGRGMLLDAGYDFNIEGKELSSDFYVWFEKDLYRFEKQRIGAVAWAYYQTSGPMS
FT                   FAAYASWHRTAPEGLNGTVYVGAKFEADSAFDYKTFMQSYATYKQAVSTYNEYWQYLND
FT                   SIAYMADDEYEAYVANPPAEPSVESIVYRQTMGKWFGPVFRSRISYKFKNRITVEAKMN
FT                   LFYGFAVGGPDSDYEKIKKFNGTWGASVSWKYWKMVYYLGLERNYKHMDLPNFYKGLYR
FT                   ESTVLTQLKLGVKWDF"
FT   gene            complement(719263..719763)
FT                   /locus_tag="Fisuc_0611"
FT   CDS_pept        complement(719263..719763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0611"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74223"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74223.1"
FT                   /translation="MKKIVMASAVMAATAMAGEIDSRPEASVPTPVEARETLDKVPKMS
FT                   EKENVDWQKMREERRLAREQILKDLRTNSVVEKKELRNELAKPAVAELPPVAEKDAVKP
FT                   KDEFVREKKIEEKEQPKEPQGGMNPWPGRMEPMRPFVPRPIERNPWEKHNQRDWEKGNF
FT                   PKK"
FT   gene            complement(719808..721262)
FT                   /locus_tag="Fisuc_0612"
FT   CDS_pept        complement(719808..721262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0612"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   mxa:MXAN_4020 sigma-54 dependent trancsriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74224"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACX74224.1"
FT                   /translation="MKSESMLATEKMLDVVKTLLDEEQPEALFPKILEVAKDVLHADAA
FT                   VLDIGGEEPLHFSNPEKVSISISAVKLAKNEKRAVVWNQLDDESADLSKSIVQNQLTSI
FT                   MVSPFRTPDSEAGYLYLQRAARKEPFTDEDSALFDSFVAVCEKFAFAAYDRLRDKESLD
FT                   TLKNVVRKDGIVYSSKAMVDVIAMADKLSPLPLPVIIRGETGTGKEVMARYIHKHSPRA
FT                   EKPFIAVNCGAIPEHLMESLMFGHAKGSFTGAIENKKGFFEEADGGTIFLDEIGELPLN
FT                   MQVKLLRVLQEKHITRVGDNREIPVNVRVISATHVDLEEAVREKRFREDLYFRIQVLPL
FT                   ELPPLRDRGQDVVLLAENFIQRYGAEYGRGKFHLSRNAEKALLGYHWPGNVRELENRVQ
FT                   KGLVQAVHGVIQPKDLGLDDMQGQAKESPRTLKEAREAVEREVISRALKDTNANLTLAS
FT                   TILGIDRKVLREIMERLGLKKEDFKV"
FT   gene            complement(721283..722449)
FT                   /locus_tag="Fisuc_0613"
FT   CDS_pept        complement(721283..722449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0613"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   ank:AnaeK_3532 serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74225"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ACX74225.1"
FT                   /translation="MRKSGTSLLDSVKGGSLLHQGGEASIYLLNVGGTPYVLKWYNDGF
FT                   SFDESVVERSHKVREPGLYRIEEWGNRDGTPYLVYDYIDGESSETLGRMPVAVALVALR
FT                   QVAQTLAALRKQGVSHGDLSPANVIFAVDGNGGNADLGLCTVLIDCGIVGPGALAYAAP
FT                   ERFQGKIADEKSDLFSLGLLLYRWIAGEDLITADGYEQFAEQMANVQDLNISEKLYATG
FT                   AFETPEGAQQLSALEPLWSGLLCAEVSDRVEDFDELDEILEIALDKVSHGEVALAGCVT
FT                   QYIQSINRPESEKNAGQKVPDGLEKGLPFVVCKKNKWLKWAVLGIFGLILLLIVLLLTS
FT                   GTMRFGIDATGDQLLKRSRNLEHSVESDSAPILKVDSLLLDLPVPAAE"
FT   gene            complement(722461..723183)
FT                   /locus_tag="Fisuc_0614"
FT   CDS_pept        complement(722461..723183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0614"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /note="SMART: Tetratricopeptide repeat; KEGG: TPR Domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74226"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACX74226.1"
FT                   /translation="MLGRVVHNRLYNAVEALFAILFATVLGACDGNDLTRGDDALRIGD
FT                   YDRAVTNFSKVLDAEPANRDARYGLAIAYYAIAEDKERLKESTLALWERTVREFKILSV
FT                   VDSSEKSKPMYSTALFYLARAMLAENAQAKVLHLLDQSVQLDPENYFSYNLKALILAGQ
FT                   GDVDGAKKIYAYIVTKEPKFASAYVNLGNLYWNAHDYESAWDIWSMGREALPQDAVLAK
FT                   WTRIAEDSLKAMVYSGKL"
FT   gene            complement(723407..723838)
FT                   /locus_tag="Fisuc_0615"
FT   CDS_pept        complement(723407..723838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gem:GM21_3568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74227"
FT                   /inference="similar to AA sequence:KEGG:GM21_3568"
FT                   /protein_id="ACX74227.1"
FT                   /translation="MKKGILAALCAGMIVLSGCYGSYGSTKWLHNAIGKISNKWAKSLV
FT                   HFLATPAYGLCFFFVDFLFVNTIEFWTGSNPFAAGDSYYEKDAQGNSVAAVKNEDGSLS
FT                   VQFTSAKGEVSNLTLQRDENVVRALDSNGDLVAQYEIEK"
FT   gene            complement(723938..724315)
FT                   /locus_tag="Fisuc_0616"
FT   CDS_pept        complement(723938..724315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0616"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: azo:azo0728
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74228"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACX74228.1"
FT                   /translation="MMAICGFVHRKGRVLMCKRGSGMLFPGFWELPTEVLEEGETAEDA
FT                   LERGFFERLTDIPVSLRPAGAVDFSCGGGGRLLAYDVELCKNFIHIYGYDDFRWVKPKD
FT                   MKRLRVLEPHVTLLTAMNHGL"
FT   gene            724436..725989
FT                   /locus_tag="Fisuc_0617"
FT   CDS_pept        724436..725989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0617"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mlo:mll4149 sugar ABC transporter, (sugar-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74229"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACX74229.1"
FT                   /translation="MNAITKVTSIITAIAVSSIFAAKAPVAKPAAKKQEALTVWIMPNG
FT                   ASPQEKLEQRLNLFTKKTGIKTKVTVLDWGVAWNRITTALATGIDAPDVLQLGTTWVPY
FT                   FASRGEIKPLNEWLTQIDSTRFVPVSWNTTHIDSDTTIYSVPWFIDIRPILANKRILKK
FT                   NDINPDDVSTFDGFVKAIRKVNNSHEMLDDGTKVRAFAFPGKNDWNIPHNFAPWVWSNG
FT                   GNFIEKDNSGKWKAAILTPKTIYGIAKYLSFVLDTLVSTEALQMNTAQIVQHFNAGELA
FT                   FIVNTSEVIMQTRFDGAKGGLNNTKIGKDSVMALPIPTGTEGSVSFIGGSNLAIPTGNK
FT                   KQESLDLLLYLTNDENLDAYTKQIGMLPASKKVLANWSKDDDYKTLVPMLGTGRAYTAI
FT                   PEWGDIEQILGSMFSAIWDHLEIPALYSEEKIYEILANYSNDINKHLNHPISGDLTFAE
FT                   FRETWHKALGIKDGNQNKGIEEKTKPTEENDSGFSRTPWIFAIAVLFGFIFAFTRRKKH
FT                   "
FT   gene            726038..727738
FT                   /locus_tag="Fisuc_0618"
FT   CDS_pept        726038..727738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0618"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: pin:Ping_0260 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   histidine kinase HAMP region domain protein; SMART: GGDEF
FT                   domain containing protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74230"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX74230.1"
FT                   /translation="MGLKFSNLTNSIIIKSLLLLIVSMLVIVMIGTYVFTQRQMKTTLK
FT                   LSYDTNETQLQQLANTVNNEMEQFASRLTLLAKTSEIQSMDKLIAAGYLKSFNISSLFI
FT                   SGESISLFDRSYNLVCNNSMLGSTKITYPIEFNRISPHRPTISPWFRDTDGTPKRAFGV
FT                   VVSDRAMGDGRLVSNFSIRRLWKYFSEYKVGQNGILIACNGQGEILYHPDMRTWLDGIH
FT                   KITELGLGDMNIKQDSDNSIRFVKLDNGKSYLINRTFNPTYDLGLIALQPKTEIDAMVS
FT                   SVHHVSQIILFSSIIAILLVSLWQILIVCKPLNNLIDHISQITEGKLDIEEFKARSSQD
FT                   EIGRLAKVFNQMHATIKRQIQELNAHRDMLEKEVKERTYELEQANKKLDLISRTDELTQ
FT                   LPNRRDMHRTIEKEVDRANRFKKAFSIIFIDIDHFKDVNDTYGHAAGDAVLKSVASTIR
FT                   SLLRKYDVLARYGGEEFLTLLPETELKDAAHVAERFRKQIENQTIFFGGQEIKVTITLG
FT                   VAQFDSGLGAERCIQLADKALYEGKEHGRNRVILWTDDQAVESTDKPLA"
FT   gene            727771..728808
FT                   /locus_tag="Fisuc_0619"
FT   CDS_pept        727771..728808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0619"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /note="TIGRFAM: TIM-barrel protein, yjbN family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: tgr:Tgr7_1852
FT                   tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74231"
FT                   /inference="protein motif:TFAM:TIGR00742"
FT                   /protein_id="ACX74231.1"
FT                   /translation="MNIDFNRRLSIAPMLDCTDRHERYFLRLLSKHILLYSEMVVSTGL
FT                   LHCENKDLFLGHEPFEHPAVLQLGGSNPADLASASKLVEAAGFSEVNLNCGCPSDRVQN
FT                   GNFGACLMKEKNVVADCFKAMQDAVSIPVSIKCRIGVDDLDSWEFFTDFIQTVRDAGCK
FT                   IFIVHARKAWLKGLSPKENREVPPLHYEFVHRLKAEMPELNLSINGGIKTLDQIEEQLK
FT                   DLDGVMVGREAYENPWFLHDADARIFGDVRPESNDPAEIIAGNARPATRKALLEAYLPY
FT                   VEKQTAEGCPATILVKHLYGLFAGLPGARKFRATLSNESPRAHLYGGAAALIRKAMELV
FT                   GETRD"
FT   gene            729228..730187
FT                   /locus_tag="Fisuc_0620"
FT   CDS_pept        729228..730187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0620"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: pca:Pcar_2415 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74232"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACX74232.1"
FT                   /translation="MIDRNKHFLRLMDWSEEKVLETIEIASRLKAEVHAGKVSDRLHGQ
FT                   NIAMFFEKPSLRTITTFQVGMNQLGGHAVLLSPDSIGLGKRESVKDVARCLSRWVNAIV
FT                   VRCFKQQLVEELAEYGSIPVVNALTDDYHPCQAIAFAQMINESLGGFKNADGKPKTVAF
FT                   IGDGNNVANSFLALAAKVGMNFTLACPKGFEQPAKVVEEAEAGLKKHGCQYRVFHDPKE
FT                   AVKDADILYSDVWVSMGQEGEKATKQSHFLPFQINDELLKLAPSHCKVSHCLPAHRGEE
FT                   ITDSVMDNLDVNMSFEEAENRLHAHKAVLWQVMTPFNK"
FT   gene            730292..731263
FT                   /locus_tag="Fisuc_0621"
FT   CDS_pept        730292..731263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0621"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: cha:CHAB381_0711 biotin synthase; TIGRFAM:
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74233"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ACX74233.1"
FT                   /translation="MSFIQDLKEKVLGGYEISREDAIKLLSEDLDELTKAADEIREKFH
FT                   GDDFDFCSIVNARSGRCSENCKYCAQSSYYHTGAPEYKLLSADEIVADAKKKEAAGIPR
FT                   YSIVTSGRTLSNRDVEQISEALRRLKKETKLSICLSAGLLNKEQFDKLKEAGLTRFHNN
FT                   LETYRRHFPDVCTTHTYDDKIGALQNALAAGLEICSGGIMGLGETMEDRIDMCLDLRKL
FT                   GVKSTPVNVLNAIPGTPYENLPKLTNDEFCRIVAIYRFINPKAFIRLAGGRGVLGDDGK
FT                   RAFKSGANAAITDDMLTTAGVNSCKDFELVKGLGFKPHGFIG"
FT   gene            complement(731331..732749)
FT                   /locus_tag="Fisuc_0622"
FT   CDS_pept        complement(731331..732749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0622"
FT                   /product="Lanthionine synthetase C family protein"
FT                   /note="PFAM: Lanthionine synthetase C family protein; KEGG:
FT                   scl:sce1308 Terpenoid cylases/protein
FT                   prenyltransferase-domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74234"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="ACX74234.1"
FT                   /translation="MKLNFVQNLDFSASKNGNYLEAVLQIVKYLKTNEVVTPHGKYWKA
FT                   SPEPGNEYKGDLMITPKGLYAGSAGIGQFFLQLYDVTQDEAYLQEAKDAAEYILNTYEG
FT                   KQFFDNVLNGNDGGVWPVKGWGTSVYASPAGQAIFVEQLYEHTGDPRYREFLIRTADDS
FT                   IAAGVDDGNTLHWSSEADLMADGSYAFFFLYVYRKTKDKKYLEAAKKVVAFTDTRIVHA
FT                   KEGGIYYKNVDLTLVGWKSKESVFPNFSHGAAGSAFLNVLLYEETKEKAYLDKANEVVK
