(data stored in ACNUC7421 zone)

EMBL: CP001794

ID   CP001794; SV 1; circular; genomic DNA; STD; PRO; 3622844 BP.
XX
AC   CP001794; ACED01000000-ACED01000061;
XX
PR   Project:PRJNA30537;
XX
DT   16-OCT-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Geobacillus sp. Y412MC61, complete genome.
XX
KW   .
XX
OS   Geobacillus sp. Y412MC61
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
XX
RN   [1]
RP   1-3622844
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Brumm P.,
RA   Mead D.;
RT   "Complete sequence of chromosome of Geobacillus sp. Y412MC61";
RL   Unpublished.
XX
RN   [2]
RP   1-3622844
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Brumm P.,
RA   Mead D.;
RT   ;
RL   Submitted (07-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9ccc8f11c5fb409e4b5b42a5f076f07a.
DR   BioSample; SAMN00017500.
DR   EnsemblGenomes-Gn; EBG00001205412.
DR   EnsemblGenomes-Gn; EBG00001205413.
DR   EnsemblGenomes-Gn; EBG00001205414.
DR   EnsemblGenomes-Gn; EBG00001205415.
DR   EnsemblGenomes-Gn; EBG00001205416.
DR   EnsemblGenomes-Gn; EBG00001205417.
DR   EnsemblGenomes-Gn; EBG00001205418.
DR   EnsemblGenomes-Gn; EBG00001205419.
DR   EnsemblGenomes-Gn; EBG00001205420.
DR   EnsemblGenomes-Gn; EBG00001205421.
DR   EnsemblGenomes-Gn; EBG00001205422.
DR   EnsemblGenomes-Gn; EBG00001205423.
DR   EnsemblGenomes-Gn; EBG00001205424.
DR   EnsemblGenomes-Gn; EBG00001205425.
DR   EnsemblGenomes-Gn; EBG00001205426.
DR   EnsemblGenomes-Gn; EBG00001205427.
DR   EnsemblGenomes-Gn; EBG00001205428.
DR   EnsemblGenomes-Gn; EBG00001205429.
DR   EnsemblGenomes-Gn; EBG00001205430.
DR   EnsemblGenomes-Gn; EBG00001205431.
DR   EnsemblGenomes-Gn; EBG00001205432.
DR   EnsemblGenomes-Gn; EBG00001205433.
DR   EnsemblGenomes-Gn; EBG00001205434.
DR   EnsemblGenomes-Gn; EBG00001205435.
DR   EnsemblGenomes-Gn; EBG00001205436.
DR   EnsemblGenomes-Gn; EBG00001205437.
DR   EnsemblGenomes-Gn; EBG00001205438.
DR   EnsemblGenomes-Gn; EBG00001205439.
DR   EnsemblGenomes-Gn; EBG00001205440.
DR   EnsemblGenomes-Gn; EBG00001205441.
DR   EnsemblGenomes-Gn; EBG00001205442.
DR   EnsemblGenomes-Gn; EBG00001205443.
DR   EnsemblGenomes-Gn; EBG00001205444.
DR   EnsemblGenomes-Gn; EBG00001205445.
DR   EnsemblGenomes-Gn; EBG00001205446.
DR   EnsemblGenomes-Gn; EBG00001205447.
DR   EnsemblGenomes-Gn; EBG00001205448.
DR   EnsemblGenomes-Gn; EBG00001205449.
DR   EnsemblGenomes-Gn; EBG00001205450.
DR   EnsemblGenomes-Gn; EBG00001205451.
DR   EnsemblGenomes-Gn; EBG00001205452.
DR   EnsemblGenomes-Gn; EBG00001205453.
DR   EnsemblGenomes-Gn; EBG00001205454.
DR   EnsemblGenomes-Gn; EBG00001205455.
DR   EnsemblGenomes-Gn; EBG00001205456.
DR   EnsemblGenomes-Gn; EBG00001205457.
DR   EnsemblGenomes-Gn; EBG00001205458.
DR   EnsemblGenomes-Gn; EBG00001205459.
DR   EnsemblGenomes-Gn; EBG00001205460.
DR   EnsemblGenomes-Gn; EBG00001205461.
DR   EnsemblGenomes-Gn; EBG00001205462.
DR   EnsemblGenomes-Gn; EBG00001205463.
DR   EnsemblGenomes-Gn; EBG00001205464.
DR   EnsemblGenomes-Gn; EBG00001205465.
DR   EnsemblGenomes-Gn; EBG00001205466.
DR   EnsemblGenomes-Gn; EBG00001205467.
DR   EnsemblGenomes-Gn; EBG00001205468.
DR   EnsemblGenomes-Gn; EBG00001205469.
DR   EnsemblGenomes-Gn; EBG00001205470.
DR   EnsemblGenomes-Gn; EBG00001205471.
DR   EnsemblGenomes-Gn; EBG00001205472.
DR   EnsemblGenomes-Gn; EBG00001205473.
DR   EnsemblGenomes-Gn; EBG00001205474.
DR   EnsemblGenomes-Gn; EBG00001205475.
DR   EnsemblGenomes-Gn; EBG00001205476.
DR   EnsemblGenomes-Gn; EBG00001205477.
DR   EnsemblGenomes-Gn; EBG00001205478.
DR   EnsemblGenomes-Gn; EBG00001205479.
DR   EnsemblGenomes-Gn; EBG00001205480.
DR   EnsemblGenomes-Gn; EBG00001205481.
DR   EnsemblGenomes-Gn; EBG00001205482.
DR   EnsemblGenomes-Gn; EBG00001205483.
DR   EnsemblGenomes-Gn; EBG00001205484.
DR   EnsemblGenomes-Gn; EBG00001205485.
DR   EnsemblGenomes-Gn; EBG00001205486.
DR   EnsemblGenomes-Gn; EBG00001205487.
DR   EnsemblGenomes-Gn; EBG00001205488.
DR   EnsemblGenomes-Gn; EBG00001205489.
DR   EnsemblGenomes-Gn; EBG00001205490.
DR   EnsemblGenomes-Gn; EBG00001205491.
DR   EnsemblGenomes-Gn; EBG00001205492.
DR   EnsemblGenomes-Gn; EBG00001205493.
DR   EnsemblGenomes-Gn; EBG00001205494.
DR   EnsemblGenomes-Gn; EBG00001205495.
DR   EnsemblGenomes-Gn; EBG00001205496.
DR   EnsemblGenomes-Gn; EBG00001205497.
DR   EnsemblGenomes-Gn; EBG00001205498.
DR   EnsemblGenomes-Gn; EBG00001205499.
DR   EnsemblGenomes-Gn; EBG00001205500.
DR   EnsemblGenomes-Gn; EBG00001205501.
DR   EnsemblGenomes-Gn; EBG00001205502.
DR   EnsemblGenomes-Gn; EBG00001205503.
DR   EnsemblGenomes-Gn; EBG00001205504.
DR   EnsemblGenomes-Gn; EBG00001205505.
DR   EnsemblGenomes-Gn; EBG00001205506.
DR   EnsemblGenomes-Gn; EBG00001205507.
DR   EnsemblGenomes-Gn; EBG00001205508.
DR   EnsemblGenomes-Gn; EBG00001205509.
DR   EnsemblGenomes-Gn; EBG00001205510.
DR   EnsemblGenomes-Gn; EBG00001205511.
DR   EnsemblGenomes-Gn; EBG00001205512.
DR   EnsemblGenomes-Gn; EBG00001205513.
DR   EnsemblGenomes-Gn; EBG00001205514.
DR   EnsemblGenomes-Gn; EBG00001205515.
DR   EnsemblGenomes-Gn; EBG00001205516.
DR   EnsemblGenomes-Gn; EBG00001205517.
DR   EnsemblGenomes-Gn; EBG00001205518.
DR   EnsemblGenomes-Gn; EBG00001205519.
DR   EnsemblGenomes-Gn; EBG00001205520.
DR   EnsemblGenomes-Gn; EBG00001205521.
DR   EnsemblGenomes-Gn; EBG00001205522.
DR   EnsemblGenomes-Gn; EBG00001205523.
DR   EnsemblGenomes-Gn; EBG00001205524.
DR   EnsemblGenomes-Gn; EBG00001205525.
DR   EnsemblGenomes-Gn; EBG00001205526.
DR   EnsemblGenomes-Gn; EBG00001205527.
DR   EnsemblGenomes-Gn; EBG00001205528.
DR   EnsemblGenomes-Gn; EBG00001205529.
DR   EnsemblGenomes-Gn; EBG00001205530.
DR   EnsemblGenomes-Gn; EBG00001205531.
DR   EnsemblGenomes-Gn; EBG00001205532.
DR   EnsemblGenomes-Gn; EBG00001205533.
DR   EnsemblGenomes-Gn; EBG00001205534.
DR   EnsemblGenomes-Gn; EBG00001205535.
DR   EnsemblGenomes-Gn; EBG00001205536.
DR   EnsemblGenomes-Gn; EBG00001205537.
DR   EnsemblGenomes-Gn; EBG00001205538.
DR   EnsemblGenomes-Gn; EBG00001205539.
DR   EnsemblGenomes-Gn; EBG00001205540.
DR   EnsemblGenomes-Gn; EBG00001205541.
DR   EnsemblGenomes-Gn; EBG00001205542.
DR   EnsemblGenomes-Gn; EBG00001205543.
DR   EnsemblGenomes-Gn; EBG00001205544.
DR   EnsemblGenomes-Gn; EBG00001205545.
DR   EnsemblGenomes-Gn; EBG00001205546.
DR   EnsemblGenomes-Gn; EBG00001205547.
DR   EnsemblGenomes-Gn; EBG00001205548.
DR   EnsemblGenomes-Gn; EBG00001205549.
DR   EnsemblGenomes-Gn; EBG00001205550.
DR   EnsemblGenomes-Gn; EBG00001205551.
DR   EnsemblGenomes-Gn; EBG00001205552.
DR   EnsemblGenomes-Gn; EBG00001205553.
DR   EnsemblGenomes-Gn; EBG00001205554.
DR   EnsemblGenomes-Gn; EBG00001205555.
DR   EnsemblGenomes-Gn; EBG00001205556.
DR   EnsemblGenomes-Gn; EBG00001205557.
DR   EnsemblGenomes-Gn; EBG00001205558.
DR   EnsemblGenomes-Gn; EBG00001205559.
DR   EnsemblGenomes-Gn; EBG00001205560.
DR   EnsemblGenomes-Gn; EBG00001205561.
DR   EnsemblGenomes-Gn; EBG00001205562.
DR   EnsemblGenomes-Gn; EBG00001205563.
DR   EnsemblGenomes-Gn; EBG00001205564.
DR   EnsemblGenomes-Gn; EBG00001205565.
DR   EnsemblGenomes-Gn; EBG00001205566.
DR   EnsemblGenomes-Gn; EBG00001205567.
DR   EnsemblGenomes-Gn; EBG00001205568.
DR   EnsemblGenomes-Gn; EBG00001205569.
DR   EnsemblGenomes-Gn; EBG00001205570.
DR   EnsemblGenomes-Gn; EBG00001205571.
DR   EnsemblGenomes-Gn; EBG00001205572.
DR   EnsemblGenomes-Gn; EBG00001205573.
DR   EnsemblGenomes-Gn; EBG00001205574.
DR   EnsemblGenomes-Gn; EBG00001205575.
DR   EnsemblGenomes-Gn; EBG00001205576.
DR   EnsemblGenomes-Gn; EBG00001205577.
DR   EnsemblGenomes-Gn; EBG00001205578.
DR   EnsemblGenomes-Gn; EBG00001205579.
DR   EnsemblGenomes-Gn; EBG00001205580.
DR   EnsemblGenomes-Gn; EBG00001205581.
DR   EnsemblGenomes-Gn; EBG00001205582.
DR   EnsemblGenomes-Gn; EBG00001205583.
DR   EnsemblGenomes-Gn; EBG00001205584.
DR   EnsemblGenomes-Gn; EBG00001205585.
DR   EnsemblGenomes-Gn; EBG00001205586.
DR   EnsemblGenomes-Gn; EBG00001205587.
DR   EnsemblGenomes-Gn; EBG00001205588.
DR   EnsemblGenomes-Gn; EBG00001205589.
DR   EnsemblGenomes-Gn; EBG00001205590.
DR   EnsemblGenomes-Gn; EBG00001205591.
DR   EnsemblGenomes-Gn; EBG00001205592.
DR   EnsemblGenomes-Gn; EBG00001205593.
DR   EnsemblGenomes-Gn; EBG00001205594.
DR   EnsemblGenomes-Gn; EBG00001205595.
DR   EnsemblGenomes-Gn; EBG00001205596.
DR   EnsemblGenomes-Gn; EBG00001205597.
DR   EnsemblGenomes-Gn; EBG00001205598.
DR   EnsemblGenomes-Gn; EBG00001205599.
DR   EnsemblGenomes-Gn; EBG00001205600.
DR   EnsemblGenomes-Gn; EBG00001205601.
DR   EnsemblGenomes-Gn; EBG00001205602.
DR   EnsemblGenomes-Gn; EBG00001205603.
DR   EnsemblGenomes-Gn; EBG00001205604.
DR   EnsemblGenomes-Gn; EBG00001205605.
DR   EnsemblGenomes-Gn; EBG00001205606.
DR   EnsemblGenomes-Gn; EBG00001205607.
DR   EnsemblGenomes-Gn; EBG00001205608.
DR   EnsemblGenomes-Gn; EBG00001205609.
DR   EnsemblGenomes-Gn; EBG00001205610.
DR   EnsemblGenomes-Gn; EBG00001205611.
DR   EnsemblGenomes-Gn; EBG00001205612.
DR   EnsemblGenomes-Gn; EBG00001205613.
DR   EnsemblGenomes-Gn; EBG00001205614.
DR   EnsemblGenomes-Gn; EBG00001205615.
DR   EnsemblGenomes-Gn; EBG00001205616.
DR   EnsemblGenomes-Gn; EBG00001205617.
DR   EnsemblGenomes-Gn; EBG00001205618.
DR   EnsemblGenomes-Gn; EBG00001205619.
DR   EnsemblGenomes-Gn; EBG00001205620.
DR   EnsemblGenomes-Gn; EBG00001205621.
DR   EnsemblGenomes-Gn; EBG00001205622.
DR   EnsemblGenomes-Gn; EBG00001205623.
DR   EnsemblGenomes-Gn; EBG00001205624.
DR   EnsemblGenomes-Gn; EBG00001205625.
DR   EnsemblGenomes-Gn; EBG00001205626.
DR   EnsemblGenomes-Gn; EBG00001205627.
DR   EnsemblGenomes-Gn; EBG00001205628.
DR   EnsemblGenomes-Gn; EBG00001205629.
DR   EnsemblGenomes-Gn; EBG00001205630.
DR   EnsemblGenomes-Gn; EBG00001205631.
DR   EnsemblGenomes-Gn; EBG00001205632.
DR   EnsemblGenomes-Gn; EBG00001205633.
DR   EnsemblGenomes-Gn; EBG00001205634.
DR   EnsemblGenomes-Gn; EBG00001205635.
DR   EnsemblGenomes-Gn; EBG00001205636.
DR   EnsemblGenomes-Gn; EBG00001205637.
DR   EnsemblGenomes-Gn; EBG00001205638.
DR   EnsemblGenomes-Gn; EBG00001205639.
DR   EnsemblGenomes-Gn; EBG00001205640.
DR   EnsemblGenomes-Gn; EBG00001205641.
DR   EnsemblGenomes-Gn; EBG00001205642.
DR   EnsemblGenomes-Gn; EBG00001205643.
DR   EnsemblGenomes-Gn; EBG00001205644.
DR   EnsemblGenomes-Gn; EBG00001205645.
DR   EnsemblGenomes-Gn; EBG00001205646.
DR   EnsemblGenomes-Gn; EBG00001205647.
DR   EnsemblGenomes-Gn; EBG00001205648.
DR   EnsemblGenomes-Gn; EBG00001205649.
DR   EnsemblGenomes-Gn; EBG00001205650.
DR   EnsemblGenomes-Gn; EBG00001205651.
DR   EnsemblGenomes-Gn; EBG00001205652.
DR   EnsemblGenomes-Gn; EBG00001205653.
DR   EnsemblGenomes-Gn; EBG00001205654.
DR   EnsemblGenomes-Gn; EBG00001205655.
DR   EnsemblGenomes-Gn; EBG00001205656.
DR   EnsemblGenomes-Gn; EBG00001205657.
DR   EnsemblGenomes-Gn; EBG00001205658.
DR   EnsemblGenomes-Gn; EBG00001205659.
DR   EnsemblGenomes-Gn; EBG00001205660.
DR   EnsemblGenomes-Gn; EBG00001205661.
DR   EnsemblGenomes-Gn; EBG00001205662.
DR   EnsemblGenomes-Gn; EBG00001205663.
DR   EnsemblGenomes-Gn; EBG00001205664.
DR   EnsemblGenomes-Gn; EBG00001205665.
DR   EnsemblGenomes-Gn; EBG00001205666.
DR   EnsemblGenomes-Gn; EBG00001205667.
DR   EnsemblGenomes-Gn; EBG00001205668.
DR   EnsemblGenomes-Gn; EBG00001205669.
DR   EnsemblGenomes-Gn; EBG00001205670.
DR   EnsemblGenomes-Gn; EBG00001205671.
DR   EnsemblGenomes-Gn; EBG00001205672.
DR   EnsemblGenomes-Gn; EBG00001205673.
DR   EnsemblGenomes-Gn; EBG00001205674.
DR   EnsemblGenomes-Gn; EBG00001205675.
DR   EnsemblGenomes-Gn; EBG00001205676.
DR   EnsemblGenomes-Gn; EBG00001205677.
DR   EnsemblGenomes-Gn; EBG00001205678.
DR   EnsemblGenomes-Gn; EBG00001205679.
DR   EnsemblGenomes-Gn; EBG00001205680.
DR   EnsemblGenomes-Gn; EBG00001205681.
DR   EnsemblGenomes-Gn; EBG00001205682.
DR   EnsemblGenomes-Gn; EBG00001205683.
DR   EnsemblGenomes-Gn; EBG00001205684.
DR   EnsemblGenomes-Gn; EBG00001205685.
DR   EnsemblGenomes-Gn; EBG00001205686.
DR   EnsemblGenomes-Gn; EBG00001205687.
DR   EnsemblGenomes-Gn; EBG00001205688.
DR   EnsemblGenomes-Gn; EBG00001205689.
DR   EnsemblGenomes-Gn; EBG00001205690.
DR   EnsemblGenomes-Gn; EBG00001205691.
DR   EnsemblGenomes-Gn; EBG00001205692.
DR   EnsemblGenomes-Gn; EBG00001205693.
DR   EnsemblGenomes-Gn; EBG00001205694.
DR   EnsemblGenomes-Gn; EBG00001205695.
DR   EnsemblGenomes-Gn; EBG00001205696.
DR   EnsemblGenomes-Gn; EBG00001205697.
DR   EnsemblGenomes-Gn; EBG00001205698.
DR   EnsemblGenomes-Gn; EBG00001205699.
DR   EnsemblGenomes-Gn; EBG00001205700.
DR   EnsemblGenomes-Gn; EBG00001205701.
DR   EnsemblGenomes-Gn; EBG00001205702.
DR   EnsemblGenomes-Gn; EBG00001205703.
DR   EnsemblGenomes-Gn; EBG00001205704.
DR   EnsemblGenomes-Gn; EBG00001205705.
DR   EnsemblGenomes-Gn; EBG00001205706.
DR   EnsemblGenomes-Gn; EBG00001205707.
DR   EnsemblGenomes-Gn; EBG00001205708.
DR   EnsemblGenomes-Gn; EBG00001205709.
DR   EnsemblGenomes-Gn; EBG00001205710.
DR   EnsemblGenomes-Gn; EBG00001205711.
DR   EnsemblGenomes-Gn; EBG00001205712.
DR   EnsemblGenomes-Gn; EBG00001205713.
DR   EnsemblGenomes-Gn; EBG00001205714.
DR   EnsemblGenomes-Gn; EBG00001205715.
DR   EnsemblGenomes-Gn; EBG00001205716.
DR   EnsemblGenomes-Gn; EBG00001205717.
DR   EnsemblGenomes-Gn; EBG00001205718.
DR   EnsemblGenomes-Gn; EBG00001205719.
DR   EnsemblGenomes-Gn; EBG00001205720.
DR   EnsemblGenomes-Gn; EBG00001205721.
DR   EnsemblGenomes-Gn; EBG00001205722.
DR   EnsemblGenomes-Gn; EBG00001205723.
DR   EnsemblGenomes-Gn; EBG00001205724.
DR   EnsemblGenomes-Gn; EBG00001205725.
DR   EnsemblGenomes-Gn; EBG00001205726.
DR   EnsemblGenomes-Gn; EBG00001205727.
DR   EnsemblGenomes-Gn; EBG00001205728.
DR   EnsemblGenomes-Gn; EBG00001205729.
DR   EnsemblGenomes-Gn; EBG00001205730.
DR   EnsemblGenomes-Gn; EBG00001205731.
DR   EnsemblGenomes-Gn; EBG00001205732.
DR   EnsemblGenomes-Gn; EBG00001205733.
DR   EnsemblGenomes-Gn; GYMC61_R0001.
DR   EnsemblGenomes-Gn; GYMC61_R0002.
DR   EnsemblGenomes-Gn; GYMC61_R0003.
DR   EnsemblGenomes-Gn; GYMC61_R0004.
DR   EnsemblGenomes-Gn; GYMC61_R0005.
DR   EnsemblGenomes-Gn; GYMC61_R0006.
DR   EnsemblGenomes-Gn; GYMC61_R0007.
DR   EnsemblGenomes-Gn; GYMC61_R0008.
DR   EnsemblGenomes-Gn; GYMC61_R0009.
DR   EnsemblGenomes-Gn; GYMC61_R0010.
DR   EnsemblGenomes-Gn; GYMC61_R0011.
DR   EnsemblGenomes-Gn; GYMC61_R0012.
DR   EnsemblGenomes-Gn; GYMC61_R0013.
DR   EnsemblGenomes-Gn; GYMC61_R0014.
DR   EnsemblGenomes-Gn; GYMC61_R0015.
DR   EnsemblGenomes-Gn; GYMC61_R0016.
DR   EnsemblGenomes-Gn; GYMC61_R0017.
DR   EnsemblGenomes-Gn; GYMC61_R0018.
DR   EnsemblGenomes-Gn; GYMC61_R0019.
DR   EnsemblGenomes-Gn; GYMC61_R0020.
DR   EnsemblGenomes-Gn; GYMC61_R0021.
DR   EnsemblGenomes-Gn; GYMC61_R0022.
DR   EnsemblGenomes-Gn; GYMC61_R0023.
DR   EnsemblGenomes-Gn; GYMC61_R0024.
DR   EnsemblGenomes-Gn; GYMC61_R0025.
DR   EnsemblGenomes-Gn; GYMC61_R0026.
DR   EnsemblGenomes-Gn; GYMC61_R0027.
DR   EnsemblGenomes-Gn; GYMC61_R0028.
DR   EnsemblGenomes-Gn; GYMC61_R0029.
DR   EnsemblGenomes-Gn; GYMC61_R0030.
DR   EnsemblGenomes-Gn; GYMC61_R0031.
DR   EnsemblGenomes-Gn; GYMC61_R0032.
DR   EnsemblGenomes-Gn; GYMC61_R0033.
DR   EnsemblGenomes-Gn; GYMC61_R0034.
DR   EnsemblGenomes-Gn; GYMC61_R0035.
DR   EnsemblGenomes-Gn; GYMC61_R0036.
DR   EnsemblGenomes-Gn; GYMC61_R0037.
DR   EnsemblGenomes-Gn; GYMC61_R0038.
DR   EnsemblGenomes-Gn; GYMC61_R0039.
DR   EnsemblGenomes-Gn; GYMC61_R0040.
DR   EnsemblGenomes-Gn; GYMC61_R0041.
DR   EnsemblGenomes-Gn; GYMC61_R0042.
DR   EnsemblGenomes-Gn; GYMC61_R0043.
DR   EnsemblGenomes-Gn; GYMC61_R0044.
DR   EnsemblGenomes-Gn; GYMC61_R0045.
DR   EnsemblGenomes-Gn; GYMC61_R0046.
DR   EnsemblGenomes-Gn; GYMC61_R0047.
DR   EnsemblGenomes-Gn; GYMC61_R0048.
DR   EnsemblGenomes-Gn; GYMC61_R0049.
DR   EnsemblGenomes-Gn; GYMC61_R0050.
DR   EnsemblGenomes-Gn; GYMC61_R0051.
DR   EnsemblGenomes-Gn; GYMC61_R0052.
DR   EnsemblGenomes-Gn; GYMC61_R0053.
DR   EnsemblGenomes-Gn; GYMC61_R0054.
DR   EnsemblGenomes-Gn; GYMC61_R0055.
DR   EnsemblGenomes-Gn; GYMC61_R0056.
DR   EnsemblGenomes-Gn; GYMC61_R0057.
DR   EnsemblGenomes-Gn; GYMC61_R0058.
DR   EnsemblGenomes-Gn; GYMC61_R0059.
DR   EnsemblGenomes-Gn; GYMC61_R0060.
DR   EnsemblGenomes-Gn; GYMC61_R0061.
DR   EnsemblGenomes-Gn; GYMC61_R0062.
DR   EnsemblGenomes-Gn; GYMC61_R0063.
DR   EnsemblGenomes-Gn; GYMC61_R0064.
DR   EnsemblGenomes-Gn; GYMC61_R0065.
DR   EnsemblGenomes-Gn; GYMC61_R0066.
DR   EnsemblGenomes-Gn; GYMC61_R0067.
DR   EnsemblGenomes-Gn; GYMC61_R0068.
DR   EnsemblGenomes-Gn; GYMC61_R0069.
DR   EnsemblGenomes-Gn; GYMC61_R0070.
DR   EnsemblGenomes-Gn; GYMC61_R0071.
DR   EnsemblGenomes-Gn; GYMC61_R0072.
DR   EnsemblGenomes-Gn; GYMC61_R0073.
DR   EnsemblGenomes-Gn; GYMC61_R0074.
DR   EnsemblGenomes-Gn; GYMC61_R0075.
DR   EnsemblGenomes-Gn; GYMC61_R0076.
DR   EnsemblGenomes-Gn; GYMC61_R0077.
DR   EnsemblGenomes-Gn; GYMC61_R0078.
DR   EnsemblGenomes-Gn; GYMC61_R0079.
DR   EnsemblGenomes-Gn; GYMC61_R0080.
DR   EnsemblGenomes-Gn; GYMC61_R0081.
DR   EnsemblGenomes-Gn; GYMC61_R0082.
DR   EnsemblGenomes-Gn; GYMC61_R0083.
DR   EnsemblGenomes-Gn; GYMC61_R0084.
DR   EnsemblGenomes-Gn; GYMC61_R0085.
DR   EnsemblGenomes-Gn; GYMC61_R0086.
DR   EnsemblGenomes-Gn; GYMC61_R0087.
DR   EnsemblGenomes-Gn; GYMC61_R0088.
DR   EnsemblGenomes-Gn; GYMC61_R0089.
DR   EnsemblGenomes-Gn; GYMC61_R0090.
DR   EnsemblGenomes-Gn; GYMC61_R0091.
DR   EnsemblGenomes-Gn; GYMC61_R0092.
DR   EnsemblGenomes-Gn; GYMC61_R0093.
DR   EnsemblGenomes-Gn; GYMC61_R0094.
DR   EnsemblGenomes-Gn; GYMC61_R0095.
DR   EnsemblGenomes-Gn; GYMC61_R0096.
DR   EnsemblGenomes-Gn; GYMC61_R0097.
DR   EnsemblGenomes-Gn; GYMC61_R0098.
DR   EnsemblGenomes-Gn; GYMC61_R0099.
DR   EnsemblGenomes-Gn; GYMC61_R0100.
DR   EnsemblGenomes-Gn; GYMC61_R0101.
DR   EnsemblGenomes-Gn; GYMC61_R0102.
DR   EnsemblGenomes-Gn; GYMC61_R0103.
DR   EnsemblGenomes-Gn; GYMC61_R0104.
DR   EnsemblGenomes-Gn; GYMC61_R0105.
DR   EnsemblGenomes-Gn; GYMC61_R0106.
DR   EnsemblGenomes-Gn; GYMC61_R0107.
DR   EnsemblGenomes-Gn; GYMC61_R0108.
DR   EnsemblGenomes-Gn; GYMC61_R0109.
DR   EnsemblGenomes-Gn; GYMC61_R0110.
DR   EnsemblGenomes-Gn; GYMC61_R0111.
DR   EnsemblGenomes-Gn; GYMC61_R0112.
DR   EnsemblGenomes-Gn; GYMC61_R0113.
DR   EnsemblGenomes-Gn; GYMC61_R0114.
DR   EnsemblGenomes-Gn; GYMC61_R0115.
DR   EnsemblGenomes-Gn; GYMC61_R0116.
DR   EnsemblGenomes-Gn; GYMC61_R0117.
DR   EnsemblGenomes-Tr; EBT00001576208.
DR   EnsemblGenomes-Tr; EBT00001576209.
DR   EnsemblGenomes-Tr; EBT00001576210.
DR   EnsemblGenomes-Tr; EBT00001576211.
DR   EnsemblGenomes-Tr; EBT00001576212.
DR   EnsemblGenomes-Tr; EBT00001576213.
DR   EnsemblGenomes-Tr; EBT00001576214.
DR   EnsemblGenomes-Tr; EBT00001576215.
DR   EnsemblGenomes-Tr; EBT00001576216.
DR   EnsemblGenomes-Tr; EBT00001576217.
DR   EnsemblGenomes-Tr; EBT00001576218.
DR   EnsemblGenomes-Tr; EBT00001576219.
DR   EnsemblGenomes-Tr; EBT00001576220.
DR   EnsemblGenomes-Tr; EBT00001576221.
DR   EnsemblGenomes-Tr; EBT00001576222.
DR   EnsemblGenomes-Tr; EBT00001576223.
DR   EnsemblGenomes-Tr; EBT00001576224.
DR   EnsemblGenomes-Tr; EBT00001576225.
DR   EnsemblGenomes-Tr; EBT00001576226.
DR   EnsemblGenomes-Tr; EBT00001576227.
DR   EnsemblGenomes-Tr; EBT00001576228.
DR   EnsemblGenomes-Tr; EBT00001576229.
DR   EnsemblGenomes-Tr; EBT00001576230.
DR   EnsemblGenomes-Tr; EBT00001576231.
DR   EnsemblGenomes-Tr; EBT00001576232.
DR   EnsemblGenomes-Tr; EBT00001576233.
DR   EnsemblGenomes-Tr; EBT00001576234.
DR   EnsemblGenomes-Tr; EBT00001576235.
DR   EnsemblGenomes-Tr; EBT00001576236.
DR   EnsemblGenomes-Tr; EBT00001576237.
DR   EnsemblGenomes-Tr; EBT00001576238.
DR   EnsemblGenomes-Tr; EBT00001576239.
DR   EnsemblGenomes-Tr; EBT00001576240.
DR   EnsemblGenomes-Tr; EBT00001576241.
DR   EnsemblGenomes-Tr; EBT00001576242.
DR   EnsemblGenomes-Tr; EBT00001576243.
DR   EnsemblGenomes-Tr; EBT00001576244.
DR   EnsemblGenomes-Tr; EBT00001576245.
DR   EnsemblGenomes-Tr; EBT00001576246.
DR   EnsemblGenomes-Tr; EBT00001576247.
DR   EnsemblGenomes-Tr; EBT00001576248.
DR   EnsemblGenomes-Tr; EBT00001576249.
DR   EnsemblGenomes-Tr; EBT00001576250.
DR   EnsemblGenomes-Tr; EBT00001576251.
DR   EnsemblGenomes-Tr; EBT00001576252.
DR   EnsemblGenomes-Tr; EBT00001576253.
DR   EnsemblGenomes-Tr; EBT00001576254.
DR   EnsemblGenomes-Tr; EBT00001576255.
DR   EnsemblGenomes-Tr; EBT00001576256.
DR   EnsemblGenomes-Tr; EBT00001576257.
DR   EnsemblGenomes-Tr; EBT00001576258.
DR   EnsemblGenomes-Tr; EBT00001576259.
DR   EnsemblGenomes-Tr; EBT00001576260.
DR   EnsemblGenomes-Tr; EBT00001576261.
DR   EnsemblGenomes-Tr; EBT00001576262.
DR   EnsemblGenomes-Tr; EBT00001576263.
DR   EnsemblGenomes-Tr; EBT00001576264.
DR   EnsemblGenomes-Tr; EBT00001576265.
DR   EnsemblGenomes-Tr; EBT00001576266.
DR   EnsemblGenomes-Tr; EBT00001576267.
DR   EnsemblGenomes-Tr; EBT00001576268.
DR   EnsemblGenomes-Tr; EBT00001576269.
DR   EnsemblGenomes-Tr; EBT00001576270.
DR   EnsemblGenomes-Tr; EBT00001576271.
DR   EnsemblGenomes-Tr; EBT00001576272.
DR   EnsemblGenomes-Tr; EBT00001576273.
DR   EnsemblGenomes-Tr; EBT00001576274.
DR   EnsemblGenomes-Tr; EBT00001576275.
DR   EnsemblGenomes-Tr; EBT00001576276.
DR   EnsemblGenomes-Tr; EBT00001576277.
DR   EnsemblGenomes-Tr; EBT00001576278.
DR   EnsemblGenomes-Tr; EBT00001576279.
DR   EnsemblGenomes-Tr; EBT00001576280.
DR   EnsemblGenomes-Tr; EBT00001576281.
DR   EnsemblGenomes-Tr; EBT00001576282.
DR   EnsemblGenomes-Tr; EBT00001576283.
DR   EnsemblGenomes-Tr; EBT00001576284.
DR   EnsemblGenomes-Tr; EBT00001576285.
DR   EnsemblGenomes-Tr; EBT00001576286.
DR   EnsemblGenomes-Tr; EBT00001576287.
DR   EnsemblGenomes-Tr; EBT00001576288.
DR   EnsemblGenomes-Tr; EBT00001576289.
DR   EnsemblGenomes-Tr; EBT00001576290.
DR   EnsemblGenomes-Tr; EBT00001576291.
DR   EnsemblGenomes-Tr; EBT00001576292.
DR   EnsemblGenomes-Tr; EBT00001576293.
DR   EnsemblGenomes-Tr; EBT00001576294.
DR   EnsemblGenomes-Tr; EBT00001576295.
DR   EnsemblGenomes-Tr; EBT00001576296.
DR   EnsemblGenomes-Tr; EBT00001576297.
DR   EnsemblGenomes-Tr; EBT00001576298.
DR   EnsemblGenomes-Tr; EBT00001576299.
DR   EnsemblGenomes-Tr; EBT00001576300.
DR   EnsemblGenomes-Tr; EBT00001576301.
DR   EnsemblGenomes-Tr; EBT00001576302.
DR   EnsemblGenomes-Tr; EBT00001576303.
DR   EnsemblGenomes-Tr; EBT00001576304.
DR   EnsemblGenomes-Tr; EBT00001576305.
DR   EnsemblGenomes-Tr; EBT00001576306.
DR   EnsemblGenomes-Tr; EBT00001576307.
DR   EnsemblGenomes-Tr; EBT00001576308.
DR   EnsemblGenomes-Tr; EBT00001576309.
DR   EnsemblGenomes-Tr; EBT00001576310.
DR   EnsemblGenomes-Tr; EBT00001576311.
DR   EnsemblGenomes-Tr; EBT00001576312.
DR   EnsemblGenomes-Tr; EBT00001576313.
DR   EnsemblGenomes-Tr; EBT00001576314.
DR   EnsemblGenomes-Tr; EBT00001576315.
DR   EnsemblGenomes-Tr; EBT00001576316.
DR   EnsemblGenomes-Tr; EBT00001576317.
DR   EnsemblGenomes-Tr; EBT00001576318.
DR   EnsemblGenomes-Tr; EBT00001576319.
DR   EnsemblGenomes-Tr; EBT00001576320.
DR   EnsemblGenomes-Tr; EBT00001576321.
DR   EnsemblGenomes-Tr; EBT00001576322.
DR   EnsemblGenomes-Tr; EBT00001576323.
DR   EnsemblGenomes-Tr; EBT00001576324.
DR   EnsemblGenomes-Tr; EBT00001576325.
DR   EnsemblGenomes-Tr; EBT00001576326.
DR   EnsemblGenomes-Tr; EBT00001576327.
DR   EnsemblGenomes-Tr; EBT00001576328.
DR   EnsemblGenomes-Tr; EBT00001576329.
DR   EnsemblGenomes-Tr; EBT00001576330.
DR   EnsemblGenomes-Tr; EBT00001576331.
DR   EnsemblGenomes-Tr; EBT00001576332.
DR   EnsemblGenomes-Tr; EBT00001576333.
DR   EnsemblGenomes-Tr; EBT00001576334.
DR   EnsemblGenomes-Tr; EBT00001576335.