FT                   FLSAIVEGDENGALIPYLYNPEKGRFHDFYYLSTCHGPVGTTLLFRKLFDVTQNKENLE
FT                   WVDLLTKGILKTGAPLKHTPGYWNSYCLCCGAPGVLAHFVKTAEVLNDESYIEQAKLTA
FT                   DKLLGDSWNDDKGRRWFAAWTRKLPGFVETYTGLYDGAAGVGTALLYLYAHEKGIKIKT
FT                   ETVEYLFLNPVKAA"
FT   gene            complement(732749..733762)
FT                   /locus_tag="Fisuc_0623"
FT   CDS_pept        complement(732749..733762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0623"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: ara:Arad_12357 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74235"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACX74235.1"
FT                   /translation="MSKIHKSIAELVGNTPLVELTNYESKYGLKAHIIGKLEFLNPTGS
FT                   VKDRLALALIRDGEKKGAIKKGDTLIDVTSGNTGIALAGIGHALGYEYVPYLEPGTTIE
FT                   RVQIFEGYGLDLQSFYDIKEVADFEKKGLVLDDLIAGMERLAKEKGQYYTGQTLNNANQ
FT                   EYHYQTTGPEIWNDTDGHVDYFVAMGGTAGTIVGTGRYLREKNPNVKIIGVQAAPTSRP
FT                   DNPDFTGHIVDGTLPLGRVDESLVPTIIKDNRNNGFEFDEIIDIKAEEAYETAQETAKT
FT                   DGLFLGTSAAAALTAAIQIAKRPEAAGKNIVVIYADNGYKYLSTDLYKRKKKSEAV"
FT   gene            complement(733817..734611)
FT                   /locus_tag="Fisuc_0624"
FT   CDS_pept        complement(733817..734611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0624"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_5671 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74236"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX74236.1"
FT                   /translation="MSEKKVIVITGAAQGIGLAAVKKYVKEGWAVAATDIKKEQLDGEV
FT                   AKLTAQGADVTAYELDVANYKQGQEVVAQIVKKYGRIDALFNDAGIVGHRKNVLSFDPE
FT                   EIKQAENVNLWGSLYLIQHVGRVFIEKGIKGAIVNVSSFVASFAEWTPFAYGISKTAVD
FT                   GLTRAAAFHLGRYGIRVNSVAPGFTKTEMAIKHDYSDPKLRKAAEDRSILNRWIEPEEI
FT                   ANAVFFLTSDQASAITGIKLPVDAGYTATKEDNKVNIYGDAE"
FT   gene            735083..735907
FT                   /locus_tag="Fisuc_0625"
FT   CDS_pept        735083..735907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0625"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: shn:Shewana3_0063
FT                   NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74237"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACX74237.1"
FT                   /translation="MAFKKRLITRILVVCSLVLLANCAFPVRPGYDRKSGTYKRYRVAT
FT                   TAPEPIDTTAVDPQEELVQEERLATASTTSTDSLTSSAEKSANTKDSTAHLSKTQSKPD
FT                   STVVRKDSIVKIDSTKKDPVKKEPASKTSTAAKTETAKKTTKQAKPASKPTNLEKYAKE
FT                   WLGAKYVYGAASKKKTDCSGYVMQVYKGFYGISLDHNAQHIYDDGRGYSIRRTKLQEGD
FT                   LVFFGNFWKISHVGIYLKGNRFIHASTSKGVVITSMDDNYWSSKYKGARRFK"
FT   gene            735925..736797
FT                   /locus_tag="Fisuc_0626"
FT   CDS_pept        735925..736797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0626"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: SORBIDRAFT_06g015310; hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74238"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACX74238.1"
FT                   /translation="MKKIAFQGRRGAYSESAAYHLFGNDIEVVPMDTFEQIFQGIETGV
FT                   VDGGAIPIENSTAGSIYDNYDLLYKWRHPIVAEVKLQIEHTLCALPGTKLEDLTEVLSH
FT                   PQGLAQCSRFFGQHPNIKSTAFYDTAGSAEEIAKRGDKHIGAIASAYAAKFYGLDILKQ
FT                   GLENLPGVNFTRFYAIQKTAIELPDFKANETVKPPIKTTLLLMLSDSSKSGALYEALGC
FT                   FAKRKLNLTRIESRPHPDRPWEYIFHLSFEGNPKDPNVVEALKELQQYTDFIYRLGSFR
FT                   EGTTEKLSY"
FT   gene            736842..737567
FT                   /locus_tag="Fisuc_0627"
FT   CDS_pept        736842..737567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0627"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: bba:Bd2700 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74239"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACX74239.1"
FT                   /translation="MSYTRTDRKPEEFRNLKMTTGFISSADGSVLIEMGRTRVICNATL
FT                   LPKVPDWLAGRGTGWITAEYSLLPQSTGKRVERERKGASGRTQEIQRLVGRSLRGAADL
FT                   AALGENAIVVDCDVIEADGGTRTASIIGGFVALAIAVKKIKERLGITQQILKHGITAIS
FT                   VGVVDGNPLCDLCYVEDSAADVDMNVVMQDAKNFIEVQGTGEHASFDRAMLNTLLDLGE
FT                   NACKEIYKKQMELIGGELP"
FT   gene            complement(737697..739373)
FT                   /locus_tag="Fisuc_0628"
FT   CDS_pept        complement(737697..739373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74240"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74240.1"
FT                   /translation="MFRRILDIAASALLFGFVACSDDNPSGSFDVPAYGNSSSSVETVP
FT                   GSSDGVGMSSSVVGGESSSSVIVNSSSSAKTPKNTAACLWRGFDKKTYVNTGFVNEDLD
FT                   NYAGLWYNFGDDPDGGTSSVVFPDVCAFETPEYECMENLLEYYGGYSGAIVLQKGILNE
FT                   AFAGVGFNVAGVENPEEYYTKHIQRYGDISDWGGVCVTYAADRDMFLWLGADSVTFYEV
FT                   KLDKSLEFVEKCVPWSEFVGATAKATSTAAEAAKHAHSIRVVMKSSEETKGHFNIAAIG
FT                   KFDAMGACEVDGFAEVVSKFNGGAEVGTIILRSSSSSGVNGSSSSFTPSHDCVSPESVS
FT                   EMWYGPKAVNNNDYHVETGLDNGSETSGYWFSFGDDMSGVGSVKLPQPLGIEYPTGDEI
FT                   YDYCMGACGELQFAKEGYLGIGFHVAGVVDPLDGDLPAAKANISSWGGLCVTYASDSDL
FT                   EVVLAYTQEGGFGNLSRMPKMTLPKSIKLKTVCADWDNFMTVFSEVSTTFMTSILFAVQ
FT                   GEANAKSRINIRGLGKYSEKTNFCSTGEDPFVSGKKGLVIK"
FT   gene            complement(739405..740940)
FT                   /locus_tag="Fisuc_0629"
FT   CDS_pept        complement(739405..740940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74241"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74241.1"
FT                   /translation="MFRRILGGAISAFLLGIVACSDDNPSIPIAEPIAEGSSSSVDALS
FT                   SDGVVVESSSSGAVKARRYNLWDPAVDYKVKTGDDSTGFWRTFGDTLFGQQGKSKIVFP
FT                   VELEKSSTPLASVFKHCDGLCGSLEPDTSVYRPWAGFEIQLARDGATADVSSWGGICIT
FT                   YESDYWMYVHLKVNVDGIDSNSEIWPFMAYPEGFLERTTHGGSEPTLRNLYWIDEPKTV
FT                   CAEWSRFDITKWKYSEYSINRQVYTGEEAAKEILSIMFEVKSQGDDDKKTFNIRGISTY
FT                   KPDEFSFDWEFPNDGVNVNFPDDDSLTCLWKGVDGTHVKTGYNDRDRYAGWLEHFEASP
FT                   GDAYAHIEFPVELSGEFGYEVYGGLIEDCLGFCGTMDFTLEGAEYAVGGVSFNIAGFND
FT                   GDYVFEDIQDWGGVCVTYYSEKDAYLNFVVKDVPYENSPKVALPKSSGLVEKCFTWNEI
FT                   APNDPDMGRAVGAIQFAIKGTEDHEQCRFNLAGIGKYSVNGACSFETPAFFEK"
FT   gene            complement(741087..742427)
FT                   /locus_tag="Fisuc_0630"
FT   CDS_pept        complement(741087..742427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74242"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74242.1"
FT                   /translation="MLRNLINISACAFLLGMVACSKETAGITEEGNPVADNTQYKYDLW
FT                   NGANGSARVNMGDGVTGYWYVESSPVLGRSSITFPVSVEEDDSPDAMESVVSYCGGVCG
FT                   TVELGEGSDVSAGVGIALVEKDTAIDVSGWDGLCVSYESELSMKGLLGYKDGDAEASAE
FT                   DMPSVNFEKTTKGSVAARCAKWAEFQNGSSAEVAKKVTSLIFKFMGKSKESGFFNIKGV
FT                   SSYKHGIVKIDSLEQDSCLWNAAPKDDGDSLITGYDGLEGGSWYEFNDQEEGGLSSLEW
FT                   DVLPSKYMSVSVWVADVVKSKGGLSATVNLQKNNNEEAFAGIGLQIIGYDEESEDFYPK
FT                   PRDVSAWGGLCVTYMSEMDARLVLVADSAHEASATLPMSTSPIEKCLTWEEMSAQEVAK
FT                   NASLIEFELRSLVDTTAGLSVIAVGKYSPTGTCKIDVSKVTLFPVNE"
FT   gene            complement(742408..743286)
FT                   /locus_tag="Fisuc_0631"
FT   CDS_pept        complement(742408..743286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0631"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74243"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX74243.1"
FT                   /translation="MLPFNTKLYIFIAMKSVTEYQDYRVYMQDYYDERKRVSSFSWREY
FT                   AKASGFTSPTYLKLVCEGKTRLSPQGAEKVGMAMSLAGFELEYFKTMVTYCHAKTDQER
FT                   KIAFESMMELAANNKVKLVDGDAFKYFESWVHPVVRELAPIMPKATPGDIARRCCQCVS
FT                   AGEIRDSLDFMVRVGLLKKNGDTYEQADKHLKGSSSVVSMALRYMHRKMAVFAGEAIDR
FT                   FDPEERNFTGLTMGISDEDYEQILQELDTCRKRIAQIALNSRGTDRVYRLNLQLFPLTW
FT                   GKDKCDAKEPN"
FT   gene            complement(743375..743989)
FT                   /locus_tag="Fisuc_0632"
FT   CDS_pept        complement(743375..743989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0632"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: dal:Dalk_3651 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74244"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ACX74244.1"
FT                   /translation="MAITVVDYNAGNLTSVMNALKFIGADAKVSRDPDEIAKATRLIFP
FT                   GVGAAASAMETLTKTGIGEAIKAVVKAGNPVLGICIGCQIILEESEEDGGVKTLGLIPG
FT                   RAVRFKDEPGLKIPHMGWNQVNFTREHPIMKGIRSGCDFYYVHSYYPQVPAEYSFAETT
FT                   YGTQTFTGLLGKDNLIASQFHQEKSGEVGLAMLKNFCDWQI"
FT   gene            complement(744076..744948)
FT                   /locus_tag="Fisuc_0633"
FT   CDS_pept        complement(744076..744948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74245"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74245.1"
FT                   /translation="MKKSLFAIACATLISASTAFADGGMFEAWLPENMTADVVAAVKFT
FT                   RMQFSNWKFEDGTSSYTWLFSYDADLKNHWSVVDWRNKLNLALGYTWIDGVGKRKSSDK
FT                   IFYETMADFNASEKIKPYIGARFESQFTRGYDYSEDEDGNEIKTTVSHFMAPGYVTQMA
FT                   GIGYFPNDNFSTRLAFANRMTISSDYAYADDPDTKKLEKFKDEPGLESITEFKYSFSEI
FT                   VTFKSRLWAFVNFKGVDEIDGKWENLLAVSLSPLFEFQVSYDIAYDKDLDKDSQHKNVI
FT                   LVGVTWRWF"
FT   gene            745066..745584
FT                   /locus_tag="Fisuc_0634"
FT   CDS_pept        745066..745584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74246"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74246.1"
FT                   /translation="MLLKRLVTIFFLIFCTGNVLAKDSPEKSPWTFEAGISAGRPTPIM
FT                   LNAGVGYKNIFFRAMGGGMYFGTDDFWVGFRGGFAWEFFRELPFTLDLGIGSGYAFAKA
FT                   PNGYLKALNRANGERMVRSYNYKEALDISPEIRASIYGIFTYIAIPVHCFMKHDEPTVL
FT                   WQVGYAYRF"
FT   gene            complement(745658..746362)
FT                   /locus_tag="Fisuc_0635"
FT   CDS_pept        complement(745658..746362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0635"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74247"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74247.1"
FT                   /translation="MKKFVLCASLWIGLFLAACGDDSSVTSPSGKESLSTLTDSRDGQT
FT                   YKTVVIGKQTWMAQNLNIETEKSFCFNDDSSNCTKYGRLYTWAAAMDSAGEWSSNGKGC
FT                   GYKSECSAMSPVRGVCPNGWHLPTKAEFETLFSAVGGDSVAGKMLKSTSGWNFAKASGN
FT                   GSDDYAFSALPVGYRDGGGDYTYVGNEATFWISTEKSDEYAYAMRLIYRNDNADVDYRP
FT                   KFMAFSVRCVKD"
FT   gene            complement(746470..747738)
FT                   /locus_tag="Fisuc_0636"
FT   CDS_pept        complement(746470..747738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0636"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: argininosuccinate synthase; K01940
FT                   argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74248"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACX74248.1"
FT                   /translation="MAKTESKKKVVLAYSGGLDTSIIIPWLKETYDVEVIAFAADLGQN
FT                   DFPNAKALEEKALKTGASKCYVLDLKKEFLEEYVWPTVRAGAKYEGTYLLGTSFARPLI
FT                   AKYQVKIAEKEGAYAVAHGATGKGNDQVRFELTYAALNPKLEVIAPWKDPRWTFHSRED
FT                   AIDYAAAHKIPLNGISKKKIYSEDGNLWHLSHEGGVLEFPEQEHKYEFLKHTNTYEKAP
FT                   NKADHVTISFEKGNPVAINGKKMGAVELLEFLNEIGGKNACGLLDIVENRLVGLKSRGV
FT                   YETPGGTLLYKAHECLQQLVLDKETLFEAQKMSMTYANLVYNGQWFTPLRQAMDAFFNE
FT                   VNKVVTGEVTLKLYKGNIIPAGIKSPYSLYDMGLGGFTDVDMYDQKDATGFIRCYGLPL
FT                   KTRALLLGKKTNVDFGGVPSLKK"
FT   gene            747923..748939
FT                   /locus_tag="Fisuc_0637"
FT   CDS_pept        747923..748939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0637"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: kinetochore protein NDC80"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74249"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACX74249.1"
FT                   /translation="MKLSDRALGYISLIVFAGIFAGISFGMWAAHQNVHQTAIVDFKEL
FT                   GSLQPEDPVVLHGYRVGTIGSVTWLKDRSRVKIHFTEPLKLREGTQFNNVNYALMGQRR
FT                   LEIIPSKTGTLMPENHVFQGHFEPGIAETLRLVENVNEQLEAVRKTILLLAQGDSSHKS
FT                   APEIYEEAMHSIEDIFAHTEKTVSKLGPKMNKLFKQMNSSTKAISKTALQADSAIKTVT
FT                   ASANEKLSLVDSVVITLTENAKKTNEVLTSIEKGIDSQTLLQSKELVENINEIIASLNK
FT                   AVQTIDTKNFGFKDKDGNPIKLITWKNMNIVGDNARDKARKRLEEAKAQQEQKKAGK"
FT   gene            748940..751033
FT                   /locus_tag="Fisuc_0638"
FT   CDS_pept        748940..751033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0638"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; type III restriction protein res
FT                   subunit; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   hha:Hhal_0967 ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74250"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACX74250.1"
FT                   /translation="MDLSSLPGLGPKRLEKLNKSGLSTIADLLYNIPRTYLDQTKVSKI
FT                   AELHDGDRAVVIGIITRAGIVKGRMSRFMAVLTDGTAEISLLFFRGTRFIANRVKPGTR
FT                   WLVSGTVGSYRGLQLVHPDMQPFDEGEAFNGQILPVYPISEVCREAKMEQRFFRNLYKT
FT                   IFNFPGLTLPNACPRELTDYLHFAPVMDNLRTLHMPKDFDSIYKAKRELKILELLPFCL
FT                   RMVKRRENQKIRGHERQIDLGNVMAAKARLPFQLTAGQDAALNTIIDGLNGKKQFHALL
FT                   QGDVGCGKTVVAMLAIMAVCGAGEQCALMVPTDILARQHFKSLKPFFDAAGIRVHLLVG
FT                   ATPAAEKKVILGELQMGLCNVVIGTHALFSKDVFFAKLGLVIIDEQHRFGVSQREALLA
FT                   KGDYPDMLVMSATPIPRSLAMTLYGDLKVISIKEKPAGRKPIKTRLVNAAKRESMKQFI
FT                   CKEAAGGNLCYWIASRVNADGSDNADESSARSVDDIVNEMRSFIAAFGHTDANIAKLKV
FT                   AGVHGQMDDTQRDEIIKRFAAGEIQILVATTVIEVGVNVPAANLMVIDQPDRFGLAQLH
FT                   QLRGRVGRGNQEAWCFLMTPEGEAAETSMERLSQFAATEDGFEIAELDLKTRGAGNLEG
FT                   NEQSGAWVFRWFDWIHDQELISQTLERAEHILKDGSAFNETAKEKIQTWYNEKPSANED
FT                   GVH"
FT   gene            complement(751037..751393)
FT                   /locus_tag="Fisuc_0639"
FT   CDS_pept        complement(751037..751393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74251"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74251.1"
FT                   /translation="MATDEEKNQDVTARENRRRRAREAKRIFLRVEIIIGIIAMIAGSW
FT                   LTILVWNEGYFVGAFMLVMTGGINVFLAAKELVNPTDHIFHWQAIFFLIVRRAMFFLNV
FT                   VLIALVVGTMTRLL"
FT   gene            complement(751426..753243)
FT                   /locus_tag="Fisuc_0640"
FT   CDS_pept        complement(751426..753243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0640"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74252"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74252.1"
FT                   /translation="MKKLIFCLLSFAAASFADVVDSNAVFRVDEIRYNIGDAFDDSKAH
FT                   TKYDRWAYDILNWVHIETRESTVSKLLLFDKGDLVNLNLLLESERFLRDQKFLSDASIS
FT                   VADEEGKKVVTVQTSDNWTLTIPFALGFSGSEWSYDNLVWGIGVQESNFLGLGQKLGFY
FT                   FGHDQFRDMWQLEYGDPHFLFRYNHLDLLYSYNTDGYLASWKMYVPFLSRSVNQWAYTL
FT                   EGLKNKRNVFYYGRGELPSGAKIYDYTQNKAFLKQLEIARKDLDNKKKSDRQIDSIATD
FT                   KYLNSLSRYNGKKSVKVMAIEDYITDSLSLRFSRSFGGTQRKIYLGATYDYLRETANEG
FT                   RVLPYAFMYGDDVYAVDSASAVNEWTQERKDSRLGFYIMYSNLRYEKIKNFHNVRWTED
FT                   IDKGFSVKAQLSKNYEQLGSDNNDIRLDFWTDLYLGHLNHHLTLKSYMYFYLDHGKRRD
FT                   FYGRLNGEYIFHPSMRFSTALSGLVDLYDDAKLGYQLTLGDSDGFGFPTGFYAGQARIY
FT                   GNLEQRWFPDFEILTLAPVVVAFGSVGETAPTIKDIRRKDLIYVAGFGIRLAQTKSITR
FT                   LINKIDVSFPLNGVLKGKPHYSVTTSYSL"
FT   gene            753388..753704
FT                   /gene="rnpB"
FT                   /locus_tag="Fisuc_R0011"
FT   ncRNA           753388..753704
FT                   /gene="rnpB"
FT                   /locus_tag="Fisuc_R0011"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam(RF000
FT                   10), score 224.83"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(753756..754355)
FT                   /locus_tag="Fisuc_0641"
FT   CDS_pept        complement(753756..754355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0641"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74253"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74253.1"
FT                   /translation="MKKFLLAMGSIALAFALTACDDSASSNSDASSTSNNQNNAASSNN
FT                   GTGANTSNAKKGSFPENGDPNFYCIVTHGEEPDGKIWSEKKFNIPNRQGHVERLTFDAD
FT                   GNGTQYYEDSYYNLNNRNKVAMCMEFNEAVKEKSNKKNFIETYCEGQVSYFIIAFENAP
FT                   LDELISRTNSFAEDCKWEEKNWEDSQNRQKEDDLYD"
FT   gene            complement(754384..755028)
FT                   /locus_tag="Fisuc_0642"
FT   CDS_pept        complement(754384..755028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0642"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: saz:Sama_3577
FT                   transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74254"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACX74254.1"
FT                   /translation="MLHVFKHELRLIFRDPRFWIPFIIPPVILAASQAIAVSRYGGEIM
FT                   QGMESYMMLLLGCLMAPMGAPLAGDSFAGERERNSLELLQLSPIAPAKLFWGKLFAILP
FT                   FPVVFALLAQLGYWFSHSEITAMAAIASMLGALSAVLLTTAFSLMVSLRVKTVRAATHI
FT                   TLFFIIPLLLLVQLGHEVFLSGLFIPLVILALSVLVSIAVTFAGMKKFVSL"
FT   gene            755149..755481
FT                   /locus_tag="Fisuc_0643"
FT   CDS_pept        755149..755481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74255"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74255.1"
FT                   /translation="MSDNLKNKLYVWAVFTVGGLIFGAFLVPIFGFEKVFYVFLTYSLF
FT                   SAICIFVFGVFPAERPINGKQQFIDDYFSEEDNHGDETDKFDEIMGLREKEKSFDELIA
FT                   ARKKDK"
FT   gene            complement(755625..757319)
FT                   /locus_tag="Fisuc_0644"
FT   CDS_pept        complement(755625..757319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0644"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_01978 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74256"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX74256.1"
FT                   /translation="MAEQNKAEKFVFYMYKMTKSYPPNKEVLKDISLSFYYGAKIGIIG
FT                   QNGAGKSTLLRIMAGIDKEFQGEAWIEPGRTAGYLPQEPQLDPNLTVKENVMQAVAKKQ
FT                   AVLDRFNEISMKFAEPMEDDEMNKLLDEQAKLQDIIDAQDLWSLDRNIEIAMDALRCPP
FT                   GDWPVTNLSGGEKRRVALCRLLLEEPDLLLLDEPTNHLDAETVAWLERHLREYKGSVIL
FT                   VTHDRYFLDNVTNWILEIDRGRGIPWEGNYAQWLDQKLERMKNEEKGESDRQKRLAREQ
FT                   EWVKQSPKARQAKSKARLKAYEELLAEDSKEQIKVAQIHIANGKRLGDVVIQAEHLQKA
FT                   FGEKVLFDDLNFSLPRSGIVGIIGPNGAGKTTLFKIIMGQEKPDGGTLKIGETVEIISM
FT                   EQGRESLDDSKTVWESITGGNDEILVGDRKMNGRAYCGLFNFTGAAQQKKLSQLSGGER
FT                   NRVLMAKNLQKPGNLLFLDEPTNDLDIETLQALEQAILKFAGCAVIISHDRWFLDRIAT
FT                   HILAYEGDSKVVWFEGNWSEYEADRRKRLGEDADNPKPIRYKTLKRD"
FT   gene            complement(757374..757595)
FT                   /locus_tag="Fisuc_0645"
FT   CDS_pept        complement(757374..757595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0645"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msu:MS1207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74257"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74257.1"
FT                   /translation="MGVVSALGVYGIYAFIERGLWKYMTLQQPFFSLDLEHGYLLFTLD
FT                   YIAIMALFAVSMQLVMLALNRYFYIRNA"
FT   gene            complement(757604..758182)
FT                   /locus_tag="Fisuc_0646"
FT   CDS_pept        complement(757604..758182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0646"
FT                   /product="flavodoxin"
FT                   /note="KEGG: ccv:CCV52592_1956 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74258"
FT                   /inference="similar to AA sequence:KEGG:CCV52592_1956"
FT                   /protein_id="ACX74258.1"
FT                   /translation="MRKIVLILLMFLIGVSMAAEKKILVAYFSHIGENVSVGTIIKGNT
FT                   EIIAEMIAEKTGATLLRVMPETEYPRTYDECLSAAKKDRAENARPAIKPVEVNPEEFDE
FT                   IYIGYPVWLNDMPMLMYTFLEKYNLKGKLVHPFVTHEGSGLSAIAKLKKAATGAVVTKG
FT                   LSIYGHIAQNNRKKAQKDVDKWLKYLGVL"
FT   gene            complement(758309..758953)
FT                   /locus_tag="Fisuc_0647"
FT   CDS_pept        complement(758309..758953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0647"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: hhe:HH1046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74259"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACX74259.1"
FT                   /translation="MPNTLPDPMTVHPIAGYDKEIYVKPMVKNPQIVVGDFTYIADSDF
FT                   ESHVTHLYPWNDDKLIVGKFCQIAAGVEFVMNGANHQMNAVSTFPFYTLQGWNMAPPAK
FT                   ENLPLKGDTVIGNDVWIGQNAVILPGVHIGDGAIVGANAVVGSDVEPYTIVAGNPAQYI
FT                   RSRFDEELTMLLLKWKWWDKSVEEINTLIPVITNSDLNFVKAKIKQFLACI"
FT   gene            759011..760855
FT                   /locus_tag="Fisuc_0648"
FT   CDS_pept        759011..760855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0648"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: vfm:VFMJ11_0068 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase RecQ;
FT                   ATP-dependent DNA helicase, RecQ family; PFAM: DEAD/DEAH
FT                   box helicase domain protein; RQC domain; helicase domain
FT                   protein; HRDC domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; HRDC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74260"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACX74260.1"
FT                   /translation="MPTAHEILKSVFGYDAFRPMQEEIIEHVVSGKDALVLMPTGGGKS
FT                   ICYQIPALMFKGITVVISPLISLMKDQVDALNANGIGADALNSNNEEGENAAIRQRCKA
FT                   GQTKILYISPERLQREIPWLQQHLSISLFAIDEAHCISQWGHDFRPEYTQLGMLHQAFP
FT                   SATIMALTATADKLTKEDIVRQLNLRDFRLFVSSFDRPNLSLDVRRGYSASEKLKAILS
FT                   IISKHKHESGIIYCLSRKSTEKVAEELINAGVYAKAYHAGLTAEERNNVQEDFINDNIN
FT                   VVCATIAFGMGIDKSNVRYVIHYNLPKSIESFYQEIGRAGRDGLPSETVLFYNFQDIIT
FT                   LRKFVNDSGQRDINSEKLDRMQEYAESQVCRRRILLNYFGENNSSNCGNCDICKHPPQR
FT                   FNGTILVQKALSAIKRTGEHIGFSMTADILKGTLSDEIVQKGYNKLKTFGVGSKTTLKH
FT                   WHDYLLQMLQLGYIEIAYNENNHLKITESGNEVLFGKKTAELAIAAKAEAKEDAKPRSS
FT                   RTSFNRSGNSHTTYAHSSADDAEDNSLFEALRKVRRQIADENNWPAYVVLSDRTLRDLA
FT                   YKAPTSINELQDVSGFGEMKIRKFGQQFVDAIRDYMNQ"