DR   EnsemblGenomes-Tr; EBT00001576336.
DR   EnsemblGenomes-Tr; EBT00001576337.
DR   EnsemblGenomes-Tr; EBT00001576338.
DR   EnsemblGenomes-Tr; EBT00001576339.
DR   EnsemblGenomes-Tr; EBT00001576340.
DR   EnsemblGenomes-Tr; EBT00001576341.
DR   EnsemblGenomes-Tr; EBT00001576342.
DR   EnsemblGenomes-Tr; EBT00001576343.
DR   EnsemblGenomes-Tr; EBT00001576344.
DR   EnsemblGenomes-Tr; EBT00001576345.
DR   EnsemblGenomes-Tr; EBT00001576346.
DR   EnsemblGenomes-Tr; EBT00001576347.
DR   EnsemblGenomes-Tr; EBT00001576348.
DR   EnsemblGenomes-Tr; EBT00001576349.
DR   EnsemblGenomes-Tr; EBT00001576350.
DR   EnsemblGenomes-Tr; EBT00001576351.
DR   EnsemblGenomes-Tr; EBT00001576352.
DR   EnsemblGenomes-Tr; EBT00001576353.
DR   EnsemblGenomes-Tr; EBT00001576354.
DR   EnsemblGenomes-Tr; EBT00001576355.
DR   EnsemblGenomes-Tr; EBT00001576356.
DR   EnsemblGenomes-Tr; EBT00001576357.
DR   EnsemblGenomes-Tr; EBT00001576358.
DR   EnsemblGenomes-Tr; EBT00001576359.
DR   EnsemblGenomes-Tr; EBT00001576360.
DR   EnsemblGenomes-Tr; EBT00001576361.
DR   EnsemblGenomes-Tr; EBT00001576362.
DR   EnsemblGenomes-Tr; EBT00001576363.
DR   EnsemblGenomes-Tr; EBT00001576364.
DR   EnsemblGenomes-Tr; EBT00001576365.
DR   EnsemblGenomes-Tr; EBT00001576366.
DR   EnsemblGenomes-Tr; EBT00001576367.
DR   EnsemblGenomes-Tr; EBT00001576368.
DR   EnsemblGenomes-Tr; EBT00001576369.
DR   EnsemblGenomes-Tr; EBT00001576370.
DR   EnsemblGenomes-Tr; EBT00001576371.
DR   EnsemblGenomes-Tr; EBT00001576372.
DR   EnsemblGenomes-Tr; EBT00001576373.
DR   EnsemblGenomes-Tr; EBT00001576374.
DR   EnsemblGenomes-Tr; EBT00001576375.
DR   EnsemblGenomes-Tr; EBT00001576376.
DR   EnsemblGenomes-Tr; EBT00001576377.
DR   EnsemblGenomes-Tr; EBT00001576378.
DR   EnsemblGenomes-Tr; EBT00001576379.
DR   EnsemblGenomes-Tr; EBT00001576380.
DR   EnsemblGenomes-Tr; EBT00001576381.
DR   EnsemblGenomes-Tr; EBT00001576382.
DR   EnsemblGenomes-Tr; EBT00001576383.
DR   EnsemblGenomes-Tr; EBT00001576384.
DR   EnsemblGenomes-Tr; EBT00001576385.
DR   EnsemblGenomes-Tr; EBT00001576386.
DR   EnsemblGenomes-Tr; EBT00001576387.
DR   EnsemblGenomes-Tr; EBT00001576388.
DR   EnsemblGenomes-Tr; EBT00001576389.
DR   EnsemblGenomes-Tr; EBT00001576390.
DR   EnsemblGenomes-Tr; EBT00001576391.
DR   EnsemblGenomes-Tr; EBT00001576392.
DR   EnsemblGenomes-Tr; EBT00001576393.
DR   EnsemblGenomes-Tr; EBT00001576394.
DR   EnsemblGenomes-Tr; EBT00001576395.
DR   EnsemblGenomes-Tr; EBT00001576396.
DR   EnsemblGenomes-Tr; EBT00001576397.
DR   EnsemblGenomes-Tr; EBT00001576398.
DR   EnsemblGenomes-Tr; EBT00001576399.
DR   EnsemblGenomes-Tr; EBT00001576400.
DR   EnsemblGenomes-Tr; EBT00001576401.
DR   EnsemblGenomes-Tr; EBT00001576402.
DR   EnsemblGenomes-Tr; EBT00001576403.
DR   EnsemblGenomes-Tr; EBT00001576404.
DR   EnsemblGenomes-Tr; EBT00001576405.
DR   EnsemblGenomes-Tr; EBT00001576406.
DR   EnsemblGenomes-Tr; EBT00001576407.
DR   EnsemblGenomes-Tr; EBT00001576408.
DR   EnsemblGenomes-Tr; EBT00001576409.
DR   EnsemblGenomes-Tr; EBT00001576410.
DR   EnsemblGenomes-Tr; EBT00001576411.
DR   EnsemblGenomes-Tr; EBT00001576412.
DR   EnsemblGenomes-Tr; EBT00001576413.
DR   EnsemblGenomes-Tr; EBT00001576414.
DR   EnsemblGenomes-Tr; EBT00001576415.
DR   EnsemblGenomes-Tr; EBT00001576416.
DR   EnsemblGenomes-Tr; EBT00001576417.
DR   EnsemblGenomes-Tr; EBT00001576418.
DR   EnsemblGenomes-Tr; EBT00001576419.
DR   EnsemblGenomes-Tr; EBT00001576420.
DR   EnsemblGenomes-Tr; EBT00001576421.
DR   EnsemblGenomes-Tr; EBT00001576422.
DR   EnsemblGenomes-Tr; EBT00001576423.
DR   EnsemblGenomes-Tr; EBT00001576424.
DR   EnsemblGenomes-Tr; EBT00001576425.
DR   EnsemblGenomes-Tr; EBT00001576426.
DR   EnsemblGenomes-Tr; EBT00001576427.
DR   EnsemblGenomes-Tr; EBT00001576428.
DR   EnsemblGenomes-Tr; EBT00001576429.
DR   EnsemblGenomes-Tr; EBT00001576430.
DR   EnsemblGenomes-Tr; EBT00001576431.
DR   EnsemblGenomes-Tr; EBT00001576432.
DR   EnsemblGenomes-Tr; EBT00001576433.
DR   EnsemblGenomes-Tr; EBT00001576434.
DR   EnsemblGenomes-Tr; EBT00001576435.
DR   EnsemblGenomes-Tr; EBT00001576436.
DR   EnsemblGenomes-Tr; EBT00001576437.
DR   EnsemblGenomes-Tr; EBT00001576438.
DR   EnsemblGenomes-Tr; EBT00001576439.
DR   EnsemblGenomes-Tr; EBT00001576440.
DR   EnsemblGenomes-Tr; EBT00001576441.
DR   EnsemblGenomes-Tr; EBT00001576442.
DR   EnsemblGenomes-Tr; EBT00001576443.
DR   EnsemblGenomes-Tr; EBT00001576444.
DR   EnsemblGenomes-Tr; EBT00001576445.
DR   EnsemblGenomes-Tr; EBT00001576446.
DR   EnsemblGenomes-Tr; EBT00001576447.
DR   EnsemblGenomes-Tr; EBT00001576448.
DR   EnsemblGenomes-Tr; EBT00001576449.
DR   EnsemblGenomes-Tr; EBT00001576450.
DR   EnsemblGenomes-Tr; EBT00001576451.
DR   EnsemblGenomes-Tr; EBT00001576452.
DR   EnsemblGenomes-Tr; EBT00001576453.
DR   EnsemblGenomes-Tr; EBT00001576454.
DR   EnsemblGenomes-Tr; EBT00001576455.
DR   EnsemblGenomes-Tr; EBT00001576456.
DR   EnsemblGenomes-Tr; EBT00001576457.
DR   EnsemblGenomes-Tr; EBT00001576458.
DR   EnsemblGenomes-Tr; EBT00001576459.
DR   EnsemblGenomes-Tr; EBT00001576460.
DR   EnsemblGenomes-Tr; EBT00001576461.
DR   EnsemblGenomes-Tr; EBT00001576462.
DR   EnsemblGenomes-Tr; EBT00001576463.
DR   EnsemblGenomes-Tr; EBT00001576464.
DR   EnsemblGenomes-Tr; EBT00001576465.
DR   EnsemblGenomes-Tr; EBT00001576466.
DR   EnsemblGenomes-Tr; EBT00001576467.
DR   EnsemblGenomes-Tr; EBT00001576468.
DR   EnsemblGenomes-Tr; EBT00001576469.
DR   EnsemblGenomes-Tr; EBT00001576470.
DR   EnsemblGenomes-Tr; EBT00001576471.
DR   EnsemblGenomes-Tr; EBT00001576472.
DR   EnsemblGenomes-Tr; EBT00001576473.
DR   EnsemblGenomes-Tr; EBT00001576474.
DR   EnsemblGenomes-Tr; EBT00001576475.
DR   EnsemblGenomes-Tr; EBT00001576476.
DR   EnsemblGenomes-Tr; EBT00001576477.
DR   EnsemblGenomes-Tr; EBT00001576478.
DR   EnsemblGenomes-Tr; EBT00001576479.
DR   EnsemblGenomes-Tr; EBT00001576480.
DR   EnsemblGenomes-Tr; EBT00001576481.
DR   EnsemblGenomes-Tr; EBT00001576482.
DR   EnsemblGenomes-Tr; EBT00001576483.
DR   EnsemblGenomes-Tr; EBT00001576484.
DR   EnsemblGenomes-Tr; EBT00001576485.
DR   EnsemblGenomes-Tr; EBT00001576486.
DR   EnsemblGenomes-Tr; EBT00001576487.
DR   EnsemblGenomes-Tr; EBT00001576488.
DR   EnsemblGenomes-Tr; EBT00001576489.
DR   EnsemblGenomes-Tr; EBT00001576490.
DR   EnsemblGenomes-Tr; EBT00001576491.
DR   EnsemblGenomes-Tr; EBT00001576492.
DR   EnsemblGenomes-Tr; EBT00001576493.
DR   EnsemblGenomes-Tr; EBT00001576494.
DR   EnsemblGenomes-Tr; EBT00001576495.
DR   EnsemblGenomes-Tr; EBT00001576496.
DR   EnsemblGenomes-Tr; EBT00001576497.
DR   EnsemblGenomes-Tr; EBT00001576498.
DR   EnsemblGenomes-Tr; EBT00001576499.
DR   EnsemblGenomes-Tr; EBT00001576500.
DR   EnsemblGenomes-Tr; EBT00001576501.
DR   EnsemblGenomes-Tr; EBT00001576502.
DR   EnsemblGenomes-Tr; EBT00001576503.
DR   EnsemblGenomes-Tr; EBT00001576504.
DR   EnsemblGenomes-Tr; EBT00001576505.
DR   EnsemblGenomes-Tr; EBT00001576506.
DR   EnsemblGenomes-Tr; EBT00001576507.
DR   EnsemblGenomes-Tr; EBT00001576508.
DR   EnsemblGenomes-Tr; EBT00001576509.
DR   EnsemblGenomes-Tr; EBT00001576510.
DR   EnsemblGenomes-Tr; EBT00001576511.
DR   EnsemblGenomes-Tr; EBT00001576512.
DR   EnsemblGenomes-Tr; EBT00001576513.
DR   EnsemblGenomes-Tr; EBT00001576514.
DR   EnsemblGenomes-Tr; EBT00001576515.
DR   EnsemblGenomes-Tr; EBT00001576516.
DR   EnsemblGenomes-Tr; EBT00001576517.
DR   EnsemblGenomes-Tr; EBT00001576518.
DR   EnsemblGenomes-Tr; EBT00001576519.
DR   EnsemblGenomes-Tr; EBT00001576520.
DR   EnsemblGenomes-Tr; EBT00001576521.
DR   EnsemblGenomes-Tr; EBT00001576522.
DR   EnsemblGenomes-Tr; EBT00001576523.
DR   EnsemblGenomes-Tr; EBT00001576524.
DR   EnsemblGenomes-Tr; EBT00001576525.
DR   EnsemblGenomes-Tr; EBT00001576526.
DR   EnsemblGenomes-Tr; EBT00001576527.
DR   EnsemblGenomes-Tr; EBT00001576528.
DR   EnsemblGenomes-Tr; EBT00001576529.
DR   EnsemblGenomes-Tr; GYMC61_R0001-1.
DR   EnsemblGenomes-Tr; GYMC61_R0002-1.
DR   EnsemblGenomes-Tr; GYMC61_R0003-1.
DR   EnsemblGenomes-Tr; GYMC61_R0004-1.
DR   EnsemblGenomes-Tr; GYMC61_R0005-1.
DR   EnsemblGenomes-Tr; GYMC61_R0006-1.
DR   EnsemblGenomes-Tr; GYMC61_R0007-1.
DR   EnsemblGenomes-Tr; GYMC61_R0008-1.
DR   EnsemblGenomes-Tr; GYMC61_R0009-1.
DR   EnsemblGenomes-Tr; GYMC61_R0010-1.
DR   EnsemblGenomes-Tr; GYMC61_R0011-1.
DR   EnsemblGenomes-Tr; GYMC61_R0012-1.
DR   EnsemblGenomes-Tr; GYMC61_R0013-1.
DR   EnsemblGenomes-Tr; GYMC61_R0014-1.
DR   EnsemblGenomes-Tr; GYMC61_R0015-1.
DR   EnsemblGenomes-Tr; GYMC61_R0016-1.
DR   EnsemblGenomes-Tr; GYMC61_R0017-1.
DR   EnsemblGenomes-Tr; GYMC61_R0018-1.
DR   EnsemblGenomes-Tr; GYMC61_R0019-1.
DR   EnsemblGenomes-Tr; GYMC61_R0020-1.
DR   EnsemblGenomes-Tr; GYMC61_R0021-1.
DR   EnsemblGenomes-Tr; GYMC61_R0022-1.
DR   EnsemblGenomes-Tr; GYMC61_R0023-1.
DR   EnsemblGenomes-Tr; GYMC61_R0024-1.
DR   EnsemblGenomes-Tr; GYMC61_R0025-1.
DR   EnsemblGenomes-Tr; GYMC61_R0026-1.
DR   EnsemblGenomes-Tr; GYMC61_R0027-1.
DR   EnsemblGenomes-Tr; GYMC61_R0028-1.
DR   EnsemblGenomes-Tr; GYMC61_R0029-1.
DR   EnsemblGenomes-Tr; GYMC61_R0030-1.
DR   EnsemblGenomes-Tr; GYMC61_R0031-1.
DR   EnsemblGenomes-Tr; GYMC61_R0032-1.
DR   EnsemblGenomes-Tr; GYMC61_R0033-1.
DR   EnsemblGenomes-Tr; GYMC61_R0034-1.
DR   EnsemblGenomes-Tr; GYMC61_R0035-1.
DR   EnsemblGenomes-Tr; GYMC61_R0036-1.
DR   EnsemblGenomes-Tr; GYMC61_R0037-1.
DR   EnsemblGenomes-Tr; GYMC61_R0038-1.
DR   EnsemblGenomes-Tr; GYMC61_R0039-1.
DR   EnsemblGenomes-Tr; GYMC61_R0040-1.
DR   EnsemblGenomes-Tr; GYMC61_R0041-1.
DR   EnsemblGenomes-Tr; GYMC61_R0042-1.
DR   EnsemblGenomes-Tr; GYMC61_R0043-1.
DR   EnsemblGenomes-Tr; GYMC61_R0044-1.
DR   EnsemblGenomes-Tr; GYMC61_R0045-1.
DR   EnsemblGenomes-Tr; GYMC61_R0046-1.
DR   EnsemblGenomes-Tr; GYMC61_R0047-1.
DR   EnsemblGenomes-Tr; GYMC61_R0048-1.
DR   EnsemblGenomes-Tr; GYMC61_R0049-1.
DR   EnsemblGenomes-Tr; GYMC61_R0050-1.
DR   EnsemblGenomes-Tr; GYMC61_R0051-1.
DR   EnsemblGenomes-Tr; GYMC61_R0052-1.
DR   EnsemblGenomes-Tr; GYMC61_R0053-1.
DR   EnsemblGenomes-Tr; GYMC61_R0054-1.
DR   EnsemblGenomes-Tr; GYMC61_R0055-1.
DR   EnsemblGenomes-Tr; GYMC61_R0056-1.
DR   EnsemblGenomes-Tr; GYMC61_R0057-1.
DR   EnsemblGenomes-Tr; GYMC61_R0058-1.
DR   EnsemblGenomes-Tr; GYMC61_R0059-1.
DR   EnsemblGenomes-Tr; GYMC61_R0060-1.
DR   EnsemblGenomes-Tr; GYMC61_R0061-1.
DR   EnsemblGenomes-Tr; GYMC61_R0062-1.
DR   EnsemblGenomes-Tr; GYMC61_R0063-1.
DR   EnsemblGenomes-Tr; GYMC61_R0064-1.
DR   EnsemblGenomes-Tr; GYMC61_R0065-1.
DR   EnsemblGenomes-Tr; GYMC61_R0066-1.
DR   EnsemblGenomes-Tr; GYMC61_R0067-1.
DR   EnsemblGenomes-Tr; GYMC61_R0068-1.
DR   EnsemblGenomes-Tr; GYMC61_R0069-1.
DR   EnsemblGenomes-Tr; GYMC61_R0070-1.
DR   EnsemblGenomes-Tr; GYMC61_R0071-1.
DR   EnsemblGenomes-Tr; GYMC61_R0072-1.
DR   EnsemblGenomes-Tr; GYMC61_R0073-1.
DR   EnsemblGenomes-Tr; GYMC61_R0074-1.
DR   EnsemblGenomes-Tr; GYMC61_R0075-1.
DR   EnsemblGenomes-Tr; GYMC61_R0076-1.
DR   EnsemblGenomes-Tr; GYMC61_R0077-1.
DR   EnsemblGenomes-Tr; GYMC61_R0078-1.
DR   EnsemblGenomes-Tr; GYMC61_R0079-1.
DR   EnsemblGenomes-Tr; GYMC61_R0080-1.
DR   EnsemblGenomes-Tr; GYMC61_R0081-1.
DR   EnsemblGenomes-Tr; GYMC61_R0082-1.
DR   EnsemblGenomes-Tr; GYMC61_R0083-1.
DR   EnsemblGenomes-Tr; GYMC61_R0084-1.
DR   EnsemblGenomes-Tr; GYMC61_R0085-1.
DR   EnsemblGenomes-Tr; GYMC61_R0086-1.
DR   EnsemblGenomes-Tr; GYMC61_R0087-1.
DR   EnsemblGenomes-Tr; GYMC61_R0088-1.
DR   EnsemblGenomes-Tr; GYMC61_R0089-1.
DR   EnsemblGenomes-Tr; GYMC61_R0090-1.
DR   EnsemblGenomes-Tr; GYMC61_R0091-1.
DR   EnsemblGenomes-Tr; GYMC61_R0092-1.
DR   EnsemblGenomes-Tr; GYMC61_R0093-1.
DR   EnsemblGenomes-Tr; GYMC61_R0094-1.
DR   EnsemblGenomes-Tr; GYMC61_R0095-1.
DR   EnsemblGenomes-Tr; GYMC61_R0096-1.
DR   EnsemblGenomes-Tr; GYMC61_R0097-1.
DR   EnsemblGenomes-Tr; GYMC61_R0098-1.
DR   EnsemblGenomes-Tr; GYMC61_R0099-1.
DR   EnsemblGenomes-Tr; GYMC61_R0100-1.
DR   EnsemblGenomes-Tr; GYMC61_R0101-1.
DR   EnsemblGenomes-Tr; GYMC61_R0102-1.
DR   EnsemblGenomes-Tr; GYMC61_R0103-1.
DR   EnsemblGenomes-Tr; GYMC61_R0104-1.
DR   EnsemblGenomes-Tr; GYMC61_R0105-1.
DR   EnsemblGenomes-Tr; GYMC61_R0106-1.
DR   EnsemblGenomes-Tr; GYMC61_R0107-1.
DR   EnsemblGenomes-Tr; GYMC61_R0108-1.
DR   EnsemblGenomes-Tr; GYMC61_R0109-1.
DR   EnsemblGenomes-Tr; GYMC61_R0110-1.
DR   EnsemblGenomes-Tr; GYMC61_R0111-1.
DR   EnsemblGenomes-Tr; GYMC61_R0112-1.
DR   EnsemblGenomes-Tr; GYMC61_R0113-1.
DR   EnsemblGenomes-Tr; GYMC61_R0114-1.
DR   EnsemblGenomes-Tr; GYMC61_R0115-1.
DR   EnsemblGenomes-Tr; GYMC61_R0116-1.
DR   EnsemblGenomes-Tr; GYMC61_R0117-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001794.
DR   SILVA-SSU; CP001794.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024126
CC   Source DNA and bacteria available from David Mead
CC   (dmead@lucigen.com)
CC   Contacts: David Mead (dmead@lucigen.com)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Geobacillus sp. Y412MC61
CC   GOLD Stamp ID         :: Gi02566
CC   Funding Program       :: DOEM 2005
CC   Isolation Site        :: Obsidian Hot Spring in Yellowstone
CC                            National Park
CC   Isolation Country     :: USA
CC   Latitude              :: 44.376262
CC   Longitude             :: -110.690383
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Energy Source         :: Chemoorganotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3622844
FT                   /organism="Geobacillus sp. Y412MC61"
FT                   /strain="Y412MC61"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:544556"
FT   gene            123..1475
FT                   /locus_tag="GYMC61_0001"
FT   CDS_pept        123..1475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: gka:GK0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76701"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACX76701.1"
FT                   /translation="MENIHDLWDHVLAEIEQKISKPSFETWLKSTKAHSLRGDTLVIVA
FT                   PNEFARDWLDSRYSHLIAETIYTITGEELAVKFIIPPNQDDEELEFQSSKKKQRKPYEE
FT                   TNDFPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLM
FT                   HAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRDNRPDDFRNKYRNVDVLLIDDIQFLA
FT                   GKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLE
FT                   TRIAILRKKAKAEGFDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLA
FT                   AEALKDIIPSAKPKVITIQDIQRVVGQHFNIKMEDFKAKKRTKSVAFPRQIAMYLSREL
FT                   TDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDTQLQRHIQEIQEKLKQL"
FT   gene            1648..2784
FT                   /locus_tag="GYMC61_0002"
FT   CDS_pept        1648..2784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gka:GK0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76702"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACX76702.1"
FT                   /translation="MNISIDREALAKSVQDVMKAVSTRTTIPILTGIKLTATASGVTLT
FT                   GSDSDISIESFIPLEKEGKLLVDVKRPGSIVLQARFFSEIVKKLPQQTVEIEREDNFLT
FT                   IIRSGHSEFRLNGLNADEYPRLPQIEEENVFQIPADLLKTVIRQTVFAVSTSETRPILT
FT                   GVNWKVEHGELVCTATDSHRLAMRKVKIESENEVSYNVVIPGKSLNELSKILDDGNHPV
FT                   DIVMTANQVLFKAEHLLFFSRLLDGNYPETARLIPTESKTTMIVNAKEFLQAIDRASLL
FT                   AREGRNNVVKLTTLPGGMLEISSISPEIGKVTEQLQTESLEGEELNISFSAKYMMDALR
FT                   ALDGTDIQISFTGAMRPFLLRPLHTDSMLQLILPVRTY"
FT   gene            2973..3203
FT                   /locus_tag="GYMC61_0003"
FT   CDS_pept        2973..3203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: gka:GK0003
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76703"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ACX76703.1"
FT                   /translation="MTRMEQRVTITTETITLGQLLKLVRLIDTGGAAKWFLQEHHVLVN
FT                   GERENRRGRKLRDGDRIDIEPFGTFVVVKAE"
FT   gene            3215..4333
FT                   /locus_tag="GYMC61_0004"
FT   CDS_pept        3215..4333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gka:GK0004 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76704"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACX76704.1"
FT                   /translation="MFLTNLTLTNYRNYEYETLNFGEGVNVILGENAQGKTNMMEAIYV
FT                   LAMAKSHRTSNDKDLIRWNEEYAKIEGRAEKRSGSLTLELLISKKGKKARCNHIEQQRL
FT                   SQYVGHLNVVMFAPEDLNLVKGSPQVRRRFVDMEIGQVSPVYIHDLSQYQKLLQQRNHY
FT                   LKMMQARERSDEAVLDVLTEQLVLLAAKITLRRRQFLSLLEQWAMPIHYEISRGAEQLC
FT                   IRYEPSVDVSEKAELSRIVEAYSETFAAMREREVLRGTTLVGPHRDDIAFFVNGKNVQT
FT                   FGSQGQQRTTALAVKLAELELIFSELGDYPILLLDDVLSELDDFRQTHLLDAIRKKVQT
FT                   FVTTTSIDGIKHDIIQEAAIYRVHSGSVTAPS"
FT   gene            4380..6302
FT                   /locus_tag="GYMC61_0005"
FT   CDS_pept        4380..6302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gka:GK0005 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76705"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACX76705.1"
FT                   /translation="MTMEQRVEQTYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLV
FT                   WEIVDNSIDEALAGYCTNIDVTIGKDNSITVADNGRGIPVDIHEATGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVYRDGKIHYQRYERGEPCTDLQVIG
FT                   ETDRTGTTTRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLTDERVDSRKNEY
FT                   VYEGGIRSYVRHLNRTREVLHEEPIYIAGERDGIAVEIALQYNDGYTSNIYSFVNNIHT
FT                   HEGGTHESGFKMALTRIINDYARKQQIFKENDANLTGEDVREGLTAIVSIKHPSPQFEG
FT                   QTKTKLGNSDARTVTDAVFSEQFETFLLENPTIARKIVEKGMMAARARLAAKKARELTR
FT                   RKSALEISNLPGKLADCSSRDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKILN
FT                   VEKARLDKILSNNEVRAIITALGTGIGEEFDISKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRELIEHGYIYIAQPPLYKIEQGKQVRYAYNDRQLEKILAELPDQPKPTIQRYK
FT                   GLGEMNPEQLWETTMNPETRTLLQVSLQDAIDADETFEILMGDKVEPRRQFIEENARYV
FT                   KNLDI"
FT   gene            6453..8909
FT                   /locus_tag="GYMC61_0006"
FT   CDS_pept        6453..8909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gka:GK0006 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76706"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACX76706.1"
FT                   /translation="MAEHEQPRIREVNISQEMRSSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLV
FT                   DGHGNFGSIDGDAAAAMRYTEARMSKIAMELLRDINKDTIDYQDNYDGSEKEPVVLPSR
FT                   FPNLLVNGSSGIAVGMATNIPPHQLGEVIDALLALSQNPEMTVADLMEYIPGPDFPTAG
FT                   QIIGRSGIRKAYETGRGSITLRAKAEIEQQPNGKETIIVTELPYQVNKAKLIERIAELV
FT                   RDKKIDGITDLRDESDRSGMRIVIEVRRDANAKVVLNNLYKHTALQTSFGINMLALVNG
FT                   EPKVLNLKECLEHYLNHQKTVIRRRTAFELKKAEARAHILEGLRIALDHLDEVIDLIRR
FT                   SQTTEAAREGLMARFSLSERQAQAILDMRLQRLTGLEREKIEQEYQDLVRLIAELRGVL
FT                   ADEEKVLQIIRDELSEIKERFNDERRTEIVSGAVEQFDDEDLIPQEHVVITLTHKGYIK
FT                   RLPLSTYRSQKRGGRGVQGMHTAEDDFVEHLLITSTHDTVLFFTNKGKVYQAKGYEIPE
FT                   FGRTAKGLPIINLLELDKDEWINAMIPIESEFSDERYLVFATKQGIAKRSPLSAFAHIR
FT                   NNGLIAIHLREGDELISVRLTDGKKHLIIGTKNGMLIRFPETDVRAMGRSATGVKAITL
FT                   DDGDEVVGMEILEDHHDVLVVTKKGFGKRTPASEYRVQSRGGKGLKTCNVTDKNGPVVA
FT                   VTTVVGNEDVMVITTGGVLIRIAVSDISRTGRIAQGVKLIRLSGEDGHECVATVAKVPE
FT                   EERDEE"
FT   gene            9056..10123
FT                   /locus_tag="GYMC61_0007"
FT   CDS_pept        9056..10123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0007"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: gka:GK0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76707"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACX76707.1"
FT                   /translation="MVRVKRSQLREGCVLAEDVLGKTKRPIIPKNTVITKPLLLVLEKF
FT                   LVEEVDVEPLLANGEPFPNVDSASTAAAKQPMAFYLEAVQRYKTWFQSWQAGLPVDIGE
FT                   IRGVIISLFERMAGQKRELLMLHHYATKDEYLHHHAVSVGLLAGFLAMQLGYSEGECHQ
FT                   IALAGVLADCGMAKVSKRILTNPSALTEAEFNEVKQHPVFSYRMVQKIPALNHGAKLAV
FT                   LQHHERNDGSGYPLGVKAERIHPYSQIVAVADVYHAMTSERLYRRKQSPFRAIETMQRE
FT                   QFGKLSTEAVAALVNNLIGLQTGAVVKLSNGEMAEVMFIPSDEPARPIVKIIETGQLLS
FT                   LSVQRDIYIEEMVQG"
FT   gene            10516..12061
FT                   /locus_tag="GYMC61_R0001"
FT   rRNA            10516..12061
FT                   /locus_tag="GYMC61_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            12524..12597
FT                   /locus_tag="GYMC61_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            12524..12597
FT                   /locus_tag="GYMC61_R0002"
FT                   /product="tRNA-Ile"
FT   gene            12604..12679
FT                   /locus_tag="GYMC61_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            12604..12679
FT                   /locus_tag="GYMC61_R0003"
FT                   /product="tRNA-Ala"
FT   gene            12923..15850
FT                   /locus_tag="GYMC61_R0004"
FT   rRNA            12923..15850
FT                   /locus_tag="GYMC61_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            16091..16206
FT                   /locus_tag="GYMC61_R0005"
FT   rRNA            16091..16206
FT                   /locus_tag="GYMC61_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            complement(16250..17227)
FT                   /locus_tag="GYMC61_0008"
FT   CDS_pept        complement(16250..17227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76708"
FT                   /inference="similar to AA sequence:KEGG:GK0008"
FT                   /protein_id="ACX76708.1"
FT                   /translation="MFGNHGQLFRLSVFRSADTAQQFLRQCYQQLQRDDAVQRSYANCY
FT                   PFLYYLEHGQNFYAAAQQAPLSIKPVLLFYGMVQLLKACLLTVDPDYPESTSVLAHGVS
FT                   ARKRKKQGYEFLDDEVKIQKNGLFAHFSEKMFHVKQEAGEKFRMGTLLQRIGELHETFF
FT                   LLSGRKKPLSLPVVHTASPPMLAIPKVILDHYHMSLSRFVQYLCEEGQGKRLSFAKEEG
FT                   EFLYFHIESPLSPAGEGPFLFHLDGTLRIPVKKEKTFSLPEIHAHYLLLYNLSMISRYE
FT                   TEWWSELLHSYPSKAYTFILEFLSVSAEKVPLLLHEYLMRKFLG"
FT   gene            17353..18819
FT                   /locus_tag="GYMC61_0009"
FT   CDS_pept        17353..18819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0009"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: gka:GK0009 inosine 5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76709"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ACX76709.1"
FT                   /translation="MWEAKFAKEGLTFDDVLLIPAKSDVLPRDVDVTTKLSDTLQLNIP
FT                   ILSAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITDPFFLTP
FT                   DHQVYDAEHLMSKYRISGVPIVNNPEEQKLVGIITNRDLRFIQDYSIKISEVMTKENLI
FT                   TAPVGTTLEEAEKILQRHKVEKLPLVDENGVLKGLITIKDIEKVIEFPNSAKDAKGRLI
FT                   VGAAVGVTADTMIRVKKLVEAGVDVIVVDTAHGHSKGVLETVANIRRQYPDLNIIAGNV
FT                   ATAEGTRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGVPIIA
FT                   DGGIKYSGDIVKAIAAGAHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVAAMER
FT                   GSKDRYFQEDAKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLEELREKT
FT                   QFIRMTSAGLRESHPHDVQITKEAPNYSAF"
FT   gene            18924..20282
FT                   /locus_tag="GYMC61_0010"
FT   CDS_pept        18924..20282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0010"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; beta-lactamase; Penicillin-binding
FT                   protein 5 domain protein; KEGG: gka:GK0010 serine-type
FT                   D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76710"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACX76710.1"
FT                   /translation="MRRRKQNWLFWLLSICLCLTFGPFQQTVKAESAPLDIRADAAILV
FT                   DAQTGRILYEKNIDTVLGIASMTKMMTEYLLLDAIKAKRVKWDQMYTPSDYVYRLSQDR
FT                   ALSNVPLRKDGKYTVRELYEAMAIYSANGATVAIAEIIAGSEKNFVKMMNDKAKELGLK
FT                   DYKFVNATGLSNKDLKGFHPEGTSTNEENVMSARAMAMLAYRLLKDHPEVLKTASIPHK
FT                   VFREGTKDEIKMDNWNWMLPGLVYGYEGVDGLKTGYTEFAGNCFTGTAKRNGVRLISVV
FT                   MNAKDASGKTTKEARFKETEKLFNYGFNQYSLETLYPKGYQLKGKETLPVVKGKEKEVR
FT                   VATGKNLDLLVKNGEEKQYKPVYVLDKKKMTKEGKLVAPLKKGETVGYMTLEYKGDDSL
FT                   AFLSPDMQKNIRVPLVTTAEVEKANWFVLSMRAVGGLFVDLWTSVAKTVKGWL"
FT   gene            20413..21297
FT                   /locus_tag="GYMC61_0011"
FT   CDS_pept        20413..21297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0011"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: gka:GK0011 pyridoxal biosynthesis
FT                   lyase PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76711"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ACX76711.1"
FT                   /translation="MALTGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVIEEVMNAVSIPVMAKVRIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVVNMSEDELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGGVATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATTHYEDYELIAHLSKGLGGAMRGIDIA
FT                   TLLPEHRMQERGW"
FT   gene            21322..21912
FT                   /locus_tag="GYMC61_0012"
FT   CDS_pept        21322..21912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0012"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG: gka:GK0012
FT                   glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76712"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACX76712.1"
FT                   /translation="MKIGVLGLQGAVREHVRAIEACGAEAVIVKKPEQLEGLDGLVLPG
FT                   GESTTMRRLIDRYGLMEPLKQFAAAGKPMFGTCAGLILLAKRIVGYDEPHLGLMDITVE
FT                   RNSFGRQRESFEAELSIKGVGDGFVGVFIRAPHIVEAGDGVDVLATYNDRIVAARQGQF
FT                   LGCSFHPELTDDHRLMQYFLNMVKEAKMASSLK"
FT   gene            22196..23470
FT                   /locus_tag="GYMC61_0013"
FT   CDS_pept        22196..23470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: gka:GK0013 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76713"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACX76713.1"
FT                   /translation="MLDVKILRTQFEEVKEKLMQRGGDLTNIDRFEQLDKDRRRLIAEV
FT                   EELKSKRNDVSQQIAVLKREKKDAEPLIAQMREVGDRIKRMDEQIRQLEAELDDLLLSI
FT                   PNVPHESVPIGQSEEDNVEVRRWGEPRSFSFEPKPHWEIADRLGLLDFERAAKVAGSRF
FT                   VFYKGLGARLERALINFMLDIHLDEFGYEEVLPPYLVNRASMIGTGQLPKFAEDVFHLD
FT                   SEDYFLIPTAEVPVTNLHRDEILAADDLPIYYAAYSACFRAEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYDELEKLTRQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVW
FT                   LPSYGTYREISSCSNFEAFQARRANIRFRRDPKAKPEYVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGSVIVPEALRPYMGNRDVIR"
FT   variation       22789
FT                   /locus_tag="GYMC61_0013"
FT                   /replace="t"
FT                   /note="SNP"
FT   gene            complement(23691..24977)
FT                   /locus_tag="GYMC61_0014"
FT   CDS_pept        complement(23691..24977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0014"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18;
FT                   Peptidoglycan-binding lysin domain; SMART: chitinase II;
FT                   Peptidoglycan-binding LysM; KEGG: gka:GK0014 spore
FT                   peptidoglycan hydrolase (N-acetylglucosaminidase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76714"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ACX76714.1"
FT                   /translation="MQIHVVQSGQTLSGIAEAYGTTAEEIVRANKLPNPDKLVVGQALV
FT                   IPIVGRFYWVQRGDTLWSIARRFSIPMQRLAEVNRLSLNAPLKVGQRLYIPPGAKRRAE
FT                   FNAYIEPRGATVSPALEASAREAAPYLTYLSPFYFAIRRDATLQEPPLDDFPDIARANR
FT                   VTLVMVVANIENGQFSDELGALMLTNETLQNRLLDNIVATARRYGFRDIHFDFEYLRPE
FT                   DREAYNAFLRKAKRRFAREGWMMSTALAPKTSATQRGRWYEAHDYRAHGQIVDFVVIMT
FT                   YEWGYSGGPPMPVSPIGPVRRVLEYAISEMPAGKILMGQNLYGYDWTLPYVPGGPYAQA
FT                   ISPQQAIALAAKYNVAIEYDMEAQAPHFRYRDENGREHEVWFEDARSIQAKFNLVKELG
FT                   LRGVSYWKLGIDFPQNWRLIADQFTVVKK"
FT   gene            25063..25560
FT                   /locus_tag="GYMC61_0015"
FT   CDS_pept        25063..25560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0015"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gka:GK0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76715"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACX76715.1"
FT                   /translation="MNTDEYYMRLAMEEAKKAEQIGEVPIGAVIVQDGRVIARAHNLRE
FT                   TEQRAIAHAEILAIDEACRATGSWRLERATLYVTLEPCAMCAGAIVLSRIERVVFGAFD
FT                   PKGGCAGTLMNLLQESRFNHQVKVVSGVLADECGSLLSQFFRRLREQKRNVGGSANENS
FT                   VD"
FT   gene            25705..25813
FT                   /gene="ffs"
FT                   /locus_tag="GYMC61_R0006"
FT   ncRNA           25705..25813
FT                   /gene="ffs"
FT                   /locus_tag="GYMC61_R0006"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            25981..27660
FT                   /locus_tag="GYMC61_0016"
FT   CDS_pept        25981..27660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0016"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gka:GK0017 DNA polymerase III subunits gamma
FT                   and tau; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76716"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACX76716.1"
FT                   /translation="MAYQALYRVFRPQRFADMVGQEHVTKTLQSALLQHKISHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEQAPAAEPCNECPACLGITNGTVPDVLEIDAASNNRVDEI
FT                   RDIREKVKFAPTSARYKVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   ATIISRCQRFDFRRIPLPAIVSRLKYVASAQGVEASDEALSAIARAADGGMRDALSLLD
FT                   QAISFSDGKLRLDDVLAMTGAASFAALSSFIEAIHRKDTAAVLQQLETMMAQGKDPHRL
FT                   VEDLILYYRDLLLYKTAPYVEGAIQIAVVDEAFTSLSEMIPVSNLYEAIELLNKSQQEM
FT                   KWTNHPRLLLEVALVKLCHPSAAAPSLSASELEPLIKRIETLEAELRRLKEQPPAPPST
FT                   AAPVKKLSKPMKTGGYKAPVGRIYELLKQATHEDLALVKGCWADVLDTLKRQHKVSHAA
FT                   LLQESEPVAASASAFVLKFKYEIHCKMATDPTSSVKENVEAILFELTNRRFEMVAIPEG
FT                   EWGKIREEFIRNKDAMVEKSEEDPLIAEAKRLFGEELIEIKE"
FT   gene            27684..28010
FT                   /locus_tag="GYMC61_0017"
FT   CDS_pept        27684..28010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gka:GK0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76717"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACX76717.1"
FT                   /translation="MMRGGMGNMQKMLKQMQKMQKEMQKAQEELAEKTVEGTAGGGMVT
FT                   VVANGHKQILEVKIKEEVVDPDDIEMLQDLILAATNDALKKADELANEMMGQFTKGLNI
FT                   PGLF"
FT   gene            28020..28616
FT                   /locus_tag="GYMC61_0018"
FT   CDS_pept        28020..28616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0018"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: gka:GK0019 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76718"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACX76718.1"
FT                   /translation="MHYPEPLSKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAK
FT                   ALVDVKRHIHYCTICGHITDTDPCYICKDERRDRTTICVVQDPKDVIAMERMKEYNGLY
FT                   HVLHGAISPMEGIGPEDIKIAELLTRLQDETIQEVILATDPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   gene            28640..28864
FT                   /locus_tag="GYMC61_0019"
FT   CDS_pept        28640..28864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0019"
FT                   /product="Protein of unknown function DUF2508"
FT                   /note="PFAM: Protein of unknown function DUF2508; KEGG:
FT                   gka:GK0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76719"
FT                   /inference="protein motif:PFAM:PF10704"
FT                   /protein_id="ACX76719.1"
FT                   /translation="MLWRRKGKLKRQFDEKLMAELQKARTEWLEQKQLIEKSVDPSPEV
FT                   LSALQLAEAKYFFLLREAKHRRITLKEVR"
FT   gene            28943..29206
FT                   /locus_tag="GYMC61_0020"
FT   CDS_pept        28943..29206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0020"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="TIGRFAM: pro-sigmaK processing inhibitor BofA; PFAM:
FT                   sigmaK-factor processing regulatory BofA; KEGG: gka:GK0021
FT                   inhibitor of the pro-sigma K processing machinery"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76720"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ACX76720.1"
FT                   /translation="MEPKVVITVLLALIAVLLIVGARLKALRLIGYAAIRLIVGALALF
FT                   VINTIGGHFNIHIPINLVTSIVCGFLGLPGAAALIVIDRYIL"
FT   gene            29512..29613
FT                   /locus_tag="GYMC61_0021"
FT   CDS_pept        29512..29613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76721"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76721.1"
FT                   /translation="MHPEVEGDLAEESEAPKLDNPKSGGRLPIGETR"
FT   gene            29755..31300
FT                   /locus_tag="GYMC61_R0007"
FT   rRNA            29755..31300
FT                   /locus_tag="GYMC61_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            31641..31714
FT                   /locus_tag="GYMC61_R0008"
FT                   /note="tRNA-Ile2"
FT   tRNA            31641..31714
FT                   /locus_tag="GYMC61_R0008"
FT                   /product="tRNA-Ile"
FT   gene            31721..31796
FT                   /locus_tag="GYMC61_R0009"
FT                   /note="tRNA-Ala2"
FT   tRNA            31721..31796
FT                   /locus_tag="GYMC61_R0009"
FT                   /product="tRNA-Ala"
FT   gene            32065..34991
FT                   /locus_tag="GYMC61_R0010"
FT   rRNA            32065..34991
FT                   /locus_tag="GYMC61_R0010"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            35232..35347
FT                   /locus_tag="GYMC61_R0011"
FT   rRNA            35232..35347
FT                   /locus_tag="GYMC61_R0011"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            35499..35705
FT                   /locus_tag="GYMC61_0022"
FT   CDS_pept        35499..35705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0022"
FT                   /product="Sigma-G inhibitor, Gin"
FT                   /note="PFAM: Sigma-G inhibitor, Gin; KEGG: gka:GK0022
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76722"
FT                   /inference="protein motif:PFAM:PF10764"
FT                   /protein_id="ACX76722.1"
FT                   /translation="MRTSIADRNQREHVCIVCEQEKKEGIFLFGHFLCLDCNRAIVQTN
FT                   TDDPNYSFYVRQLRKMFTSKIHS"
FT   gene            35876..37309
FT                   /locus_tag="GYMC61_0023"
FT   CDS_pept        35876..37309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0023"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   aminotransferase class I and II; Orn/Lys/Arg decarboxylase
FT                   domain protein; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: gka:GK0023 lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76723"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACX76723.1"
FT                   /translation="MDQTKTPLYDALVHHWARRPVSFHVPGHKYGALFSKRGRDMFAPL
FT                   LALDATEISGLDDLHHPESVIAEAQALAAELYGVRETFFLVNGSTAGNLAMIAAVCDGK
FT                   RKKVIVQRNCHKSVMHALQLMEATPVLLAPEFDRDVCVASHIRPEAVKEALALHDDVAA
FT                   VVLTNPNYYGMAADLTEIVRLVHEHGIPVLVDEAHGAHFVVGPPFPTSALRYGADVVVQ
FT                   SAHKTLPAMTMGAFLHVNSERVDLERLKYFLQLFQSSSPSYPIMASLDLARSYVAQLSK
FT                   SDAAAIVAEIEKFKAALADIDGVAVVCSRHFGVQTDPLKVTVQTRCSLTGYELQRWLER
FT                   EGVFVELADRMNVLFVCPLAVTGRLQEAAEKIKRAWRDLPDGEAPVCNASPFLGPPLSV
FT                   LVPYNELRHLRTKAVALEEAEGHIAAETVIPYPPGVPLVWVGERIGRGHIEQIRQLLCQ
FT                   RAHIQGGSRLKDGQLVVYE"
FT   gene            37324..37968
FT                   /locus_tag="GYMC61_0024"
FT   CDS_pept        37324..37968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0024"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: gka:GK0024 thymidylate kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76724"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ACX76724.1"
FT                   /translation="MPRVMNGCFFSFEGPEGAGKTTMISKLESLLRERGIDVVATREPG
FT                   GVRIAEAIRSIILNRDYTEMDGRTEALLYAAARRQHLLEKIVPALEAGCVVLCDRFVDS
FT                   SLAYQGFARGLGIEEVWKINEFAIDGYMPSLTIYFDIDPQIGLERIRRNRGREVNRLDL
FT                   ETLSFHEKVREGYRELARRFADRIVVIDANRPLDDVFAETTAAVLSRLKGR"
FT   gene            38048..39040
FT                   /locus_tag="GYMC61_0025"
FT   CDS_pept        38048..39040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0025"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: gka:GK0025 DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76725"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ACX76725.1"
FT                   /translation="MAMRWEQLAKRQPVVAKMLQSGLEKGRISHAYLFEGQRGTGKKAA
FT                   SLLLAKRLFCLSPIGVSPCLECRNCRRIDSGNHPDVRVIGPDGGSIKKEQIEWLQQEFS
FT                   KTAVESDKKMYIVEHADQMTTSAANSLLKFLEEPHPGTVAVLLTEQYHRLLGTIVSRCQ
FT                   VLSFRPLPPAELAQGLVEEHVPLPLALLAAHLTNSFEEALALAKDSWFAEARTLVLQWY
FT                   EMLGKPELQLLFFIHDRLFPHFLESHQLDLGLDLLLYLYRDLLHIQAGQMDGVLYRDQL
FT                   DRLQRWALACPQRRILAGMEAILQAKTRLNTTNMSTALLVEQLVLQLKR"
FT   gene            39055..39882
FT                   /locus_tag="GYMC61_0026"
FT   CDS_pept        39055..39882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0026"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: gka:GK0026 signal
FT                   peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76726"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ACX76726.1"
FT                   /translation="MYTVVGVRFKKAGKIYYFDPGDAVIPVGEFVIVETVRGIEYGKVV
FT                   IANKQVDENDIVLPLKKVIRVANEKDKWIVEENKKAAREAYDICLRKVEEHGLEMKLVD
FT                   VEYTFDRNKVIFYFTADGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENEEYETAKEQLPDL
FT                   GEYVETPHGFGKVVGLNILERVLQIELPEFGRVVEYTLDELMKNGTLSIRVAD"
FT   gene            39898..40260
FT                   /locus_tag="GYMC61_0027"
FT   CDS_pept        39898..40260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0027"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   gka:GK0027 DNA replication intiation control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76727"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ACX76727.1"
FT                   /translation="MEKVDKKEVFRSVANMEEQLSYFYRELVQLKQRVTELLEENHQLQ
FT                   IENAHLRRRLEQLSEAWEEGKRKGDKHGKKLIDIGEGYDNLARLYQEGFHICHIHYGSI
FT                   RTEGDCLFCLSFLNKN"
FT   gene            40321..41070
FT                   /locus_tag="GYMC61_0028"
FT   CDS_pept        40321..41070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0028"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gka:GK0028
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76728"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACX76728.1"
FT                   /translation="MVELYEDERLDYLFNEELRIIQSPSVFSFSLDAVLLAHFAYMPIQ
FT                   KGQIVDLCTGNGVIPLLLSRRTKGTIIGIEIQERLCDMARRSVQYNGLEGQIEIIHGDI
FT                   KEAPQRIGYSRYDVVTCNPPYFPAVGKDELSKNEHIAIARHEIYCTLEDVIRVSSQLLK
FT                   QGGKAAFVHRPGRLLDLVTLMRQYRLEPKRLRFVYPKEGKEANMILIEGTKDASPDLKV
FT                   LPPLVVYDENNEYTEETKRILYGIISS"
FT   gene            41086..41997
FT                   /locus_tag="GYMC61_0029"
FT   CDS_pept        41086..41997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0029"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: gka:GK0029
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76729"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACX76729.1"
FT                   /translation="MLWQQKSFTEQTEQGTLYIVPTPIGNLEDMTFRAVRTLQEADVIA
FT                   AEDTRQTKKLLAHFGIHTPLVSYHEHNKYASGRQLVEWLKEGKTVALVSDAGMPGISDP
FT                   GYELIAAALAERCRVVPLPGANAALTALVASGLPTDRFLFVGFLKRAKKEKKEQLLSLK
FT                   TAAETLIFYEAPHRLKETLALMYDIFGNRRIALGRELTKRFEEFIRGDLSDAVAWAEEH
FT                   DIRGEFCLIVEGARDGNKQEQEGEEWWQPLSLVEHVDYYIREHSLSVKEAVKQAASDRN
FT                   MSKRDVYRQYHQQQEEEKKEFL"
FT   gene            complement(42014..42313)
FT                   /locus_tag="GYMC61_0030"
FT   CDS_pept        complement(42014..42313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0030"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: gka:GK0030
FT                   transition state regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76730"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ACX76730.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDINEKDALEIYVDDDRIIL
FT                   KKYKPNMTCVVTGEVSDDNFKLAGGKIILSREGAEILLQEIQQHLEAATDKEKE"
FT   gene            42710..44662
FT                   /locus_tag="GYMC61_0031"
FT   CDS_pept        42710..44662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0031"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein; KEGG: gka:GK0031
FT                   methionyl-tRNA synthetase (methionine--tRNA ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76731"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACX76731.1"
FT                   /translation="MEKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVM
FT                   YLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKV
FT                   VEQIFTRLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFR
FT                   MSKYVDRLLQYYEENPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKH
FT                   VIYVWIDALANYITALGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLP
FT                   LPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPE
FT                   GFIERINYDLANDLGNLLHRTVAMIERYFDGVIPPYRGPKTTFDQELVQTAREVVRQYE
FT                   EAMEGMEFSVALAAVWQLISRTNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHTA
FT                   VLLQPFLTRTPERMFAQLGITDHSLKEWDSLYDFGLIPEGTKVQKGEPLFPRLDIEAEV
FT                   EYIKAHMQGGKPAAEPVKEEKKAAEAAEISIDEFAKVDLRVAEVIHAERMKNADKLLKL
FT                   QLDLGGEKRQVISGIAEFYKPEELVGKKVICVANLKPAKLRGEWSEGMILAGGSGGEFS
FT                   LATVDQHVPNGTKIK"
FT   gene            44799..45569
FT                   /locus_tag="GYMC61_0032"
FT   CDS_pept        44799..45569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0032"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: gka:GK0032 deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76732"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACX76732.1"
FT                   /translation="MLFDTHAHLNAVQYEEDLEQVIERARDEGVSHIVVVGFDRPTIDR
FT                   AIELAERYPFIYAAVGWHPVDAIEMTDDDLQMIEHLAAHPKVVALGEMGLDYHWDKSPK
FT                   DVQQEVFRQQIRLAKKVKLPIIIHNREATADILKILQEENAAEVGGIMHCFSGSVEVAK
FT                   QCMDMNFLISLGGPVTFKNAKKPKEVAKEIPLSHLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KYVAEAIAQIKNISFAEVAETTAENAKKLFAIDR"
FT   gene            45770..46975
FT                   /locus_tag="GYMC61_0033"
FT   CDS_pept        45770..46975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0033"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; protein of unknown function
FT                   DUF348; G5 domain protein; KEGG: gka:GK0033 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76733"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ACX76733.1"
FT                   /translation="MLPNGRKWLDLWRKNVTVTAGGFLAISATTGVAGYEMAKDDVTLI
FT                   KNGNKQEIRTHAKTVKELLAEQNIQPRKEDYVYPSLHSPITDDLHIVWEASKEVTLTVN
FT                   GKKKKIWTTADTVAELLRSQHVAVGAYDKVAPALSAKIQKGMDIGVEKAFPVHVNVGGK
FT                   QQQVWTTSTTVADFLKQQGIQLGQFDRIEPSLHETVKEQMTIRVIRVKKVTDVVEEPVD
FT                   FAVVTKRDDSLPKGERRVIQPGEKGMVQKTYEVTLENGKETVRKLIAAKTLKESKARIV
FT                   AIGMKTVRSAAAPDRPSSRGSDHAAKEFYVTATAYTAYCAGCSGITSTGINLRKNPSAK
FT                   VIAVDPSIIPLGSKVYVEGYGYAIAADTGSGIRGYKIDVFFPERSDAFRWGRKRVKIRV
FT                   LP"
FT   gene            47248..47796
FT                   /locus_tag="GYMC61_0034"
FT   CDS_pept        47248..47796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0034"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="KEGG: gka:GK0034 hypothetical protein; TIGRFAM:
FT                   primase/topoisomerase like protein; PFAM: TOPRIM domain
FT                   protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76734"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ACX76734.1"
FT                   /translation="MIVVEGKDDTAAIRRAVDADTIETNGAAVGVDVIERIKLAKERRG
FT                   VIIFTDPDFPGEKIRRTIAEQVPGCKHAFLPREAAKAKNGKGIGVEHASPDEIRRALAN
FT                   VYEEASDWKEEITFAELIEAGLIGGAMARRRRQRLGEELKIGYANGRQFHKRLQVFRIS
FT                   RDAFYAALAHVMQEEADDV"
FT   gene            47789..48670
FT                   /locus_tag="GYMC61_0035"
FT   CDS_pept        47789..48670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0035"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: gka:GK0035 dimethyladenosine transferase;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: ribosomal RNA
FT                   adenine methylase transferase; SMART: Ribosomal RNA adenine
FT                   methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76735"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACX76735.1"
FT                   /translation="MYKDIATPGRTKEILERYGFSFKKSLGQNFLIDANILRKIVDVAD
FT                   ISPDTGAIEIGPGIGALTEQLARRAKKVVAFEIDGRLLPILADTLSPYDNVRIFHQDVL
FT                   KADLHAVIAEELADVSDRMVVANLPYYVTTPIIMKLLTDRLPIRGMVVMLQKEVADRLA
FT                   AKPGTKDYGSLTIAVQYYTEAEVIMTVPRTVFMPQPNVDSAVIRLVKRQHPPVVVDDEG
FT                   VFFQVVRASFAQRRKTLFNNLTNNLPGGKENKEQIERVLVALGIDPRRRGETLDIAEFA
FT                   SLSNALAPLFGK"
FT   gene            48810..49709
FT                   /locus_tag="GYMC61_0036"
FT   CDS_pept        48810..49709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0036"
FT                   /product="sporulation peptidase YabG"
FT                   /note="TIGRFAM: sporulation peptidase YabG; PFAM: peptidase
FT                   U57 YabG; KEGG: gka:GK0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76736"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ACX76736.1"
FT                   /translation="MDVIKIGDIVARKSYQCDLLFRVIDIKEKNGEWEAILYGEDVRLV
FT                   ADAPCSDLVVIDEQEQQERKKREIELIEQSYRLFRQDYQAIKQKVEYRATGGYRVEKDF
FT                   FQIPGRVLHLDGDPLYLRKCMDLYERIGVPVHGIYCEESEMPEKVGYWIEQFRPDILVI
FT                   TGHDSYSKSKGKVHELKAYRHSRHFVQTVKEARKKVPHLDQLIIFAGACQSHFESLIRA
FT                   GANFASSPARVNIHALDPVYIVSRLSFTPFTETVDVWDVLRNTLTGEKGLGGVETKGVL
FT                   RTGMPFRLIEDREENRRS"
FT   gene            49893..50150
FT                   /locus_tag="GYMC61_0037"
FT   CDS_pept        49893..50150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0037"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   gka:GK0037 veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76737"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ACX76737.1"
FT                   /translation="MPKTLSDIKKTLDSNIGKRLTLRANGGRRKMIERCGILAETYPSV
FT                   FVIELDQKENSFERVSFSYADVLTETVKLTFWDDEQAGGQ"
FT   gene            50400..50588
FT                   /locus_tag="GYMC61_0038"
FT   CDS_pept        50400..50588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0038"
FT                   /product="small acid-soluble spore protein,
FT                   minoralpha/beta-type SASP"
FT                   /note="KEGG: gtn:GTNG_0038 small acid-soluble spore
FT                   protein, minoralpha/beta-type SASP"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76738"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0038"
FT                   /protein_id="ACX76738.1"
FT                   /translation="MLTLGRRRGIMSQRLKEELAKELGFYDVVQREGWGAIRAKDAGNM
FT                   VRLAIERAERQLAGTTE"
FT   gene            50811..51683
FT                   /locus_tag="GYMC61_0039"
FT   CDS_pept        50811..51683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0039"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: gka:GK0039 4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76739"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACX76739.1"
FT                   /translation="MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVA
FT                   LPEEDAIRIVSQNRFVPDDCRNLAYQAAKLLKETFSIRQGVAISITKHIPVAAGLAGGS
FT                   SDAAATLRGLNKLWQLGLTLDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIASPP
FT                   PCWVVLAKPPIGVSTAEVYRNLELERVSHPDVDAMVRAIERQDYAAICRLVGNVLEEVT
FT                   LKKYPEVAHIKEQMKRFGADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVR
FT                   LLGERHSLD"
FT   gene            51739..52560
FT                   /locus_tag="GYMC61_0040"
FT   CDS_pept        51739..52560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0040"
FT                   /product="purine operon repressor, PurR"
FT                   /note="TIGRFAM: pur operon repressor; PFAM: purine
FT                   repressor ; phosphoribosyltransferase; KEGG: gka:GK0040 pur
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76740"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ACX76740.1"
FT                   /translation="MKLRRSGRLVDMTHYLLERPHQLIPLTLFAERYESAKSSISEDLA
FT                   IIKQTFEQQGIGTVRTLPGAAGGVQYIPKMAAEEAEEVVAYLCEQLSRPDRLLPGGYLY
FT                   MTDILGDPRIMNKIGRLYASMFADRPVDVVMTIATNGIPFAYAIANFLYVPVVIVRHDN
FT                   KVTEGPMVSINYVSGSSRRIQTMVLSKRSLAEGANVLIVDDFMKAGGTINGMISLLQEF
FT                   NGNVSGIGVLVESEEAKERLVDEYISLVKLSEVDVKEKRISVKEGNYKAFL"
FT   gene            52604..52978
FT                   /locus_tag="GYMC61_0041"
FT   CDS_pept        52604..52978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0041"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: gka:GK0041 translation
FT                   initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76741"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ACX76741.1"
FT                   /translation="MRKVETTKAPQAIGPYSQGIIVNNMFYSSGQIPLTPEGELVKGDI
FT                   QAQTHQVFQNLKAVLEAAGASLDTVVKTTVFLKNMDDFAAMNEVYSQYFPNHKPARSCV
FT                   EVARLPKDVLVEIEVVALVP"
FT   gene            53105..53395
FT                   /locus_tag="GYMC61_0042"
FT   CDS_pept        53105..53395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0042"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: gwc:GWCH70_0044
FT                   SpoVG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76742"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ACX76742.1"
FT                   /translation="MEVTDVRLRRVNTEGRMKAIASITLDNEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSATRGKIQEAILAEYHRLGKLEEELEEAGAS"
FT   gene            53528..54904
FT                   /locus_tag="GYMC61_0043"
FT   CDS_pept        53528..54904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0043"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; KEGG: gka:GK0043
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76743"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACX76743.1"
FT                   /translation="MKRYAVILAAGQGTRMKSKWYKVLHPVCGKPMVQHVIDQVSKLGV
FT                   EKTIAVVGFGAEQVKEQLGSQCEYALQEEQLGTAHAVMQAAPHLRGLEGVTIVVCGDTP
FT                   LITAETMETLVEHHMAAKAKATVLTAIADDPSGYGRIVRNQAGHVEKIVEHKDASEQER
FT                   NIREINTGIYCFDNQTLFQALTKVTNHNAQGEYYLTDVIEIIKADGGVVSAYQAPSFEE
FT                   TIGVNDRIALAEAERIMRARICRQHMKNGVTIIDPASTYISAEAMIGRDTVIYPGTVIE
FT                   GETVIGEDCVIGPNSEIKNCYIGHRTSIRHSVAHDSEIGSDVTIGPFAHIRPLSKIDDE
FT                   VRIGNFVEVKKSTFGKGSKAPHLSYIGDAEVGADVNLGCGSITVNYDGVNKHMTKIEDG
FT                   AFIGCNVNLIAPVTVGQGAYVAAGSTITNDVPGRALAIARARQVNKENYVDRLPGKKKS
FT                   "
FT   gene            54917..55864
FT                   /locus_tag="GYMC61_0044"
FT   CDS_pept        54917..55864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0044"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: gka:GK0044 ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76744"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACX76744.1"
FT                   /translation="MSDCQHQLKLFALNSNMKLAKEIAEVMGIELGKCSVSRFSDGEIQ
FT                   INIEESIRGDDVFVIQSTSVPVNEHLMELLIMIDALKRASARTINIVMPYYGYARQDRK
FT                   ARSREPITAKLVANLLETAGASRVITLDLHAPQIQGFFDIPIDHLMGVPILADYFKSKQ
FT                   LEDIVVVSPDHGGVTRARKLADRLKAPIAIIDKRRPKPNVAEVMNIVGQVAGKTAILID
FT                   DIIDTAGTITLAANALAESGAKEVYACCTHPVLSGPAIERIQSSKIKELVVTNSIALPE
FT                   EKKIDKIVELSVAPLIAEAITRVYEMKSVSVLFD"
FT   gene            55942..56574
FT                   /locus_tag="GYMC61_0045"
FT   CDS_pept        55942..56574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0045"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: Ribosomal protein L25-like; KEGG:
FT                   gka:GK0045 50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76745"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACX76745.1"
FT                   /translation="MAIVLEAKERTDKKRSTLRRIRSQGGIPAILYGKKVENKMIFVSA
FT                   AELEKVLREGGRTSLLTLKVGGEDYSVLLREMQRDPLRGELLHADFQAVDLSTEVDIDV
FT                   EVRLVGEAPGVKDGGVLQQNLHELSIRVLPANIPPVIEVDISGLQVGDTVTVGDVQTDG
FT                   KFEINHEPSEVIATILPPQQEEEIDSGEQQEAGQPDAAEGRETTPEE"
FT   gene            56635..57195
FT                   /locus_tag="GYMC61_0046"
FT   CDS_pept        56635..57195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0046"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: gka:GK0046 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76746"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACX76746.1"
FT                   /translation="MKLFVGLGNPGEEYEQTRHNVGFFVIDELAKRWNVSLKTAKFRGL
FT                   FGTASVSGEKVALCKPLTYMNLSGECVRPLMDYYDIAIDDVIVIYDDLDLPPGKIRLRL
FT                   KGSSGGHNGVKSLIHHLGTEQFKRIRIGIGRPTGGQPVTDYVLGRFTEEEKPAVDKAVL
FT                   RAADACEQAVKAPFIQVMNDFNE"
FT   gene            57307..57537
FT                   /locus_tag="GYMC61_0047"
FT   CDS_pept        57307..57537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76747"
FT                   /inference="similar to AA sequence:KEGG:GK0047"
FT                   /protein_id="ACX76747.1"
FT                   /translation="MALHYYCRHCGAKVGTIEQMPIYSEKLGFHHLTEEERLEMISYEP
FT                   NGDIHVKTICEDCQEALARNPEWHQYEKFIH"
FT   gene            57627..61160
FT                   /locus_tag="GYMC61_0048"
FT   CDS_pept        57627..61160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0048"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: gka:GK0048 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: transcription factor CarD; helicase domain protein;
FT                   DEAD/DEAH box helicase domain protein; TRCF domain protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76748"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACX76748.1"
FT                   /translation="MLSLHRYLAENQDVRTIIEGLHVRLKEQLVAGLSGSARSVFISTL
FT                   YKETGRPLLVVSHNLFQAQKMYDDLVSLLGPEDVFLYSVNEVIAAEMAVASPELKAQRL
FT                   EIMNHWAQGGKGVVVCPVAGLRRLLPPPSLWKQYLFTFFVGQEFDVERCKQKFVQMGYK
FT                   RVGTVSAPGEFSVRGGIIDIYPLTAELPYRIELFDTEIESIRTFTPDDQRSQGQIERIM
FT                   IGPADEIILDGETRRRGIERIEAGLASSLETMKDEAAKQRMYEHIHAELEQLREGQEIE
FT                   QQYKYMSLFYEKVASLLDYLPEDGVLLMDEMSRLQEAAERLDREEAEWYTSLLDGGKMI
FT                   HGVPLSHSFSELLQKHRFQRVYLSLFLRHVPYAHPQNVVNITCKQMQNFHGQMALLQSE
FT                   VERWEKANYAVVFLAPNAERVKKLQSLLQDYEIDALPLARDAALLHGKCQLLEGDLNTG
FT                   FELPLQKIAVITEEELFKKRVKRPVRRQKLSNAERIKSYAELQVGDYVVHVNHGIGKYL
FT                   GIETLEINGVHKDYIHIQYQGGDTLYVPVDQIDQVQKYVGSEGKEPKIYKLGGSEWKKV
FT                   KKKVESSVQDIAEDLIKLYAEREASKGYAFSPDTEMQREFEAAFPYQETEDQLRSIEEI
FT                   KRDMESDKPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHYETVRE
FT                   RFQGFPINVGLLNRFRTKKQQAEIIKGLKDGTIDMVIGTHRLLSKDVKFKDLGLLIIDE
FT                   EQRFGVAHKEKIKQLKANIDVLTLTATPIPRTLHMSMIGVRDLSIIETPPENRFPVQTY
FT                   VMEYTPELVKEAIERELARDGQVFFLYNHIEDIDLKAEEIAQLVPEARVTYVHGRMSET
FT                   ELESTILAFLEGQYDVLVTTTIIETGIDIPNVNTLIVYDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLNEAAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNILGAEQHGF
FT                   IDSVGFDLYSQMLKEAIEKRRGIKREDEQPDVVIDVEVDAYIPSTYIADELQKIEMYKR
FT                   FKAVETLEDVEALREEMVDRFGDYPDEVAYLFQIAELKVLAKQLGVESMKQHKQQIDIL
FT                   FTEQASKTVEIQRLSDIGRRHGRLFGFGMDGAKLKIVLYIKDMKPHEWLMILEETLRRL
FT                   SGVEKEKSVTA"
FT   gene            61369..61905
FT                   /locus_tag="GYMC61_0049"
FT   CDS_pept        61369..61905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0049"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: stage V sporulation protein T;
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain protein; KEGG: gka:GK0049 stage V sporulation
FT                   protein T (transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76749"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ACX76749.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALFDSLGQPVLICDRDVYIAVAGVSKKEYMNKSVSPLVEK
FT                   AMEDRNSILHTEEGEVELVDGMTETLKSYTIGPIVANGDPIGAVIILSREKTLGEVEHK
FT                   AVETAASFLARQMEQ"
FT   gene            62180..63730
FT                   /locus_tag="GYMC61_0050"
FT   CDS_pept        62180..63730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0050"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: gka:GK0050 amino acid
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76750"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACX76750.1"
FT                   /translation="MGNVWKGAAILTAAALAAKLLSALYRVPYQNMVGDIGFYIYQQVY
FT                   PIYGIVVALSLTGYPVAVSKLVAERLAGQDEAGAAASVRVALLVLSVLGVILFASLYLG
FT                   AGVIASAMGDGRLTPLVRLLSFSFLLFPPIALLRGYFQGRHDMTPTAASQVGEQFVRVT
FT                   AILGLSYGAVQRGADVYACGMAAVAGTLVGMAAALFILLFFLSRRRRLKTSGRTPPAWD
FT                   RQVGRRLLTEGTVICLTNMALTLIPLVDSFLFVPLLQEAGARLDEVQRLKGVYDRGQPL
FT                   IQLGTVVGTSFSLALVPLLSGARRQGAVFAYGALSIRLAVVIGLGASLGLICLIRPINA
FT                   MLFENDYGSSVLAVLSSSVFFTTIALTASALLQGMGREWTAAAGVALAVAGKAALMHWL
FT                   APRFGALGAAAATTGAYALMAGFLCAFLPREYRTAGRKYMYPTVKAAAMMAVVLHGYRW
FT                   LMDSSSEGRLWAAAEALGGVAIGAVVYLACIVKGHVFSEQELAALPLANKFRLRLGGR"
FT   gene            63737..65197
FT                   /locus_tag="GYMC61_0051"
FT   CDS_pept        63737..65197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0051"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: gka:GK0051
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76751"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACX76751.1"
FT                   /translation="MNTIYVFGLGAGDVKQLPIGVYRKLKRAHPLFLRTKEHPVVKWLT
FT                   EEGIAFTSFDEVYEKHEQFADVYADIVDQLTEQAKRGDVFYAVPGHPLVAERTVQLLFE
FT                   AERRGVCRIVIEGGQSFLDALFTAVRIDPIEGFQLLDATTFRGEEWSPSLHAVFCQVYD
FT                   SFVASNVKLSLMEQLPDDYPIYIVTAAGTKDEQVKRVPLYELDRETGLDNLTSVYVPPV
FT                   KDEPLLYHRFETLRRVIATLRGPNGCPWDRKQTHASLKRYLLEEAYELLEAIDEGDDDH
FT                   MVEELGDVLLQVMLHAQIGADRGLFSIDDVIRTLTAKMIRRHPHVFGDVTAETAEQVVA
FT                   NWEKIKEKEKGGGLSESILADIPKSLPGTMRAYELQKRAAKVGFDWDDAAPIWQKVEEE
FT                   MAEFRAETSGGRRDRLVGEFGDLLFALINLARYYGIQPEEALQMANDKFARRFAYIEEQ
FT                   VRKSGRSITSFSLAELDRFWEEAKENER"
FT   gene            65211..65492
FT                   /locus_tag="GYMC61_0052"
FT   CDS_pept        65211..65492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0052"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: gka:GK0052
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76752"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACX76752.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEIADQGRVWINGHVAKASSDVKVGD
FT                   ELTIQFGQKRVTVKVTDLKETTKKEEATGLYELIREERTTPAPEQDDV"
FT   gene            65615..65920
FT                   /locus_tag="GYMC61_0053"
FT   CDS_pept        65615..65920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0053"
FT                   /product="sporulation protein YabP"
FT                   /note="TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein; KEGG: gka:GK0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76753"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ACX76753.1"
FT                   /translation="MSRHDEFGGSTNKGPVQEHDVIMRGRRLLDITGVKQVESFDNEEF
FT                   LLETVMGFLAIRGQNLQMKNLDVDKGVVSIKGRIFDLVYLDDHQEKAKGFFSKLFK"
FT   gene            65917..66549
FT                   /locus_tag="GYMC61_0054"
FT   CDS_pept        65917..66549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0054"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="TIGRFAM: spore cortex biosynthesis protein YabQ;
FT                   PFAM: Spore cortex biosynthesis protein, YabQ-like; KEGG:
FT                   gka:GK0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76754"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ACX76754.1"
FT                   /translation="MNVSIQLYTMLAMIGMGGWLGLAWDTYSRMLKRHERAHWLVFVND
FT                   VLFWAVQALIVFYVLLFVNEGELRFYLFLALLCGYAAYQSLLRSFYVRVLEWFIGLAVR
FT                   LGQTLVQLFRLMVMRPLILLGQMALALLLFAWRLLLWIVRFVLLAVWKMIRLLLAPLRW
FT                   TGIMIWRRVPPQRRAGVEKFFRRLKGFAGQIKNTKEKISMWFAKWRE"
FT   gene            66566..66937
FT                   /locus_tag="GYMC61_0055"
FT   CDS_pept        66566..66937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0055"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: gka:GK0055
FT                   cell-division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76755"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACX76755.1"
FT                   /translation="MNVPRRTNVTKLSSTYIAEHEEKKQKAARRRRAVAVRLVVWSLLF
FT                   AMFASALVYTLHSQAKAIDAKTAEQQKLKEQLAELKRKEKQLKEEMKKLHDDDYIAELA
FT                   RKKYYLSKDGEIIFVLPEK"
FT   gene            67056..67454
FT                   /locus_tag="GYMC61_0056"
FT   CDS_pept        67056..67454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0056"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   gka:GK0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76756"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACX76756.1"
FT                   /translation="MSIEVGSKLQGKVTGITKFGAFVELPEGVTGLVHISEVADNYVKD
FT                   INDHLKVGDMVYVKVINVGQDGKIGLSIRKAKDTPSSQRPRHRTNDRSAADSLEHKISR
FT                   FLKESEDRLASLRRHTESKRGGRGARRG"
FT   gene            67628..67704
FT                   /locus_tag="GYMC61_R0012"
FT                   /note="tRNA-Met1"
FT   tRNA            67628..67704
FT                   /locus_tag="GYMC61_R0012"
FT                   /product="tRNA-Met"
FT   gene            67717..67788
FT                   /locus_tag="GYMC61_R0013"
FT                   /note="tRNA-Glu1"
FT   tRNA            67717..67788
FT                   /locus_tag="GYMC61_R0013"
FT                   /product="tRNA-Glu"
FT   gene            67986..70466
FT                   /locus_tag="GYMC61_0057"
FT   CDS_pept        67986..70466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0057"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: gka:GK0057 stage II sporulation protein E
FT                   (serine phosphatase); TIGRFAM: stage II sporulation protein
FT                   E; PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76757"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ACX76757.1"
FT                   /translation="MERVERGTVRRSISEVPIHDTQATVSRWMRHVKLRLGHLFIHQGF
FT                   LLLLVGFLLGRALILSKLTPFALPFFVSVYMLRRDKAAFALISLLAGALTLSLDVALFV
FT                   GISIFGFLFIYGWVRRVISESLKIVPFVVFVLSLSAKWLISYYWLGERSVYGAAMAVVE
FT                   AGLSLVLTLIFMQSIPLLTVQKHKHALRAEEIISLIILLASMLTGMIGWAVYGLSLEHV
FT                   MSRYLVLLFAFVAGAATGSTVGVVTGLVLSLANVGNLSEMSLLAFAGLLGGLLREGKKL
FT                   GVAFGLLVATLLLGLYGEGKSELVPTLLESGIAIMLFFGTSRSLTEKIAKYIPGTAEYI
FT                   NEQQQYVRKIRDMTVQRVSQFSNVFQALAESFSPEPLPDANEYSDREVDYFLSDITEKT
FT                   CQTCFKKTQCWADNFRTTYAYMKQMMGEADEKTLSQNHQLLREWERYCVKAGKVVDAIE
FT                   KEMVAYQANRKLKRQIHESRKLVAEQLLGVSQVMDDFAKEMQKEQENHYLQEEQIYHAL
FT                   QEFGIEVGHVDIYSLEKGNIDIEMSIPYCEGRGECEKLIAPMLSDILGETIVVKREECA
FT                   AYPNGYCRVAFGSTKAFVVETGVAFAAKGGGFISGDSYATIELATGKYAVAISDGMGNG
FT                   ERAHDESRETLRLLQKILQTGMDESIAIKSINSILALRTTEDMYATLDLAIIDLQNAAT
FT                   KFLKIGSTPSFIKRGDKVMKVEASNLPMGIIKEVEFDVVTEQLKSGDLLIMMSDGVFEG
FT                   PMNVENHDVWMKRKIQELKTNDPQEVADLIMEEVIRQCGGEIEDDMTVVVAKVRHNTPK
FT                   WATIPAYMYMKKAQ"
FT   gene            70532..71272
FT                   /locus_tag="GYMC61_0058"
FT   CDS_pept        70532..71272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76758"
FT                   /inference="similar to AA sequence:KEGG:GK0058"
FT                   /protein_id="ACX76758.1"
FT                   /translation="MRKGTLRQILLITDGCSNHGEDPAAMAALAREQGITVNVIGILDQ
FT                   GAMDENGRREIEAIAAAGGGMSQVVYAKQLSQTVQMVTRQAMTQTLQGLVNRELKQIFG
FT                   SDVSLEDLPPDKRGQVMEVVDELGETVALDVLILIDTSGSMKTKLPTVKEALIDLSLSL
FT                   NARMGENRFSVFIFPGKRAHAEKMIDWTPRIEELSTIFPKLASGGLTPTGPALREAIAY
FT                   FERKRSLRSWIGDGDEPYIEESSL"
FT   gene            71235..72209
FT                   /locus_tag="GYMC61_0059"
FT   CDS_pept        71235..72209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0059"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; SMART:
FT                   serine/threonine protein kinase; KEGG: gka:GK0059
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76759"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACX76759.1"
FT                   /translation="MAMSHTSKNRLCNLPPGTVITGKWHGRSYRLLRRLGSGANGVVYL
FT                   AENGRTRVAVKLSDDYASLASEMNILRRFAKVQGAALGPSLLEADDWQSPFARETIPFY
FT                   VMEYIEGENFAAFIRRRGKEWAPVLVMQLLSVLDRLHQEGWVFGDLKPDNLIVTGSPPS
FT                   VRLLDVGGTTLQGRAVKEFTELYDRGYWGLGSRKAEPSYDLFAAAMVMISSCCPGPIEK
FT                   KGDGRAQLLSIIETDRFLTRYKEVLQKALDGRYRKAADMRRDLLAASSRHTSAENERKA
FT                   VPSRRSGRQVKRRRQARGIVETVVIAAALLGAYAFYIYWQLAM"
FT   gene            72277..73671
FT                   /locus_tag="GYMC61_0060"
FT   CDS_pept        72277..73671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0060"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; Protein of unkown function DUF1946
FT                   PP-loop ATpase; KEGG: gka:GK0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76760"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACX76760.1"
FT                   /translation="MIDKVRAFIHRHQLLSEGAAVIVGVSGGPDSLALLHVFLSLRDEW
FT                   KLQVIAAHVDHMFRGRESEEEMEFVKRFCVERRILCETAQIDVPAFQRSAGLGAQEAAR
FT                   ICRYRFFAELMEKHQAGYVAVGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGGYL
FT                   IRPFLAVSRAEIEAYCRQMGLSPRRDPSNEKDDYTRNRFRHHIVPLLRQENPRLHERFQ
FT                   QYSEMMAEDEQFLEELAADALNKVMEKQHRDAALSIGPFLALPRPLQRRVLQLLLLRLY
FT                   DGVPPTLTSVHIGHILMLCERGRPSGMIDLPKGLKVIRSYDRCLFTFDAESGEKGYWFE
FT                   LPVPALLPLPNGYAIISEFGEHYPRKQAGNDWFVVDPASVSLPLRVRTRRRGDRMVLKG
FT                   TGGTKKLKEIFIEAKIPRMERDRWPIVEDADGRILWVPGLKKSAFEAQNRGQARYILLQ
FT                   YQAMNS"
FT   gene            73684..74229
FT                   /locus_tag="GYMC61_0061"
FT   CDS_pept        73684..74229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0061"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: gka:GK0061 hypoxanthine-guanine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76761"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACX76761.1"
FT                   /translation="MGMKDDIQKVLITEEEIQAKVKELGGLLTKEYEGRFPLAVGVLKG
FT                   AMPFMADLLKHIDTYLEMDFMDVSSYGNATVSSGEVKIVKDLNTSVEGRDILIIEDIID
FT                   SGLTLSYLVDLFRYRKANSIKIVTLLDKPSGRKADIQADYTGFTVPDEFVVGYGLDYAE
FT                   KYRNLPFIGVLKPEVYQK"
FT   gene            74324..76222
FT                   /locus_tag="GYMC61_0062"
FT   CDS_pept        74324..76222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0062"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: gka:GK0062 cell-division protein and general