FT   gene            complement(760904..761938)
FT                   /locus_tag="Fisuc_0649"
FT   CDS_pept        complement(760904..761938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0649"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: msu:MS0896
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74261"
FT                   /inference="protein motif:TFAM:TIGR01123"
FT                   /protein_id="ACX74261.1"
FT                   /translation="MQVDLNTVDWKTLPFGYYDTDYNVRCYYRNGEWGKIEVSSSKDIS
FT                   IHMAATCLHYGQEGFEGLKAYTGKDGKVRIFRVDENAKRMQNTANRILMAVPPVELFRE
FT                   MVHTVVKLNKRFVPPYGYGATLYIRPLLIGMSPEVGVKPADEYLLMMFVTPVGPYFKDG
FT                   FKPVDMMISRNYDRAAPQGTGTVKVGGNYAASLQSLAEAKKLGYSSTIYLDAKEKKYID
FT                   ECGPANFFGIKGKTYVTPKSESILPSITNKSLQQLAEYLGYTVERRQVPFEELAEFSET
FT                   AECGTAAVITPIKKIVDPVAGKEFTYGDGKNPGPVCTELFTKYTAIQFGEAEDPFGWTE
FT                   VVDL"
FT   gene            complement(762168..762506)
FT                   /locus_tag="Fisuc_0650"
FT   CDS_pept        complement(762168..762506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0650"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   sun:SUN_1017 plasmid stabilization system protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74262"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACX74262.1"
FT                   /translation="MPSKKFMVEWSESASNDLRSIVFHIAKESKKNAKDSFARIKKESL
FT                   VLESFPDLGKVPNELDKLQIGGFRELVISPWRVIYRKENNKVVVVAVVDSRRDLEDAVW
FT                   NRMMYPFM"
FT   gene            complement(762496..762771)
FT                   /locus_tag="Fisuc_0651"
FT   CDS_pept        complement(762496..762771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0651"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: gme:Gmet_0678
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74263"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACX74263.1"
FT                   /translation="MQKLENIKPISYIKANAAKVLDHVNETRAPYIVTQNGEARGVIVD
FT                   VETFQTMQDALKLFKLIAQSEAEIAKGKVIRQKDLFDALERELDAL"
FT   gene            complement(762871..763875)
FT                   /locus_tag="Fisuc_0652"
FT   CDS_pept        complement(762871..763875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0652"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: vvu:VV1_1144
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74264"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACX74264.1"
FT                   /translation="MENSTAQLGQVAKRNEVLNLLKGLACIAVVFIHIKFPGAVGIILG
FT                   SSLTHFAVPSFLMIAGYFAFEKDETVIKRRLIKILKIFAFGYLCFLGYNVFVQILRGFA
FT                   IEWLSLNFKYTTPIKYAVFCTIDFAIPLWYLIAMAETYIVWYFIVKHKKENKALYVMPL
FT                   LFLFKMVLTVYCETNHLPWMYKINFLTGAMPYFLFGYYLHSKETFFKSFRYSSVLLVII
FT                   AGILISMISLFCGFHIKFSCIGIVFYSLAIFSLAIKIPKKSYCRPLEYIGDKLSLNVYI
FT                   FHMLIASVLSTVCSKYLLNIDLSAGLLNWIRPILVVILTLVWAQVLEKVKIRF"
FT   gene            764346..766730
FT                   /locus_tag="Fisuc_0653"
FT   CDS_pept        764346..766730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0653"
FT                   /product="diguanylate cyclase and metal dependent
FT                   phosphohydrolase"
FT                   /note="KEGG: lhk:LHK_01115 GGDEF domain protein; TIGRFAM:
FT                   diguanylate cyclase; metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; FIST C
FT                   domain; domain of unknown function DUF1745; GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74265"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX74265.1"
FT                   /translation="MKNRIFAFNDAATFEKELAQFSNWCKENGSPTVCFQIHSEELDPE
FT                   KLRPVWETLERVFPKVPWFGNSTSGNIVDCEKASEISISAIIFEKPTTKIQILQYDFSN
FT                   KSISDIAHEIVEEAKQNPWVKAVEIYHCISPFSTTNLCEGLDALAPNIQIFGGIVCSPD
FT                   ITSPNSCVFSSVGGHTTSGLLVVFYGGPDFYVESRKISGWKPIGRNFHVTRSKGNVLYE
FT                   LSSLPAYEVYNKYLNIKNDNNFFYNALEFPMLYEHNGISIVRAAGASNPDGSLTMSSDI
FT                   DEGSMVRLSYGEPQLILEKIKTESENAELFAPEVMHIFSCAARKAFWSKHEPTYEITAF
FT                   KGLASSTGFFSHGEFLREKGFLNQHNITLVIASMREGAITKRGHAKGVIIPDEKSTRLP
FT                   LAARMATFIRETSFELEQINSRLRVMNEHLQDVATTDSLTGLENRLAFDALLETINQED
FT                   SQENSWTMFLMDVNGLKYANDTFGHQAGDELIKAAAKAIKNTYGTNGNCFRIGGDEFAV
FT                   ITQAPLDSHYPMYSILQKNINEYNKKALYHLSIAVGASRLRSDSGIRKSISDWKMEADL
FT                   NMYRDKVRYHKPVENDENQNLKDLISCLISVEEAKDSYTAHHSERVKAYSELIARSLGL
FT                   SESSISLITHAAHLHDIGKIGIRDNVLTKPGKLTDEEFEIIKQHPVIGAKILMQSNYTH
FT                   EMVQIVLHHHERYDGRGYPEGLKGEDIPIGARVIAIADSIDAMTSKRVYRDAMSLDYCR
FT                   EEIEKNLGKMYDPAIGKVVLEHWNEMVDSLLSMRTGRPKVI"
FT   gene            complement(766782..768071)
FT                   /locus_tag="Fisuc_0654"
FT   CDS_pept        complement(766782..768071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0654"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: dps:DP1088 citrate synthase; TIGRFAM: citrate
FT                   synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74266"
FT                   /inference="protein motif:TFAM:TIGR01798"
FT                   /protein_id="ACX74266.1"
FT                   /translation="MSDTAILNYDGKKYELPVVTGTENEHGLDVSKLRKDTGLVTLDYG
FT                   YLNTGSTKSAITYVNGEKGILRYRGYSIEDLAEKATFPETAWLLIYGELPNQEQLSHFR
FT                   TLLTENALLHENLLHFFREMPPGAHPMGILSSVVNAVGLFTPRFYDDENIASAFELTTA
FT                   GLISKIRTIAAFAYKASIGEPFVYPEAERSYCSNFLNMMFSSKTRPYHPDPIMEKALNT
FT                   LLIVHADHEQNCSTSTVRMVGSSQANLYASICAGICALWGPLHGGANQAVLETLLRIQQ
FT                   SGMTIEQVMAKAKDKNDPFRLSGFGHRVYKSYDPRAKVLKKLMYQVFEREHVHDPLLDV
FT                   AIKLEEAALKDDYFVERKLYPNVDFYSGILYRAMGIPTNMLTVMFAIGRLPGWIAHWKE
FT                   MHDDPQSKINRPRQIYTGKTERAWIDRDKR"
FT   gene            complement(768103..769398)
FT                   /locus_tag="Fisuc_0655"
FT   CDS_pept        complement(768103..769398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0655"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   pca:Pcar_1646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74267"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACX74267.1"
FT                   /translation="MNYNPLAQSLNAELSANGCCVLDMLSEQGKAIFFPRKGILGQGAE
FT                   AKGSDINATIGTALEDDGSPLVLDCVLKSLNLPKQSFLYAPSFGNPDLRKAWKELDIKK
FT                   NPTLATKKFSNPVVTAALTHAISCAGYMFLDAGDEVIIPDLYWDNYELVFENARGAKIK
FT                   TFNTFKNGGFDTEALKAALAASKSDKKVVLLNFPNNPTGYTATEKEAVEIAKILTECAA
FT                   AGNKVVALLDDAYFGLVYEEGVTKESLFVKLVDAHENLLAVKLDGPTKEDYVWGFRVGF
FT                   MSFGFKGATEAQLKALEDKAAGTVRGNISNAPSISQKILLAAFQSPEYAQQKAEKYAVL
FT                   KKRYDIIKQEFAAHPEYKDAFEPMPCNSGYFMCIKPKGVDAEELRQKLIKDYSTGTIML
FT                   SGLIRVAFSAVPTEKLGKLFENIYNCVVAMKA"
FT   gene            complement(769532..771418)
FT                   /locus_tag="Fisuc_0656"
FT   CDS_pept        complement(769532..771418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0656"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: swp:swp_2314 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74268"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACX74268.1"
FT                   /translation="MKTFVSAHKLVQITILIVIGIVINRLLADLAIHFELPLYLDSVGT
FT                   VVVAVIGGFSPGAIVGFLTNFIGGFVDSSTFYYGTINVMIAVCAGIAARRGAFHKITRL
FT                   PMLLGMLMILSIPCSVLSYFLFDFKIAENVVTPIATALHESGLPVLLSQILADFCTEIP
FT                   DKSISIIVAYVLIRLTPRWFAKAFDSVSGRSHEDRYRSKNEIHTLKAQVTALLFVSSFA
FT                   LAVVATAVAYKTYSEAEIHETTLLAESVNRLVSDAIQNADSATLHEYIHDLKGKHPRIL
FT                   TITPGMHETGKWDVSIVCTEAPNPVCTKFSLAAIRISVVLFCTKIFSTLFGLLLAIVFT
FT                   AILIANRKVVYPIHEMTLEMDNFAYDSSRGRRESINQIKGLEVVTGNEIENLHSAIIKA
FT                   VEEIDLYINKSEYQAASIAALQTNIITVLGDMVENRDETTGGHVRRTAAYAELIARELK
FT                   DRGKEPEIDDAFISTIAVAAPLHDIGKINISDVILNKPGKLTDEEFAEMKKHTVYGRDM
FT                   LVRASKNLGETAYLKMAKEIAYSHHEWWDGSRGYPERLKGKDIPLSARIMAVADVYDAL
FT                   VSERPYKKAFSVDEAIRIITEESGTHFDPEVVNAFVKNRETVEQIMKTKFED"
FT   gene            complement(771568..772521)
FT                   /locus_tag="Fisuc_0657"
FT   CDS_pept        complement(771568..772521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74269"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74269.1"
FT                   /translation="MITDKITKMGVALAMLGLGLLAACGDTNVASSYSETQTGKPVIRS
FT                   GMPIAELDTTYIRKIIDEGGDGCHVLAKSAVDVESDDVTEIDSAVTETTIVMARITCKS
FT                   YNDIHLFIKTRAKVVDDAGAPVVGAIVYEKDCSFDDKSCQHVTDKDGYFYIDSVNFQTY
FT                   YQNETKNPKYAYVPRYHEIQLRALSADSNFGALVSLNFADATVESVDDIAVADLGKIVV
FT                   EPVYSAKVYLDSLFATVDENTPESDKPYIEEWNETMTKGLGEMGICASGYFPCYKAYEE
FT                   DYKNGYVVLFGLPEGTYKLGVSHVWGPLPQLVVTKP"
FT   gene            complement(772541..773368)
FT                   /locus_tag="Fisuc_0658"
FT   CDS_pept        complement(772541..773368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0658"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74270"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX74270.1"
FT                   /translation="MDKFIDIFQFTHFRKYLDEYQAARVQTDPEFTRAGACALLGLPKT
FT                   RSYYNDIVKGKKLTGRMIPKFVEVLGLNKKEAKYFETMVNFDQAKTTTERNAFFDELIK
FT                   QHPDPHHILNEDAYEYYNHWYNSVLFTALDVMDVSDDLEPIQKRIFPKVSVGTLKRSLE
FT                   LLERIGFVRKNEDGFWKSSRDSVSSGAYNNNDLVRQYQLQCFELSKQALLADDDNPSDM
FT                   GTFTFSVSDDAYKEIALEIQNLKAKVRKIITQDKKEATGVHQLNIHLFTNLKK"
FT   gene            complement(773447..774625)
FT                   /locus_tag="Fisuc_0659"
FT   CDS_pept        complement(773447..774625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0659"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG: bba:Bd0136
FT                   transcription regulator homolog YacF"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74271"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ACX74271.1"
FT                   /translation="MLKIDNLPKKVRFNLRNKEIFPNTILSPMDGVTDAPFRRLCRVLS
FT                   GDRMGLLVSEFVPTDGDAVFNPDGHKQLKFFPEERPFGVQIFGRFPDRMAAAAGKIAER
FT                   YHPEFIEVNAGCPAPKVAGKGSGSGLLRDLPRLQEILHDVKAVLDAKTPEIPLTLKCRI
FT                   GWDDDSINVMETLKIAEGEGVEMLTVHGRTRLQGYNGLANWDWIGKVAAAAKIPVIGNG
FT                   DVNSVECARERINTYGVSGVSIGRGAMHNPWIFGQIADAWEGREKHVITAQEALDVFPL
FT                   YYKFKIEDGATEMNAMGRMKQLAARLCKGFVLDEKYCHPGAEGDRIQDGDNVAMSVRQA
FT                   LLTCQSAAEMLECVEKLKDGIAREMVFEPERLVNLNGAKETELKFGDQFKGR"
FT   gene            774731..775105
FT                   /locus_tag="Fisuc_0660"
FT   CDS_pept        774731..775105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0660"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   tcx:Tcr_1199 integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74272"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACX74272.1"
FT                   /translation="MANITKQSLIQEIAKSTGFVRNDIKIVVEQFLDLLGEKLIEGNTI
FT                   EIRGFGTFACKPRKARPARNPRTGETVLIDERLVPTFKFSNDIKDKINSLEGILGEASV
FT                   QPELETENEIVHVGSDDDSI"
FT   gene            complement(775222..775926)
FT                   /locus_tag="Fisuc_0661"
FT   CDS_pept        complement(775222..775926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0661"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; KEGG: reh:H16_A2917 16S rRNA uridine-516
FT                   pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74273"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACX74273.1"
FT                   /translation="MAVLTLERLLASMGFGSRKDARGLVRMGLVELDGKVLDDPFMEFK
FT                   TRPEFITVNGEEAPTVEKLYVMLYKPTDVECSHNARDHKPVYDLLPERFTAMGIQSVGR
FT                   LDADSSGLLLLSNQGDFIHKVESPKKGLWKKYRVTLARPFTDAQKAELLAGVMLKDERR
FT                   PVLAREIEVSGDAVDISIGEGLYHQVRRMFAAVGNHVETLERIAIGPVVLDRTLGEGGW
FT                   RFLTDEEVAALS"
FT   gene            complement(775926..776789)
FT                   /locus_tag="Fisuc_0662"
FT   CDS_pept        complement(775926..776789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0662"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL2752 putative OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74274"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74274.1"
FT                   /translation="MGFLSWLFCVILVVALVLLLFPFAFRIDFEAGERGVRALFFFFKK
FT                   KVYEYEKKWKEEAGSKELAVDSEKLEPQDAPPMVEAVAKKPAETPKTEHLEASDSGAGN
FT                   ESEPPTEVKSSSVVEVAKPDDEKPADEKKPKKEKRKLSDREFWTIILTPDFDARAFKYI
FT                   LKILKAVLSLFRVRFRDCFVEGVRTDYQTMGYIAAVNGFLKAYSYVGDWDLRMDWCNEK
FT                   ELRAAGSVHLSITLLRIFCFTLETLVLAGILAFSFWRRRAHVIKTNELPQLGFIRRRIL
FT                   EFILED"
FT   gene            complement(776789..777367)
FT                   /locus_tag="Fisuc_0663"
FT   CDS_pept        complement(776789..777367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0663"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   gsu:GSU0813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74275"
FT                   /inference="protein motif:PFAM:PF05494"
FT                   /protein_id="ACX74275.1"
FT                   /translation="MFKKILIAIACASLLSFAAEDPVSVVKSKDVELQNIIKKSKRTAK
FT                   ETERVKNLLNDSFDFALLAKKSLAASDWKAQDEASQQKFVTEFQRMVRNSSANRLELYR
FT                   ADSTIYEPAKMKGTDDARVVAHLWNKGKESVLEYKMTLVNGKWKAWDLVIDDLSTARNY
FT                   KEQFSKILKDKSFAELIDIISKKADEAEK"
FT   gene            complement(777386..778744)
FT                   /locus_tag="Fisuc_0664"
FT   CDS_pept        complement(777386..778744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0664"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   gur:Gura_1042 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74276"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACX74276.1"
FT                   /translation="MTGIALAGEVRYDCLRFVEQGLASDPQMEELRYGTEAKKNKISAL
FT                   KSEVILPTFYVSMMVGPAPGLKEYNDYYFNQSGDTLGIEKAEKYDFSRMGPFWGVEAKF
FT                   VQPLNLGQYRTGKQALEADLQQKTFEIENSTLKKEVELQSYYYNYLLALEMKRIAADAQ
FT                   KQVDKAYDQLEEALDEDEPTVSQTDLLNLKAKMHTVKEGVIEADLGMKRVQLAIRFALG
FT                   LQDGETFAAEDTILAMRPEPMPTEDQVRELTIKHNPELKQLEAGLRARRFQMDLAEAKL
FT                   APEFFVMGQFEYVKSWAGNRNVVQKNAFAQDAVNKISGLIGVGLRYRLNFWKSWEEFRQ
FT                   ARTEYRGLKLKENYASEGLVAKAVEQYYQVVAAKGKLDALRESLRATESLLKDAAMKYD
FT                   LDKSQTSALVSAYTQNITMQKDYYFAVCRYNVEFAGLVAKMGLSLSDYKTYFK"
FT   gene            complement(778803..779492)
FT                   /locus_tag="Fisuc_0665"
FT   CDS_pept        complement(778803..779492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0665"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bba:Bd2462 soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74277"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACX74277.1"
FT                   /translation="MKKSSVRLSAMSVSVLFIIGFAVLFFFASEWYSNSRKLEKLAYQE
FT                   RILHNDIEHLEVVGKWTLDYVKIEKALTYMLGDRISEVSFRMLAENLWQISQSYSLDPL
FT                   IILAVVAQESRGNPLARGRFQTGKFSGALGLMQIKMETAKKIGRRFGVFVENEDDLMRP
FT                   DVNVVVGSAYLIRLIGKYGNLREALVAYNLGHTAVDKLLEKNAPLPTSYYEGVVRRYRD
FT                   LVKHCSF"
FT   gene            complement(779479..779706)
FT                   /locus_tag="Fisuc_0666"
FT   CDS_pept        complement(779479..779706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74278"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74278.1"
FT                   /translation="MVGQGREISDKQAQITALESQKARYIREIDRLESAIGPMRKLGVV
FT                   QDTTLLSSFGAIQDWVTYLEFLEKTRREKK"
FT   gene            complement(779728..780168)
FT                   /locus_tag="Fisuc_0667"
FT   CDS_pept        complement(779728..780168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74279"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74279.1"
FT                   /translation="MRADLIDIQVEDRGEEVEISLYGILGEYQLSAVREKLEMLVRGPG
FT                   VFFFVNLQNARFTTDAYRSLFLEILNLVKQQKATLILIFDSEELQAYFERYRNIFEIYK
FT                   SREEYRKSGISKQVNLVGVHYEKKSISLSLGFAISVALFLVG"
FT   gene            complement(780172..782028)
FT                   /locus_tag="Fisuc_0668"
FT   CDS_pept        complement(780172..782028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0668"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   sun:SUN_1273 4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74280"
FT                   /inference="protein motif:PFAM:PF03065"
FT                   /protein_id="ACX74280.1"
FT                   /translation="MNPRISFVLQMSPSTSYENLEAVARNLLEGLNVLLNSEQVKCSIF
FT                   LDGPVIEALYNVAKPLMFGKIQNAIRNGVLEFLGGGYYDPMLPLFPEDLQTMQLELHRD
FT                   YLKKVLGAEPQGYFNSSLVWEPGMADVLERSRFDYALVTEAAVQDALGRSTPVSGWFTL
FT                   EDRGALIRIVPVSEVLSKAIAEDNLSWRSVAEQYCRDGKSAIALLDIPSEPTEIIEFFG
FT                   RFVDFVEMNEVQTRTVGFAVDQLETCGTISFLVSAGRRLGLPSTARTCRELLIRRPEIN
FT                   MHHKSFLNLYRRARSVLSGKKWLEFCHALLPAMAPLYFRDMHNRSGMRSMMVRKRSNRM
FT                   LLSASQVLDDLTGFSGLRVDVCDFLLRGKKVLFCENPESSYLLDYRIGGALRAWNYKGA
FT                   KTNLVNSWRDDGEPSFAFLDCLVPNVDFTPVKLEQMLYDRKHLLADPYDYRILRSDVGT
FT                   EIMLDEEQGFDNEERKALFKIKKVFTFQGDAAKFTVSYAIDNLAYVNTKGYFGTILELG
FT                   LLSHGDVNKVWIDGKNVRWNMMEPLLYPDGQSLEIRDEKAGCVFRMAFDRPTSIFIGSI
FT                   FGATSTAAPQAFQGIRVFPFWNAPFNVLDRKAFKISVSVTKR"
FT   gene            complement(782208..782321)
FT                   /locus_tag="Fisuc_R0012"
FT   rRNA            complement(782208..782321)
FT                   /locus_tag="Fisuc_R0012"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(782430..785327)
FT                   /locus_tag="Fisuc_R0013"
FT   rRNA            complement(782430..785327)
FT                   /locus_tag="Fisuc_R0013"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(785507..785579)
FT                   /locus_tag="Fisuc_R0014"
FT                   /note="tRNA-Ala5"
FT   tRNA            complement(785507..785579)
FT                   /locus_tag="Fisuc_R0014"
FT                   /product="tRNA-Ala"
FT   gene            complement(785586..785659)
FT                   /locus_tag="Fisuc_R0015"
FT                   /note="tRNA-Ile3"
FT   tRNA            complement(785586..785659)
FT                   /locus_tag="Fisuc_R0015"
FT                   /product="tRNA-Ile"
FT   gene            complement(785755..787241)
FT                   /locus_tag="Fisuc_R0016"
FT   rRNA            complement(785755..787241)
FT                   /locus_tag="Fisuc_R0016"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(787714..788613)
FT                   /locus_tag="Fisuc_0669"
FT   CDS_pept        complement(787714..788613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0669"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: sfu:Sfum_1920 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74281"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ACX74281.1"
FT                   /translation="MPILFALVGATGVGKSRLSLELAERFNAEIIGVDSRQIYKDFAIG
FT                   TAQPSLEDMARVKHHMVDFLDPCKVFSAGDFCTNVKKLLSANPNQNYILVGGTGLYLQS
FT                   LMLGLPQIPKIEESVRKSFEDDAIKFGSKSLYEKAKQVDPEAMEKVEENNVQRIIRILE
FT                   VFQLTGRKLSEWQKEREGGVGVLPVFWLNRSRENLYARIDARVDQMMADGWLDEIHELA
FT                   KKVPLEAPAWQSLGYKELLCAKDGNQVRSVLEEVKRKTRNYAKRQLTWFRWQVKSTEVD
FT                   LDTCANPLECIHNRVVTP"
FT   gene            788644..789753
FT                   /locus_tag="Fisuc_0670"
FT   CDS_pept        788644..789753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0670"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74282"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74282.1"
FT                   /translation="MIKLKHIVALFLALGIFAGLSFFLNNQDKAHQILDKLEEASGMRE
FT                   EEPSSDEQDTTAFEQRLKDEIKIISSSYSKRSKRTIWTLARGETIVIYLLKAQKFVNKH
FT                   GGKVLLMEELNDNPNAYQSAKVDLLTPSGDSLNLILQISDNIFMNNASLLSVAFETTSI
FT                   SPEIISKLNSLDFPFDLLIPPFGLNESFYKDLDKIHNKEIVLWLAMESTKLNQVHNKLH
FT                   PLRIHHTAEQIEETIDSAKKVLPSAAGIATRYGEQAVKHKQLLQAILKPTDKYNMWFMD
FT                   LSKEDRTVVPQTCKDLKITCKIAFPYNPENSSVEDYVHQKLREAPKSGISIMILPLTEQ
FT                   NLSKIEDIAKKAAKQGTTLVELSTLLNSK"
FT   gene            789762..790490
FT                   /locus_tag="Fisuc_0671"
FT   CDS_pept        789762..790490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0671"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /EC_number="2.6.99.2"
FT                   /note="KEGG: geo:Geob_3418 pyridoxal phosphate biosynthetic
FT                   protein PdxJ; TIGRFAM: pyridoxal phosphate biosynthetic
FT                   protein PdxJ; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74283"
FT                   /inference="protein motif:TFAM:TIGR00559"
FT                   /protein_id="ACX74283.1"
FT                   /translation="MSTKLGVNVDHIATIREARKGKEPDPVAAAMIAELAGCNGITAHL
FT                   REDKRHIQDRDIRLLRGTVTTKLNLEMAPTQAMVQFAINRQPDMVTLVPEVHTELSTED
FT                   GLNVSAKIDELAKYIMTLRNNDIQVSVFIDAETEQVKAAKKVGANYVEFNTGKYATAFE
FT                   LGSREEVDREISALQDMTVLAHKYGLNVLAGRGLNYRNVEAVAQIDGIDEIIIGHSIVS
FT                   RAALVGMERAVKEMIEAIRG"
FT   gene            complement(790487..791239)
FT                   /locus_tag="Fisuc_0672"
FT   CDS_pept        complement(790487..791239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0672"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: mei:Msip34_1548 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74284"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACX74284.1"
FT                   /translation="MRYRFRCEYLGSAFYGWQEQNCGGKLRFVTVQSTLEEALSTALRA
FT                   PIRVVGSGRTDTGVHARGQCVHFDFDGELDPQKVVRSVNGLTKRLIRIRDLEPCASDFN
FT                   ARYDAVLRYYQYTIFTRPVALMRDFGWECGSLNLDIEAMGREAQSFLGEHDFIDFCIPR
FT                   NDGKSTLCTLSEFRLERLNDWSCMFHIKGNRFLHRQVRAMVGTLFDVGRGRYPEGTVNQ
FT                   IFEKNFKGERTWAPPQGLVLENVEYRDY"
FT   gene            complement(791239..792309)
FT                   /locus_tag="Fisuc_0673"
FT   CDS_pept        complement(791239..792309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0673"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_3543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74285"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74285.1"