FT                   stress protein (class III heat-shock); TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   peptidase M41 FtsH extracellular; AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76762"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACX76762.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGVVSFFNGTNQRTEPMTYDAFITHLE
FT                   NGDVKSFSIKPERGVYEIKGQLKTYSEGQYFSTYVMNSDKVLDRIDAAAARTRVEVVPA
FT                   DETSGWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSRARLYTDDKRKVRFRD
FT                   VAGADEEKEELVEIVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFETAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFNGNEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVKGREAV
FT                   LRVHARNKPLDESVDLKTIAMRTPGFSGADLENLLNEAALVAARRNKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERRIVAFHEAGHTVIGMVLADAEMVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKAELMDKITGLLGGRVAEEIVFNEVSTGAHNDFQRATNIARRMVTEFGM
FT                   SEKLGPLQFGQPSGQVFLGRDLHNEQNYSDKIAYEIDLEIQRIIKECYEKAKQILTQHR
FT                   DKLDLIANTLLEVETLDAEQIKHLFEHGTLPKDRNGREEAGKSDGDVKINIQKKEE"
FT   gene            76349..77125
FT                   /locus_tag="GYMC61_0063"
FT   CDS_pept        76349..77125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0063"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: gka:GK0063 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76763"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACX76763.1"
FT                   /translation="MIFVLDVGNTNTVLGVYDGDELKHHWRIETSRSKTEDEYGMVIKA
FT                   LLNHVGLQFSDIRGIIISSVVPPIMFALERMCLKYFHIKPLIVGPGIKTGLDIKYDNPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEHKQYMGGAIAPGIMISTEALFA
FT                   RAAKLPRIEIARPDDIIGKNTVSAMQAGILYGYVGQVEGIVSRMKAKSKIPPKVIATGG
FT                   LAPLIASESDIIDVVDPFLTLTGLKLLYEKNTEKKG"
FT   gene            77134..78024
FT                   /locus_tag="GYMC61_0064"
FT   CDS_pept        77134..78024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0064"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gka:GK0064 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76764"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACX76764.1"
FT                   /translation="MKMGDYLVKALAYNGQVRAYAARTTETVAEAQRRHQTWPTASAAL
FT                   GRALTAGVMMGAMLKGEETLTIKIDGGGPIGVILVDSNARGEVRGYVTNPHVHFELNEH
FT                   GKLDVARAVGKNGMLTVVKDLGLRDFFTGQVPLISGELGDDFTYYFASSEQIPSSVGVG
FT                   VLVNPDHTIRAAGGFIIQLMPGTEENTITRIEERLKQIPPVSRMIERGLSPEQLLEQLL
FT                   GDGGVRVLETMPVSFVCRCSRERIADALISLGPEEIQDIIDKEGQAEASCHFCNETYHF
FT                   DKAELEQLKQLAKKE"
FT   gene            78111..79037
FT                   /locus_tag="GYMC61_0065"
FT   CDS_pept        78111..79037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0065"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase A; cysteine synthase;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: gka:GK0065 cysteine
FT                   synthase(O-acetyl-L-serine sulfhydrylase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76765"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ACX76765.1"
FT                   /translation="MARTVNSITELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVK
FT                   DRIALAMIEAAEKAGKLKPGDTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERR
FT                   NLLRAYGAELVLTPGAQGMRGAIAKAEELVREHGYFMPQQFKNEANPEIHRLTTGKEIV
FT                   EQMGDQLDAFVAGVGTGGTITGAGKVLREAYPNIKIYAVEPADSPVLSGGKPGPHKIQG
FT                   IGAGFVPDILDTSIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKVAKEL
FT                   GKGKKVLAIIPSNGERYLSTPLYQFED"
FT   gene            79152..80573
FT                   /locus_tag="GYMC61_0066"
FT   CDS_pept        79152..80573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0066"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; KEGG: gka:GK0066
FT                   para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76766"
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /protein_id="ACX76766.1"
FT                   /translation="MEQRRRRLKRTIDYRGRDWFRQYEQLAYSRPHHVLLESGQGGRYS
FT                   IIGLDPIGVIRADERRLIIKQRGVETVLDGSPLEGLRQWLRCFAVPDEGESLPCQGGLI
FT                   GFISYDAVRYLERLPVLAQDDLRLPLMYFFLFDDVAIYDHQTEQLHLLAYANEGEESEA
FT                   NRRLARHARMWLEDRNEALVWPLAASTAAPSVSMTKERFMDAVRRVQRYIAAGDVFQVN
FT                   LSVRQSQPLVTHPFAVYKQLRMLNPSPYMAYLHTPEFQVVSGSPELLVRKRGWRLETRP
FT                   IAGTRSRGRTAAEDEQIARKLLASEKERAEHAMLVDLERNDLGRVCAYGTVRVDEWMTV
FT                   EKYSHVMHIVSHVSGTMTTEHDAFSVIRAMFPGGTITGAPKVRTMEIIEELEPVRRGLY
FT                   TGSIGWIDFQGNMELNIAIRTMVVKDGLAHVQAGAGIVIDSNPEHEYKECLKKAAALWK
FT                   AKELSEAEALFPSTR"
FT   gene            80576..81154
FT                   /locus_tag="GYMC61_0067"
FT   CDS_pept        80576..81154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0067"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   gka:GK0067 para-aminobenzoate/anthranilate synthase
FT                   glutamine amidotransferase component II"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76767"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACX76767.1"
FT                   /translation="MMIVMIDNYDSFTYNLVQYLGVLGEELIVKRNDEITVAEIERLRP
FT                   DFIMISPGPCTPNEAGVSLEVIDRFAGQIPIFGVCLGHQAIAQAFGGRVVRAPRLMHGK
FT                   TSSVYHDGETIFRGVPNPFTATRYHSLIVEKETLPDCFVVSAWTEEDEVMAIRHKTLPV
FT                   EGVQFHPESIMTSHGMQLLKNFINTYKKA"
FT   gene            81160..82035
FT                   /locus_tag="GYMC61_0068"
FT   CDS_pept        81160..82035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0068"
FT                   /product="Aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /note="PFAM: aminotransferase class IV; KEGG: gka:GK0068
FT                   4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76768"
FT                   /inference="protein motif:PRIAM:4.1.3.38"
FT                   /protein_id="ACX76768.1"
FT                   /translation="MYVYINGAVVPREEAQLSAFDHGFLYGLGLFETFRTYSGHPFLLD
FT                   DHLARLNKGLSELHIERQFGRAEAVAIIEQLLEANGLRDAYVRFNVSAGVGDLGLPIER
FT                   YRNPTVIVYMKPLPPPVPPEGKEGVVLAARRNSPEGNERLKSHHYLNNMIGKWELGHRP
FT                   HAEGIFLNSDGAVAEGIVSNIFWVKDGIVYTPAPAVGILNGITRQFIIALLKQLRIPVE
FT                   EGVYPLSHLLQADEAFITNSVQEIVPLCRIGHCVYQGKNGPVVRALQHHYRRLTHRLWT
FT                   RNELAERMND"
FT   gene            82035..82886
FT                   /locus_tag="GYMC61_0069"
FT   CDS_pept        82035..82886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0069"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: gka:GK0069 dihydropteroate synthase; TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76769"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACX76769.1"
FT                   /translation="MTTSMRPLRLQCRGHELDLNKKTLIMGIVNVTPDSFSDGGRFYDV
FT                   ENAVKHAKRLVAEGADIIDIGGESTRPGADPVPLDEELRRVIPAVKAIAKAVSVPISID
FT                   TYKAEVARQAMEAGAHIINDVWGAKADPDMARVAATYGAPIILMHNRRDMAYRDLISDM
FT                   IADLKESIRIVKEAGVKDENIILDPGIGFAKTVEHNLEVMRRLDEFAALGYPLLLGTSR
FT                   KRFIGHVLGVPVEERVEGTGATVCLGIMKGVHIVRVHDVLPIARMAKMMDAMLGKGESG
FT                   HR"
FT   gene            82858..83238
FT                   /locus_tag="GYMC61_0070"
FT   CDS_pept        82858..83238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0070"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="KEGG: gka:GK0070 dihydroneopterin aldolase; TIGRFAM:
FT                   dihydroneopterin aldolase; PFAM: dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76770"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACX76770.1"
FT                   /translation="MGRERAVIDKICVQGMEFYGYHGVFREENILGQRFLVDVTLELDL
FT                   QPAGRSDCLEYTVNYADVYERCRAIVEERTFALIEAVAEAIAADLLAAFPVVERCIVKV
FT                   TKPNPPIRGHYQHVAVEIDRGR"
FT   gene            83239..83766
FT                   /locus_tag="GYMC61_0071"
FT   CDS_pept        83239..83766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0071"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: gka:GK0071 7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase
FT                   (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase); TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76771"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ACX76771.1"
FT                   /translation="MENIAYLALGSNLGDRVFYLRSAIEALHHHQEILITSSSSIYETD
FT                   PVGYVNQGKFLNMVIEVATTLSPFALLDVTQQIERRFGRKREIRWGPRTLDLDILLYNH
FT                   ENIETEQLTIPHPRMAERAFVLIPLFEVNSHVAIPNLSEPLIDIIGRLPDKKGVHVWKR
FT                   KDGEDVFALFES"
FT   gene            83718..83939
FT                   /locus_tag="GYMC61_0072"
FT   CDS_pept        83718..83939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0072"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: gka:GK0072
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76772"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX76772.1"
FT                   /translation="MEAERWGRRIRAFRKLKGYTQERLAKELGISVSILGEIERGNRMP
FT                   SDSLVGQIAERLNISVEELAPPKLESNK"
FT   gene            84050..85330
FT                   /locus_tag="GYMC61_0073"
FT   CDS_pept        84050..85330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0073"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: gwc:GWCH70_2089
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76773"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACX76773.1"
FT                   /translation="MNCTQNQKINQVTEQTLVVGIDIAKRTHYACFVDDRGRVLRKSFP
FT                   IFQSKEGFRQLYEAIQEAMQAFGKPQVIVAVEPTGHYWLNLAYFLEEHGIPLVMVNPAH
FT                   VCRSKELDDNLPTKHDAKDALVIARLAKDGRFLVPRLLHEIEADLRVGSTLKEKLRKEQ
FT                   TAVKNAIVRWTDRYFPEFWTVFRDLGKTALSVLEWTPLPADMASRSAEELIEVYRQSEG
FT                   LKCPQKAKIQALIDAAKDSIGVTEGTTMARFEIAALVRRYRQLEAEIAALDAELKALVQ
FT                   TTMEYQWLKTVDGLGDATIIDLLAEIGSFAHYRDPRQLVKLAGLTLKENSSGQRKGQKH
FT                   ISKRGRKRLRSVLFRAMIPLIRHNEAFRELHDYYTTRPVNPLTGKQSIVALCRKLLNVL
FT                   FAICTKKQAFDAERMKQDVLSQVQRAA"
FT   gene            85727..86728
FT                   /locus_tag="GYMC61_0074"
FT   CDS_pept        85727..86728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0074"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: gka:GK0073 nitrogen
FT                   regulation transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76774"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACX76774.1"
FT                   /translation="MFRIGDVEIKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KGIVYNNEKTLNMLYIDEREKPISLQIFGGEKETLVKAAKFVDKNTNADIIDINMGCPV
FT                   PKITNCDAGAKWLLDPNKIYDVVAAIVDAVEKPVTVKMRIGWDEKHIYAVENAQAVERA
FT                   GGKAVAVHGRTRVQMYEGKADWNIIKQVKEAVNIPVIGNGDVKTPQDAKRMLEETGVDG
FT                   VMIGRAALGNPWMIYRTVRYLETGELIPEPTPREKIDVCLLHLDRLIALKGEYIAVKEM
FT                   RKHAAWYLKGIRGAAKIRNAINECETRDELAALLLRVAEEAEVQAAANAEAV"
FT   gene            86819..88303
FT                   /locus_tag="GYMC61_0075"
FT   CDS_pept        86819..88303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0075"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: gka:GK0074 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76775"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACX76775.1"
FT                   /translation="MSHEELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAQELFELY
FT                   GDLSKEELEEKQIEVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF
FT                   KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYL
FT                   DLIMNPESKKTFITRSLIIQSMRRYLDSRGYLEVETPMMHAVAGGAAARPFITHHNALD
FT                   MTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDI
FT                   MELTENLIAHIATEVLGTTKIQYGEHVVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEE
FT                   ARELAKEHGVEVAPHMTFGHIVNEFFEQKVESHLIQPTFIYGHPVEISPLAKKNPDDPR
FT                   FTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLKEREQGNDEAHEMDEDFLEALEYG
FT                   MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK"
FT   gene            88526..88641
FT                   /locus_tag="GYMC61_R0014"
FT   rRNA            88526..88641
FT                   /locus_tag="GYMC61_R0014"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            88649..88724
FT                   /locus_tag="GYMC61_R0015"
FT                   /note="tRNA-Val1"
FT   tRNA            88649..88724
FT                   /locus_tag="GYMC61_R0015"
FT                   /product="tRNA-Val"
FT   gene            89138..89213
FT                   /locus_tag="GYMC61_R0016"
FT                   /note="tRNA-Lys1"
FT   tRNA            89138..89213
FT                   /locus_tag="GYMC61_R0016"
FT                   /product="tRNA-Lys"
FT   gene            89224..89308
FT                   /locus_tag="GYMC61_R0017"
FT                   /note="tRNA-Leu1"
FT   tRNA            89224..89308
FT                   /locus_tag="GYMC61_R0017"
FT                   /product="tRNA-Leu"
FT   gene            89320..89394
FT                   /locus_tag="GYMC61_R0018"
FT                   /note="tRNA-Gly1"
FT   tRNA            89320..89394
FT                   /locus_tag="GYMC61_R0018"
FT                   /product="tRNA-Gly"
FT   gene            89411..89496
FT                   /locus_tag="GYMC61_R0019"
FT                   /note="tRNA-Leu2"
FT   tRNA            89411..89496
FT                   /locus_tag="GYMC61_R0019"
FT                   /product="tRNA-Leu"
FT   gene            89500..89573
FT                   /locus_tag="GYMC61_R0020"
FT                   /note="tRNA-Arg1"
FT   tRNA            89500..89573
FT                   /locus_tag="GYMC61_R0020"
FT                   /product="tRNA-Arg"
FT   gene            89578..89651
FT                   /locus_tag="GYMC61_R0021"
FT                   /note="tRNA-Pro1"
FT   tRNA            89578..89651
FT                   /locus_tag="GYMC61_R0021"
FT                   /product="tRNA-Pro"
FT   gene            89664..89736
FT                   /locus_tag="GYMC61_R0022"
FT                   /note="tRNA-Ala3"
FT   tRNA            89664..89736
FT                   /locus_tag="GYMC61_R0022"
FT                   /product="tRNA-Ala"
FT   gene            90322..91867
FT                   /locus_tag="GYMC61_R0023"
FT   rRNA            90322..91867
FT                   /locus_tag="GYMC61_R0023"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            92507..95433
FT                   /locus_tag="GYMC61_R0024"
FT   rRNA            92507..95433
FT                   /locus_tag="GYMC61_R0024"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            95664..95779
FT                   /locus_tag="GYMC61_R0025"
FT   rRNA            95664..95779
FT                   /locus_tag="GYMC61_R0025"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            96044..96505
FT                   /locus_tag="GYMC61_0076"
FT   CDS_pept        96044..96505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0076"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: gka:GK0075 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76776"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ACX76776.1"
FT                   /translation="MPNISDIIEQYLKQVLNMSDQDIVEIKRSEIANKFQCVPSQINYV
FT                   INTRFTLERGYIVESKRGGGGYIRIMKVKAKSEAQLIDQLIELVGHRISQSNAEDVVKR
FT                   LVEEKVISEREAKIMLSAMDRSVLYIDLPERDELRARMLKAMLTSLKYK"
FT   gene            96521..97069
FT                   /locus_tag="GYMC61_0077"
FT   CDS_pept        96521..97069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0077"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: gka:GK0076
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76777"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ACX76777.1"
FT                   /translation="MICQECKQRPATMHFTKIVNGEKTEFHLCEQCAREHGHMFTFYGN
FT                   DDFSLNNLLAGLLNFQAPMKEMTTNAFPNPDVLQCETCQMTYHQFTQIGRFGCVDCYRT
FT                   FARYLPPILKRLHSGNTAHSGKIPKRKGGVLHLRKQLAILKQKLQELVAREEFERAAEV
FT                   RDQIRSLEDELRRRGEGDM"
FT   gene            97075..98166
FT                   /locus_tag="GYMC61_0078"
FT   CDS_pept        97075..98166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0078"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   gka:GK0077 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76778"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ACX76778.1"
FT                   /translation="MSFEKFFNTAVSAWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLF
FT                   SSEEAMQIVALFERTFAHRSYEGAGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPF
FT                   GACLLSENEEISIMINEEDHIRIQCLFPGLQLAEALEAASELDDWIEEYVNYAFDERLG
FT                   YLTSCPTNVGTGLRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIF
FT                   QISNQITLGKSEEDIVADLHTIVQQLIAQERAARQALVKTLGIQLEDKVFRSYGILANC
FT                   RVIESKEAAQCLSDVRLGIDLGYIKNISRNILNELMILTQPGFLQQYAGGPLRPEERDV
FT                   RRAALIRERLKMEERRKMEGDER"
FT   gene            98163..100595
FT                   /locus_tag="GYMC61_0079"
FT   CDS_pept        98163..100595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0079"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; Clp ATPase-like;
FT                   AAA ATPase central domain protein; UvrB/UvrC protein;
FT                   Torsin; ATPase associated with various cellular activities
FT                   AAA_5; Clp domain protein; SMART: AAA ATPase; KEGG:
FT                   gka:GK0078 ATP-dependent Clp protease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76779"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACX76779.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGI
FT                   AAKALMALGLGPDKIQKEVESLIGRGSEVSHTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESMSGHGGGASHVSTPTL
FT                   DSLARDLTAIAREGRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKYIEKDAALERRFQPIYVD
FT                   EPTVEESIQILKGLRDRYEAHHRVSISDEAIEQAVKLSDRYITDRFLPDKAIDLIDEAC
FT                   SKVRLRSFTAPPKLKELEQKLEEVRKEKDAAVQSQEFEKAASLRDMEQRLREELEETKR
FT                   AWKEKQGQENLEVTVEDIAAVVSSWTGIPVSKLAETETERLLKLEEILHSRVVGQDEAV
FT                   KAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFGDEDALIRIDMSE
FT                   YMEKHSTSRLIGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEMEKAHPDVFNILLQVLE
FT                   DGRLTDSKGRTVDFRNTIIIMTSNVGADALKRNKYVGFNIQDGNQQYKDMKSKVMDELK
FT                   KAFRPEFLNRIDEIIVFHSLEKDHLKQIVRLMADTLVKRLKEQDIDLELTEAAIEKIAA
FT                   EGFDPEYGARPLRRALQKHVEDRLSEELLKGTIAKGQKVVVDVKDGEFVVLSKQAVV"
FT   gene            100592..102046
FT                   /locus_tag="GYMC61_0080"
FT   CDS_pept        100592..102046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0080"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: gka:GK0079 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76780"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACX76780.1"
FT                   /translation="MREEKACGSFLPMPFFRWKTLQKGLRSMAKKKTKFVCQECGYESA
FT                   KWLGRCPGCQTWNSLVEEIEQEKPTVRGAFLHSERAGSAKPVPITAVEAVQEPRMKTNS
FT                   AELDRVLGGGIVKGSLVLIGGDPGIGKSTLLLQTSAQLAAAGHQVLYVSGEESVKQVKL
FT                   RAGRLRAECDRLYVLAEADLEYIVAAVETVQPACVIIDSIQTVYRTDISSAPGSVAQVR
FT                   ECTAELMKLAKTKGIAIFIVGHVTKEGAIAGPRLLEHMVDTVLYFEGERHHTYRILRAV
FT                   KNRFGSTNEIGIFEMRDIGLKEVENPSEVFLEERSRGAAGSTVVAAMEGTRPVLVEIQA
FT                   LVSPTSFGNPRRMATGLDHNRVSLLMAVLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDL
FT                   AVAVSIASSFRDRPTNPADVIIGEVGLTGEVRRVSRIEQRVQEAVKLGFSRIIVPKNNL
FT                   AGWQPPKGVQVIGVSHVAEALEHTMC"
FT   gene            102355..103449
FT                   /locus_tag="GYMC61_0081"
FT   CDS_pept        102355..103449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0081"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: gka:GK0080 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76781"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACX76781.1"
FT                   /translation="MVKRIVQLFFLAVGGTLGAMFFPDLLKLMNVSGMPLLNNSYTLAV
FT                   LGAVVFFLLTFWLVDYVVDMIRWVEETLVKAPAADVLFGSLGLIFGLIIAFFVVMPLQS
FT                   FHIQVLNTVLPIFLTVLLGYLGFRVGLKKRNELMNLFSLSNRMAKKKGGEAENEPSKGG
FT                   AVKILDTSVIIDGRIADICQTGFLEGPLVIPRFVLEELQHIADSSDVLKRNRGRRGLDI
FT                   LNRIQKEMAMKVEIHEADFSDVQEVDSKLVKLAKQLQGVVVTNDFNLNKVCELQNVRVL
FT                   NINDLANAVKPVVLPGEELNVHVIKDGKEHNQGVAYLDDGTMIVVEDGKEYIGKRVDVL
FT                   VTSVLQTSAGRMIFAKLKLLQKAL"
FT   gene            103471..104157
FT                   /locus_tag="GYMC61_0082"
FT   CDS_pept        103471..104157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0082"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   gka:GK0081 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76782"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACX76782.1"
FT                   /translation="MNYEAIVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDEW
FT                   CTRIVLVVNPAERSRFEQLLARFRIRKVAALTDGGEERQHSVYNGLQALAGEEIVLIHD
FT                   GARPFVRVHHLHELVNAAVQYGAAIPAVRVKDTIKKANGLFVEQTIDRSSLWAVQTPQA
FT                   FRLSLIMEAHEAAKQAGYLGTDDAGLVERIGKPVKIIEGDYRNIKLTTPEDLLFAEAIL
FT                   ASRMAE"
FT   gene            104172..104648
FT                   /locus_tag="GYMC61_0083"
FT   CDS_pept        104172..104648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0083"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: gka:GK0082 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76783"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACX76783.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGVTIPYEKGLLGHSDADVLLHAV
FT                   ADACLGAIGAGDIGRHFPDTDPRFKDADSAELLAHVWALARQEGYRLVNADCTIIAQKP
FT                   KMAPYIEEMRAVIARLLEAERSQVNVKATTTEKLGFTGRGEGIAAQAVVLLQKS"
FT   gene            104847..106322
FT                   /locus_tag="GYMC61_0084"
FT   CDS_pept        104847..106322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0084"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; KEGG: gka:GK0083 glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76784"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ACX76784.1"
FT                   /translation="MMAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIE
FT                   DTDIERNVEGGEKSQLENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQG
FT                   HAYKCFCTPEELEREREAQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPE
FT                   GKTYEFYDLVRGKVVFESKDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHL
FT                   SNTPKQLMVYEYFGWEPPQFAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMF
FT                   NFFALLGWSPEGEEEIFTKDELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRL
FT                   VELALPHLVKAGRLPADMTDEQRQWARDLIALYQEQMSYGAEIVPLSELFFKEEIDYED
FT                   EARQVLAEEQVPAVLSTFLESVRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAV
FT                   TGQTHGPELPFAIQLLGKEKVIERLERALQEKF"
FT   gene            106691..107365
FT                   /locus_tag="GYMC61_0085"
FT   CDS_pept        106691..107365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0085"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   gka:GK0084 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76785"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ACX76785.1"
FT                   /translation="MFKTLKEDIEVIFEQDPAARSYLEVILTYSGLHAIWAHRIAHALY
FT                   KRKFYFLARLISQISRFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIGDNVTVYQGV
FT                   TLGGTGKEKGKRHPTIKDNCLIAAGAKVLGSITIGENSKIGAGSVVLKDVPPNSTVVGI
FT                   PGRVVVRDGVKVKKDLNHTDLPDPIADRFRELEEEIARLKSELEALKQQERKNEYEQHP
FT                   AL"
FT   gene            107343..108743
FT                   /locus_tag="GYMC61_0086"
FT   CDS_pept        107343..108743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0086"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: gka:GK0085 cysteinyl-tRNA synthetase; TIGRFAM:
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia ; Cysteinyl-tRNA synthetase class Ia DALR; tRNA
FT                   synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76786"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACX76786.1"
FT                   /translation="MSSIRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARA
FT                   AIVFDTIRRYLEFRGYDVTYVSNFTDVDDKLIKAARELGESVPAIAERFIEAYFEDIQA
FT                   LGCKKADIHPRVTENIDTIIEFIQALIDKGYAYEVDGDVYYRTRKFREYGKLSHQSIDE
FT                   LQAGARIEIGEKKDDPLDFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTI
FT                   DIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDI
FT                   IREIDPQVLRFFMLSVHYRHPINYSEELLESARRGLERLKTAYSNLQHRLQASTNLTDN
FT                   DEEWVSRIADIRASFIREMDDDFNTANGIAVLFELAKQANLYLQEKTTSEKVIHAFLRE
FT                   FEQLADVLGLTLKQDELLDEEIEALIQKRNEARKNRDFALADRIRDELRAKNIILEDTP
FT                   QGTRWKRG"
FT   gene            108750..109175
FT                   /locus_tag="GYMC61_0087"
FT   CDS_pept        108750..109175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0087"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; SMART: ribonuclease III;
FT                   KEGG: gka:GK0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76787"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ACX76787.1"
FT                   /translation="MMAEFETVNDVKQLNGLALAYIGDAVYEVYVRRHLLAGGSVRPHE
FT                   LHRRAVRYVSARAQARVILALLDEGVLTEEEKDIVRRGRNAKSGTIPKNTDVQTYRHST
FT                   AFEALIGYHFLVNNEKRVDELIGRSFAIIEREERALE"
FT   gene            109172..109912
FT                   /locus_tag="GYMC61_0088"
FT   CDS_pept        109172..109912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0088"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: gka:GK0087
FT                   tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76788"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACX76788.1"
FT                   /translation="MMDYIIGKNPVIEALKAGRDINKIWIAEGAQRHTVEPVLEWAKRR
FT                   GVLVQYVPKRKLDQMAEGAHQGVIAQAAAYRYYEIDDLFARAAERGEAPFFLILDELED
FT                   PHNLGAIMRTADAVGAHGLIIPKRRSVGLTQTVAKASTGAIEHVPVARVTNLARTIDEL
FT                   KERGVWVAGTDASAQDDYRSLDGTMPLALVIGSEGKGISRLVLEKCDFLFRLPMRGHVT
FT                   SLNASVAASLLMYEVYRKRYPLGE"
FT   gene            109916..110428
FT                   /locus_tag="GYMC61_0089"
FT   CDS_pept        109916..110428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0089"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   gka:GK0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76789"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ACX76789.1"
FT                   /translation="MNILIVDGYNIIGAWPELRRLKEEGDLAAARDLLIEKMADYKGFT
FT                   GDHVVIVFDAHLVQGNEKKYKHYDVDVIFTKEHETADERIERLAKTLMNARTKVYVATS
FT                   DYTEQWTVFGQGALRKSARELLDEVETVERDISQKVKAMRQRTPISKVPLNDRIAEIFE
FT                   KWRRGEK"
FT   gene            110465..111181
FT                   /locus_tag="GYMC61_0090"
FT   CDS_pept        110465..111181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0090"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   gka:GK0089 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76790"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ACX76790.1"
FT                   /translation="MLAIDAVGGISVGECLKAMKGKDYHQLDDERLVALVHEGDGEALD
FT                   FLIHKYQNFVRAKARSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSSFKAFAELCIT
FT                   RQMITAIKTATRQKHIPLNSYVSLDKPIYDDESDRTLMDVLSGTQVTDPEQLIVNREEV
FT                   DDIELKMAELLSDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLEY
FT                   REISLWASRRRIKRCH"
FT   gene            111242..111391
FT                   /locus_tag="GYMC61_0091"
FT   CDS_pept        111242..111391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0091"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: gka:GK0090 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76791"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ACX76791.1"
FT                   /translation="MRQKVTLACAQCGSRNYTAAKQIRRLGERLMANKFCSTCNKHTIH
FT                   RETK"
FT   gene            111432..111614
FT                   /locus_tag="GYMC61_0092"
FT   CDS_pept        111432..111614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0092"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: gka:GK0091
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76792"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ACX76792.1"
FT                   /translation="MQRVINFLKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFA
FT                   VVDLGISELIRLVFE"
FT   gene            111727..112260
FT                   /locus_tag="GYMC61_0093"
FT   CDS_pept        111727..112260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0093"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: gka:GK0092 transcription antitermination
FT                   protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM: NGN domain
FT                   protein; KOW domain protein; SMART: NGN domain protein; KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76793"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ACX76793.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEETE
FT                   TDVKNGKRKTTKKKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSSGAGSKPTPLMEE
FT                   EVKMILKRMGMPLAEVDVDYEVNETVRIKEGPFANFTGKIEAIDPDKHKVKLLVDMFGR
FT                   ETRVELEFSQIEKI"
FT   gene            112495..112920
FT                   /locus_tag="GYMC61_0094"
FT   CDS_pept        112495..112920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0094"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: gka:GK0093 50S ribosomal protein L11; TIGRFAM:
FT                   ribosomal protein L11; PFAM: ribosomal protein L11; SMART:
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76794"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ACX76794.1"
FT                   /translation="MAKKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDK
FT                   VREIAELKMPDLNAASIEAAMRMIEGTARSMGIVIED"
FT   gene            113102..113802
FT                   /locus_tag="GYMC61_0095"
FT   CDS_pept        join(113102..113260,113260..113802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="GYMC61_0095"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: gka:GK0094 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76795"
FT                   /inference="protein motif:PFAM:PF00687"
FT                   /protein_id="ACX76795.1"
FT                   /translation="MPKRGKKYLEALKLVDRSKAYPIAEAIELVKKTNIAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEKAKEAEAAGADYVGDTEYINKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVAKAVQEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDNEKLAENFAAVYEAILKAKPAAAKGTYVKNVTITSTMGPGI
FT                   KVDPSTVAVAQ"
FT   gene            114061..114561
FT                   /locus_tag="GYMC61_0096"
FT   CDS_pept        114061..114561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0096"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: gka:GK0095 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76796"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACX76796.1"
FT                   /translation="MSSAIELKKQVVAEIADKFRASKATVIVDYRGLNVAEMTELRKQL
FT                   REAGVEFKVYKNTLTRRALAEVGLEGLDEVFTGPNAIAFSNEDVVAPAKILSEFAKTHE
FT                   ALEIKGGVIEGNIASKEEIDALAKLPSREGLLSMLLSVLQAPIRNFALAIKAVADKQEE
FT                   QGA"
FT   gene            114616..114984
FT                   /locus_tag="GYMC61_0097"
FT   CDS_pept        114616..114984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0097"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: gka:GK0096 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76797"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ACX76797.1"
FT                   /translation="MTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAA
FT                   GAEAAAEKTEFDVILADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEE
FT                   AEEIKAKLEEAGAKVEIK"
FT   gene            115090..115698
FT                   /locus_tag="GYMC61_0098"
FT   CDS_pept        115090..115698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0098"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gka:GK0097
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76798"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACX76798.1"
FT                   /translation="MMMSEHYYSVNPKSERNPQTWTYVLRGHEFRFTTDSGVFSKREVD
FT                   FGTRLLIETFEEPGVAGDLLDVGCGYGPIGLALAKSFPNRRVHMIDVNERALELAQENK
FT                   QANGIDNAVIYKSDLFSEVGEQRFAAVVTNPPIRAGKRVVYAIFEQSRDHLLDHGELWV
FT                   VIQKKQGAPSALQKLNECFPAVEVVAKKKGYYIIKAKKC"
FT   gene            116111..119683
FT                   /locus_tag="GYMC61_0099"
FT   CDS_pept        116111..119683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0099"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: gka:GK0098 DNA-directed RNA polymerase subunit
FT                   beta; TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 7; RNA polymerase Rpb2
FT                   domain 3; RNA polymerase Rpb2 domain 2; DNA-directed RNA
FT                   polymerase, beta subunit, external 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76799"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ACX76799.1"
FT                   /translation="MTGRLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFREISPIEDFSGNLSLEFIDYSLGEPKYTVEEAKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSDKVDKNGKRGYSATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFSSDQEIIDLLGDNEYLRNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTLENAKNLLASRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETIIDPETKEVIAEAGAMIDRRTLNRLLPYLEKGVGLQTYRPAEGVVDG
FT                   DISVQTIKIYAPNDPDGEKVINVIGNGFIAEDVKHITPADIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIAAI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGRVTDQIDYLTADEEDNYVVAQ
FT                   ANVPLAEDGTFLEENVVARFRGENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLEPEAPIVGTGMEYVSAKDSGAAVICKHRGIVERVEAKEIWVRR
FT                   LIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKKGDIVEKGEILADGPSMDKGEL
FT                   ALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAESRDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIVRIGAEVKDGDLLVGKVTPKGMTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVFELHLGMAAKKLGLHIAS
FT                   PVFDGATEEDVWNILEEAGLARDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENIPEPGVPESFKVLIKELQSLGMDVTILTSDEQEVNMENFDDDDDHAPD
FT                   AIMVDVKPAEREEAGEEKDAVTKE"
FT   gene            119776..123375
FT                   /locus_tag="GYMC61_0100"
FT   CDS_pept        119776..123375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0100"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: gka:GK0099 DNA-directed RNA polymerase subunit
FT                   beta'; TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76800"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ACX76800.1"
FT                   /translation="MLDVNKFEYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKKQLLSEKEYRAYREKYG
FT                   QSFQASMGAEAIKKLLQDIDLDKEVAALKEELKTAQGQRRARIIKRLEVLEAFRSSGND
FT                   PAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERGLAHNIKSAKRKIERVHPEVWD
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFK
FT                   DTDEALLAYHNGYVHLHSRIAIHAGSLKNETFTEEQNNKLLLTTVGKLIFNEILPNSFP
FT                   YINEPTTENIEGRTPDKYFLDKGVNVREEIRKRELVPPFKKKVLGQIIAEVFKRFKITE
FT                   TSKMLDRMKDLGFQYSTKAGITIGVADIVVLPEKQEILDEAQAKVDTVLKQFRRGLITD
FT                   EERYERVISIWSAAKDKIQDRLMKSLDKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREEDCGTDRGILARALTDGTEVVVKLEERLVGRYAHKTVRHPETGEVIVRKDEMITED
FT                   IANEIIKAGITEVWIRSVFACNTRHGVCKKCYGRNMATGMDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRVQELFEARNPKGQAVISEIDGTVISINETRDNQY
FT                   EIVVQSEVETRTYVAPYNARLKVEEGQRVERGQELTEGSVDPKQLLRVRDITSVQEYLL
FT                   REVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDVLPGTLLDVHQFTDVNAKAL
FT                   REGKRPATARQVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMARYRKVKPAVKKETAGDTVSSK"
FT   gene            123510..123758
FT                   /locus_tag="GYMC61_0101"
FT   CDS_pept        123510..123758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0101"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   gka:GK0100 putative ribosomal protein L7Ae-like"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76801"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ACX76801.1"
FT                   /translation="MSYEKVLQAGKIVIGTKQTIRALKEGKAAEVIVAEDADLPIIEKV
FT                   TAAANEANVPVTKVDSMKKLGKACKIQVGAAAVAILR"
FT   gene            123855..124277
FT                   /locus_tag="GYMC61_0102"
FT   CDS_pept        123855..124277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0102"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: gka:GK0101 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76802"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACX76802.1"
FT                   /translation="MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKEQTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDAAGVANRMQGRSKYGAKKPKAAKK"
FT   gene            124317..124787
FT                   /locus_tag="GYMC61_0103"
FT   CDS_pept        124317..124787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0103"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: gka:GK0102 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76803"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACX76803.1"
FT                   /translation="MPRRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYT
FT                   AFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWL
FT                   VQYARLRNEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANRAFAHYRW"
FT   gene            124968..127037
FT                   /locus_tag="GYMC61_0104"
FT   CDS_pept        124968..127037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0104"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: gka:GK0103 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76804"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACX76804.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAIT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVKTLHDRLQANAHPVQ
FT                   LPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIDIPEEYRDMAEEYHNKLIEAVAELD
FT                   EELMMKYLEGEEISTEELKAAIRKATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSP
FT                   VDIPAIRGVVPDTEEEVTREASDDAPFAALAFKIMTDPYVGKLTFIRVYSGTLDSGSYV
FT                   MNTTKGKRERIGRLLQMHANHRQEISKVYAGDIAAAVGLKDTTTGDTLCDEKHPVILES
FT                   MQFPEPVISVAIEPKSKADQDKMSQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNER
FT                   GKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASLALKNAATKCDPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRIEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIQKK"
FT   gene            127176..128363
FT                   /locus_tag="GYMC61_0105"
FT   CDS_pept        127176..128363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0105"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: gka:GK0104
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76805"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACX76805.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAK
FT                   AYDQIDAAPEERERGITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDEVPVIKGSALKALEGDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSIT
FT                   GRGTVATGRVERGTLKVGDPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLR
FT                   GVSRDEVERGQVLAKPGSITPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVT
FT                   GIITLPEGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE"
FT   gene            128660..128968
FT                   /locus_tag="GYMC61_0106"
FT   CDS_pept        128660..128968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0106"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: gtn:GTNG_0105 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76806"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACX76806.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTE
FT                   RTVYTILRAVHKYKDSREQFEMRTHKRLIDIINPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            128989..129630
FT                   /locus_tag="GYMC61_0107"
FT   CDS_pept        128989..129630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0107"
FT                   /product="50S ribosomal protein L3"
FT                   /note="TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal
FT                   protein L3; KEGG: gka:GK0106 50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76807"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ACX76807.1"
FT                   /translation="MTKGILGRKIGMTQIFAENGDLIPVTVIHATPNVVLQKKTIENDG
FT                   YEAIQLGFEDISEKRANKPQIGHAAKANTAPKRFIREIRGANIDEYEVGQEVKVDIFSE
FT                   GEIVDVTGISKGKGFQGAIKRHGQSRGPMAHGSRYHRRPGSMGSIAPNRVFKTKNLPGR
FT                   MGGERVTIQNLKIVKVDPERNLLLIKGNVPGPRKGLVIVKSAVKAAKKAK"
FT   gene            129660..130283
FT                   /locus_tag="GYMC61_0108"
FT   CDS_pept        129660..130283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0108"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: gka:GK0107 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76808"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACX76808.1"
FT                   /translation="MPKVALYNQNGQTVGEIELNDAVFGIEPNKHVLFEAVIMQRASMR
FT                   QGTHKTKNRAEVSGGGRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKK
FT                   VRRLAIKSALSSKVLENDIVVLDQLSLEAPKTKEMVKILNNLSVDRKALIVTDELNENV
FT                   YLSARNIPGVKVVAANGINVLDVLNHDKLVITKAAVEKVEEVLA"
FT   gene            130283..130570
FT                   /locus_tag="GYMC61_0109"
FT   CDS_pept        130283..130570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0109"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: gka:GK0108
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76809"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACX76809.1"
FT                   /translation="MKDPRDIIKRPIITENTMNLIGQKKYTFEVDVKANKTEVKDAVEK
FT                   IFGVKVAKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV"
FT   gene            130598..131428
FT                   /locus_tag="GYMC61_0110"
FT   CDS_pept        130598..131428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0110"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: gka:GK0109 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76810"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACX76810.1"
FT                   /translation="MAIKKYKPTSNGRRGMTVLDFSEITTDQPEKSLLAPLKKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRDKDGIPGRVATIEYDPNRSANIALINYADGEKRYI
FT                   IAPKNLKVGMEIMSGPDADIKIGNALPLENIPVGTLVHNIELKPGRGGQLVRAAGTSAQ
FT                   VLGKEGKYVIVRLASGEVRMILGKCRATVGEVGNEQHELVNIGKAGRARWLGIRPTVRG
FT                   SVMNPVDHPHGGGEGKAPIGRKSPMTPWGKPTLGYKTRKKKNKSDKFIIRRRKK"
FT   gene            131462..131740
FT                   /locus_tag="GYMC61_0111"
FT   CDS_pept        131462..131740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0111"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: gka:GK0110 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76811"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACX76811.1"
FT                   /translation="MGRSLKKGPFCDEHLMKKIEKLNATGQKQVIKTWSRRSTIFPQFV
FT                   GHTIAVYDGRKHVPVYITEDMVGHKLGEFAPTRTFRGHAGDDKKTKR"
FT   gene            131759..132100
FT                   /locus_tag="GYMC61_0112"
FT   CDS_pept        131759..132100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0112"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: gka:GK0111 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76812"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACX76812.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASP
FT                   IIEKVLKSAVANAEHNYDMDVNNLVITQAYVDEGPTLKRFRPRAMGRASAINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            132104..132760
FT                   /locus_tag="GYMC61_0113"
FT   CDS_pept        132104..132760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0113"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: gka:GK0112 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76813"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACX76813.1"
FT                   /translation="MGQKVNPIGLRIGIIRDWESRWYAEKDYADLLHEDLKIREYISKR
FT                   LQDAAVSRVEIERAANRVNVTIHTAKPGMVIGKGGSEVEALRKALAQLTGKRVHINIVE
FT                   IKKPDLDARLVAENIARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIAR
FT                   SEHYSEGTVPLHTLRADIDYGTAEADTTYGKIGVKVWIYRGEVLPTKKKAEEGGK"
FT   gene            132763..133188
FT                   /locus_tag="GYMC61_0114"
FT   CDS_pept        132763..133188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0114"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: Ribosomal
FT                   protein L10e/L16; KEGG: gka:GK0113 50S ribosomal protein
FT                   L16"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76814"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACX76814.1"
FT                   /translation="MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEFGLQALESAWITNR
FT                   QIEAARRAMTRYMRRGGKVWIRIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EVGGVSEEVAREALRLASHKLPIKCKFVKREETGGEA"
FT   gene            133188..133388
FT                   /locus_tag="GYMC61_0115"
FT   CDS_pept        133188..133388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0115"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: gka:GK0114 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76815"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACX76815.1"
FT                   /translation="MKAKEIRELTTAEIEQKIKALKEELFNLRFQLATGQLENTARIRQ
FT                   VRKDIARMKTIIRERELAANK"
FT   gene            133413..133676
FT                   /locus_tag="GYMC61_0116"
FT   CDS_pept        133413..133676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0116"
FT                   /product="30S ribosomal protein S17"
FT                   /note="TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal
FT                   protein S17; KEGG: gka:GK0115 30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76816"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ACX76816.1"
FT                   /translation="MSQRNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDEHNIAKVGDIVKIMETRPLSATKRFRLVEVIEKSVVL"
FT   gene            133726..134094
FT                   /locus_tag="GYMC61_0117"
FT   CDS_pept        133726..134094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0117"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: gka:GK0116 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76817"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACX76817.1"
FT                   /translation="MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKD
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRPDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
FT   gene            134131..134442
FT                   /locus_tag="GYMC61_0118"
FT   CDS_pept        134131..134442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0118"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: gka:GK0117 50S ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76818"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACX76818.1"
FT                   /translation="MHVKKGDKVQVISGKDKGKQGVILAAFPKKNRVIVEGVNIVKKHA
FT                   KPSQANPQGGIIEKEAPIHVSKVMPLDPKTGEPTRIGYKIVDGKKVRYAKKSGEILDK"
FT   gene            134470..135009
FT                   /locus_tag="GYMC61_0119"
FT   CDS_pept        134470..135009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0119"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: gka:GK0118 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76819"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACX76819.1"
FT                   /translation="MNRLKEKYVNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQ
FT                   NPKALDSAVEELTLIAGQRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTANTD
FT                   EEARELLALLGMPFQK"
FT   gene            135039..135224
FT                   /locus_tag="GYMC61_0120"
FT   CDS_pept        135039..135224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0120"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: gwc:GWCH70_0124
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76820"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACX76820.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQLPGIKKASW"
FT   gene            135258..135656
FT                   /locus_tag="GYMC61_0121"
FT   CDS_pept        135258..135656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0121"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: gtn:GTNG_0119 SSU
FT                   ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76821"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACX76821.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGF
FT                   IRDYEYIEDNKQGILRIFLKYGPNNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIA
FT                   ILSTSQGILTDKEARQKGTGGEVIAYVW"
FT   gene            135689..136225
FT                   /locus_tag="GYMC61_0122"
FT   CDS_pept        135689..136225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0122"
FT                   /product="ribosomal protein L6"
FT                   /note="TIGRFAM: ribosomal protein L6; PFAM: Ribosomal
FT                   protein L6, alpha-beta domain; KEGG: gka:GK0121 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76822"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ACX76822.1"
FT                   /translation="MSRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITV
FT                   EGNVITVTRPSDEKHHRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLV
FT                   LSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIR
FT                   YEGELVRLKEGKTGK"
FT   gene            136259..136621
FT                   /locus_tag="GYMC61_0123"
FT   CDS_pept        136259..136621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0123"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: gka:GK0122 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76823"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACX76823.1"
FT                   /translation="MITKVDRNAVRKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQII
FT                   DDTKSSTIVSASTLDKEFGLDSTNNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
FT   gene            136641..137141
FT                   /locus_tag="GYMC61_0124"
FT   CDS_pept        136641..137141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0124"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; KEGG:
FT                   gka:GK0123 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76824"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACX76824.1"
FT                   /translation="MRRIDPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTG
FT                   VIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLKRAEDVARLRGKTVEE
FT                   LLG"
FT   gene            137155..137343
FT                   /locus_tag="GYMC61_0125"
FT   CDS_pept        137155..137343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0125"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: gka:GK0124 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76825"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACX76825.1"
FT                   /translation="MAKKLAITLTRSVIGRPEDQRVTVRTLGLRKMHQTVIHNDNPAIR
FT                   GMINKVAHLVKVKEIEE"
FT   gene            137368..137808
FT                   /locus_tag="GYMC61_0126"
FT   CDS_pept        137368..137808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0126"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: gka:GK0125 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76826"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACX76826.1"
FT                   /translation="MKLHELQPAPGSRKKAVRVGRGIGSGNGKTSGRGQKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEYAVVNLEKLNRFEDGTEVTPELLLETGVISK
FT                   LKSGVKILGKGQIEKKLTVKAHKFSASAKEAIEAAGGKTEVI"
FT   gene            137808..139100
FT                   /locus_tag="GYMC61_0127"
FT   CDS_pept        137808..139100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0127"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: gka:GK0126 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76827"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACX76827.1"
FT                   /translation="MFRTISNFMRVSDIRNKIIFTLLMLIVFRIGTFIPVPGVNADVLK
FT                   LQDELNAFGVLNIFGGGALRNFSIFAMGVMPYITASIIVQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTVVLGFIQAIGMSYGFNNLAGGMLIRNPGIGTYLLIAVVLTAGTAFL
FT                   MWLGEQITAKGVGNGISIIIFAGIVSGIPTVLNQIYAQQFENVGEDVFLRIVRLLLVAL
FT                   AVVAVIVGVIYIQQAFRKIPIQYAKRLEGRSPVGGHSTHLPLKVNPAGVIPVIFAVSFL
FT                   IAPPTIASFFGTNDVTLWIRRTFDYTHPVGMIIYVVLIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGIRPGKNTQEYVTRILYRLTLVGSIFLAVVAVLPVFFVNFANLPSSARIGG
FT                   TSLLIVVGVALETMKQLESQLVKRHYRGFIK"
FT   gene            139144..139797
FT                   /locus_tag="GYMC61_0128"
FT   CDS_pept        139144..139797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0128"
FT                   /product="adenylate kinase"
FT                   /note="TIGRFAM: adenylate kinase; PFAM: adenylate kinase;
FT                   adenylate kinase lid domain protein; KEGG: gka:GK0127
FT                   adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76828"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ACX76828.1"
FT                   /translation="MNLVLMGLPGAGKGTQAGKIVEAYGIPHISTGDMFRAAIKEGTPL
FT                   GSQAKQYMDRGDLVPDEVTIGIVRERLSKEDCQNGFLLDGFPRTVAQAEALETLLSEIG
FT                   RKLDYVIHIDVRQEVLMERLTGRRICRNCGATYHLVFHPPAKPGVCDKCGGDLYQRPDD
FT                   NEATVANRLEVNMKQMKPLLDFYEQKGYLRHINGEQEMEKVFADICEVLGGLAR"
FT   gene            139794..140561
FT                   /locus_tag="GYMC61_0129"
FT   CDS_pept        139794..140561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0129"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: gka:GK0128 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76829"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ACX76829.1"
FT                   /translation="MIRCKTAQEIALMREAGKIVFLTLKELQKHIRPGITTKELDAIAE
FT                   EVIRSHGAIPSFKGYQGFPGSICASVNEELVHGIPSGRALREGDIITIDVGAQYEGYHA
FT                   DSAWTYPVGEIDAETKRLLDVTEQSLYVGLAEAKPGARLTNISHAIQTYVEAHHFSVVR
FT                   EYVGHGIGQHLHEDPQIPHYGPPNKGPILRPGMALCIEPMVNAGSRYVKTLADDWTVVT
FT                   ADGKRCAHFEHTIVITEDGCEILTHCGNESPTS"
FT   gene            140657..140875
FT                   /locus_tag="GYMC61_0130"
FT   CDS_pept        140657..140875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0130"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   S1 IF1 family protein; KEGG: gka:GK0129 translation
FT                   initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76830"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ACX76830.1"
FT                   /translation="MAKDDVIEVEGTVIETLPNAMFRVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDRVTVELSPYDLTRGRITYRYK"
FT   gene            140912..141025
FT                   /locus_tag="GYMC61_0131"
FT   CDS_pept        140912..141025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0131"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: gwc:GWCH70_0135 ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76831"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACX76831.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQRQG"
FT   gene            141046..141411
FT                   /locus_tag="GYMC61_0132"
FT   CDS_pept        141046..141411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0132"
FT                   /product="30S ribosomal protein S13"
FT                   /note="TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal
FT                   protein S13; KEGG: gtn:GTNG_0129 30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76832"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ACX76832.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGIGKPTAQKILKEAGVSEDTRV
FT                   RDLTEEELGRIREIVGCLKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            141437..141826
FT                   /locus_tag="GYMC61_0133"
FT   CDS_pept        141437..141826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0133"
FT                   /product="30S ribosomal protein S11"
FT                   /note="TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal
FT                   protein S11; KEGG: gka:GK0132 30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76833"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ACX76833.1"
FT                   /translation="MARRTNTRKRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNAIAWA
FT                   SAGSLGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPIPHNGCRPPKRRRV"
FT   gene            141977..142921
FT                   /locus_tag="GYMC61_0134"
FT   CDS_pept        141977..142921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0134"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: gka:GK0133 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase alpha subunit
FT                   domain protein; RNA polymerase dimerisation; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76834"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACX76834.1"
FT                   /translation="MIEIEKPKIETVELSEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIDGVVEDVTAIILNIKKLALKIYSDEEKTLEIDVQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLAEGGRLRMRMTAKRGRGYVPAEANKREDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVTDYDKLTIDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEDDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVKAKLAELGLSLRKDD"
FT   gene            143022..143384
FT                   /locus_tag="GYMC61_0135"
FT   CDS_pept        143022..143384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0135"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: gka:GK0134 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76835"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACX76835.1"
FT                   /translation="MSYRKLGRTTSQRKALLRDLATDLIINERIETTEARAKELRSVME
FT                   KMITLGKRGDLHARRQAAAFIRKEVANSETGQDALQKLFSDIAPRYQDRQGGYTRIMKL
FT                   GPRRGDGAPMVIIELV"
FT   gene            143502..144341
FT                   /locus_tag="GYMC61_0136"
FT   CDS_pept        143502..144341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0136"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gka:GK0135 cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76836"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX76836.1"
FT                   /translation="MAEPILSIEGVSFRYPNQSDYAVQNVSFTAERGEWLAIVGHNGSG
FT                   KSTIARMLIGLLRPERGAIRLFGRLLNDATVWEVRRRVGLVFQNPDNQFVGATVEDDIA
FT                   FALENNGIPRLEMVERIREAIRQVHMEPFLHYEPHRLSGGQKQRVAIAGILALRPDMII
FT                   LDEATSMLDPRGREEVLETVRRLNRQQRITVLSITHDLEEAAKADRLIVMNKGEVMAEG
FT                   TPEQIFRLGSKLERIGLDLPFAVKMGSRLREQGIPLRAGYFTTEELVEELWTLYSKK"
FT   gene            144317..145189
FT                   /locus_tag="GYMC61_0137"
FT   CDS_pept        144317..145189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0137"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gka:GK0136 cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76837"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX76837.1"
FT                   /translation="MDIVFEKVEHVYNARSPLARRALYDVNVAIRSGVYVAIVGHTGSG
FT                   KSTLLQHLNGLLQPTSGAVKIGQETITSNKRPKQLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPLNFGVPEDEAKRKARELIQLVGLSEDVLTKSPFDLSGGQMRRVAIAGVLALE
FT                   PEVLVLDEPTAGLDPRGRKEMMEMFYRLHREKQLTTVLVTHSMEDAARYADEIIVMHEG
FT                   TVWGHGTPEEMFRDADKLAAIGLSVPETVKLKQQLEKRLGVVIPSPCLTLEQTAEAIQQ
FT                   LFSKVSVHD"
FT   gene            145182..145979
FT                   /locus_tag="GYMC61_0138"
FT   CDS_pept        145182..145979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0138"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: gka:GK0137
FT                   cobalt transporter system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76838"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACX76838.1"
FT                   /translation="MTNHLIIGQYVPGHSVIHRLDPRAKLLIVFAYVLIVFLANNAATY
FT                   ALLSLFAFAFAALSRIPFSFIARGLKPILWVILFTLLLHLFMTKEGDVIYQIGALSVYE
FT                   GGIKQGVFISLRFLLLVLMTTMLTLTTTPIEVTDGVESLLGPLKKMRVPVHELALMMAI
FT                   SLRFIPTLMEETEKIMKAQAARGVDFSGGRFSERMKAIVSLLVPLFISSFKRADELATA
FT                   MEARGYRGGEGRTKFRQLAWKPVDTVFLAAVALLAVLLFLLRS"
FT   gene            145992..146768
FT                   /locus_tag="GYMC61_0139"
FT   CDS_pept        145992..146768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0139"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: gka:GK0138 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76839"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACX76839.1"
FT                   /translation="MTKRIKCIIAYDGTHFSGYQIQPGKRTVQGELEEVLRRMHKGKGV
FT                   RVAASGRTDAGVHAYGQVIHFDTSLSLSSEQWKKALNAQLPDDIVVRFVQEADADFHAR
FT                   FSAKAKEYRYKVWTAAERDVFRRHYCAWHPYPLHMDAMNEALRLFCGTHDFTSFCSAKT
FT                   TIEDRVRTIYRAKVKVDGPMLEFRFVGSGFLYNMVRIMVGTVLEIGQGKRSPADISTLL
FT                   AAKDRRLAGPTAPAEGLYLWRVYYGDEWLDRELADG"
FT   gene            146948..147385
FT                   /locus_tag="GYMC61_0140"
FT   CDS_pept        146948..147385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0140"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: gka:GK0139 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76840"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACX76840.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAAGKTLGRLASEVAALLRGKHKPTF
FT                   TPHVDCGDHVIVINADKVELTGKKLTKKLYYRHSLYPGGLKVRTALEMRTNYPEQMIER
FT                   AVRGMLPKGSLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
FT   gene            147408..147800
FT                   /locus_tag="GYMC61_0141"
FT   CDS_pept        147408..147800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0141"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: gka:GK0140 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76841"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACX76841.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGDGRIIVNKRDIREYIPSEALI
FT                   EMVKQPLVLTETLGSYDVLVNVQGGGFAGQAGAIRHGIARALLEVDPEFRAVLKRAGLL
FT                   TRDARVKERKKYGLKGARRAPQFSKR"
FT   gene            147920..148360
FT                   /locus_tag="GYMC61_0142"
FT   CDS_pept        147920..148360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0142"
FT                   /product="Protein of unknown function DUF2521"
FT                   /note="PFAM: Protein of unknown function DUF2521; KEGG:
FT                   gka:GK0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76842"
FT                   /inference="protein motif:PFAM:PF10730"
FT                   /protein_id="ACX76842.1"
FT                   /translation="MTVITSLAEKRQEKQLRYERNMLRELSLEKLRTKALEHFVPFYTA
FT                   YRMFPSVVEEGCIDLAIEAYLLGARYSRFGYYGEPAASVRCRCAQEEKYLIDTLFDFLC
FT                   FWGHIDNDFLSQSLYDACEQYIGNWWTEGFERGKKRRRLKLR"
FT   gene            148427..149143
FT                   /locus_tag="GYMC61_0143"
FT   CDS_pept        148427..149143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0143"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: gka:GK0142 germination-specific
FT                   N-acetylmuramoyl-L-alanine amidase (cell wall hydrolase)
FT                   (autolysin); TIGRFAM: N-acetylmuramoyl-L-alanine amidase
FT                   CwlD; PFAM: cell wall hydrolase/autolysin; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76843"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ACX76843.1"
FT                   /translation="MKEKWKWLVAFAAVALMSTLLFPSLFSDLTSTKPWNLPLSGRIIV
FT                   LDPGHGGPDGGAVGGEAVEKDIALNVAKKLRDYLQQQGALVLMTRETDRDLASPSTRGY
FT                   SRRKTEDLLERTAFVNRSNADLFISIHLNAIPSPRWRGAQTFYYGSFIENERLARFIQA
FT                   ELRRNLENTHRLAKMIDTVYLLKHAKIPGALVEVGFLSNPDERELLVSDGYQTKLAASI
FT                   YKGVLRYFSNEHTPRE"
FT   gene            149337..150353
FT                   /locus_tag="GYMC61_0144"
FT   CDS_pept        149337..150353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0144"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: gka:GK0143
FT                   ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76844"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ACX76844.1"
FT                   /translation="MLTETEVRAILEKMKDPFLNKTFKETNAIQEIKIKEEKNHVSVKI
FT                   ALAKTGTPEQLRVQTAIVEQLKDAGAATVGLRFAELPRDVVEKYSENKQKTTYIAIASG
FT                   KGGVGKSTVSVNLAVALARLGKKVGLIDADIYGFSVPDMMGITERPTVRGDKIIPVERF
FT                   GVKVISMAFFVEDNAPVIWRGPMLGKMLNNFFKEVEWGDLDYLLLDLPPGTGDVALDVH
FT                   TLLPSCKEIIVTTPHPTAAFVAARAGAMALRTEHEIIGVIENMSYYESRKTGEREYVFG
FT                   KGGGEKLAKELQTELLGQLPLQQPDWNDDDFAPSVYAEDHPIGKIYMDIARKIVAKY"
FT   gene            complement(150439..151074)
FT                   /locus_tag="GYMC61_0145"
FT   CDS_pept        complement(150439..151074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0145"
FT                   /product="spore germination protein GerD"
FT                   /note="KEGG: gtn:GTNG_0142 spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76845"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0142"
FT                   /protein_id="ACX76845.1"
FT                   /translation="MNKCLPLLLLSFLVLGSCAPQEISPPPPDYDETKKMVVDILKTDE
FT                   GKKAIQDIMSEDQMKQQLVIDQKAVKETLQQMLTSDQGKKFWESALKDPKFAESFAKGL
FT                   QAEHEKMMKALMKDPDYQALMIDILKDPEMEKAMVDVLKSKEFRQHLQKVITETLNSPL
FT                   YQAKIQDMLMKAAEKVQQGGEKQEEEGGGEGGEGEGEESTGNQQGGGG"
FT   gene            151224..151823
FT                   /locus_tag="GYMC61_0146"
FT   CDS_pept        151224..151823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0146"
FT                   /product="KinB signaling pathway activation protein"
FT                   /note="KEGG: gka:GK0147 KinB signaling pathway activation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76846"
FT                   /inference="similar to AA sequence:KEGG:GK0147"
FT                   /protein_id="ACX76846.1"
FT                   /translation="MNSRKWVRLFLSTLLIGGIATAAVGIVFNWEEFGRLLLRLEMVEF
FT                   MAVLLWHIGVGFIFSVISQAGFLAYLTVHRFGLGIFRSLWNAVQVVLIMFVLFDLVYFR
FT                   YMAFADKGDSIIPYLLTALFILVVGLVVAYVKSAQTNKGAFVPALFFMVVVTVIEWFPV
FT                   LRINDRDWLYLMLIPLLVCNAYQLLILHKLTGGAKQ"
FT   gene            complement(151961..152716)
FT                   /locus_tag="GYMC61_0147"
FT   CDS_pept        complement(151961..152716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0147"