FT                   /translation="MSNFENEKGFIAKFSGMKKYAAPVVLFVLACALIVYLKVDFSGSS
FT                   SSFDVSRYMQTRAKIDSLEVALWNSQGNVDAQVKIRDELANAWEDLSAMRTNTADEAET
FT                   PEENVGGFSGGVWLWIIGGTLAVLLCSVVLVLVLIHRKKIVETRMMEALAKSRETGEMP
FT                   SVDDTETVLTPRVHAPKKSIIDEAEEFAAKRRETMELQTKVAAAANPVDQSATNLNASN
FT                   ANASNVNSAKAAFEDEHGVPENRILTSPFNGRTVLRPTARERITSAMQSLSDVLHHDRT
FT                   KVKPAAPAAAPKPEVVATAVAHPLEMNRFDRESSVNSKILQMSRRGFPASAIASKLKIP
FT                   QAKVEAVIKEAVEAGN"
FT   gene            792633..794411
FT                   /locus_tag="Fisuc_0674"
FT   CDS_pept        792633..794411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74286"
FT                   /inference="similar to AA sequence:KEGG:Bpet0205"
FT                   /protein_id="ACX74286.1"
FT                   /translation="MQPQALRLSRITISNLRSIQRETFPLSDFTALIGYNNAGKTNILM
FT                   GIRWLLANFSLDISYFDDPNHPVEAEGLFEGITEQVLNRLGEEKAAEVEPFLSGTTLRV
FT                   KKVQRIPGELPGNIEFWAFCPPNGKRKGKDWVRVNDKFTAAFNRMFPESIAIWDFEGNQ
FT                   AYTKLMHEIFKPLERKFGGELSQVIEQFTELLSPGSDCQAEEIKAFDKEVNSALRPLFP
FT                   SVRVELDIPVPTLETFLKSATIKVVDEDDGFERDISRMGAGSQRAIQMALIRYLAEIKK
FT                   HHNNHYLSRKLLLIDSPELFLHPQAVELVRVALKNLSNEGYQVIFATHSAQMVTSEDVS
FT                   TSLLIRKNRERGTFMRKRMEDAVRQVVKDAPSQLQMLFSLSNSNELLFADYVLLTEGKT
FT                   EWRVLPALFERITGQSFALIKCALVRQGGVSNTRKSMQVLSAMDIPVRAIVDLDYAFTT
FT                   ATRDGFLSANDPDITECRNLFRELACHNHLRLVNGLPVNKHSNISASTAYAMMASMPEA
FT                   ERPIRNIHNKLCEQGIWVWTRGAIEEHLGLNGKNEMVWRNFIERSKSKNFVQTLPDYDG
FT                   IEALCQWIINGSRGQF"
FT   gene            complement(794486..796714)
FT                   /locus_tag="Fisuc_0675"
FT   CDS_pept        complement(794486..796714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0675"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: vch:VC1141 isocitrate dehydrogenase; TIGRFAM:
FT                   isocitrate dehydrogenase, NADP-dependent; PFAM: Isocitrate
FT                   dehydrogenase NADP-dependent monomeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74287"
FT                   /inference="protein motif:TFAM:TIGR00178"
FT                   /protein_id="ACX74287.1"
FT                   /translation="MNTKIYYTLTDESPFLATQSLLPIVSAFAKTADIDVETKNISLPG
FT                   RILAAFADTLPAGTTFAGKPVTDDLAFLGKLTLEPDANIIKLPNISASVPQLKAAIAEL
FT                   QKNGYALPDYPDAPANDEEKAIRARYDKVKGSAVNPVLRQGNSDRRAPNAVKNYARNNP
FT                   HSNGVWNESVKTYVASMQADDFYGNEKSITMAEADSFKIEFVDEAGAVTELRAAKPLLK
FT                   GEIIDATVMRMASLEKFIANAMAEAKAKGLLFSVHLKATMMKVSDPVLFGAFVRVFFKD
FT                   VFTKYADLFKELGIDANNGLGDLFKRLEGNAKEAEVKAAIDAALAAGPDLAMVDSAKGV
FT                   TNLHVPSDVIIDASMPAMIRNSGCMWNKEGKLQEVVACIPDRCYAGIYDETIEFCKQNG
FT                   AFDPKTMGTVPNVGLMAQGAEEYGSHDKTFVAKGKGVIRAVNSKGEVLLQQEVAAGDIF
FT                   RMCQAKDAPVRDWVKLAVTRARLSNTPAIFWLDPERAHDREIQKKVEAYLPEHDLKGLD
FT                   IKIMSPRKAIVETMKRAKAGLDTIGVTGNVMRDYLTDLFPILEVGTSAKMLSIVPLMAG
FT                   GGLYETGAGGSAPKQVQQFLAENYLRWDSLGEYFALVPAFEQVALKDGNKKAKVLADTL
FT                   DAANGKILEFNRTPARKIGELDNRGSHFYLALYWAQALAAQKDDAELAGKFAPIAAALS
FT                   AKETEIVAALAAEQGKPADIGGYYVPKAELLKKWMRPVEAFNAIIDNI"
FT   gene            complement(796772..798379)
FT                   /locus_tag="Fisuc_0676"
FT   CDS_pept        complement(796772..798379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74288"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74288.1"
FT                   /translation="MMRANKIIVSGLAAFWVSCAEVSTTPDVTGATTEPSTSPMAELTE
FT                   AQKTILAKSLYTLVDSTKVDSLKAIFGSDITKIDHRYIEYFNTRPYSVKNDQVFSYPSK
FT                   DGRKVCDVVTYKQENGKDQKGVFLAMSYDEHNHRCKWEGSKFEEKRCLADDYLGTHRNE
FT                   TVVDAKITDVDGVPVVIKSIGMTSFNQFFGYGVSCGEYLKEFKQSCNASNGLFMDFGDG
FT                   CNMNQLSLACASFIPEGKTPDEVLNSYTEGYKIQCLEDSIKYAPYDDENYVYHDPYSDS
FT                   LSRDSLSRIGELVYEWSRAQKHSMYAYRWQFSIIDSTVGLDDCNNFVYQEREDDEIALK
FT                   HLSSLGYAYNTLPDTKNADAYRKEGVYVLPDSLVAEFFPNLATYPAAGLEGLKWYPPEI
FT                   FYIIVLKDVGAKGHFVTNFDANGIYVTDIVKSGNCPEDTTVHYSMILLLNSPDWDVMNR
FT                   PIVKTTYVSDNWNCDKPETLEKIEPYGEWTISFDGSTYYEEWFSKFETDRYLELYGGKE
FT                   AFIEHFGEDRYLELVGKE"
FT   gene            complement(798381..799202)
FT                   /locus_tag="Fisuc_0677"
FT   CDS_pept        complement(798381..799202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0677"
FT                   /product="hypothetical protein, TIGR02147"
FT                   /note="TIGRFAM: hypothetical protein, TIGR02147; KEGG:
FT                   bba:Bd3700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74289"
FT                   /inference="protein motif:TFAM:TIGR02147"
FT                   /protein_id="ACX74289.1"
FT                   /translation="MKPITEYQDYREFMRDFYEERKRSSLFSWREFSKLAGFTSPNFMQ
FT                   LVCEGKSRLSKTGVEKVADAMELAGADRDYFLAMERFGDAKNDASKIQAFNEMQKIAKE
FT                   NRLRVVDAEAFKYFESWVNPVLRELAPIMPGAKPLELARKCYPVVSAAEVRHSLDFMCH
FT                   AEFLKKVGEDTYVQTEKVVTGSSEAIPLALRSMNRQMSKLATEAIDEIPPEKRHIAGVT
FT                   LGISEETYQWLVQKLETLRQQVVAMAAKEKEYDKVYRLNIQLFPLTKGKEE"
FT   gene            799571..801295
FT                   /locus_tag="Fisuc_0678"
FT   CDS_pept        799571..801295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0678"
FT                   /product="pectate lyase"
FT                   /note="TIGRFAM: pectate lyase; PFAM: Pectic acid lyase;
FT                   Carbohydrate binding family 6; KEGG: cja:CJA_2040 pectate
FT                   lyase, putative, pel10B"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74290"
FT                   /inference="protein motif:TFAM:TIGR02474"
FT                   /protein_id="ACX74290.1"
FT                   /translation="MKNFGFGNYKFFVAAMSVASFSFAATYTPPATAVSKINSYRGYSE
FT                   LTSAASGMDIDQYTYNMTTWQIANGGFYKAMADKYKSAYGGGQKSEWRAQGGADLGTID
FT                   NNATVQEMRLLAVRYKETTNNNYKSAFKTSFNKAVNFLLTMQRSKGGLPQVWPKRGNYS
FT                   DQITLNDNAMIRAMVTMMDIANKTSPFDSDIIDDATRSKMKSALNKAVDYLLKAQIVND
FT                   GKVTVWCAQHDTNSLAPVGARAYELPSKSGNESMGVVWFLMNWPDQNEAIQKAVKGAIA
FT                   WYKKNKLKDKAFSKTAGVVDKAGSSLWFRFYEVNNDNYFFCDRDGASTKTQDFMKISEE
FT                   RRKGYQWAGDYGSAILSTENAYLEALAKMDDNYVPPPPAPAMCGNDTCKTYIDGVDFID
FT                   IQGVKETTNTGFVGEGYANVDNSTGSYVTYGVTAFKEGKYTLFISFANGGGSARGYSVS
FT                   AGDKTLIADGSMESTAAWTTWKVQSIEIELPQGYSELKFTSLSKDGMANIDYIGWMSED
FT                   LKIGEVEVPRTSIDAMHSVRKAQPSNRYFVDFSRNANGAGAYFKRGNNTFRVNGKVR"
FT   gene            801297..803396
FT                   /locus_tag="Fisuc_0679"
FT   CDS_pept        801297..803396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0679"
FT                   /product="Pectinesterase"
FT                   /note="PFAM: Pectinesterase; Carbohydrate binding family 6;
FT                   KEGG: dda:Dd703_2766 pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74291"
FT                   /inference="protein motif:PFAM:PF01095"
FT                   /protein_id="ACX74291.1"
FT                   /translation="MLNSWFYKFAVCMPLAMAVNASAIAKHGFDFVLGVDGDFKAAIAK
FT                   ASSSGATESKRFILFVPNGEYNITKVTGDEHGKSTFSGSNISIIGESVDKTIIWNTTDT
FT                   EGISTTATLYFPSNKNMYMQDITLQNRGTYNSGSAARQVALQQNAGDKFIYKNVRLLSG
FT                   QDTYYTKKGRTYWEGGEIDGTVDFICGGGDVFFEGTKLVMTRNGGYITASQNPDTWGYV
FT                   FNNAIIEVSNSGFNKTFYLGRSWGRAKVVWLNTIMRAEPKAEGWGPDMNSAPVVFGEYN
FT                   SKNGSGGAINTSQRKTYFNGGKDASTATTLKTVWNANDAAKYTLKNVLGGSDNWDPTKF
FT                   TAQVSAPKISQEGANIIWNDDDNAICWAVFVNGKYHSNTTTNSIDVGGIAAGSKVTVRA
FT                   ANSMGGLGASSNEITVLEANVTYYNLTINSSIGGSVIASPNREKIAEGTAVTFTAEPAS
FT                   GWKFAGWTGKSASDAGSESTWKTTMTKNIELGAIFEAKGTTTFQAEDGIIDNAINESTN
FT                   AGFAGTGYINFGTGKSTVQVPVYVEFPGEYTMEMTYANGSGKARSLAFAAPGTCTAGVD
FT                   GCKGAEVISFEATDKWTTYQTKEATITLPKGASYITFSIVDGNDGPNLDQIKLTEKDVD
FT                   KGPVAITKITRVNTAVTESRIYDTNGKLVRYAKGNANLTGLTPGIYVVKTSAQGYTKQK
FT                   MVQVR"
FT   gene            803416..804324
FT                   /locus_tag="Fisuc_0680"
FT   CDS_pept        803416..804324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74292"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74292.1"
FT                   /translation="MLGIEQKKGNDEQLCGRMIAYARILPSPDAEPAETPFDDMIKNGL
FT                   LTLEGDFRQAEHKPSRREVNRAVDAKFNNFLKTMEENGVELPENLDVDAMRERLHELSN
FT                   MEVIPIPARIGNFNNEEDILKEDADIYYIGEFIGANQAHYCLTTLPIYYQAKYREQAKR
FT                   NEMDMLNEMLLQFEEGDFVNTEDIQKDTEELFPKGLTLNTFMGDLSKLLNVRVIPFLLA
FT                   CESDSEYDTQIQLFYAFMKGYPDQKDIKRIDKALRELRKQSDSIEARNLLELSCKRINA
FT                   IYNEDSQLASELLKQIETIEN"
FT   gene            804335..804970
FT                   /locus_tag="Fisuc_0681"
FT   CDS_pept        804335..804970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0681"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74293"
FT                   /inference="similar to AA sequence:KEGG:Patl_2976"
FT                   /protein_id="ACX74293.1"
FT                   /translation="MKQKFLVAITAVAFSLLTACDNGTSSGDVVATSLNDSRDGQIYNI
FT                   VKIGDQVWMAENLKYEIPVAAGEEPKSFCYSDSEINCGIYGRLYTWDNAANICPEGWHL
FT                   PDTTEWNKLFDAVGGKHIAGKKLKAVSNKWLVNSGTDEFGFGALPAGFKKTILDAYFFD
FT                   LGSYGNFWTDVQSAGSHAYHVTVFYDKDSVKYIEDPKDFALSVRCLKN"
FT   gene            805101..805304
FT                   /locus_tag="Fisuc_0682"
FT   CDS_pept        805101..805304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wol:WD1137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74294"
FT                   /inference="similar to AA sequence:KEGG:WD1137"
FT                   /protein_id="ACX74294.1"
FT                   /translation="MMKNARWDNEVVLDYIEQHDSEAFKKHDEKVRKDDHLTQAKKMLA
FT                   DNIPINDIIKYTGLSKEEIEGV"
FT   gene            complement(805655..806953)
FT                   /locus_tag="Fisuc_0683"
FT   CDS_pept        complement(805655..806953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0683"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3048 putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74295"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74295.1"
FT                   /translation="MVSNLFLQLAHIELLMSYPVKDILTLVKRDSRFNVKLLNDLYFED
FT                   SYVDESAYRFIMDNIVAWLYERGENPDEFIERIVKRCAAFEAVPARSVLRSYLPFVSSF
FT                   YSAEDARELCLEIIPKRYPFLTKASILRNDVIDGNRRVDFTFQFETPGVLAANPMRWIR
FT                   SMINIGPLLLNTPAYEHISYLATQTSFIEALENRVPAEMKEDGGVYIKGELVGRHATFE
FT                   DCIKEHNLDWKNDVEKSIGCVRSLTDIRDPKTGAILIEKDCYYGAPAYVLEFNFKANVN
FT                   ASEPFLKLMSSVVKQEFAAWAPIQKAHEQLLDAMNDSVTIVYYKSDDSISVNSKHLMRN
FT                   VPARILRKLLREYTVTGREEYENREIKRDPAICMDPLRPNFESRLNRVIAHINGSDDPE
FT                   HPSEGVKKYFEIERHRRGGFRFVPKCKIIFREE"
FT   gene            807055..808989
FT                   /locus_tag="Fisuc_0684"