FT                   /product="polysaccharide deacetylase family sporulation
FT                   protein PdaB"
FT                   /note="TIGRFAM: polysaccharide deacetylase family
FT                   sporulation protein PdaB; PFAM: polysaccharide deacetylase;
FT                   KEGG: gka:GK0148 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76847"
FT                   /inference="protein motif:TFAM:TIGR02764"
FT                   /protein_id="ACX76847.1"
FT                   /translation="MFYALNGRTLKKVLIIICSAFFTAVVLYAYEMNRPVFSLPSGPKA
FT                   VYKVDNARNEVALTFDISWGDENADKILDVLKQHGIQNATFFLSASWAERHPAVVKRIK
FT                   EEGHEIGSMGYNFVNYTELENAKIRQDLIMAKKVFDMLGMKQVELLRPPGGNFNKNVLK
FT                   VAQSLGYTVVHWSIDSKDWLNPGTDQIVENVTRDLEPGDIVLLHASDSAKQTAKALPKI
FT                   IASMKENGYKNVNLSELLANGEAESRGIE"
FT   gene            153387..154932
FT                   /locus_tag="GYMC61_R0026"
FT   rRNA            153387..154932
FT                   /locus_tag="GYMC61_R0026"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            complement(155060..155338)
FT                   /locus_tag="GYMC61_0148"
FT   CDS_pept        complement(155060..155338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76848"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76848.1"
FT                   /translation="MNKLPCGFVPRNLASLNLLADAGTGAFEGTFHSFKTERSDCLESA
FT                   SLQLCAEESIFLESAGRRRRKTSEGIFHSLKTERNRSAVVHRITTNV"
FT   gene            155595..158521
FT                   /locus_tag="GYMC61_R0027"
FT   rRNA            155595..158521
FT                   /locus_tag="GYMC61_R0027"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            158762..158877
FT                   /locus_tag="GYMC61_R0028"
FT   rRNA            158762..158877
FT                   /locus_tag="GYMC61_R0028"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            159033..159107
FT                   /locus_tag="GYMC61_R0029"
FT                   /note="tRNA-Asn1"
FT   tRNA            159033..159107
FT                   /locus_tag="GYMC61_R0029"
FT                   /product="tRNA-Asn"
FT   gene            159115..159190
FT                   /locus_tag="GYMC61_R0030"
FT                   /note="tRNA-Thr1"
FT   tRNA            159115..159190
FT                   /locus_tag="GYMC61_R0030"
FT                   /product="tRNA-Thr"
FT   gene            159201..159272
FT                   /locus_tag="GYMC61_R0031"
FT                   /note="tRNA-Glu2"
FT   tRNA            159201..159272
FT                   /locus_tag="GYMC61_R0031"
FT                   /product="tRNA-Glu"
FT   gene            159387..159461
FT                   /locus_tag="GYMC61_R0032"
FT                   /note="tRNA-Gln1"
FT   tRNA            159387..159461
FT                   /locus_tag="GYMC61_R0032"
FT                   /product="tRNA-Gln"
FT   gene            160025..160100
FT                   /locus_tag="GYMC61_R0033"
FT                   /note="tRNA-Lys2"
FT   tRNA            160025..160100
FT                   /locus_tag="GYMC61_R0033"
FT                   /product="tRNA-Lys"
FT   gene            160105..160176
FT                   /locus_tag="GYMC61_R0034"
FT                   /note="tRNA-Gly2"
FT   tRNA            160105..160176
FT                   /locus_tag="GYMC61_R0034"
FT                   /product="tRNA-Gly"
FT   gene            160183..160258
FT                   /locus_tag="GYMC61_R0035"
FT                   /note="tRNA-Ala4"
FT   tRNA            160183..160258
FT                   /locus_tag="GYMC61_R0035"
FT                   /product="tRNA-Ala"
FT   gene            160404..161303
FT                   /locus_tag="GYMC61_0149"
FT   CDS_pept        160404..161303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0149"
FT                   /product="arginase"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: gka:GK0149
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76849"
FT                   /inference="protein motif:TFAM:TIGR01229"
FT                   /protein_id="ACX76849.1"
FT                   /translation="MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLEHLHYDIED
FT                   LGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIG
FT                   TLAGVAKHYERLGVIWYDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPK
FT                   IKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETITYLKERTDGVH
FT                   LSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNK
FT                   TASVAVALMGSLFGEKLI"
FT   gene            161495..162067
FT                   /locus_tag="GYMC61_0150"
FT   CDS_pept        161495..162067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0150"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-W factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; sigma-70
FT                   region 4 domain protein; KEGG: gka:GK0150 RNA polymerase
FT                   sigma factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76850"
FT                   /inference="protein motif:TFAM:TIGR02948"
FT                   /protein_id="ACX76850.1"
FT                   /translation="MYFMDLFIKKRIKAIQKGDQNAYADLVDLYKDKIYRLCYRMLGNR
FT                   HEAEDAAQEAFIRAYIHIDTYNPEMKFSTWLYRIATNLTIDKLRKRKPDVYLDEEVGGT
FT                   DGLTMQAQLPSREASPEEAVESLELQETVQRAIEQLPEKYRSVIVLKYMEDLSLQEISE
FT                   ILGLPVGTVKTRLHRGREALRRQLGHL"
FT   gene            162082..162693
FT                   /locus_tag="GYMC61_0151"
FT   CDS_pept        162082..162693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0151"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: gka:GK0151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76851"
FT                   /inference="similar to AA sequence:KEGG:GK0151"
FT                   /protein_id="ACX76851.1"
FT                   /translation="MECPKEIVLLMHSYFDGDLQPEGEQQLKEHLRSCAACAAHFHELK
FT                   KTVAFLQYAAHVAAPPSFAAKVMEAMPKERKTARLRRFMHRHPLLTAASLFLALTLGSL
FT                   ASSWGERGAFSVSADEHVIIRDHTVIVPKGETVKGDIVVRNGSIRIEGTVDGDVTVIHG
FT                   KKYMASAGQVTGEVEEINQVFEWIWYNIKERFNRALQSIE"
FT   gene            162766..163587
FT                   /locus_tag="GYMC61_0152"
FT   CDS_pept        162766..163587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0152"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   gka:GK0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76852"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACX76852.1"
FT                   /translation="MSFGELPIVSYLLKVVDILVVWYVIYKLIMMIRGTKAIQLLKGIF
FT                   LIILVRFVSNYLGLTTLQWLMDQAIIWGFLAIIIIFQPELRRALEQLGRGRLFTRNTVN
FT                   EDEERMRMVEAIVKATEYMAKRRIGALISIERETGMNDYVETGIMLNAHVSPELLINIF
FT                   IPNTPLHDGAVIIQKNQIAAAACYLPLSESPFISKELGTRHRAALGISEVTDSVTVVVS
FT                   EETGAVSLTKNGELYRDLTIDEFRELLTGELAPATKAPASSRWQWRGKKHG"
FT   gene            163580..164818
FT                   /locus_tag="GYMC61_0153"
FT   CDS_pept        163580..164818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0153"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: gka:GK0153
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76853"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ACX76853.1"
FT                   /translation="MDKLMDHPWFIRVVSLLLAIMLYMSANVGAKTGETRNTFGQEDTE
FT                   TLIDIPVVAYYDEDNLVVSGVPKYVNVTLQGPASIVKPTALQRNFEVYVDLTELPLGTY
FT                   TVPIKYRDISDKLKVTIQPSSAKVTIREKVSKRFPVGVEFFNRNKMPDGYSVGEPTVKP
FT                   DAVTITGAKELIDEIAFVKAIVDLDGATETLTREARVRVYDRRGNELDIEPEPSSVEVT
FT                   VPVKSPSKTVPVQVQTTGELPDGVHLVSITPEPDRVTIYGPKEVLNHIDKLEGLTVDLD
FT                   DITDDATVELDAPLPDGAKNVDPDKIKVHIDVEKDVTQTWKDVPIAVVGLPDSYKAEFV
FT                   KPLEGKITVRLVGPPDVVRGLTKDDIRLYVDVRGLDTGEHQVPIQWNHPEQVQWQPSAE
FT                   TAMVHISDKATAQ"
FT   gene            164846..166195
FT                   /locus_tag="GYMC61_0154"
FT   CDS_pept        164846..166195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0154"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: gka:GK0154 phosphoglucomutase (glycolysis);
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76854"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ACX76854.1"
FT                   /translation="MGKYFGTDGVRGVANRELTPELAFQIGRCGGYVLTKSAERPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQEAEIEALIDSAEDMLPRPIGAGLGQVNDYFEGGQKYLQYL
FT                   KQTIDEEDFSGMKIALDCAHGATSSLATYLFADLDADVVTMGASPNGLNINEGVGSTHP
FT                   EALAAFVKEKGADVGLAFDGDGDRLIAVDERGNIVDGDQIMYICAKYLKETGRLKQQTV
FT                   VSTVMSNLGFYKALEAQGIKSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTG
FT                   DGMLTALQLVNIMKIKGKPLSELAGEMKKYPQLLVNVRVADKEKAMENEQVKKVIQEVE
FT                   AEMNGNGRVLVRPSGTEPLVRIMAEAQTEEACRAYVERIADVVRREMGVE"
FT   gene            166742..168544
FT                   /locus_tag="GYMC61_0155"
FT   CDS_pept        166742..168544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0155"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; KEGG: gka:GK0155
FT                   glucosamine--fructose-6-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76855"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACX76855.1"
FT                   /translation="MCGIVGYIGYQDVKEILLRGLEKLEYRGYDSAGIAVLNESGVHVF
FT                   KEKGRIADLRRIVDPNVNATVGIGHTRWATHGAPSRVNAHPHQSASGRFTLVHNGVIEN
FT                   YEMVKRDYLADVTFQSDTDTEVIVQLVEKFVNDGLATEEAFRKTLSLLKGSYAIAMIDA
FT                   QDENTIYAAKNKSPLLVGLGDGFNVVASDAMAMLQVTNQFVELMDGELVIVTSENVTIQ
FT                   TLNGETVERKPFTAELDASDIEKGTYPHYMLKEIDEQPFVIRRIIQKYQDENGGLTIDQ
FT                   AIINEVLNADRLYIVACGTSYHAGLVGKQLIESWAKIPVEVHIASEFSYNMPLLSEKPL
FT                   FIFISQSGETADSRAVLVQTNKLGHKAITITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAILAAAAAKAKGFELDFDLTKELAIVANVMEMLCDAKEEMEKIASDYLT
FT                   LTRNCFFIGRAVDYYVCLEGALKLKEISYIQAEGFAGGELKHGTIALIEDGTPVIALAT
FT                   QEHVNLSIRGNVKEVVARGANPCVISMRGLEGDGDRFIIPAVHPDLTPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            169383..170663
FT                   /locus_tag="GYMC61_0156"
FT   CDS_pept        169383..170663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0156"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: gwc:GWCH70_2089
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76856"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACX76856.1"
FT                   /translation="MNCTQNYKIDQVTEQTLVVGIDIAKRTHYACFVDDRGRVLRKSFP
FT                   IFQSKEGFRQLYEAIQEAMQAFGKPQVIVAVEPTGHYWLNLAYFLEEHGIPLVMVNPAH
FT                   VCRSKELDDNLPTKHDAKDALVIARLAKDGRFLVPRLLHEIEADLRVGSTLKEKLRKEQ
FT                   TAVKNAIVRWTDRYFPEFWTVFRDLGKTALSVLEWTPLPADMAGRSAEELIEVYRQSEG
FT                   LKCPQKAKIQALIDAAKDSIGVTEGTTMARFEIAALVRRYRQLEAEIAALDAELKALVQ
FT                   TTMEYQWLKTVDGLGDATIIDLLAEIGSFAHYRDPRQLVKLAGLTLKENSSGQRKGQKH
FT                   ISKRGRKRLRSVLFRAMIPLIRHNEAFRELHDYYTTRPVNPLTGKQSIVALCRKLLNVL
FT                   FAICTKKQAFDAERMKQDVLSQVQRAA"
FT   gene            171059..172186
FT                   /locus_tag="GYMC61_0157"
FT   CDS_pept        171059..172186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0157"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; Bacterio-opsin activator HTH domain
FT                   protein; sigma-70 1.1 domain protein; sigma-70 region 4
FT                   domain protein; KEGG: gka:GK2482 RNA polymerase sigma
FT                   factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76857"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACX76857.1"
FT                   /translation="MAEKPAQSKQAEAAGESLEQVKEQLAELGKKRGILTYEEIAERLS
FT                   GFDLDSDQMDEYYEYLAEQGIEVISESDLEADPDIDDLAKEEEFDLNDLSVPPGVKIND
FT                   PVRMYLKEIGRVPLLSAEEEIELAKRIEQGDEEAKRRLTEANLRLVVSIAKRYVGRGML
FT                   FLDLIQEGNMGLIKAVEKFDYRKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVET
FT                   INKLIRVQRQLLQDLGREPTPEEIAEEMDLTPEKVREILKIAQEPVSLETPIGEEDDSH
FT                   LGDFIEDQDATSPSEHAAYELLKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVG
FT                   KVFGVTRERIRQIEAKALRKLRHPSRSKRLKDFLE"
FT   gene            172260..172775
FT                   /locus_tag="GYMC61_0158"
FT   CDS_pept        172260..172775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76858"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2418"
FT                   /protein_id="ACX76858.1"
FT                   /translation="MNRQRRETIIQEIEYWKRSRLLPEHYCDYLLALYTEGDARSHGRR
FT                   WRSSLAAGLCLLLPAAALVIYFTELSFVLQTFLFALFLAACLFFCWRWRNKRELLHFPL
FT                   IGSAWILLMASILEVDRYFPRQTGALVAVVLGNCVLWFVVGRLLHLRYFSLAAVSGALL
FT                   VTAAIWWR"
FT   gene            172884..173246
FT                   /locus_tag="GYMC61_0159"
FT   CDS_pept        172884..173246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0159"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: gka:GK2480
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76859"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACX76859.1"
FT                   /translation="MNRNPLIPFFIIMAFGIVLTFVLSFKGLGDAKEMAKEKKGGEKTE
FT                   QTAEFNPEQFYQQTCSGCHGQNYEGGVGPSLKGVGQRLSMDQIKDVIQHGRGNMPPGLV
FT                   PADKADAMAKWLAGLK"
FT   gene            173391..174095
FT                   /locus_tag="GYMC61_0160"
FT   CDS_pept        173391..174095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0160"
FT                   /product="protein of unknown function DUF633"
FT                   /note="PFAM: protein of unknown function DUF633; KEGG:
FT                   gka:GK2479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76860"
FT                   /inference="protein motif:PFAM:PF04816"
FT                   /protein_id="ACX76860.1"
FT                   /translation="MNEFRLSKRLETVASFIPKGAVLADIGSDHAYLPCYACLHGYASK
FT                   AIAGEVADGPFRLAQQQVEKSGLSHLISVRKGDGLSILAPGEVNCITIAGMGGALIARI
FT                   LGDGKEKLAGVKRLILQPNIGAELVRRWLLDHGWELVAERILKEDGQIYEVLVAEPGAP
FT                   RRPYRHLEAELLLGPFLRRENSEVFREKWKREIENWKRIIADLTAKGQSEAAERKKREL
FT                   ERKVQLVEEALL"
FT   gene            174092..175213
FT                   /locus_tag="GYMC61_0161"
FT   CDS_pept        174092..175213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0161"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   gka:GK2478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76861"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ACX76861.1"
FT                   /translation="MSRVPYGYEIIQLLEQLAPKQLAMEGDRIGLQIGTLNKPVKKVMI
FT                   ALDVLEDVVVEAIDQQVDLIIAHHPPLYRPLKQLLTDDGHGRMIAACIKHDIAVYAAHT
FT                   NLDVADGGLNDWLAEALGLNDTAVLVPTYTEPLKKLVVYVPVTHAEVVRKALGDAGAGH
FT                   IGRYSHCTFNSRGVGTFLPHEGARPFIGEQGRLEEVEEVRIETIVPASLEREAIQAMLA
FT                   VHPYEEVAYDIYPLDNEGRRFGLGRIGRLPQPVTLGAFAEQVKTAFSVPAVRVVGRLDD
FT                   LVQTVAVLGGDGNKFVAAAASAGADVYVTGDVYYHTAHDAQALGLHIIDPGHNVEKIMK
FT                   EGVARYLITELSKRQWGAEVVASSVHTDPFQFV"
FT   gene            complement(175295..176245)
FT                   /locus_tag="GYMC61_0162"
FT   CDS_pept        complement(175295..176245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0162"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="KEGG: gka:GK2477 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase; PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76862"
FT                   /inference="protein motif:TFAM:TIGR00216"
FT                   /protein_id="ACX76862.1"
FT                   /translation="MEVIKITPRGYCYGVVDAMVIARNAALDPSLPRPIYILGMIVHNK
FT                   HVTDAFAEEGIITLDGENRLEILEKIDHGTVIFTAHGVSPEVKKRALEKGLVTIDATCP
FT                   DVTKTHRLIEQKLADGYDIIYIGKKGHPEPEGAVGINPERIHLVETIDDVERLSIHNER
FT                   IMVTNQTTMSQWDVADIMAKVKEKYPHVEMHKEICLATQLRQEAVAEQAKEADVTIVVG
FT                   DPRSNNSNRLAQVSEEIAGTKAYRVADVTEIDINWIKDAKKVAVTAGASTPTPITKEVI
FT                   DFLEQFDPNDPSTWKRERKVPLQKILPKVKTKKEE"
FT   gene            complement(176367..176897)
FT                   /locus_tag="GYMC61_0163"
FT   CDS_pept        complement(176367..176897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76863"
FT                   /inference="similar to AA sequence:KEGG:GK2476"
FT                   /protein_id="ACX76863.1"
FT                   /translation="MRYSRPPMMPSPFAGRPPSPFARMPAPPFGPSGPGGFLARLFSRG
FT                   QPPAAASSPWGLPLLSNAANTAASNTGGGLVGMLNNVQKMLGIAQNVMPMVQQYGPLIR
FT                   NLSAMIRIFRELKPADEGEGETTSESAPANETKQKPAAKAPKKRSVPQAKREEPQEKEA
FT                   PAAPKPSKPKLYI"
FT   gene            177296..178606
FT                   /locus_tag="GYMC61_0164"
FT   CDS_pept        177296..178606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0164"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: gka:GK2475 ATP-dependent RNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76864"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACX76864.1"
FT                   /translation="MAETQFTRFPFQPFIIEAIKTLRFYKPTEIQERIIPGALRGESMV
FT                   GQSQTGTGKTHAYLLPIMEKIKPERAEVQAVITAPTRELATQIYHETLKITKFCPKDRM
FT                   IVARCLIGGTDKQKALEKLNVQPHIVIGTPGRINDFIREQALDVHTAHILVVDEADLML
FT                   DMGFITDVDQIAARMPKDLQMLVFSATIPEKLKPFLKKYMENPTFVHVNPKQTANENIE
FT                   HVLIPLRGREKTKLLHDVLLSYNPYLAIVFVNTRKMADEVADRLAEQGLKVGVLHGDLT
FT                   PRERRKMMNLIRDLEFQYVVATDLAARGIDIEGVSHVINYELPDDLQFYIHRAGRTARA
FT                   GYSGIAATIYEPSDQDAIARLEKMGISFVHRDLVRGEWKELPPWNRRSKRAGEKDDELA
FT                   LLFAKLKKTKQVKPGYKKKLRAELEKKKKRLGRFKKS"
FT   gene            178648..179547
FT                   /locus_tag="GYMC61_0165"
FT   CDS_pept        178648..179547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0165"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="KEGG: gka:GK2474 endonuclease IV; TIGRFAM: apurinic
FT                   endonuclease Apn1; PFAM: Xylose isomerase domain protein
FT                   TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76865"
FT                   /inference="protein motif:TFAM:TIGR00587"
FT                   /protein_id="ACX76865.1"
FT                   /translation="MLKIGSHVSMSGKKMLLAASEEAASYGANTFMIYTGAPQNTKRKS
FT                   IEELNIEAGRKHMQAHGIEEIVVHAPYIINIGNTTNLDTFSLGVDFLRAEIERTEAIGA
FT                   KQLVLHPGAHVGAGVEAGLRQIIRGLNEVLTREQTVEIALETMAGKGSECGRTFEELAY
FT                   IIDGVAYNDKLSVCFDTCHTHDAGYDIVNDFDGVLEEFDRIIGLERLKVLHINDSKNPR
FT                   GSRKDRHENIGFGHIGFAALNYIVHHPQLEDIPKILETPYVGEDKHNKKPPYKHEIAML
FT                   RAQSFDDQLLEKINAGAE"
FT   gene            complement(179568..179828)
FT                   /locus_tag="GYMC61_0166"
FT   CDS_pept        complement(179568..179828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76866"
FT                   /inference="similar to AA sequence:KEGG:GK2473"
FT                   /protein_id="ACX76866.1"
FT                   /translation="MNIYQQLVKQKLKTITPEELVSYSREYGLPITTSQAKQILHLART
FT                   NDINVFDPEERKKWVRELAKITSPDIARKANELFLKFVQKK"
FT   gene            179925..180806
FT                   /locus_tag="GYMC61_0167"
FT   CDS_pept        179925..180806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0167"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="PFAM: Protein of unknown function DUF2179; protein
FT                   of unknown function DUF161; KEGG: gka:GK2472 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76867"
FT                   /inference="protein motif:PFAM:PF10035"
FT                   /protein_id="ACX76867.1"
FT                   /translation="MAPKQHKKEPLGHVLYRVLMIAIGASLAAFAIERLLVPNKMIDGG
FT                   IIGISLILDYLTPDEWRLLNFATLVILLNVPFMYFGYKQIGKTFMLSTILGVVILGVTE
FT                   RLFHHFSPLTTEPILATVFGGLSLGLGVGLVIRHGGSLDGTEILGILMTKRIPFSVGEF
FT                   VMFVNVFIFGWAAFVFGLEPAMYSVMTYYIASKTIDAVIEGLDETRAAFIVTDHYEEIS
FT                   DAILHRLGRGTTKLLGKGGYTDEQKEIIYAVVTRLEVTKLKSIVNEIDPDAFITIMPTH
FT                   EVRGARFKSAIH"
FT   gene            180889..181656
FT                   /locus_tag="GYMC61_0168"
FT   CDS_pept        180889..181656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0168"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gka:GK2471 metal (zinc) ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76868"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX76868.1"
FT                   /translation="MENGLVVQIEDVSFRYENENVLEHVSLTVPKGAFLGLVGPNGSGK
FT                   STLLKCVLGLLKPNSGRIFLFGEPIESFREWHRIGFVSQKANSFNRSFPATVEEVAASG
FT                   VAAKRGLFRPLTNEDRRAVEAALAAVGLSGLAKRNIAELSGGQQQRVFIARALASKPDL
FT                   LILDEPTVGVDARHVHEFYELLGDLNRRGLTLILVTHDIGTITDRVTDIACLNKRLYFH
FT                   GKAEEFEHLGNEAISQFYGHPLHVLSHEHERAE"
FT   gene            181682..182515
FT                   /locus_tag="GYMC61_0169"
FT   CDS_pept        181682..182515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0169"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: gka:GK2470 metal (zinc)
FT                   ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76869"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACX76869.1"
FT                   /translation="MWEAIWQYEFLRNAFVAGVLTGFTAPLLGVFIVVRRLSLIADALS
FT                   HVTLAGIAAGLLLEKTIPAAASWNPLYIGMGFSVVGSLFIEKLRAVYRHYEELAIPIVL
FT                   SSGLGLSVIFISMANGFTTDLFSYLFGSVSAVSRADVWTAFAVAAAAAMVILTFYKELF
FT                   LLSFDEEYARVSGVRTTLIHFLFIVLVALVIAASMRIVGVLLISSLMTLPVAASIRIAK
FT                   SFKQVIGLSILFGELAVIAGLWAAYELDWAPGGTIVIAAVVILLFALGWKRGRQR"
FT   gene            182512..182931
FT                   /locus_tag="GYMC61_0170"
FT   CDS_pept        182512..182931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0170"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: gka:GK2469 FUR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76870"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACX76870.1"
FT                   /translation="MNIDEALQLMKEKGFKYTEKRRQMLELFAESDKYLTAKDVLEALR
FT                   PVYPGLSVDTVYRNLSLFTLLGILEMTELSGEKHFRFACGARRHHHHVICIQCGKTKKI
FT                   DACPMDGLAAQLDGYEITDHKFEIYGTCPQCQQRG"
FT   gene            complement(182969..183535)
FT                   /locus_tag="GYMC61_0171"
FT   CDS_pept        complement(182969..183535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76871"
FT                   /inference="similar to AA sequence:KEGG:GK2468"
FT                   /protein_id="ACX76871.1"
FT                   /translation="MKKRLGIDIDGTVTCPSTFIPYLNEAFGKELALNDITQYNLAPLY
FT                   GVAEEEMDRWLEENEADIYERAPLARYALEVIDSWKDKYELYYISARGRHLYGLTERWF
FT                   RRHGVHYHHIDLIGSHDKIAAVRQYKLSAFFEDKYDNACEIAETCGIPVILFDTPYNQG
FT                   PLPENVIRVNNWLEAKREIEQRLRP"
FT   gene            183633..183980
FT                   /locus_tag="GYMC61_0172"
FT   CDS_pept        183633..183980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76872"
FT                   /inference="similar to AA sequence:KEGG:GK2467"
FT                   /protein_id="ACX76872.1"
FT                   /translation="MADDRERTYNGSYVQSIGKEEPERNFMEETAAEVAEPIRRGDERD
FT                   EERADGAGLGWLALALSIIALFIWPILLGAAGIIVGFIARRRGAETLGAWAIGIGVIAI
FT                   LVRLFIMPFYT"
FT   gene            complement(184038..185162)
FT                   /locus_tag="GYMC61_0173"
FT   CDS_pept        complement(184038..185162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0173"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: gka:GK2466 4-hydroxy-3-methylbut-2-en-1-yl
FT                   diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76873"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ACX76873.1"
FT                   /translation="MGEIIHRSKTRPVRVGPLTIGGSNEVIIQSMTTTKTHDVEATVAQ
FT                   IHRLEEAGCQIVRVACPDERAAEAIPEIKKRINIPLVADIHFDYKLALKAIEGGVDKIR
FT                   INPGNIGRREKVEAVVKAAKERGVPIRIGVNAGSLEKRILEKYGYPTADGMVESALYHI
FT                   RILEELDFHDIIVSLKASDVRLAIEAYEKAARTFDYPLHVGITEAGTLFSGTIKSAVGL
FT                   GAILSKGIGNTIRVSLSADPVEEVKVAREILKTFGLASNAATLISCPTCGRIEIDLISI
FT                   ANEIEDYIAKIQAPIKVAVLGCAVNGPGEAREADIGIAGARGEGLLFRHGKIVRKVPEE
FT                   QMVEELKKEIDKLAEEYFAKQKENKAALKGSSAQ"
FT   gene            complement(185245..185559)
FT                   /locus_tag="GYMC61_0174"
FT   CDS_pept        complement(185245..185559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76874"
FT                   /inference="similar to AA sequence:KEGG:GK2465"
FT                   /protein_id="ACX76874.1"
FT                   /translation="MKKFIFLLLLFLSSYIVYRDLAIGTLHPSSETAAAVVQSKQAAIP
FT                   YRTVTIRPGDTLLSIIEKELNGPLPVPLEQLIRDFERLNPGEHAQTLKIGKTYKVPIYR
FT                   "
FT   gene            185859..186749
FT                   /locus_tag="GYMC61_0175"
FT   CDS_pept        185859..186749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0175"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   gka:GK2463 phosphate ABC transporter (phosphate-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76875"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ACX76875.1"
FT                   /translation="MWSKRVKLGLAALLMTGVLAGCGQTEKNNAGGNEGTAKKEETYSG
FT                   TIALAGSTALQPLAEEAANAFMEKYPDVSITVQGGGSGTGVNQVAAGAVQIGNSDVPAA
FT                   EKLDDKTKASELVDHKVAGIAFAIVVNDDVKVDNLTTKQIQDIFSGKIKNWKEVGGPDE
FT                   AIHVINRPASSGTRATFEKTIMKGVKIDDSIGTVQDSNGAVEQAINSTPGAVSYVAMSY
FT                   LIGEKKNLKTVKIDGAEPTVENIRTEKYPFWSYEYMITKGEAKEEVRAFIDFVKSEEFA
FT                   PTVKKMGYIPMTELE"
FT   gene            186806..187702
FT                   /locus_tag="GYMC61_0176"
FT   CDS_pept        186806..187702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0176"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: gka:GK2462
FT                   phosphate ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76876"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACX76876.1"
FT                   /translation="MQQMHTKRRNRWLEEYIGRTFAVICGWLIVLITVTMIIFLAVKGI
FT                   QSFTDSGLSLSDMLLSAQWDPNGTPPKYGALIFIVGSMLVSLGALLISAPIALALAIFM
FT                   NFIAPKWFVSLLKPVLELLVGIPSVVYGWLGVTILVPLLREWFGGSGFSLLAGIIVLSM
FT                   MILPTITSIAADALANVPMTYMEASYGLGSTRWQAISRVIVPAAKAGIATGVVLGLARA
FT                   FGEALAVQMVIGNTIKLPSGLDSPTATLTSVLTMDMANTINGTPWNNALWTLALILLLI
FT                   SFFFIAVIRLVGPRKER"
FT   gene            187704..188627
FT                   /locus_tag="GYMC61_0177"
FT   CDS_pept        187704..188627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0177"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: gka:GK2461
FT                   phosphate ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76877"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACX76877.1"
FT                   /translation="MTARMIDKVWTGIFYAVAAAVIGLLMFFFAVVLSKGAGFWQPEFL
FT                   FGRPSNTQAGGGIGPQLINSFYMLVVTLLLSVPLSLGAGIYLAEYAKQGRIVGFIRLCL
FT                   ETMASLPSIVVGLFGLLAFVTLTGWGYTLLGGALAVTIINLPGLTRICETAILDVPANI
FT                   KEGSLALGATRWQTLVKAVLPAAIPQIVTGVILSAGRIFGEAAVFIYTAGLTTPMLRWD
FT                   ADWGSQANPLNVFRPAETLTVHIWKLNSEGIVPDAKLIAAKSAAVLMVAVLLFNLAARL
FT                   ASSLLARHFSGGRRARRGRGERSKAA"
FT   gene            complement(188666..189448)
FT                   /locus_tag="GYMC61_0178"
FT   CDS_pept        complement(188666..189448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0178"
FT                   /product="protein of unknown function DUF1189"
FT                   /note="PFAM: protein of unknown function DUF1189; KEGG:
FT                   gka:GK2460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76878"
FT                   /inference="protein motif:PFAM:PF06691"
FT                   /protein_id="ACX76878.1"
FT                   /translation="MSAMNVFVQLWKSLYSPKDIARFRFQGIGKTIGYLFLLTLLSILP
FT                   TFYYVSSSLMEGIRTTSALLNNELPPFSIENGELHSEAATPIHIDQGGFTIIFDSTGKV
FT                   TSENVEQFPNAIALLKHEAVLVAGHQAQHYSYATFPDVTITDEDVRAFIAGLQSLLPVL
FT                   IPLFGLVLYVLACAGKFISVCIFAFFGLILAGVLDKTLRYRHTWVMSAYAITLSTVFFT
FT                   VMETVQAVVPYGALIHWFVSLVVLFLAVKEVPSAKREI"
FT   gene            189728..190342
FT                   /locus_tag="GYMC61_0179"
FT   CDS_pept        189728..190342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0179"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: Manganese/iron superoxide dismutase-like;
FT                   KEGG: gka:GK2457 manganese superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76879"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACX76879.1"
FT                   /translation="MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEG
FT                   HPDLQNKSLEELLSNLEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEA
FT                   INKKFGSFTAFKDEFSKAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGL
FT                   DVWEHAYYLKYQNRRPEYIAAFWNIVNWDEVAKRYSEAKAK"
FT   gene            190485..190610
FT                   /pseudo
FT                   /locus_tag="GYMC61_0180"
FT                   /product="hypothetical protein"
FT   gene            complement(190739..192397)
FT                   /locus_tag="GYMC61_0181"
FT   CDS_pept        complement(190739..192397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0181"
FT                   /product="transposase"
FT                   /note="KEGG: gka:GK1903 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76880"
FT                   /inference="similar to AA sequence:KEGG:GK1903"
FT                   /protein_id="ACX76880.1"
FT                   /translation="MNVKVKGVYRNGYLNIISVLVKKLDIPHLIDHLVPVDPQCQTRVS
FT                   DAVQAILYNLFDGRQALVHLERWAQEIDLEKLIRPGLHPSWLNDDALARHLDRLYEADI
FT                   HKVISTCLIHIYRKEGLSLRAFHADTTDKTVYGAYESASLEALQITHGYNRHHRWQKQI
FT                   GFGLVGNEDGIPFYGDVHDGNLSDKAWNPEVLSRIHEQFKQAKIDDEWIYVADSAAMTK
FT                   DTLAQTKAARAFLITRGPSSLRIVKQALAEADSPHIPWSEPFTLAERNGATYRVWETAA
FT                   TYEGHPVRLIVVESSALDQRKGKTLEKERVKEAELLREEQVRWERHPFSCREDAEQALT
FT                   SLKASLRPRFHRVEAAVEEIVRPKKRRGRPKKGAEPETETLYTLRLNVEFDQPAWEQAR
FT                   RKASRFVLVTTVPKEWKGQQMDAQEILKLYKGQISVEMNFAFLKDPFFTDEIYVKKPER
FT                   VAVLGYLFLLALAIYRVFQRRVRQFITPERPLKGAGGRKLTRPTGQAIFQLFQYVNVIL
FT                   LELPDGRIQRALDRSLNPDQRRILQGLGMDESIYV"
FT   gene            192422..193669
FT                   /locus_tag="GYMC61_0182"
FT   CDS_pept        192422..193669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76881"
FT                   /inference="similar to AA sequence:KEGG:GK2456"
FT                   /protein_id="ACX76881.1"
FT                   /translation="MCVKDSFDIGTKNPPDFRRKGAKCEYLWKQTGDFRDLALYNLAIV
FT                   TMQPLTFIFAGRMAKQIDRILVLRLGVSCLAVFFVTVLLVGSRAHQYLLFLGALLGVGY
FT                   GFYWLAFNVLTFEITEPETRDFFNGFFGVLTSSAGMIGPIVAGYMISSLAGAKGYTLVF
FT                   SLSLGLFLVAVLLSFFLKRRAAAGKYLFVRILKERNENRNWRLITNAHFFQGLREGTFV
FT                   FIISVLVYVTSGSEWALGKFGLVNSFTSFVAYYAVSRLIKREYRMKAILLGGALLYGAI
FT                   FLIVFHPTYPRLILYAITIAIAYPLLLVPYSSLTFDVIGKSWKSAEARVEYIVVRELFL
FT                   NAGRVASILAFLTAVALFGEEAGIRVLMFVCGAGHLVIYWFVRRIRFTDGCSERGRRER
FT                   LLLRPKLAGERGRSPV"
FT   gene            193742..195856
FT                   /locus_tag="GYMC61_0183"
FT   CDS_pept        193742..195856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0183"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   gka:GK2455 peptidoglycan biosynthesis (penicillin-binding
FT                   protein 2A)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76882"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ACX76882.1"
FT                   /translation="MKRKKRAQVPIRLNILFFFVFLLFSALILRLGVVQIVYGEDYRRE
FT                   VERTQDEIVSTPVPRGKIYDRFGRVIVDNTPEKAITYTRSKTTQPEEILDVARKLAQYI
FT                   DIPDAEKKVTERDMKDYWILTHPEEAKKKVSEQERKKLADQGLTQKEIDKKVYEWTLDR
FT                   ITKQDLAQISKSELEVIAIKHEMESGYALTPQTVKSKGVTDREYAVVSEHLSELPGVNT
FT                   TVDWDRKYVYDNTFRSVLGSVTEEDEGVPRERLDYFLARDYSRNDRVGKSYLEMQYEEV
FT                   LHGKKAKVKNVVDKSGNVISVEQVYPGERGKDLVLTIDAELQQKVEEIIQQEILATKRK
FT                   GRSPLLDRAFVVMMNPKTGEVLAMAGKLLQDGKFVDFAIGNITSAYAMGSAVKGATVLT
FT                   GFQTGVLHPNTYIKDEPLYIKGTPVKKSWKTMGTINELTALKQSSNVYMFKTAIAIGGG
FT                   VYRPHAPLRINPEAFTTIRHYFSQFGLGVKTGIDLPNELSGFQGQSTRGGFLLDLAIGQ
FT                   YDMYTPMQLAQYVSTIANGGYRMKPQLVKEIREPSADGKKLGRIMKRFEPVVLNRIDMK
FT                   TEYIKRVQEGFRRVMQEPGGTAYSYFASASYKPAGKTGTAEAFYDGPIQSRRNDPTYNL
FT                   TLVGYAPYNDPEVSFAVVVPWATQGKSDGINDRIGRRILDAYFELKAKRAAEGGSSFDA
FT                   QGGAEAADAR"
FT   gene            196161..196997
FT                   /locus_tag="GYMC61_0184"
FT   CDS_pept        196161..196997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0184"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: gka:GK2454 phosphate ABC transporter
FT                   ATP-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76883"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACX76883.1"
FT                   /translation="MKGVTPMRTMAVVERRKEDIPSAQLVKKEVVYETNGLNVWYGEHH
FT                   ALKHIHLSFYEREITAIIGPSGCGKSTYIKTLNRMIELIPNVRLEGEILYRGRRIFDTS
FT                   YPVEQLRTQVGMVFQKPNPFPKSIYDNVAYGPRIHGIRDRRRLDEIVEKSLRQAALWEE
FT                   VKDRLHENALGLSGGQQQRLCIARCLAVEPDVILMDEPTSALDPISTAKVEELMGELKT
FT                   KYSIIIVTHNMQQAARISDRTAFFLNGEVIEYGETKTLFSRPADQRTADYIAGRFG"
FT   gene            complement(197138..197587)
FT                   /locus_tag="GYMC61_0185"
FT   CDS_pept        complement(197138..197587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76884"
FT                   /inference="similar to AA sequence:KEGG:GK2453"
FT                   /protein_id="ACX76884.1"
FT                   /translation="MNKRSMRSFALGLLVSTALIGASYYASPPAAPTEAEIKTFLKQHG
FT                   LVAVAKEEYDRLRSAQPNAAPKAASKQMSEPSGQTVYVYRLVIQKGDTPETFARELEEA
FT                   GIIQSARAFNDYLEQHGLTRSIRPGVYNVKSDMDYAAIGRLIAEP"
FT   gene            complement(197584..197934)
FT                   /locus_tag="GYMC61_0186"
FT   CDS_pept        complement(197584..197934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76885"
FT                   /inference="similar to AA sequence:KEGG:GK2452"
FT                   /protein_id="ACX76885.1"
FT                   /translation="MVEYAIIALAALAIILLVLSFFAKDELKPLEEQIDHLTVSLAQET
FT                   YQIKKRLQVIEEELLIPERQRSASPRLGGSLSPADRRILFLHKQGFPLEDIARETGLTV
FT                   AEVERAVRRLRR"
FT   gene            198094..198243
FT                   /locus_tag="GYMC61_0187"
FT   CDS_pept        198094..198243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0187"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: gka:GK2450 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76886"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ACX76886.1"
FT                   /translation="MRVNITLACTECGERNYITSKNKRNNPERLELKKYCPRDRKVTLH
FT                   RETK"
FT   gene            198297..198869
FT                   /locus_tag="GYMC61_0188"
FT   CDS_pept        198297..198869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0188"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   gka:GK2449 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76887"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACX76887.1"
FT                   /translation="MMDGKQEWRQRMLNQLRQLKAAEKEMYDRQIAAHLYRWPLWQTAR
FT                   TIAMTVSRETEVNTLSIIEQAWREGKTIGVPKCDPRAKTMSFRRLESFSQLEKAYAGLF
FT                   EPIEKQTTPIDRDEFDLIMVPGVCFAKTGYRIGYGGGYYDRYLRGASAVTAALAYSFQV
FT                   MDDIPAEEHDVPVKFIITDQGVLHCER"
FT   gene            198859..199632
FT                   /locus_tag="GYMC61_0189"
FT   CDS_pept        198859..199632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0189"
FT                   /product="protein of unknown function DUF92 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF92
FT                   transmembrane; KEGG: gka:GK2448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76888"
FT                   /inference="protein motif:PFAM:PF01940"
FT                   /protein_id="ACX76888.1"
FT                   /translation="MSDEWWYIAVSALAAGGGWLLRSLSISGAAAAVVIGAAVGCGFSW
FT                   GGIWVLGCFFVSSSFFSHIGKQRKAKLSEKLAKGGRRDAIQVLANGGVPAVLALLAAVR
FT                   PDPIWDDLFVVAVAAANADTWASEIGSLSPWPPRVWPSFRPVEAGTSGAVTLLGTAASF
FT                   AGALFIAAVGVFFLDVRPVFTPAFFGWLGSWFDTWLGAAWQAAYRCPACGATTERKRHC
FT                   GQATIHMKGWRWLDNDAVNVLSVISAVLAAFVLAR"
FT   gene            199708..199887
FT                   /locus_tag="GYMC61_0190"
FT   CDS_pept        199708..199887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76889"
FT                   /inference="similar to AA sequence:KEGG:GK2447"
FT                   /protein_id="ACX76889.1"
FT                   /translation="MNKWSYSLLVVAAGCLAYRYRYRMAAFALRVPPLRKQLVRFALHI
FT                   PPVRNALVSQMLRP"
FT   gene            200063..201223
FT                   /locus_tag="GYMC61_0191"
FT   CDS_pept        200063..201223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0191"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: gka:GK2446
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76890"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACX76890.1"
FT                   /translation="MDVLFWQLVQRLSRGGYRIVRMSEQADEVWLESNHWRRPTLIRLV
FT                   RADFDWSRSLRLDMEYTWQFVQQMRGWNFSKAGRVINVYVMVYPPVDDWEFLVAEPLPL
FT                   SGASDGVLHTLLLHSGNMGDVLPRLAEMTGVALRFEPPVETSDPFAAAERLKREVVREW
FT                   RRRREEERRIFEYGKPMFTRLFIVVQVAMFLVLEWSGGSTNPDVLIHYGAKFNPLIEAG
FT                   EWWRLLTPMFLHIGFLHLLTNTLALYYLGITVERLYGSLRFLFIYVTAGFFGALASFLF
FT                   TPSLSAGASGAIFGLFGALLYFGTVYRHLFFRTMGMNVISLIIVNLLFGLLVPGIDNAG
FT                   HIGGLVGGFLAAGVVHLPKHTALGRQAGALAVSALLVAAGLWIGFR"
FT   gene            complement(201274..202137)
FT                   /locus_tag="GYMC61_0192"
FT   CDS_pept        complement(201274..202137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76891"
FT                   /inference="similar to AA sequence:KEGG:GK2445"
FT                   /protein_id="ACX76891.1"
FT                   /translation="MKRWMIPFMALAFFLAAALASLWEHDQTAETIKFFPLDREAAFIE
FT                   AKTSLALEGDNEPGRYALRWSAASILNRRAYLRQDVSLLFADGRLADVLSKWKTNTDAI
FT                   DMEKTVRMRDSRFFQAVSFHHGELHTGENITSSQTMSSSYLYVIDSPYHPRASFRRPRT
FT                   DDEREWQRVLNKATNEFLRHKADELLTHFSLSKKDYYALYLPELVAYTEQPLPGLSTAK
FT                   TQTVIGRLWEGLYKSYILGIKKEDGSILSPIGSTMPLILIRKDYSRLFVLIEAKTGEKV
FT                   MLVQLL"
FT   gene            202263..203726
FT                   /locus_tag="GYMC61_0193"
FT   CDS_pept        202263..203726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0193"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   gka:GK2444 stage V sporulation protein AF"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76892"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ACX76892.1"
FT                   /translation="MEKQMPKRPASRRLHDNASYLAERLGVGKSLDVIRLDVEYGGRAM
FT                   ALFMIDGFVKDDILHYLMRYLSRLEEHELDVHPLEKLLKKYLPYVEIGQTDDLEEAVAM
FT                   VLAGPTALVVDGVERIILIDARTYPVRGPQEPDTERVVRGARDGFVETIVFNTALIRRR
FT                   VRDPSLRMEYVQVARRSKTDICICYIEEIADPELVRRVRESITAIDTDGLVMAEKTVEE
FT                   FISGRHWNPYPVVRYTERPDTAAAHLYEGHVLVIVDGSPSVIITPATFWHHLQHAEEYR
FT                   NKPIVGAYLRLVRFLAVWASVFLLPLWYLLMIEPELLPDPLQFLGKAKLGDIPLFAQIL
FT                   MIEIGMDMLRMAAIHTPSSLATALGLVAALMIGGIAVEVGLFSNEVILYFSVTAIGTFA
FT                   TPSYEMSLANRLVRIALLILSGLFGLYGYVIGITVWILALARMTSFGVPYLWPFIPFSY
FT                   RAMRDVLIRSPMPLKNRRPAILHPRDPDR"
FT   gene            203821..204033
FT                   /locus_tag="GYMC61_0194"
FT   CDS_pept        203821..204033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0194"
FT                   /product="protein of unknown function DUF910"
FT                   /note="PFAM: protein of unknown function DUF910; KEGG:
FT                   gka:GK2443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76893"
FT                   /inference="protein motif:PFAM:PF06014"
FT                   /protein_id="ACX76893.1"
FT                   /translation="MKTVYDVQQLLKQFGTIIYMGDRLADLELMEEEVKELYQSQLIDA
FT                   KQLQAALFILRQEAQMEREKRMKKG"
FT   gene            204041..204994
FT                   /locus_tag="GYMC61_0195"
FT   CDS_pept        204041..204994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0195"
FT                   /product="glucokinase, ROK family"
FT                   /note="TIGRFAM: glucokinase, ROK family; PFAM: ROK family
FT                   protein; KEGG: gka:GK2442 glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76894"
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /protein_id="ACX76894.1"
FT                   /translation="MEPWLVGIDLGGTTIKMAFVTTEGDIVHKWEIPTNTANRGEHIVA
FT                   DIARSLEKTLGQLGGAKERLLAAGIGAPGPVEEETGMLYETVNIGWTNYPLKQRLEEAT
FT                   GLPVSVDNDANLAALGEMWKGAGGGARHLLFVTLGTGVGGGVIANGAIVRGINGAGGEI
FT                   GHMTMIPDGGARCNCGKTGCLETIASATGIVRIAKEKLTADERPSELRNGDVTAKAVFD
FT                   AAKAGDALALEVVDEATYYLGWALANAANVTNPEKIVIGGGVSKAGDMLVERVAAHFRR
FT                   FAFPRVAAGAKLVLATLGNDAGVIGAAWLAKELVGA"
FT   gene            205181..206341
FT                   /locus_tag="GYMC61_0196"
FT   CDS_pept        205181..206341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0196"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; SMART:
FT                   peptidase M14 carboxypeptidase A; KEGG: gka:GK2441
FT                   gamma-D-glutamyl-L-diamino acid endopeptidase I
FT                   (endopeptidase I)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76895"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ACX76895.1"
FT                   /translation="MHLQAWPGDTFETYGRWFSVPTELIIDSNPHVKEGLRPGQTVAIP
FT                   GYAPIDTWEALADRLSLPTEVLRRLPGAMAVINGTAPLPKRISSPIVRSVRPYDFAALM
FT                   EDITALVCRYPFVRQRTIGHSVLGLPLVELQIGRGPVRVHMNGSFHANEWITTAVIMAL
FT                   IDEYARALVNDDELAGHRVLDYYRKVTLSVVPMVNPDGVNLVLNGPPEEEPHRSEVVCI
FT                   NGGSLDFSQWKANIRGVDLNNQFPANWEIEQARKPPKAPAPRDFPGFSPLTEPEAKAMA
FT                   ALAESGDFAMIVAFHTQGKEIYWGYEGFEPPEAKATVQAMAEASGYQAVRYIDSHAGYR
FT                   DWFIQTWRRRGYTVELGEGVNPLPLSQFAQIYRDSLGLFLAALKMA"
FT   gene            complement(206377..206553)
FT                   /locus_tag="GYMC61_0197"
FT   CDS_pept        complement(206377..206553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76896"
FT                   /inference="similar to AA sequence:KEGG:GK2440"
FT                   /protein_id="ACX76896.1"
FT                   /translation="MGTVIIFALVTLLALYGMLRTLREKNVLGFLFGLATTAVFGWFTI
FT                   MTILHHGIPTGTH"
FT   gene            206722..207354
FT                   /locus_tag="GYMC61_0198"
FT   CDS_pept        206722..207354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0198"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gka:GK2439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76897"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX76897.1"
FT                   /translation="MEWTRIPVGPIQANAYLLSSADRQCLIVDPGAEGAALVRRIEEKG
FT                   LTPLAILLTHAHFDHIGGIPDVLARWDIPVYVHEKEKQWLQDPALNGSLYFGGPVAVRC
FT                   EPTCLKGPTALNIGPFALDVRETPGHSPGSVSYYCKQANIVFSGDALFAGSIGRTDLPG
FT                   GNHQQLLKSIHDELLTLPEETIVLSGHGPETTIAAEMDANPFLHGFS"
FT   gene            207676..208809
FT                   /locus_tag="GYMC61_0199"
FT   CDS_pept        207676..208809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0199"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   gka:GK2438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76898"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ACX76898.1"
FT                   /translation="MGRLYEQIAAAPGGRVSYADYMQMALYDERFGYYMRERAKIGKEG
FT                   DFFTNSSFAPVFGKALASLWVRMVEQSGLPPAVCEWGGGDGRLALSVLEEWKKKSPHTY
FT                   DRLSYTIIDQSPFHRRRQRETLQPAAEKVEQYDDVSRWLAERGPFSGIVFSNEFFDAFP
FT                   VHVIVKEGGVLHECFVAARDGRLVEEKAPLCRPAIVRYLHERGLDLAEGQRLEVPLAMK
FT                   AFWLEVGTLFHQAVMVTIDYGYTDEQLRAPARRHGSLRGYFRHQLVADPLRHPGEMDLT
FT                   SHVQWDAFRLYARQAGWEEVAFVRQDRFLLAAGLLHEWNVSEAGDFFSPASRQNRMIRA
FT                   LIADDGVSRFFDVLILQKGMSLAARDFWPAPEFLPAD"
FT   gene            complement(208893..209135)
FT                   /locus_tag="GYMC61_0200"
FT   CDS_pept        complement(208893..209135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76899"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2373"
FT                   /protein_id="ACX76899.1"
FT                   /translation="MDRMFRVLAFWTGIFAVMFYLGHMHTTSLIFFGQTVFFLFLGFLK
FT                   LTERMYIYIFGAYLTIFFAAFTYWTTFMMVPGMGE"
FT   gene            complement(209293..209991)
FT                   /locus_tag="GYMC61_0201"
FT   CDS_pept        complement(209293..209991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0201"
FT                   /product="putative transcriptional regulator"
FT                   /note="SMART: regulatory protein ArsR; KEGG: gka:GK2436
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76900"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACX76900.1"
FT                   /translation="MEQTLKITSVLSDPTRFHIYEYIAKVHREVSVQEIAEKFHIHPNV
FT                   ARLHLTKLEDVRMVVSDTQKTGKGGRPSRLYRLSDEVIGLYFPFRDYQLLARIAIQTMA
FT                   KLGPIGSEALRETGKRFGRELIASRLPHNGAASALTMADKIAIMEEAAEAAGFLPQLHY
FT                   DEEKGVLYLDIFNCPFKEIAAQAPDTVCGMHHSFLEGMVETLFAGAEVTETENMMEGSH
FT                   RCAYRIVIRP"
FT   gene            complement(210168..211355)
FT                   /locus_tag="GYMC61_0202"
FT   CDS_pept        complement(210168..211355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0202"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gka:GK2942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76901"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX76901.1"
FT                   /translation="MNRLAHHQGIHKFFFTLGLTLQLSKPVIKHLIHIVDALTTKGFSG
FT                   TLTDIHHWSFHPNHRTTLSHFFTKSPWDEERLLGKLQEWILRRIERLVERKNQPLFVSI
FT                   DDTICQKTKPSSRATHAIQGCDWHYSHKDHQSVWGHSLVWLMVHTLTQAFPFAFRLYDK
FT                   KAGKSKIDLAIEMLSSLKVKRAQPVYVLMDSWYPSKKLIEACLKQGFHVIAMLKTNRIL
FT                   YPKGIAIQAKQFARYVESEDTRLVTVGKERYRVYRYEGAIHGLDDAVVLLAWKADQPMA
FT                   PEHLHVVLSTDRELSDEDILRYYAQRWTIECFFRQAKDQLKLDGYRVRHIRAVKRYWAV
FT                   VLLACVYSIAESRQNLSAGLELLRSRKDHSVVEFIYDAAKQDIPIDVIKKQLRIA"
FT   gene            211421..211531
FT                   /locus_tag="GYMC61_0203"
FT   CDS_pept        211421..211531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76902"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76902.1"
FT                   /translation="MSPFLFGCQFMLVNLLIYSFTKKLRQKQDNDSCSSK"
FT   gene            211560..212633
FT                   /locus_tag="GYMC61_0204"
FT   CDS_pept        211560..212633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0204"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: gka:GK2435 DNA transport machinary"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76903"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACX76903.1"
FT                   /translation="MLNEIEQTANRLLAEAVQRRASDLHLVPRRRDAAVRLRLDGMLVD
FT                   VGALPKETAERLIVHFKFLAGMDIGERRRPQSGAMEVAEFGETVYLRLSTLPTLYDESL
FT                   VIRLLPQRLPLPLRELSLFFHSTARLFSFMQHPQGLVLLTGPTGSGKTTTLYTLLDLCQ
FT                   AERQRNIITLEDPIEKQNERLLQVQINEKAGITYAAGLKAALRHDPDVLMVGEIRDHDT
FT                   AAIAIRSALSGHLVVSTMHAADAVGAVYRLHEFGIPLGDLAETLLAVSAQRLVELCCPL
FT                   CGDDCHPSCGRLGRRRRTAVYELLCGSALEDVIHFLSNGRGKPKRSYMTLARLIRKGIA
FT                   LGYLPVRMLELVGGEER"
FT   gene            212630..213658
FT                   /locus_tag="GYMC61_0205"
FT   CDS_pept        212630..213658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0205"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   gka:GK2434 DNA transport machinery"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76904"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACX76904.1"
FT                   /translation="MKRKMWPLVEQALFFTRLGRLLERGYPLGQALEFLAIQAPTHRRL
FT                   EIERCLQQLRAGLPLFAAVEALSVDRMAVNLLFFAERHGDLPRGMAETGETLAQKARFH
FT                   EQLRRFSRYPMFLLSLLIIMLVLMEWWLLPQFERAAAAFSPQRGHTAWLLAVVAHAPMA
FT                   MAAIAVLAVFSGLFYTACFRRWPVSRKLQFALRIPGLASFLRLFVTCLTARQLGRLLQA
FT                   GLSVYDALGVFSEPSSWPFLQMEGRRLRDGLMKGMTLDGLIGAARYYEQELALVIRHGQ
FT                   SNGELGKELEHYSEFLLQVMEQRIESVLKCMQPLLLAVVGSFVVGMYLAILLPMFSMLN
FT                   EL"
FT   gene            213861..214157
FT                   /locus_tag="GYMC61_0206"
FT   CDS_pept        213861..214157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0206"
FT                   /product="DNA transport machinery (exogenous DNA-binding
FT                   protein)"
FT                   /note="KEGG: gka:GK2433 DNA transport machinery (exogenous
FT                   DNA-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76905"
FT                   /inference="similar to AA sequence:KEGG:GK2433"
FT                   /protein_id="ACX76905.1"
FT                   /translation="MNQKGFTLIEMLIVMMVISVLLLIAIPNMTKHNSMINSKGCEAFL
FT                   NTVQAQVKAYEMEHNKIPTVEELLAGRYIKSDKCPNGRAIQISANGDVSESGS"
FT   gene            214147..214584
FT                   /locus_tag="GYMC61_0207"
FT   CDS_pept        214147..214584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76906"
FT                   /inference="similar to AA sequence:KEGG:GK2432"
FT                   /protein_id="ACX76906.1"
FT                   /translation="MARNGGFTLLEMLIVFSVVLVLAALAVPTLGGAVRHQEEMYMLAV
FT                   LRADLYGAQQHAIARRVNVAVFFTDGGAGYKAIDAASGRQVVARSLPSPWRFRLGTLRN
FT                   PLIFTDNGNIERAGTIWIGGGQMTYKVTFLLGKGRFYVQKM"
FT   gene            214568..214894
FT                   /locus_tag="GYMC61_0208"
FT   CDS_pept        214568..214894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76907"
FT                   /inference="similar to AA sequence:KEGG:GK2431"
FT                   /protein_id="ACX76907.1"
FT                   /translation="MCKKCSGGFLLVEALFALALLWTTAAVLLPLLTQMAHERNGLILE
FT                   EKARRLLAIALYEEPLAGETMIADGRTVFRLQASDEGGGMWKVCVRWNDYAGREMERCG
FT                   YGKR"
FT   gene            214873..215319
FT                   /locus_tag="GYMC61_0209"
FT   CDS_pept        214873..215319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76908"
FT                   /inference="similar to AA sequence:KEGG:GK2430"
FT                   /protein_id="ACX76908.1"
FT                   /translation="MRVWQAVAAKENGFTMIEALLALAAAMAVAAAVPALLSVRLLAPE
FT                   PTDAFSRLEWRLFVQQLQIELNETKQWSTGGRVLYLQKWSGETVSFSVVASRAELIRQV
FT                   DGAGNETALRHVRTVSYRAGARGIFLQVTADDGTVCEAFVARAF"
FT   gene            215395..215784
FT                   /locus_tag="GYMC61_0210"
FT   CDS_pept        215395..215784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76909"
FT                   /inference="similar to AA sequence:KEGG:GK2429"
FT                   /protein_id="ACX76909.1"
FT                   /translation="MGRQDGVMFPIVAVVSLLLVFSVMHVLLLYEAERQAAYAARQAAE
FT                   ADELVQMAVFDVKERIASADPSTAGEAGEWTYPRGMAAYRWVREDAAHVRVSLSIRSAS
FT                   GLRRAVMFTVTLPALHIVEWSEQNG"
FT   gene            215831..216010
FT                   /locus_tag="GYMC61_0211"
FT   CDS_pept        215831..216010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76910"
FT                   /inference="similar to AA sequence:KEGG:GK2428"
FT                   /protein_id="ACX76910.1"
FT                   /translation="MAVNDYVKFVTQQFVAYMDLPKEERRQRRQVRKQEQLPLSYRLFG
FT                   MVPLSLRLLFRRRP"
FT   gene            complement(216113..216907)
FT                   /locus_tag="GYMC61_0212"
FT   CDS_pept        complement(216113..216907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76911"
FT                   /inference="similar to AA sequence:KEGG:GK2427"
FT                   /protein_id="ACX76911.1"
FT                   /translation="MQQHEIRRFVERYFAANGCTFVEASDDYLTVQLTAEMDKELMNRP
FT                   FYWHYIERTGGVPQPMRLTLITRASERTDKLKGERLHFGAPRLHQLFRSAQKRGSFIRL
FT                   YEEPSAPLDGNAALHPWLGMNVTISYECDRKKDEIVSLGLHLISGTIVESFHERMRERR
FT                   LTPKIPDYCFTISPLIKPRSGIGRLEQYIRSRIAADNHAWADEARRRWADDLALLDEFY
FT                   KDCEEKPECYYIEKEALEKQYKPRITVSVINGGLFYLLPRSS"
FT   gene            complement(216894..218558)
FT                   /locus_tag="GYMC61_0213"
FT   CDS_pept        complement(216894..218558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0213"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicase ; helicase domain protein; KEGG: gka:GK2426
FT                   DNA/RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76912"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACX76912.1"
FT                   /translation="MNIDLEMDETWKEEFLARVEKDGPWASWEMYELALEAAHHLSVPE
FT                   FHGLQAPKHLPHLTILPHQLEVARRVVEEMNGKAILADEVGLGKTIEAGLVLKEYMIRG
FT                   LVKKALILVPASLVSQWVRELNEKFFIPAVQQKKSYVWEQCDIVVSSIDTAKKPPHRDI
FT                   IYGQSYDMIIIDEAHRLKNNKTKNYEFVQNLKKKFCLLLTATPIQNRIEEIFNLVSLLK
FT                   PGHLGSSEQFAKTYGKTRAVQTNDHLKALVNKVMIRNRRADTPIEWAKRHVEPVLIEFT
FT                   NEERELYEAVKALRRESFAGSFSLITLLREACSSREALFLTIKNMIDKCSGAVPEPLER
FT                   VLEKINAVKTNSKAEKALELIRSIHDKVIIFTEYRATQLYLQWFLKQHGISSVPFRGGF
FT                   RRGKKDWMQELFKHHAQVFIATEAGGEGINLQFCRYVINYDLPWNPMRLEQRIGRVHRL
FT                   GQTDDVYIYNFAVKQTVEEHILTLLYEKIRLFERVVGELDDILAKMNLANLERYFEDAF
FT                   VHSRSEGEMKIKMENIVAMIELAEQLGKEGGERHAAT"
FT   misc_binding    218778..218866
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   67.69"
FT   misc_binding    218869..218986
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   32.20"
FT   gene            219054..220148
FT                   /locus_tag="GYMC61_0214"
FT   CDS_pept        219054..220148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0214"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: gka:GK2425 glycine
FT                   cleavage system aminomethyltransferase T"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76913"
FT                   /inference="protein motif:TFAM:TIGR00528"
FT                   /protein_id="ACX76913.1"
FT                   /translation="MLKRTPLFSVYARYGAKTIEFGGWEMPVQFSSIKEEHEAVRTRAG
FT                   LFDVSHMGEIVVRGRGSLAFLQKLMTNDVAKLRPGRAQYTLMCYEDGGTVDDLLIYQKG
FT                   ENDYLLVVNAANTEKDFAWLSGHVEGDVELQDVSSETAQLALQGPAAERVLQRLTDFDL
FT                   AALRPFSFADGVEVSGVKALVSRTGYTGEDGFELYCKAEDAAALWEAILAAGARDGVLP
FT                   CGLGARDTLRFEACLPLYGQELSDSISPVEAGLGFAVKTEKEPPFIGQAVLKRQKEEGP
FT                   PRRIVGIEMIDRGIPRHGYLVFADGEEVGFVTTGTQSPTLKKNIGLALVKADVAAIGRE
FT                   VEVDIRGKRLKANIVPIPFYRRAK"
FT   gene            220184..221530
FT                   /locus_tag="GYMC61_0215"
FT   CDS_pept        220184..221530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0215"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: Glycine cleavage system P-protein-like; KEGG:
FT                   gka:GK2424 glycine dehydrogenase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76914"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ACX76914.1"
FT                   /translation="MLHRYLPMTEEDKQEMLKTIGVASIDDLFADIPEQVRFRGELKVK
FT                   PAKSEPELWKELAALAEKNASVKQYVSFLGAGVYDHYIPAVVDHVLSRSEFYTAYTPYQ
FT                   PEISQGELQAIFEFQTMVCELTGMDVANSSMYDGGTALAEAVLLSASHTKRKKVLISTA
FT                   VHPQYREVVRTYAKGQKLEVKEIPYDGGITDLKALEAEMGDDVACVVVQYPNFFGQIEP
FT                   LKAIAPLAHEKKSLFVVASNPLALGVLTPPGAFGADIVVGDMQPFGIPTQFGGPHCGYF
FT                   AVKAPLMRKIPGRLVGQTTDEDGRRGFVLTLQAREQHIRRDKATSNICSNQALNALAAS
FT                   VALSALGKRGVKEMAAMNIQKAHYAKVELEKRGLSSPFAGPFFNEFVIRLGRPVSDVND
FT                   RLLEKGIIGGYDLGADYPELAGHMLVAVTELRTKEEIDRFVNELGDGHA"
FT   gene            221523..222995
FT                   /locus_tag="GYMC61_0216"
FT   CDS_pept        221523..222995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0216"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: Glycine cleavage system P-protein-like;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: gka:GK2423 glycine dehydrogenase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76915"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ACX76915.1"
FT                   /translation="MRNDQPLIFERSKPGRIAYSLPALDVPAVDVSELVPADYLRTEEP
FT                   ELPEVSELDLMRHYTALSKRNHGVDSGFYPLGSCTMKYNPKINENVARLAGFAHIHPLQ
FT                   PEKTVQGALELMYDLQEHLKEITGMDAVTLQPAAGAHGEWTGLMMIRAYHEANGDFNRT
FT                   KVIVPDSAHGTNPASATVAGFETVTVKSTADGLVDLEDLKRVVGPDTAALMLTNPNTLG
FT                   LFEEHIVEMAEIVHKAGGKLYYDGANLNAILGKARPGDMGFDVVHLNLHKTFTGPHGGG
FT                   GPGSGPVGVKADLVPFLPKPVIEKGENGYYLDDDRPQSIGRVKPFYGNFGINVRAYTYI
FT                   RSMGPDGLKAVSEYAVLNANYMMRRLAEYYDLPYDRHCKHEFVLSGRRQKKLGVRTLDI
FT                   AKRLLDFGFHPPTIYFPLIVEECMMIEPTETESKETLDAFIDAMIQIAKEAEENPEIVQ
FT                   EAPHTTVVKRLDETTAARKPILRYQKPKHSDN"
FT   gene            223309..224496
FT                   /locus_tag="GYMC61_0217"
FT   CDS_pept        223309..224496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0217"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: gka:GK2422
FT                   transcriptional repressor of the xylose operon"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76916"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACX76916.1"
FT                   /translation="MRTGNISLVKKMNKQLVLKLIRDQHPISRADIAKTTGLNKATVSA
FT                   LVDELIAEHFVHESGIGESTGGRRPLMLRFNADAGSLIGVELGVNYLYAVLTNLNADIL
FT                   WEQRRSFRPSEGQEAIISEMMELIEAAIRRAPATPYGVMGIGIGVPGVVHTESGTVVFA
FT                   PNLRWDDVALAAVLRQRWPERPVIVENEAKLAALGEKWFGAGNEFAHFVYISAGIGIGA
FT                   GVVLHHQLYRGVSGLAGEIGHHTIDVNGIRCSCGNIGCWEMYASEKYIERRLAEEGRSE
FT                   WLDERFSIAAMALAAESDEQLARILEETGRYLGVGLLQVIYAYNPESVIIGGPLAQAGE
FT                   YVIGPARQEVRKRILVKKESEPSIISSKLKEKSCAIGAAASVLEAVVLPPEFAAV"
FT   gene            complement(224553..224927)
FT                   /locus_tag="GYMC61_0218"
FT   CDS_pept        complement(224553..224927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0218"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: gka:GK2421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76917"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACX76917.1"
FT                   /translation="MEALLIILGAIIIYSVITYIWQRRIVKSLTEEEFRAGYRKAQLID
FT                   VREPDEFAAGHILGARNIPLTQLRVRMKELRKDQPIYLYCQNGLRSGRAAQMLYRKGYR
FT                   DLYHLKGGFKTWTGKVKKKA"
FT   gene            225138..225974
FT                   /locus_tag="GYMC61_0219"
FT   CDS_pept        225138..225974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0219"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   gka:GK2420 lipoate protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76918"
FT                   /inference="protein motif:PFAM:PF03099"
FT                   /protein_id="ACX76918.1"
FT                   /translation="MAKEVWRFIDSGYCPPAFNMALDEALLDWHSEGKIPPTIRFYGWN
FT                   PPTLSIGYFQKVEKEIDLEAVKRHGLGFVRRPTGGRGVLHDKELTYSVIVSESHPAMPK
FT                   TVTEAYRVISQGILEGFRYLGLDAYFAVPRTEEEKADLRSPRSAVCFDAPSWYELVVEG
FT                   RKIAGSAQTRQKGVILQHGSILLDLDEDLLFSLFKYPNERVKERLQRDFKKKAVAINEL
FT                   TSRTVTIEEAKEAFYKGFEKGLNIVLEPYTLTAEERAYVEELARTKYESDEWNFKR"
FT   gene            226319..227599
FT                   /locus_tag="GYMC61_0220"
FT   CDS_pept        226319..227599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0220"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: gwc:GWCH70_2089
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76919"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACX76919.1"
FT                   /translation="MNCTQNYKIDQVTEQTLVVGIDIAKRTHYACFVDDRGRVLRKSFP
FT                   IFQSKEGFRQLYEAIQEAMQAFGKPQVIVAVEPTGHYWLNLAYFLEEHGIPLVMVNPAH
FT                   VCRSKELDDNLPTKHDAKDALVIARLAKDGRFLVPRLLHEIEADLRVGSTLKEKLRKEQ
FT                   TAVKNAIVRWTDRYFPEFWTVFRDLGKTALSVLEWTPLPADMASRSAEELIEVYRQSEG
FT                   LKCPQKAKIQALIDAAKDSIGVTEGTTMARFEIAALVRRYRQLEAEIAALDAELKALVQ
FT                   TTMEYQWLKTVDGLGDATIIDLLAEIGSFAHYRDPRQLVKLAGLTLKENSSGQRKGQKH
FT                   ISKRGRKRLRSVLFRAMIPLIRHNEAFRELHDYYTTRPVNPLTGKQSIVALCRKLLNVL
FT                   FAICTKKQAFDAERMKQDVLSQVQRAA"
FT   gene            228000..230975
FT                   /pseudo
FT                   /locus_tag="GYMC61_0221"
FT                   /product="hypothetical protein"
FT   gene            228788..228949
FT                   /locus_tag="GYMC61_0222"
FT   CDS_pept        228788..228949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76920"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76920.1"
FT                   /translation="MRRQTAGVKSRELLEHPKANLTTTELVTADVTVGKQVGCNNGQPA
FT                   AKHLWKRR"
FT   gene            231099..232511
FT                   /locus_tag="GYMC61_0223"
FT   CDS_pept        231099..232511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0223"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; glycoside
FT                   hydrolase family 18; SMART: Peptidoglycan-binding LysM;
FT                   chitinase II; KEGG: gka:GK2418 spore peptidoglycan
FT                   hydrolase (N-acetylglucosaminidase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76921"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACX76921.1"
FT                   /translation="MIVHVVKRGETLWQLAQRYGVPLERIVAANELSDPNRLAVGQALV
FT                   IPVPYRYHTVRTGETLWQIARQYGVAVEAIIQANRITNPSLLYPGTTLFIPARIHTVRS
FT                   GETLAQIASFYGVTVQQLIEVNDITDPNRIVPGQRLIIPPAKPLIEVNAFTVDQGEKGA
FT                   EQVREVGRHLTYAAPFAYTIRADGGLNPINDTAFIQAAYAARVVPMMTITNFTYQDPGS
FT                   RLAQMILADVALQTRLLDNVIQVMRAKGYRTLNVDFENVYPSDRKRYNEFLQRAANRLH
FT                   AEGYVLSTSLAPKISAEQKGLLYEAHDYPAHGRIADFVVLMTYEWGYRFGPPQAISPVN
FT                   QIRRVLDYAVTAIPRSKIMMGFQIYARDWVLPHVQGQEAETFSPKEALERAVRYGASIQ
FT                   YDAAAASPFYRYTDEQGRQHEVWFEDARSALAKFELVKEYGLRGISYWVLGYPYPENWV
FT                   LLEDNFRIRKRG"
FT   gene            complement(232551..232949)
FT                   /locus_tag="GYMC61_0224"
FT   CDS_pept        complement(232551..232949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76922"
FT                   /inference="similar to AA sequence:KEGG:GK2417"
FT                   /protein_id="ACX76922.1"
FT                   /translation="MSHELVELLRSVLKEELQPIHERLDRLEAGQQRLEERQQRLEERQ
FT                   QRLEERQQRLEEQQQRLGEKLDHFIIETRSHFKKIEDKLAGHRRMFDILPHDWRDTTMA
FT                   IEYLKHKISQHDLEIYQLKKRLELQETK"
FT   gene            233095..233634
FT                   /locus_tag="GYMC61_0225"
FT   CDS_pept        233095..233634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0225"
FT                   /product="protein of unknown function UCP012608"
FT                   /note="PFAM: protein of unknown function UCP012608; KEGG:
FT                   gtn:GTNG_2349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76923"
FT                   /inference="protein motif:PFAM:PF10094"
FT                   /protein_id="ACX76923.1"
FT                   /translation="MEFNGMKRAKNVVKSRRIREMIKLNFTWVAERIGIDLHVIDLKKE
FT                   DDRRWMKALIWPEHKDRRQLFEKAARCLEQTPIRLIEGDGVELLSDLVAQVPSDTVVCI
FT                   FHTHVANQMSDEAKRGLLEQLREIGRQRDLFHVYNNMWDPKLHLDRMINGRECRQIVAE
FT                   TDGHARWFRWEADGCG"
FT   gene            233739..234764
FT                   /locus_tag="GYMC61_0226"
FT   CDS_pept        233739..234764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0226"
FT                   /product="spore photoproduct lyase"
FT                   /note="TIGRFAM: spore photoproduct lyase; PFAM: Radical SAM
FT                   domain protein; KEGG: gtn:GTNG_2348 spore photoproduct
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76924"
FT                   /db_xref="GOA:C9RZ55"
FT                   /db_xref="InterPro:IPR023897"
FT                   /db_xref="InterPro:IPR034560"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9RZ55"
FT                   /inference="protein motif:TFAM:TIGR00620"
FT                   /protein_id="ACX76924.1"
FT                   /translation="MKPFVPKLVYFEPEALSYPLGQELYEKFTQMGIEIRETTSHNQVR
FT                   GIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCYLQTTLG
FT                   SKPYIRVYVNLDDIFAQAQKYIDERAPEITRFEAACTSDIVGIDHLTHSLKKAIEFIGA
FT                   TDYGRLRFVTKYEHVDHLLDAKHNGKTRFRFSVNSRYVINHFEPGTSSFDARLQAARKV
FT                   AGAGYKLGFVVAPIYRHDGWEQGYFELFQELARQLEGVDLSDLTFELIQHRFTKPAKRV
FT                   IEQRYPKTKLDLDESKRKYKWGRYGIGKYVYRDKEARELEETMRSYIARFFPSAQVQYF
FT                   T"
FT   gene            234933..235358
FT                   /locus_tag="GYMC61_0227"
FT   CDS_pept        234933..235358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0227"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; SMART: iron
FT                   dependent repressor; KEGG: gka:GK2416 manganese transport
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76925"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ACX76925.1"
FT                   /translation="MPTPSMEDYIEQIYILIEEKGYARVSDIAEALSVHPSSVTKMVQK
FT                   LDKDEYLVYEKYRGLVLTPKGRKIGQRLVYRHELLEQFLRLIGVSEENIYRDVEGIEHH
FT                   LSWNAIDRIGDLVQYFQEDERRLEALRDVQKRNEQGE"
FT   gene            235446..236327
FT                   /locus_tag="GYMC61_0228"
FT   CDS_pept        235446..236327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0228"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: gka:GK2415 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76926"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACX76926.1"
FT                   /translation="MDIDLVFSGGGVKGFALLGAYEAIEEKGLRWKRLAGTSAGALLSA
FT                   LLSAGYSARDIARLLEELELEQFLDERPLWIPFSLWKWVRLYWHLGLYQGKAFERWLEA
FT                   ALAARGVRTFQDVPAGSLYIVASDVTNGRIVVLPDDLAIYGIDPGSFSIAKAVRMSISI
FT                   PYFFEPVRLRGRNGVAFIVDGGVLSNFPLFLFDEEKKKKRPVLGVQLSPKPGERPKRTI
FT                   TNALDLYEALFAAMREAHDARYISRRHEKNIVFLPVDNVISTEFSIDLEARRRLIDYGR
FT                   ERTRQFLRQWAY"
FT   gene            complement(236406..236762)
FT                   /locus_tag="GYMC61_0229"
FT   CDS_pept        complement(236406..236762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76927"
FT                   /inference="similar to AA sequence:KEGG:GK2414"
FT                   /protein_id="ACX76927.1"
FT                   /translation="MRRRAIHPLVGLMILLGTLGIVYTLFAHPTVLFRQLLFVALFLAA
FT                   IYFFYRFVYQRRTDKDRLSYLKAVRQSKKLHPRSGRKQAKPAKLKRPLKKRTAIPHLTV
FT                   IEGKKGKKKNRASF"
FT   gene            complement(236785..237720)
FT                   /locus_tag="GYMC61_0230"
FT   CDS_pept        complement(236785..237720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0230"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   gka:GK2413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76928"
FT                   /inference="protein motif:PFAM:PF07136"
FT                   /protein_id="ACX76928.1"
FT                   /translation="MKSSMEKPLYGGQAVVEGVMFAGKTHSVTAIRRHDGTIDYFTLPR
FT                   RSHPTLAALKKIPFVRGIVAIIEASANGAKHLQFASEQYEASSDEKQAAEESRSKFGLI
FT                   LGAAVIGVLSFLFAKTIFTLVPALAADAFKPLVPGKMGQILLEGAFKLALLLGYIYFIS
FT                   LTPLVRRLFQYHGAEHKVINAFEAGWPLTVEHVQRASRLHYRCGSSFILFTVMISLFLY
FT                   LFVPTDPLWLRIANRLALIPVVLGVSFEVLQFTNKLRDIPLLSWLGYPGLWLQRLTTKE
FT                   PDDDQVEVAIASFQRLLDLEAEAERKQAVQ"
FT   gene            237908..238438