FT   CDS_pept        807055..808989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0684"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   gbm:Gbem_0978 DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74296"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACX74296.1"
FT                   /translation="MAEIHLLSDEIINKIAAGEVIERPASAVKELIENAIDAGATRIQV
FT                   QIEQGGKKKIQVTDNGKGMGAADLDLCYLRHTTSKLTNADDLFHLHTNGFRGEAVASIA
FT                   AVSKLTITSATQEGESGRIIVKGGEVIEKEDIQASRGTTFLVEDLFYNTPVRRTFLGSE
FT                   TSECSRILDIVLKTAISHPEIRFDYKVGDRTVFTGVPGELRSRIAEAIGSKVAKGLLPV
FT                   DYTEAGVHVTGYISPTTETNGKRNHQFLFMRNRPIENKMVSKAVSQAYEPYGAQCKPVT
FT                   VLFLDMPDMEFDINVHPAKREVRFANGNLVFLVVTHAIRDTFTKDLEAHSPIIDLSDEF
FT                   MGGTTPASQTTPAQPAMPETPAQPQNDLPWENPFQQAKPYAAASQQPIQQQARPSFASK
FT                   PYAQPAKPVNSLSDKKSKYDVSDDVQDLFSLPEYGKIISLEPDHSKPAPPPETPWAPPS
FT                   FFQIANTYIAGEDSNGLLIIDQHAAHTRVLFEQAMESLQNNIMQDSQELLFPELIDLSK
FT                   QEKEIFRNVDEQLRKLGFFVEPFGGDTYQIRSIPSALPLSRAAKAVHDFLNDVDENDTK
FT                   NDMVKFQEAIAKSWAKTNAYQAGDKLKPEEITALVGQLMITQDPLKSPFGSPTLMRLTL
FT                   EELSKKFRH"
FT   gene            complement(808951..810117)
FT                   /locus_tag="Fisuc_0685"
FT   CDS_pept        complement(808951..810117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0685"
FT                   /product="Lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="PFAM: glycosyl transferase family 19; KEGG:
FT                   mca:MCA0400 lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74297"
FT                   /inference="protein motif:PRIAM:2.4.1.182"
FT                   /protein_id="ACX74297.1"
FT                   /translation="MQNVNEENSPYILFCAGEDSGDMIGAEMVSTAVQQGFKVIGLGGP
FT                   LMQEKGLQPLWDYNDLPVSGVGDVVPKYFSLKNVFEVLSDAAESKKCLGIVAIDYPGFN
FT                   MKLARLAKKWGKPMLYVAPPQIWAWKSKRASLFKQANNIRLAVFFDIEAKAYQQMGVET
FT                   VRIKHPIAGWVYDQVEPRSDMLLLPGSRRDSALRNLPSFVTVAERYRNVWAERNSGPLP
FT                   DVIVVASREHLEVPLLVALEKLYDGHLPSWLKVVVAPKIISERLNFYSAYSAALTSFGT
FT                   STLEMACVGIPFAACIVPDFLTYAMGKFMVKSEFLSLPNAIFGCGVTPEFIIRHKLNDR
FT                   MADAIVEALFQQDIGSADEIALRLRKALDVGKTSSELVSEFLAQFLKS"
FT   gene            complement(810104..813961)
FT                   /locus_tag="Fisuc_0686"
FT   CDS_pept        complement(810104..813961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0686"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: hch:HCH_01861 DNA polymerase III subunit
FT                   alpha; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   DNA polymerase III alpha subunit; PHP domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SMART:
FT                   phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74298"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ACX74298.1"
FT                   /translation="MAFVHLQTHSEFSILQASARLDDILAAAAAENAPAVALTDHGAMF
FT                   GILEIQTRGKELNKKRKEQGLPPVKTVYGCHIYVDTPSASQKDPTTFERLTLLVENEKG
FT                   YYNLLRIVSYRYEDGERWAEIPSVPLETINEFKEGIIAIAGDYFSRYGQNVASGRDSLA
FT                   LEYMDRLNEIFDHDHLYISVCDNGIPQQKHVNEFNVELAKKYGREVVAVGDVHYIKPED
FT                   ATSHKILRCISLKVTLNGFEDKRFPTEKFYFRTEKEMVELFGHIPGAIENTVKIAERCN
FT                   FTVKTGIGDEFWPRFKIPDEFLASEEYQNIKAIMKAEYDAEYPVVRERELKGVIKDRKK
FT                   KVKANYCAEKGIAEDALTDADNAEIDRLSQPEFFDADDNKAWEKNIHRWCKPGGDADIY
FT                   ITHLCNERLKWRFPDEDFKFPAHETNVGKRMYKELNCIRNMNVAGYLLIVWDFINWSRE
FT                   HGIPVGPGRGSAAGSLVTYIIGITDIDPLTFDLLFERFLNPERVSMPDIDTDFADRDRG
FT                   RVIQYVTDKYGKECVGQIITYGMLKSKAVITDVARVLGIPPAEAKAITKLFPQRTLNFS
FT                   LKQAWTGKDKKGNNLEDGYSPEPLQAMIGSRASYQNLWDVAKRLEDLPRQTGVHACGVV
FT                   ITPTPIYNLAPLYRAAPEDTPVVMYDKHYAEDIGLLKMDFLGLINLSIIQDTVKMVEQN
FT                   RNIKLVMNKIPIDDKATFELLGKGLTTTVFQFESPGMQKYLRELKPTRIFDLIAMNALY
FT                   RPGPIDQIPHFIARKNGKEEIDCYHPDLEQVLGETYGVIVYQEQVMKLAQILGGYSLGG
FT                   ADNIRRIMAKKMPEKMAKLEPEFFQKCLDKGYDKAMIQKVWDAVLPFCGYAFNKSHAAA
FT                   YAYVAYQTAYLKTHYGPEYMAASMTSKMGKTEDTVTIILECKRLGIPVLSPNINTSLGV
FT                   FSANTKGQILYGLAGIRNVGIAVVEDVVAERERRGIYKDIFDFCKRVTEYQAAQPEKRP
FT                   PLNKKVLECLIMAGALDDLPGSRAVQCATVDRALEVAMRSQEDKAKGQVSLFDLGGPAA
FT                   MPNTAEVLEEAEEWTAMEMLNKERSVLGLFLSGHPLDEFRPELTGFTSCSLSEDEITRY
FT                   VGDTVVVGGVVIRMRSIETKRGDTIGSGAIQDFQGEIEMFFKKDVWERLRDTVSVDDRV
FT                   LVKGVLEQQRDRDGYQIIVEEVIQLDRVRCDMVDYIHANFTVGMLTDEFLDKLEVEMKA
FT                   NLADEYCHGCQMVFHLEADSGFEHVVVLKKYKVVYTQELLQWLKTDLGALKVWVSNRAK
FT                   R"
FT   gene            complement(813991..814968)
FT                   /locus_tag="Fisuc_0687"
FT   CDS_pept        complement(813991..814968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0687"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gur:Gura_3795 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74299"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX74299.1"
FT                   /translation="MVIDVGIINYNGGSELTECVKSLKAQSSPVRVFVFDNASTDDSID
FT                   FLKKQGLDCQITQCPKNLGYAGACNGLLEQMDSEIQVLCNMDLEFDPTWAENLLKCFER
FT                   HPEAGSVASLVMEKSGFVNAVGVLLGSDLFAKNEGSGLDASDADIREKDVFGCYGAVMS
FT                   FRKAAAQAAGKMDDSFFLFFEETEWYFRHNLAGFKTVFCPEARVYHERSMTTVRYSPLK
FT                   LFYSERNRLRSAIRLLPLGSILVLPVRGFVRYLNMAKGGVPGQSGDGKKLSKVAICKAL
FT                   AKAWLEALVSLPKEWATRKKYERKYGNVAGKVRELLASYPLQDK"
FT   gene            complement(815046..817706)
FT                   /locus_tag="Fisuc_0688"
FT   CDS_pept        complement(815046..817706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0688"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74300"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74300.1"
FT                   /translation="MRIKKLASVAALASFGVLAGCSESNTSSFVAGDVDGGSANEATGI
FT                   VASNTSYSAAKTKLSRCSHAVVNQWEMDTTAVEQKAVTVSADSAFEGENFAVEANVAVD
FT                   AADAYTVASAGIGGTGSAWALQVENGEVVFKWRDSQEGEWRVLKADKDVQKGEWNDVRL
FT                   EHVDSLSILIVNGEIAGAYKHSTKLGNLDGDFTIGFDRTEGDGSNNSGRIAVVRVEYTF
FT                   DIYVIPVESSSSEVLPEDPKSTLGDRPWIAAWEFNDAANVGRDFSGNGHNAVIGEGAVA
FT                   TVDGVAKFDGKSGFSVPLTPDLKINDFVVESRFKPANSSRFNNILVAEPPGRYGDGWIF
FT                   RLGYGKLYFNIRDAANGTGWSEFEIASVPMNEWTVARVERLGDEISFFINDSLVKTVNF
FT                   KGDVSDLGYNWGLGYDAMNQALHQRYFDGEIDYIRFGENLAETAKVDPVKEDVEEQKPE
FT                   EQKSEDPKPEEQKPVEEVVDTTAVVEPVFEVEGDWLAAWEFNDAAKVGRDFSGNGHTAL
FT                   IGEGSVVAIDGIAAFNGKSGFYVDLAKDININEFVLETRVKPTQFGTMQNIIVAEPPGR
FT                   GVDGWQLRIDEGVLTVHLRDSDKDGDNWNIFPGKKMTLGEWSTVRVERSNDSLKVFQDG
FT                   VLTVSVAYEGDLTQMRYDWGIGYDAMKQAFHNRYFIGEMDYIRFGKFEGFSDVNDASVT
FT                   EVKPLAAWEFNEPTYVGLDRMANNSTKALVGTPVVEDTTVKLDGNSGLKVYLSPTFIRN
FT                   TFAVEARVKPTKFGGMQNIIVAEPPGRLGDGWIIRLDDGVLDAYFRDENTDGSTWNSLY
FT                   GKKLALDEWTTIRVERSADSIKVFQDGELTVKAAAKGDVSQLGYDIGIGYDAMNQAIHD
FT                   RFFVGEIDYIRYFEK"
FT   gene            817942..818883
FT                   /locus_tag="Fisuc_0689"
FT   CDS_pept        817942..818883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0689"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sat:SYN_00361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74301"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ACX74301.1"
FT                   /translation="MKQETSSSKVFAKRIIQLLVSIGGFAYIFYKIPFNEVVKNWNIGM
FT                   TPWVVAMLIDATLVMAIQANRWKGLSVQGPEIPFKTYYAYTAMGYFFNNLLPTGFGGDA
FT                   VKSLAFGKNYNQTSQSVSAVLIARIQGLLAMSLCFFTALPFAFSKADIPWSYTLIMAVA
FT                   SLACIIFISLCLFSDKIPIPEAISNKLSFIPKLQKSLSIYRKHKKQLLLSSLDSLWIQF
FT                   LTLFIAYAYFRAVGVDIDISILVVFISITVVVSMLPISLNGIGVREGIHVALFTGILGI
FT                   PASIVLAAGLLGYIPVLFQAAQGAVVLIARKK"
FT   gene            complement(818953..819591)
FT                   /locus_tag="Fisuc_0690"
FT   CDS_pept        complement(818953..819591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74302"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74302.1"
FT                   /translation="MPKTQINLEGWQDYRGNMAGSLLYVETSHQSEMPVRDQLNENEKG
FT                   FLYEPNYETSTYGLMSCYNVKAINTIVKSKSRYILFGTRYEGLSDSEMRNKYLIMGYMR
FT                   IDKIKDVRTRHVQRYMANPEMEEPECMQMEHNWAVYGPMRFVSLDDSFVVTDEILKEWG
FT                   YKGHASRQLKTVFSKEHLEKILAYLDSKQDMIDEYIATVDEYKEALAEE"
FT   gene            complement(819694..820503)
FT                   /locus_tag="Fisuc_0691"
FT   CDS_pept        complement(819694..820503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0691"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: ank:AnaeK_0698 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74303"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACX74303.1"
FT                   /translation="MIGVFDSGFGGLTILQKLRHTLPQYDYLYLGDNARAPYGSRSFET
FT                   IYRYTLQSVRELFHRGCPLVILACNTASAKALRSIQQQVLPVEFPDRRVLGIVRPTAEE
FT                   IGNFSKTGHIGIFATAGTVSSNSYVLEISHFFPNLKVTQHACPMWVPLVEYGERGTEGA
FT                   RFFVKKDVDQLLAADPEIDTVLLACTHYPLLEDEIRAALPPHVRLVVQGDIVADKTLDY
FT                   LKRHVDMENRLSKGGSVHYLTTDTAEFFKKGAFRFGMENISAESLTF"
FT   gene            complement(820487..822721)
FT                   /locus_tag="Fisuc_0692"
FT   CDS_pept        complement(820487..822721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0692"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase; KEGG: gem:GM21_2947 UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74304"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACX74304.1"
FT                   /translation="MDVESLLVGLNSDQRAAVLHDHEKNGQLLILAGAGSGKTSVLTKR
FT                   IQYRIMSGVEPEKILALTFTAKAAAEMRERVQKLFPNAGVRLCTFHSLALFVLKSKVPV
FT                   GYDEACAAGACSSCPAYELVGFKKMPVPTESADKTFMQELAKVGGRKFRFSREELFSDA
FT                   HPAKLLKKLEPLRHRILESGQVVFEDLIYQAINLLENHESARAYFQNQWTEILVDEYQD
FT                   INPSQYRLVKALLGERKSLFVVGDDDQAIYGFRGADIGNINRFRDDFKESSLIRLEWNY
FT                   RSVANILHFSNRIFENKPIHLRKVLRAGNMNGSGGSPIFKENREPEIWVSEDPVEEMQK
FT                   IITSIKLLRESYDLQWKNFAILVRYNRQRLYYEEALRDAHLPIAGTVVSEAGNVEGEGE
FT                   VLENGIHVETVHASKGLQYAVVYYAGMSEGLTPGSCLGSRKQRQKQLDEERRLFYVGVT
FT                   RAESFLVLLYCKRRYWKGRLTKLKRSRFLPKESSKTECNMPVMLFRIYGAARIFAFMLE
FT                   YIFKIAFMYIFRRKDLDPWLEEKVQVFSRFCMKVLRVDLTIEDQAQLAKVDWTRPVFVM
FT                   GNHRSYLDIPLAFLALQRTVGFIAKTQLQRIPILNFWMHKLGCVFIDREKGGGAAIIQK
FT                   ALQTGKMPRLFVFPEGTRSKRDGMVAFKSGCFRLAVEANAIILPMVTRGSDLLWEHRKD
FT                   SKHHPVNIKILEPIDTVEFKKTHGGDEMDPRHELLPYVRKMMEEAYDRRL"
FT   gene            complement(822788..823798)
FT                   /locus_tag="Fisuc_0693"
FT   CDS_pept        complement(822788..823798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0693"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sat:SYN_00361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74305"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ACX74305.1"
FT                   /translation="MKLNPKLKSVIIFCLKLVVTLVPAYFVYRNIVSDPEWDVGDLYNL
FT                   FKKNSVFPLVLALLCLAVSNFTACLQWKLLLEKQGVRLKYARLLKLYHVGLFFNNFMPG
FT                   NVGGDVKKVYDIRMQGGQDTVGAGFTATVFDRLFGLFFITLFALGVGALFFIHDPEQRA
FT                   FMWPSVWIFLGFCVMFAGLLSRRIGKFFCRMAGKVLPEKFETRLLRMFDRFQKFRSKKL
FT                   WINIICLSMVTQSLRIFVHFFCGIAVGVNLSMSWYFYYIPLVAIVSALPISIGGFGPRE
FT                   FLAQSLFARAGVPGLESVVIQLLAYFVSLILSLFGAVAFLVGQKPTPIEPAKNAQ"
FT   gene            complement(823795..824940)
FT                   /locus_tag="Fisuc_0694"
FT   CDS_pept        complement(823795..824940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0694"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   hch:HCH_01049 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74306"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX74306.1"
FT                   /translation="MKILVVNYRDRMHPAAGGAEKHLHRIFSKIVEMGHTVVLFTTTFP
FT                   GAKEREIVDGIQVIRKGGDLMFQLTVALNLKKLDREFDFDVVVEDLNKLPVFAHWFVRK
FT                   PLLVQMHHLWRKSIFAEAFFPIAFMVWFFERIIPFFYRTQNFVVVSPSTKKELAEIGVD
FT                   ESRISVIYNGSEKPNFPGCADLATGTAESSETAANPYFIWLSRVHRYKGIWTALEAFEI
FT                   FSKSHPEVQLKIVGGGPLLKKLPAWIKSHGLDGKVELTGFVPAARKYELLSSSLALLQT
FT                   SYKEGWGLTVMEAAQLCKTTIASDVPGLCDSVRDGETGILFPSGDATACASAMEKIYSD
FT                   AELRANLGKNAKHYAESFSWENSARETLELLERTVDWSVRK"
FT   gene            complement(824949..825725)
FT                   /locus_tag="Fisuc_0695"
FT   CDS_pept        complement(824949..825725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0695"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Tellurite
FT                   resistance methyltransferase, TehB, core; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   sfv:SFV_0194 putative biotin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74307"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACX74307.1"
FT                   /translation="MSIKEPDQSVWNRFWQRKNDMDKVYPSSPSIIEAIKKNFKLEGLK
FT                   VLEVGAGTGRDSAELARLGADVYVLDYAENSLKIVNSLRESEGLKNLHLVRGDAFKSPF
FT                   PDNTFDLVFHQGLAEHFKDSLPLLQENFRIVKHGGCCLCDVPQTVHPYTVIKHILIAMD
FT                   KWFAGWEKQFTMGQLKKLMRDAGFEYVYAYGDWMRPNLFYRILRELCFKFGIELPKYPL
FT                   DGTAYQKIKDKILDSLQSVPVMHYTQLCIGVIGRKP"
FT   gene            826165..826977
FT                   /locus_tag="Fisuc_0696"
FT   CDS_pept        826165..826977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0696"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; sigma-70
FT                   region 2 domain protein; KEGG: bcm:Bcenmc03_1844 RNA
FT                   polymerase sigma factor RpoS"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74308"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACX74308.1"
FT                   /translation="MHIDSTDTTLKRYLEDIRRTAPLSREEEQILFQKAKEGDKIARKK
FT                   LISANMRFVLKVAIQYRGCPIPLPDLVSEGAMGLVRAIESFEHTRGLKFISYGVWWIKA
FT                   YITRAINEQGNLIRLPANQHLRVRKALHEQSRGKEINEEIRELIQIGQRGVSFDSPLKA
FT                   DSKATYAEVLPDSGASNPEADSEIQSVEALARDLMEQLPEREARVITGIFGINQEAPQT
FT                   LREVGESMNISHERVRQLRDQALRRIRKYNSKDFLQEKKDAFLAAINK"
FT   gene            complement(827058..827183)
FT                   /pseudo
FT                   /locus_tag="Fisuc_0697"
FT   gene            complement(827237..827398)
FT                   /pseudo
FT                   /locus_tag="Fisuc_0698"
FT   gene            828043..830727
FT                   /locus_tag="Fisuc_0699"
FT   CDS_pept        828043..830727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0699"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: hde:HDEF_1083
FT                   putative S of type II restriction endonuclease, N6_Mtase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74309"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACX74309.1"
FT                   /translation="MAKSIEEQVEDWCKNQLENYFTKTESINSEIDKALKTAPSKKGGS
FT                   GQNLPDIKCFVSVGFRNIPVMIECKGTKGDFAKTDENGLISNTNKKGETDYTAITKYAV
FT                   NGAIHYAKSILDFTETYKETIAIGVNGYKQDNDLQLEIGVYYLSKDNLAIPKKVGDFSD
FT                   LSFLKKKNLKEFFEKIDELKLTLEEIESRKLALEDEIETKLKRLNQTMHDDLSITVKSR
FT                   VMLIVGLIMAGLGVEDVSEGLKVEELKGELGPKSNDAQKIINKVEDFLRMKNLPEEKRE
FT                   AIMHELSNVFKNEDLYKPKNGESKLRKVYVIVHKDILPYLTSDLPNIDFTGRLFNVLND
FT                   WVDVPDGAENDVVLTPRYVTELMAKLTEVNMNSYVWDYATGSAGFLISAMHLMIADAKN
FT                   KIKSPEELRKTIAKIKAEKLLGIEKLPEIYILAVLNMILMGDGSSNIINGDSTQFDGKY
FT                   KQGKMKDKEFPANVFLLNPPYSAPGKGLNFVEKALSKMKSGKAAVLIQENAGSTQGDGY
FT                   TKKILNKNTLIASIHMSTDLFIGKSSVQTAIYVFDVGIPHDTEKLVKFIDFSNDGYARQ
FT                   NRKKSSQSVNLKDADNAKERYAELVNLVVRGKGKDDKNLNYYKDCYVEDYITSEGNDWT
FT                   YSQHKKIDIKPTENDFKKIIKEYMAWQISNLIRNEDIYPWTNKSPEQSNCILSKKERDC
FT                   IQMKNATFKAITIGSLFDIHPTKAYKATNKDLFKEKGKVPVVANSSVDNGIGGWTNLKA
FT                   TEKGNKVVFSDTTTSDSIFYQPNDFVGYPHVQGLYPYCNKWDENSLLYFITCFRKSASG
FT                   LFNYGNKFTRKNALKMKVFLPEKNKEDIDFSFMETFISAQKKLIIQKLSCWLEQQKINN
FT                   EIYIIEKEIPQDTLSMIAEKKHH"
FT   gene            831025..833787
FT                   /locus_tag="Fisuc_0700"
FT   CDS_pept        831025..833787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0700"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: sde:Sde_1369
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74310"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ACX74310.1"
FT                   /translation="MEMETRYNPKIVEDRWHDQWNKNNDFAPSGKGEPFSVVIPPPNVT
FT                   GALHLGHALNDTLQDILVRYRRKTGRDTLWIPGTDHAGIATQAVVEKRLFQDEHKTRHD
FT                   IGRDALVERIWKWKDEYEARITKQLKSLGVSCDWSRQRFTLDPVCAKAVRHAFFNLFKK
FT                   GLIYRGKRLVNWDTKLQTAVADDEIYYETVKGHFWTFKYPLADGSGFIPVSTTRPETIM
FT                   GDTALAVHPNDERYKQFIGKMLKVPFVNREIPVIADAILVDMEFGTGSVKVTPAHDPND
FT                   YATGLRHKLPMINIMNDDGSLNENAGPFQGMKGQAARDAVVKGLEDLGLLIKVEDHEMQ
FT                   VGHSDRSKTVIEPYLSDQWFVKMDVLADNAMKAVTSGEIKIIPERYANKYLDWLKEKRD
FT                   WCISRQLWWGHRIPIWHADETTTEEDLNKAFAGRNDIYYYKAQNGIWLICSEEENLKED
FT                   AVAGHKIVQEEDVLDTWFSSGLWPHSTMGWPEQTDTLKKYYPTSVLVTSRDIITLWVAR
FT                   MVLFSQENMGTVPFHTVYIHPKILDGNGMTMSKSKGNGVDPMDIEKKYGTDALRFVMAS
FT                   LCTDNQDVRLPVKKEKQEDGSVINTSEKFEIGRNFSNKLWNACRFLFPHLEQAGALSKD
FT                   MLPMDSSIFALEDRWILSRLNSTIQDATKMLEEFHFAELAGFLYRFVWDDVCSSYLEIK
FT                   KAVINSETLTAEKKNAMAILSHVLRGVIDLLHPVMPFITEELNATLFPGSERVINSAWP
FT                   KADASLIDAKIEAAFNQAFAVVESVRGVRGRYNVSPATKLKAVVSVDTAETEASVKDCQ
FT                   AIITELGGLESFSVAVKAAKPKFSASSVVPGGELYIPLEGILDPAAEIARLEKEIEKAK
FT                   AFAASIEKKLSNEKFVNGAPEAVVNAERTKLATQQDIIAKNEAALKELR"
FT   gene            834036..835577
FT                   /locus_tag="Fisuc_0701"
FT   CDS_pept        834036..835577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74311"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74311.1"
FT                   /translation="MHLKSCGLSLFALAAASFTFTACTDSNPSTPFANTPVAGPTESSS
FT                   SSDGIPTSSENLSSSEIFASSSSSAQSPIIQAGFQTWRGTDKAQQIITGYDAGTGTSGY
FT                   WYEVNDSAFNGASKVIWVAAASEQCEGICGTFVLDRANMTYNPFAAVAFDLAGKNAQGE
FT                   LVAIDATDMGGICITYSSDFAPTLELSLGEAQNAIYEYALPIKSLRKTATPETFNIKWS
FT                   EFLQPAWAKNKITSEEAIKKLVSIQFKVQATTGSESRFDIIEVGSYGNCTYTPPPTPPI
FT                   DQNPDSDPNPNLPKTSPFETWYGSLGDYRIITGYDAGTETSGYWFTYGDDPIAGASYIV
FT                   WPVETDYIPGENDWMDPIIDHCEGICGTIEFNKGKMTERSPFIGLGFNIAGEKSLDDDI
FT                   YTGEPVDASAMGGVCVTYTSNNDIDLILGLGAKEEEYDYNLPTKVLPKSQTPMTKYVAW
FT                   ADFKQPSEGNGKKISGEGAAKILTMIKFEIPGEHGTQASVNIKSVGPYNGGDCHP"
FT   gene            835595..837223
FT                   /locus_tag="Fisuc_0702"
FT   CDS_pept        835595..837223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0702"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_0835 xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74312"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74312.1"
FT                   /translation="MLCSQKFFKPYILAAIAVSATFVACGDSDTVAPPPSFESSSSNGG
FT                   IFASSSSVIIAGSSSDFAVSSSSVALSSSQIAPSSSSAQPPIIKTKEAICGDMWCARRD
FT                   RDSRVNTGFDAGFETSGYWFDESDTEYQTEGSTITWEGFDNRDCTFADDCFADMIEQCG
FT                   GICVTQTLVKRDQVNNLYASIGFNVAGVDEQNKRIVTDISELEGLCVVYTSDTEVYLEM
FT                   HIDDVSNKYLALDFPRATLPQASTPVMKDFTWKDFKQDGTGNMRISGEDAAKSLVSLMF
FT                   TLKGSQDASNHFNIMSIGRYGTCRTVANVDSVAQLSKSPFRTWHGSRDFEIKTGYDNGS
FT                   KTSGIWFSIFDDQQNGASSITWPIDPPYDNFSEDSFDSWRMELIEECKGICAEYYLNKF
FT                   QFPDEKEPFVGIGIIIAGEEINPESNISYLTTIDATNMGGVCVSYTSDNDMYIQMGLGD
FT                   KKDEELNYALPIVSIPASKEVNTVYVKWSQFQQPSWYDGDKKITGAEAAKSLAAVHFLA
FT                   HGQSGSAGKFNIMSIGPYNRGYCYP"
FT   gene            837570..839165
FT                   /locus_tag="Fisuc_0703"
FT   CDS_pept        837570..839165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74313"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74313.1"
FT                   /translation="MNRKQRKSFGKASLFALIAASLPFTACSYLDDIMPPEHDPGHDHP
FT                   IIRSSSSNLVESSSSTVRPHSSFETWYGYEGIPQIETGFGNETESYGYWLSKNDESEGG
FT                   LSQIFWPAEKGNDYSDDAMDNIIEHCGGLCGTYLLNKGSMTYNPFVSVGFNLVGERVFG
FT                   DPTPAPANATSMGGVCVTYASDMIVSLEMGLTDEMEENVGYAVPSATLPKSATGTTKFL
FT                   SWSDFKQPSWYKGSFKMPGEKAAQQLVSLRFKFQGTSGSLGSFNIAAVGPYDGCKDSMF
FT                   PVYKPTPTIPDPVDPPDPIDPPAPTTNDFETWFGYNSIYQIQTGYDNGSATSGYWFSYG
FT                   DDVDGGASKIVWPVELGNEYSDDAIDPVIDYCGGLCGTAILSKGTLTYSPYVGVGFGLA
FT                   GESKYGDLEPADAAGMGGVCISYISDVAPALEMSLGEEMDAAIGYALPAAFLPKSTVGT
FT                   TKFLKWSDFKQPSWYKGATKITGEQASRMLASLKFKMQAAPGSYNFNIQAIGPYNGGTC
FT                   SNTFTAGSNKKKRH"
FT   gene            complement(839252..840091)
FT                   /locus_tag="Fisuc_0704"
FT   CDS_pept        complement(839252..840091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0704"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecy:ECSE_0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74314"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX74314.1"
FT                   /translation="MKKSPFIWNNVHFVGELSLDWENPKVCRYMPFSRVCEMLKNRQIA
FT                   FVSPELWEDPFEKRFYDVKVVKNKEGKPKESVALPNMACLCFTSSSSENAEAFWSRSKT
FT                   SDEPYIRVVFDLYELLDALNSFADKHSARIYFAAAKYEFEHEIKNVHKKRNFTEDKLER
FT                   SYVSLMSLKRKAFSYEQELRLFIVWDKNSKKIKDFDKNKVVFVSYKKSFNNLIKRMTFD
FT                   PRLDSFEDDENSEKDKKAESKYEKELKQVLEDAKLNIDPDFSGLYSGCKCREIELSK"
FT   gene            complement(840116..841861)
FT                   /locus_tag="Fisuc_0705"
FT   CDS_pept        complement(840116..841861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fisuc_0705"
FT                   /product="lipoprotein"
FT                   /note="TIGRFAM: lipoprotein; PFAM: protein of unknown
FT                   function DUF285 lipoprotein; KEGG: sun:SUN_1960
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fisuc_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACX74315"
FT                   /inference="protein motif:TFAM:TIGR02167"
FT                   /protein_id="