FT                   /locus_tag="GYMC61_0231"
FT   CDS_pept        237908..238438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76929"
FT                   /inference="similar to AA sequence:KEGG:GK2412"
FT                   /protein_id="ACX76929.1"
FT                   /translation="MMAEQKGELEQEKTERPMTLIQKTIIIGFVGGVFWSLIGYLAYFF
FT                   HFSEISPNMILIPWVAGDWKYGKAGNYAAIVLIGIISIAAALLYYAFLRKIAGMWAGMV
FT                   YGVVLWMMVFYLFNPLFPNVQPVADLEANTIITTLCLYILYGVFVGYSISFETQEMNRP
FT                   ASNVGKEAANEGN"
FT   gene            239106..240167
FT                   /locus_tag="GYMC61_0232"
FT   CDS_pept        239106..240167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0232"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG: gka:GK2411
FT                   Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76930"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACX76930.1"
FT                   /translation="MEKLEKLRELLDEQHIDGLLVTNGYNRRYLTGFTGTAGAVLVSRQ
FT                   GAVLVTDFRYVEQASRQAQGFEVVQHSGPIIEEIANQVKRLGIKRLGFEQEHVTYAAYK
FT                   SYEEAIRAELVPTSWLVEKLRLIKSEAEIKILKEAAEIADAAFSHILSFIRPGVKEIEV
FT                   ANELEFFMRKQGASSSSFDTIVASGYRSALPHGVASEKTIERGELVTLDFGAYYKGYCS
FT                   DITRTVAVGDISAELRTIYDIVLEAQQRGMNGLKAGMTGKEADALTRDYIREKGYGDYF
FT                   GHSTGHGIGLEIHEGPTLSFRSDVVLEPGMVVTVEPGIYIPGLGGVRIEDDTVITADGN
FT                   EALTHSPKELIIL"
FT   gene            240195..240752
FT                   /locus_tag="GYMC61_0233"
FT   CDS_pept        240195..240752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0233"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor KOW domain protein; Elongation factor P ;
FT                   Elongation factor P/YeiP protein; KEGG: gka:GK2410
FT                   elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76931"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ACX76931.1"
FT                   /translation="MISVNDFRTGLTIEVDGEIWRVLEFQHVKPGKGAAFVRSKLRNLR
FT                   TGAIQERTFRAGEKVNRAQIDTRKMQYLYANGDQHVFMDMETYEQIELPAKQIEHELKF
FT                   LKENMEVFIMMYQGETIGVELPNTVELKVVETEPGIKGDTASGGSKPAKLETGLVVQVP
FT                   FFVNEGDTLIINTADGTYVSRA"
FT   gene            240929..241210
FT                   /locus_tag="GYMC61_0234"
FT   CDS_pept        240929..241210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76932"
FT                   /inference="similar to AA sequence:KEGG:GK2409"
FT                   /protein_id="ACX76932.1"
FT                   /translation="MKHWLRSIDPSVMAMAGMRMVSAFMELSAALLMLVFNDVKKALAV
FT                   NAALAVVGPTVMMVTMAIGLLSLADELSFSRLGLVALGIALILFAIYK"
FT   gene            241272..242192
FT                   /locus_tag="GYMC61_0235"
FT   CDS_pept        241272..242192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0235"
FT                   /product="stage III sporulation protein AA"
FT                   /note="TIGRFAM: stage III sporulation protein AA; SMART:
FT                   AAA ATPase; KEGG: gka:GK2408 stage III sporulation protein
FT                   AA"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76933"
FT                   /inference="protein motif:TFAM:TIGR02858"
FT                   /protein_id="ACX76933.1"
FT                   /translation="MEAVWGILPKTVAAALQHHLPSCRRGIEEIRIRVSRPLEVIVDGT
FT                   ARLLPYEVTKEDGVHLLNKLSHYSIYAVEEELKRGFMTIEGGHRVGLAGKVITEGGKVK
FT                   AIRDVSSFNIRIAKEQIGIAEPLIPYVYDGRWRHTMIIGSPQTGKTTLLRDAARLISSG
FT                   TGRIPAQKVAIVDERSEIAGCVKGIPQFSFGPRLDVLDACPKAEGMMMMIRSMSPDVMI
FT                   VDEIGREEDSEAVLEAANAGVSVWTTVHGRNIQDVWQRPTLGPVMEQKVFERFIELTNI
FT                   PHPGSIRRILDAGGTVLYERAVVHR"
FT   gene            242189..242701
FT                   /locus_tag="GYMC61_0236"
FT   CDS_pept        242189..242701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0236"
FT                   /product="stage III sporulation protein AB"
FT                   /note="TIGRFAM: stage III sporulation protein AB; PFAM:
FT                   Sporulation stage III protein AB; KEGG: gka:GK2407 stage
FT                   III sporulation protein SpoAB"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76934"
FT                   /inference="protein motif:TFAM:TIGR02833"
FT                   /protein_id="ACX76934.1"
FT                   /translation="MKWFGALLILAASTWLGFAAARVLHERPRQLRQLKAALRALEAEV
FT                   MYGHTPLADAAMHLARQTAAPLSELFERFAAALCTEETSAAEAWEKSLRAVWEKTALKQ
FT                   GEFEVMKQFGATLGQYDRLTQQRQIALALAHLEREEAEALDNQARYAKMAKSLGVLAGL
FT                   LLVILLM"
FT   gene            242717..242923
FT                   /locus_tag="GYMC61_0237"
FT   CDS_pept        242717..242923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0237"
FT                   /product="stage III sporulation protein AC"
FT                   /note="TIGRFAM: stage III sporulation protein AC; PFAM:
FT                   Stage III sporulation AC family protein; KEGG: gka:GK2406
FT                   stage III sporulation protein AC"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76935"
FT                   /inference="protein motif:TFAM:TIGR02848"
FT                   /protein_id="ACX76935.1"
FT                   /translation="MGIDVDLILKIAGVGIVIAFLHTVLDQMGRKEYAQWVTLLGFIYI
FT                   LFMVASIVSDLFQKIKDVFLFRG"
FT   gene            242945..243331
FT                   /locus_tag="GYMC61_0238"
FT   CDS_pept        242945..243331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0238"
FT                   /product="stage III sporulation protein AD"
FT                   /note="TIGRFAM: stage III sporulation protein AD; PFAM:
FT                   Sporulation stage III protein AD; KEGG: gka:GK2405 stage
FT                   III sporulation protein AD"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76936"
FT                   /inference="protein motif:TFAM:TIGR02849"
FT                   /protein_id="ACX76936.1"
FT                   /translation="MQIVGLGLIATFLVVLLQEQKSNLAFLLTVFVGCTIFLLLVDQIS
FT                   SILAMLRKMAEGAHIQMVYLETMLKIIGIAYIAEFAAQISKDAGQGAIAAKIELGGKIV
FT                   ILALAVPILTAIIEAVIGLIPSAR"
FT   gene            243345..244508
FT                   /locus_tag="GYMC61_0239"
FT   CDS_pept        243345..244508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0239"
FT                   /product="stage III sporulation protein AE"
FT                   /note="TIGRFAM: stage III sporulation protein AE; PFAM:
FT                   Sporulation stage III protein AE; KEGG: gka:GK2404 stage
FT                   III sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76937"
FT                   /inference="protein motif:TFAM:TIGR02829"
FT                   /protein_id="ACX76937.1"
FT                   /translation="MKRTAFLILGLLSLFFCPLVVQAASDGPSVSEQLAQLDVSDIRRY
FT                   WETIVSEYGGFLPESEKGPLTDFLSGDKQWSPSEWLKALARYLFYELQVNGKLLGTLIL
FT                   LAVFSTVLQSLQNAFAQQEVSKIAQAVVYMVLLLIALNSFRLAADYALEAVRTMSHFII
FT                   ALVPLLLALLATSGGVASAAFFHPIILFVMNTTGTVVEYVTLPLLLLAALLSVVSTLSD
FT                   RYKATQLADLLNKAALGLLGLILTVFLGVMSVRGATAAVADGVALRAAKFVTGNFIPVV
FT                   GKLFTDAADTVVAASMLLKNTVGLVGAAILLMIAIFPAVKIFAIVIVYKLSAALLQPLG
FT                   GGPVLSCLNIIGKSIAYVLAALLIVSLMFFLSLTVMVMAGNITMMVR"
FT   gene            244519..245130
FT                   /locus_tag="GYMC61_0240"
FT   CDS_pept        244519..245130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0240"
FT                   /product="stage III sporulation protein AF"
FT                   /note="TIGRFAM: stage III sporulation protein AF; PFAM:
FT                   Sporulation stage III protein AF; KEGG: gka:GK2403 stage
FT                   III sporulation protein AF"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76938"
FT                   /inference="protein motif:TFAM:TIGR02896"
FT                   /protein_id="ACX76938.1"
FT                   /translation="MQLVIEWVTNIILFLLFAVIIDFLLPSGTMQKYVKMAVGLMLVLV
FT                   MLAPVLRLASVDPEQLIASALVHFSNGRAGEEAIKNQIEQQKKEIQASQRAYILKQMAV
FT                   QLENDVNEELMEKYGLKADVNVYAKPGDDWRMPDDIKTIEVVLSKQKSAGSVEPVVIDT
FT                   TKPPALPEGDASLAEEVRAFLAGRWEIDEDKIDVQFRGRE"
FT   gene            245138..245770
FT                   /locus_tag="GYMC61_0241"
FT   CDS_pept        245138..245770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0241"
FT                   /product="stage III sporulation protein AG"
FT                   /note="TIGRFAM: stage III sporulation protein AG; KEGG:
FT                   gka:GK2402 stage III sporulation protein AG"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76939"
FT                   /inference="protein motif:TFAM:TIGR02830"
FT                   /protein_id="ACX76939.1"
FT                   /translation="MLPLIKRLFSSAPKDGEGAQKKWPFSYVVVLLLAGVALMAASHWA
FT                   NSGEEAEAKPSAGQPSAPAEPAFLASKETKEKVIAAYEERYEKELKAALEAIEGVDDVT
FT                   VVVNLDSTELKLYEKKRSTQQQTTEESDKEGGKRTIENESTNEEVIIIHNGEEETPLVV
FT                   ATKKPDIRGVLVVAKGADNLQIKKWIVEAVTRVLNVPSYRVAVLPKK"
FT   gene            245794..246345
FT                   /locus_tag="GYMC61_0242"
FT   CDS_pept        245794..246345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0242"
FT                   /product="stage III sporulation protein AH"
FT                   /note="KEGG: gka:GK2401 stage III sporulation protein AH"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76940"
FT                   /inference="similar to AA sequence:KEGG:GK2401"
FT                   /protein_id="ACX76940.1"
FT                   /translation="MLKKQTVWLLTMLSLVVVLSVYYVTAPKNMNDSPAFTANKKTEKT
FT                   TDQPSVAVEEAKKPSASGETGDDLFTALRMKIEDERSRLRDELNAIVASANATAEEKNE
FT                   ALDKIEKLQALSEKEATLETLIKSKGGYEDVLVRADDSQVRVTIKAKQSSAKSANEVIH
FT                   MVKKEIPDAEYVTVEFQPAG"
FT   gene            246482..247024
FT                   /locus_tag="GYMC61_0243"
FT   CDS_pept        246482..247024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0243"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: gka:GK2400 acetyl-CoA
FT                   carboxylase biotin carboxyl carrier protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76941"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ACX76941.1"
FT                   /translation="MRSMKIQEIRELIRLVDQSSIDEFVYEQGETKVHMKKGTAAVAVA
FT                   PAAAAQTAVAPPAPAAPAAVEPAPAAPPVQAAASEAPAPKAETPVVKEAKPAVEGNLHQ
FT                   ITSPMVGTFYAAPAPDKPPYVKPGDKVKKDTVVCIIEAMKLFNEIEAEVDGEIVEVLVQ
FT                   NGQLVEYGQPLFLVKPE"
FT   gene            247040..248395
FT                   /locus_tag="GYMC61_0244"
FT   CDS_pept        247040..248395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0244"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   biotin carboxylase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   RimK domain protein ATP-grasp; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: gka:GK2399
FT                   acetyl-CoA carboxylase biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76942"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ACX76942.1"
FT                   /translation="MIKKVLVANRGEIAVRIIRACRELGIETVAVFSQADRDALHVQLA
FT                   DEAYCIGPTASKDSYLNFTNIMSVATLTGCDAIHPGYGFLAENEAFAELCRECNVTFIG
FT                   PSPEAIAKMGIKDIARETMREAGVPIVPGSRGVIESLDEARAIAEEIGYPVIIKATAGG
FT                   GGKGIRVARDEGELVKGINITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADSYGNTI
FT                   HLGERDCSIQRRLQKLVEEAPSPALDDEMRRKMGEAAVKAAKAVNYTGAGTVEFIYDHR
FT                   NKQFYFMEMNTRIQVEHPVTELITGIDLVKEQIRIAAGEKLSITQEDVTFNGWAIECRI
FT                   NAENPAKNFMPSPGKIAMYLPPGGPGVRVDSAVYPGYTIPPYYDSMIAKLIVHAPTRAE
FT                   AIARMRRALSEFIIEGIHTTIPFHIKLMEHEKFQSGEFNTKFLELYDIMKAE"
FT   gene            248406..248807
FT                   /locus_tag="GYMC61_0245"
FT   CDS_pept        248406..248807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0245"
FT                   /product="protein of unknown function DUF322"
FT                   /note="PFAM: protein of unknown function DUF322; KEGG:
FT                   gka:GK2398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76943"
FT                   /inference="protein motif:PFAM:PF03780"
FT                   /protein_id="ACX76943.1"
FT                   /translation="MSEHVFETEQVYPALGKVEIAPEVIEVIAGIAASEVDGIAQMRGN
FT                   FAAGVAERFGKKHHGKGVKVDLRDDGVVIDLYCLVQFGASIPNVAKKVQENVRQALWNM
FT                   TGLEASEVNVHIVGIQFEGGKQEQGVVEQ"
FT   gene            249000..249392
FT                   /locus_tag="GYMC61_0246"
FT   CDS_pept        249000..249392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0246"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: gka:GK2397 transcription
FT                   antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76944"
FT                   /inference="protein motif:TFAM:TIGR01951"
FT                   /protein_id="ACX76944.1"
FT                   /translation="MKRHEAREKALQALFQIDVGRIPPDEALHNVTGGGDIDPFLRQLV
FT                   FGVVEHQEEIDELLRANLEKWTLERVANVDRAILRMATYEMKYADDVPVSVSLDEAVEL
FT                   AKTFGDWKSGSFVNGVLSKVKAALQK"
FT   gene            249452..250306
FT                   /locus_tag="GYMC61_0247"
FT   CDS_pept        249452..250306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0247"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: gka:GK2396 methylenetetrahydrofolate dehydrogenase;
FT                   methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76945"
FT                   /inference="protein motif:PRIAM:1.5.1.5"
FT                   /protein_id="ACX76945.1"
FT                   /translation="MTAQIISGTEMARTIRTALADEAAQLKADGVELGLAVILVGDDPA
FT                   SHSYVKGKQKACAEVGIRSFLYTFPAAIDEETLLAKIRELNVDPAVHGILVQLPLPDHI
FT                   CEWSVIETIAPEKDVDGFHPINVGKMMIGQRAFLPCTPHGILVMVQSAGIDIAGKHVVV
FT                   VGRSNIVGKPVGQLFLREHATVTYTHSKTPDLAAITRQADILIVAVGKARLIGPEHVKP
FT                   GAVVIDVGVNRLENGKLCGDVDFDAVKEVAGYITPVPGGVGPMTITMLLHNTIEAARQL
FT                   AAK"
FT   gene            250318..251664
FT                   /locus_tag="GYMC61_0248"
FT   CDS_pept        250318..251664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0248"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: gka:GK2395 exodeoxyribonuclease VII large
FT                   subunit; TIGRFAM: exodeoxyribonuclease VII, large subunit;
FT                   PFAM: Exonuclease VII, large subunit-like; nucleic acid
FT                   binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76946"
FT                   /inference="protein motif:TFAM:TIGR00237"
FT                   /protein_id="ACX76946.1"
FT                   /translation="MEVKYVTVGALTKYIKRKFDVDPHLRDLWVKGEISNFKQHSRGHM
FT                   YFTLKDSQGRIAAVMFAGYNQYLPFRPEDGMNVLARGEISVYEPNGNYQLYVKEMQPEG
FT                   VGSLYLAYEQLKQRLEAEGLFSPVHKKPLPAFPRCIGVVTSPTGAAVRDIMTTIRRRYP
FT                   LAKVILFPALVQGDGAAPSIVRAIERANAFGGVDVLIVGRGGGSIEELWAFNEEIVARA
FT                   IFASKIPIISAVGHETDFTIADFVADLRAPTPTAAAEMAAPHVGELAERLAERKWRLIR
FT                   AMKERLAADKEQLRRLQGSYAFRYPKRLYEQKEQQLDALLERLSRQRERLVDKHRQRLH
FT                   ELDMRLWRHHPAAELERMKERQKATANALEKAMRTAVERHRFRFRSNLARLEALSPLRI
FT                   MERGYSLVYNEQGELVKRTNQLRIGEHLSIQVQDGRVDCQVTGVEEKHV"
FT   gene            251661..251891
FT                   /locus_tag="GYMC61_0249"
FT   CDS_pept        251661..251891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0249"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG: gtn:GTNG_2324
FT                   exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76947"
FT                   /inference="protein motif:TFAM:TIGR01280"
FT                   /protein_id="ACX76947.1"
FT                   /translation="MSEEKEMTFEEAMKKLEEIVEKLEEGNVPLEEAIAFFQEGMKLSK
FT                   LCHDKLQHVEKQLEYMLREDGELVPFSPEEE"
FT   gene            251895..252788
FT                   /locus_tag="GYMC61_0250"
FT   CDS_pept        251895..252788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0250"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: gka:GK2393
FT                   geranyltranstransferase (farnesyl-diphosphate synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76948"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ACX76948.1"
FT                   /translation="MAQLSVEQFLNEQKRAVEAALSSYMARLRGPETLKKAMAYSLEAG
FT                   GKRIRPLLLLATIQALGKDPAIGLPVACAIEMIHTYSLIHDDLPSMDNDDLRRGKPTNH
FT                   KVFGEAMAILAGDALLTYAFQLMAEIDDDRVPPPVRLQLIEQLAKAAGPEGMVAGQAAD
FT                   MEAEGKTLALAELEYIHRHKTGKMLQYSVHAGALLGGADGRQTRELNEFAAHLGLAFQI
FT                   RDDILDIEGMEEKIGKRVGSDRDNKKATYPVLLSLGGAKEKLAFHIDAAKRHLQQAKID
FT                   DAVLAYICELVAVRDH"
FT   gene            253033..254928
FT                   /locus_tag="GYMC61_0251"
FT   CDS_pept        253033..254928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0251"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   KEGG: gka:GK2392 1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76949"
FT                   /inference="protein motif:TFAM:TIGR00204"
FT                   /protein_id="ACX76949.1"
FT                   /translation="MLDLTKIDHPRVVKNMSIPELKRLSAEIRRFLIEKLSKTGGHIGP
FT                   NLGVVELTIALHREFDSPKDKLIWDVGHQSYVHKILTGRAAAFDTLRQYKGLSGFPKRS
FT                   ESEHDVWETGHSSTSLSAAMGMAIARDLKGTDEYIVPIIGDGALTGGMALEALNHIGHE
FT                   KTDMIVILNDNEMSIAPNVGALHNILGRLRTAGKYQWVKDELELLLKRIPAVGGKLAAT
FT                   AERLKDSLKYLLVSGVFFEELGFTYLGPVDGHDFEDLLENLRYAKKMKGPVLVHVITKK
FT                   GKGYSPAENDKVGTWHGTGPYKIETGAFVKTKEAGPSWSALVSETVRRLARTDPRIVAI
FT                   TPAMPVGSKLEGFASEFPDRMFDVGIAEQHATTLAAGLATQGMKPFLAIYSTFLQRAYD
FT                   QVVHDVCRQNLNVFFAIDRAGLVGADGETHQGVFDIAFLRHVPNLVLMMPKDENEGQHM
FT                   VYTAIRYDDGPIAMRFPRGNGLGVPLDEELKEIPIGTWEVLRDGCDAAILTFGTTISMA
FT                   LKAADELAKDGISVKVVNARFLKPMDVAMLHELLESRLPILTVEEAVLQGGFGSAVLEF
FT                   AHDHGYHGAVIERMGIPDRFIEHGSVSELLNEIGLTSTHIIDRIKTMMPRKQKRA"
FT   gene            254932..255780
FT                   /locus_tag="GYMC61_0252"
FT   CDS_pept        254932..255780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0252"
FT                   /product="hemolysin A"
FT                   /note="KEGG: gka:GK2391 hypothetical protein; TIGRFAM:
FT                   hemolysin A; PFAM: RNA-binding S4 domain protein; ribosomal
FT                   RNA methyltransferase RrmJ/FtsJ; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76950"
FT                   /inference="protein motif:TFAM:TIGR00478"
FT                   /protein_id="ACX76950.1"
FT                   /translation="MKGKKERLDVLLVERGLAETREKAKRAIMAGLVYSNDVRLDKPGE
FT                   KVPVDIPLEVKGNPLPYVSRGGLKLEKALREFHIRVENKIVLDIGASTGGFTDCALQHG
FT                   AKLTYAVDVGYNQLAWKLRQDERVVVMERTNFRYVTPDQFTKGLPEVAVIDVSFISLRL
FT                   ILPVVKTVMVPGGDVIALVKPQFEAGREKVGKKGIVRDPNIHEEVLESIIQFACAEGFD
FT                   VLHLSYSPITGGDGNIEFLLHAVYSGENRKGENRLSMPIAHIVREAHAHLRGDRTEGNG
FT                   E"
FT   gene            255830..256279
FT                   /locus_tag="GYMC61_0253"
FT   CDS_pept        255830..256279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0253"
FT                   /product="arginine repressor, ArgR"
FT                   /note="TIGRFAM: arginine repressor; PFAM: arginine
FT                   repressor; KEGG: gka:GK2390 arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76951"
FT                   /inference="protein motif:TFAM:TIGR01529"
FT                   /protein_id="ACX76951.1"
FT                   /translation="MNKGQRHIKIREIIMNHDIETQDELVDRLREAGFNVTQATVSRDI
FT                   KEMQLVKVPMANGRYKYSLPSDQRFNPLQKLKRALVDVFVKLDGTGNLLVLRTLPGNAH
FT                   AVGVLLDNLDWNEIVGTICGDDTCLIICRTPKDAEKVSDQLLSML"
FT   gene            256406..258127
FT                   /locus_tag="GYMC61_0254"
FT   CDS_pept        256406..258127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0254"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: gka:GK2389 DNA repair protein (recombination
FT                   protein N)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76952"
FT                   /inference="protein motif:TFAM:TIGR00634"
FT                   /protein_id="ACX76952.1"
FT                   /translation="MLAELSIKNFAIIESLSLSFDKGLTVLTGETGAGKSIIIDAIHLL
FT                   IGGRGSAEFVRFGAEKAEIEGLFLLDDDRHPCWQKCADVGIDASDGMIVLRRDIFANGK
FT                   SVCRINGKLVTTAVLRDIGATLVDIHGQHEHQELMDPSRHLPLLDEFGGLEAAEALARY
FT                   RAVYERYEELGNKLKKLSENEQQMAHRLDLLTFQLREIEQAALELGEDERLMEEKVRIV
FT                   NFQKIYTALQKSYEALSGEGRGLDSIGEAMRHLDDVAGMDAALKDAHETTSNCYYLLEE
FT                   VMYKLRDQIEEMEYDPERLDAIESRLAEIGQLKRKYGATIADILHYAETIAEEIETIEN
FT                   RETHVHELKQQLALVTDELLTEAKNVTAVRQTYAQRLIERIHQELKDLYMDKTKFDIVF
FT                   AKREGSLDAPLVDGVPVRFQEDGIDVVEFYISTNVGEPLKPLVKVASGGELSRIMLALK
FT                   TIFSKHQGVTSIVFDEVDTGVSGRVAQAMAEKIYRIASQSQVLCISHLPQVAAMADTHL
FT                   LIAKETDGERTKTVVRKLNEEEKVKEIGRMISGVEMTELTKRHAKELLELAAKMKH"
FT   gene            258401..259696
FT                   /locus_tag="GYMC61_0255"
FT   CDS_pept        258401..259696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0255"
FT                   /product="stage IV sporulation protein B"
FT                   /EC_number="3.4.21.116"
FT                   /note="KEGG: gka:GK2388 stage IV sporulation protein B;
FT                   TIGRFAM: stage IV sporulation protein B; PFAM: peptidase
FT                   S55 SpoIVB; PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76953"
FT                   /inference="protein motif:TFAM:TIGR02860"
FT                   /protein_id="ACX76953.1"
FT                   /translation="MNKETARKIAGVLLLGILTAIAFSKPMKEYWQIPKQLVLFEGDAV
FT                   EFPAASLPVQAAVNDRNAPETLNIERKNGSLSVKAKRRGHETMVLQVAGMPIKQVDVNV
FT                   LPTLKVIPGGQSIGVKLNTVGVLVVGYHLVETENGKKSPGEAAGIQVGDIIIGINGQKI
FT                   ENMSDLSPFIEEAGKTGKPLHLKILRDQHSMTVKLVPLRDKHDDVYRIGLYIRDSAAGI
FT                   GTMTFYDPKSKTYGALGHVISDMDTKKPIVVQNGQIMRSTVTSIEKGTSGNPGEKLARF
FT                   SDGEEVIGTITTNSPFGIFGKLIKPLPNGPFTKPIPVALANQVKEGPAKILTVVENDKV
FT                   EQFDVEIVSTIPQKFPATKGLVIRVTDPRLLKKTGGIVQGMSGSPIIQDGKLVGAVTHV
FT                   FVNDPTSGYGVHIEWMLQEAGIDLYGKQKKAS"
FT   gene            260120..260899
FT                   /locus_tag="GYMC61_0256"
FT   CDS_pept        260120..260899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0256"
FT                   /product="sporulation transcriptional activator Spo0A"
FT                   /note="KEGG: gka:GK2387 stage 0 sporulation protein A
FT                   (two-component response regulator); TIGRFAM: sporulation
FT                   transcription factor Spo0A; PFAM: Sporulation initiation
FT                   factor Spo0A ; response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76954"
FT                   /inference="protein motif:TFAM:TIGR02875"
FT                   /protein_id="ACX76954.1"
FT                   /translation="MSIKVCIADDNRELVTLLDEYISSQPDMEVIGTAYNGQDCLHMLE
FT                   EKRPDILLLDIIMPHLDGLAVLEKVRAGCEHQPSVIMLTAFGQEDVTKKAVELGASYFI
FT                   LKPFDMENLVHHIRQIHGKTAPMVRKTGSAYQARDNKPKNLDASITSIIHEIGVPAHIK
FT                   GYLYLREAIAMVYHDIELLGSITKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNLE
FT                   SISSLFGYTVSVSKAKPTNSEFIAMVADKLRLEHKAS"
FT   gene            complement(261051..261203)
FT                   /locus_tag="GYMC61_0257"
FT   CDS_pept        complement(261051..261203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76955"
FT                   /inference="similar to AA sequence:KEGG:GK2386"
FT                   /protein_id="ACX76955.1"
FT                   /translation="MQPLKISLETAQKLAKALGVPIEQIMHMPPHILVNKLLELEKKEK
FT                   ENDPS"
FT   gene            261312..262040
FT                   /locus_tag="GYMC61_0258"
FT   CDS_pept        261312..262040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0258"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: gka:GK2385 glycerophosphodiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76956"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACX76956.1"
FT                   /translation="MTLIFAHRGAAGTHPENTMAAFIEAEKAGADGIELDVQLTKDGEV
FT                   VVIHDETVDRTTDGSGWVKDITYRELRRLNAAAMWDGKHGHCPIPHLEEVLAWLSSTRM
FT                   AVNIELKNSLIAYETLEQKTISLVRRYGLEKRTILSSFNHHSMRLCRTLAPEIETALLY
FT                   IEPLYDPWTYVRAMNADGVHPHYRTVTAEFAAEARRRGVAVRPFTVNKRNVMKTMFAYG
FT                   VDAVFTDYPRQAKQWKEKTP"
FT   gene            complement(262116..262364)
FT                   /locus_tag="GYMC61_0259"
FT   CDS_pept        complement(262116..262364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76957"
FT                   /inference="similar to AA sequence:KEGG:GK2384"
FT                   /protein_id="ACX76957.1"
FT                   /translation="MGRMIALLILVIPGLSAALGIKWMRDALFGINGPLFSALWLQFLA
FT                   GLALFAAGLAFLGGFLLHRDRKRNKVQARFQRKRKTP"
FT   gene            262504..264567
FT                   /locus_tag="GYMC61_0260"
FT   CDS_pept        262504..264567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0260"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: gka:GK2383 sigma-L-dependent transcriptional
FT                   regulator; TIGRFAM: PAS sensor protein; PFAM: sigma-54
FT                   factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; PAS fold-4 domain protein; PAS
FT                   fold domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76958"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACX76958.1"
FT                   /translation="MKKVMLIGADSRGTSLLKLLHGASGFEVVAVVDVDEHAPGLQLAR
FT                   RWGIAAASDWRPWMAKPLDLIIETTGRADVLEEIRRRAPEGANIVPSAVARMMAELVAE
FT                   KEALIAELKSEAARRALIFHSSHDGMIVVDEYAYITDMNQSAAELLGVDKDEVIGKHIL
FT                   DVLPSSGLPRVLKTRQTEFHQEVELANGKKLITTRIPIIDDNGKLFGALAVFKDITELV
FT                   ALAEEITDLKEVRMMLEAIIYSSEEAISVVDENGNGILINPAYTRLTGLTEEDVIGKPA
FT                   TADIAEGESMHMQVLKTRRPVRGARMKVGPKNRDVIVNVAPIIVDGVLKGSVGVIHDVS
FT                   EIQRLTAELNRARQIIRTLEAKYSFADIVGESEEMKVAIEQAKLAAKTPATILLRGESG
FT                   TGKELFAHAIHNASDRKYNKFIRVNCAAIPETLLESELFGYEEGAFSGARRGGKRGLFE
FT                   EANNGSIFLDEIGELSASTQAKLLRVLQEREIVRVGGTKPIPINVRVIAATNVNLEKAI
FT                   AEGAFREDLYYRLNRMPIYIPPLRARKEDIPALCRHLIQKLNQDYGRNVEGVTDEAMAK
FT                   LLAYDWPGNVRELENVLGRAMIFMKFHEVMIDATHLPPLASPSSVPAHRVETEEEIRPL
FT                   EEMVSRYEASLIEQALRRHRGNKTAAARALGISVRNLYYKLEKYNLDKKIMQ"
FT   gene            264706..265608
FT                   /locus_tag="GYMC61_0261"
FT   CDS_pept        264706..265608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0261"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="KEGG: gka:GK2382 phosphate butyryltransferase;
FT                   TIGRFAM: phosphate butyryltransferase; PFAM: phosphate
FT                   acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76959"
FT                   /inference="protein motif:TFAM:TIGR02706"
FT                   /protein_id="ACX76959.1"
FT                   /translation="MMKLESLVEEARQCQDRTVAVAAAEDEEVIEAVAMALEHRLGRFV
FT                   LYGDRERLGRLLKEKGCARFSDVDVVHANSIGQAAELAVRAVHLNEADALMKGHVPTAM
FT                   LLKAVLNKEYGLRTGKVLSHVAVFEVPEFDRFVIVTDAAMNIAPDLEQKVQIVNNAVSI
FT                   ARSIGIERPKVAALAAVETVNPAMPATVDAAALAMMQKRGQIEHCLLDGPLALDNAVSL
FT                   AAAKHKRIESEVAGQADILLVPDIESGNMLYKSLVYFANARVGAVIAGAKAPIVLTSRA
FT                   DSAESKLYSLALAICSAAK"
FT   gene            265633..266736
FT                   /locus_tag="GYMC61_0262"
FT   CDS_pept        265633..266736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0262"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   gka:GK2381 leucine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76960"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACX76960.1"
FT                   /translation="MELFQYMEKYDYEQVLFCQDKESGLKAIIVIHDTTLGPALGGTRM
FT                   WMYNSEEEALEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRAFGRFIQ
FT                   GLNGRYITAEDVGTTVADMDIIYQETDYVTGISPEFGSSGNPSPATAYGVYRGMKAAAK
FT                   EAFGSDSLEGKVVAVQGVGNVAYHLCRHLHEEGAKLIVTDINKEAVARAVEEFGAKAVD
FT                   PNDIYGVECDIFAPCALGGIINDQTIPQLKAKVIAGSANNQLKEPRHGDMIHEMGIVYA
FT                   PDYVINAGGVINVADELYGYNRERAMKKIEQIYDNIEKVFAIAKRDNIPTYVAADRMAE
FT                   ERIETMRKARSQFLQNGHHILSRRRAR"
FT   gene            266792..267904
FT                   /locus_tag="GYMC61_0263"
FT   CDS_pept        266792..267904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0263"
FT                   /product="butyrate kinase"
FT                   /note="TIGRFAM: butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: gka:GK2380 butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76961"
FT                   /inference="protein motif:TFAM:TIGR02707"
FT                   /protein_id="ACX76961.1"
FT                   /translation="MEEQKFRILTINPGSTSTKIGVFENERPLLEKTIRHEADVLRQYK
FT                   TIADQYEFRKQTILQALDEEGINLSKLSAVCGRGGLLRPIEGGTYRVNEAMLEDLRRGY
FT                   SGQHASNLGGILAHEIASALNIPAFIVDPVVVDELDPIARISGFPLIERRSIFHALNQK
FT                   AVARRVARQLGKRYDELNLIVAHMGGGITVGAHKQGRVVDVNNGLDGEGPFSPERAGTV
FT                   PAGDLVALCFSGEYYREEIMNMLVGGGGLVGYLGTNDAVKVEKMIEAGDEKAKLVYEAM
FT                   AYQVAKEIGAASAVLSGKVDAIILTGGLAYGKSFVEQITRRVQWIADVIVHPGENELQA
FT                   LAEGALRVLRGEEEEKVYPGEAVSPVPARR"
FT   gene            267935..269356
FT                   /locus_tag="GYMC61_0264"
FT   CDS_pept        267935..269356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0264"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; KEGG:
FT                   gka:GK2379 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76962"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ACX76962.1"
FT                   /translation="MAKEYDVVILGGGTGGYVAAIRASQLGLKTAVVEKGKLGGTCLHA
FT                   GCIPSKALLRSAEVYAQTKNGEAFGVIADGVRLDFAKVQARKAAIVEQLHKGVQHLMKK
FT                   GKIDVYAGTGRLLGPSIFSPLPGTVSVEMNDGSENEMLVPKFVVIATGSRPRTLPGLEP
FT                   DGEFVMTSDEALQMETLPSSILIVGGGVIGMEWASMLNDFGVDVTVLEYADRILPTEDE
FT                   DVSKEMEKLLRRRGVNIVTGARVLAETLEKGNGVVIQAEHQGERKTFAADKMLVSVGRQ
FT                   ANIEGIGLENTEIVVEKGYIQTNEFGQTKESHIYAIGDVIGGLQLAHVAAHEGIVAIEH
FT                   LAGHNPAPIDYTMVPRCIYTRPEAAAVGLTEQEAKAKGYDVKVGKFPFKAIGKALVFGE
FT                   AEGFVKLIADRNTDDLLGVHMVGPHVTDLISEAGLARVLDAAPWEVAHAIHPHPTLSEA
FT                   MAEAALAVDGKAIHF"
FT   gene            269426..270421
FT                   /locus_tag="GYMC61_0265"
FT   CDS_pept        269426..270421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0265"
FT                   /product="3-methyl-2-oxobutanoate dehydrogenase
FT                   (2-methylpropanoyl-transferring)"
FT                   /EC_number="1.2.4.4"
FT                   /note="PFAM: dehydrogenase E1 component; KEGG: gka:GK2378
FT                   branched-chain alpha-keto acid dehydrogenase E1 component
FT                   alpha chain (2-oxoisovalerate dehydrogenase alpha subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76963"
FT                   /inference="protein motif:PRIAM:1.2.4.4"
FT                   /protein_id="ACX76963.1"
FT                   /translation="MAQNRHQALGLSDDTVLEMYETMLLARKLDERMWLLNRAGKIPFV
FT                   ISCQGQEAAQVGAAFALDRTKDYVLPYYRDVGVVLTFGMTPRELMLAAFAKAEDPNSGG
FT                   RQMPGHFGKKKNRIVTGSSPVTTQVPHAVGFALAAKMEKKDFVAFVTFGEGSSNQGDFH
FT                   EGANFAGVHKLPVIFMCENNKYAISVPISKQLACEKVSDRAIGYGMPGYTVDGTDPLEV
FT                   YRVVKEAADRARRGEGPTLIEAVTYRLTSHSSDDDHRVYRTEEELAEARAKDPIVSFAN
FT                   YLKETGVLTDEQDEEIQARVMKEVNEATDYAEKAPYAEPEHALRYVYAEE"
FT   gene            270435..271418
FT                   /locus_tag="GYMC61_0266"
FT   CDS_pept        270435..271418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0266"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: gka:GK2377 branched-chain alpha-keto
FT                   acid dehydrogenase E1 component beta chain
FT                   (2-oxoisovalerate dehydrogenase beta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76964"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACX76964.1"
FT                   /translation="MPVISYIDAVTMAIREEMERDPRVFVLGEDVGRKGGVFKATQGLY
FT                   EQFGEERVIDTPLSESAIVGVGIGAAMYGLRPIAEIQFADFIMPAVNQIISEAARIRYR
FT                   SNNDWNCPIVIRAPYGGGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDVKGLLKAAIR
FT                   DEDPVLFFEHKRAYRLIKGEVPEDDYVLPIGKADVKREGDDITVITYGLCVHFALQAAE
FT                   RVAQDGISVHLLDLRTVYPLDKEAIIEAASKTGKVLLITEDNKEGSVMSEVAAIIAEHC
FT                   LFDLDAPIMRLAGPDVPAMPYAPTMEKFFMINPEKVEKAMRELAAF"
FT   gene            271456..272799
FT                   /locus_tag="GYMC61_0267"
FT   CDS_pept        271456..272799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0267"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; KEGG:
FT                   gka:GK2376 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76965"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACX76965.1"
FT                   /translation="MAIEQLTMPQLGESVTEGTISKWLVSPGDKVNKYDPIAEVITDKV
FT                   SAEIPSSFAGVIRELIAKEGETLPVGAPICTIEVEGAAPAPEAKPADEAPKAEDNAEPA
FT                   APKQVGRANNGRYSPAVLRLAQEHGIDLEQVKGTGLGGRVTRKDLLKLIESGQIPKAEA
FT                   APAAEQAAPKAEPRAEQPAPAAAAAQLSAAAAPTAPQAAPIKPAAPNVEAGAGDIEIPV
FT                   TPVRKAIAANMLRSKHEAPHAWTMVEVDVTDLVAYRDAIKDEFKRREGFNLTYFAFFVK
FT                   AVAQALKEFPQLNSTWAGDKIIQRKDINISIAVATDDALFVPVIKHADEKTIKGIAREI
FT                   AELAAKTRAGKLRPEDMQGGTFTVNNTGAFGSVQSMGIINYPQAAILQVETIVKRPVVK
FT                   DGMIAIRDMVNLCLSLDHRVLDGLICGRFLARVKAILENMNKDNTPIY"
FT   gene            272848..274018
FT                   /pseudo
FT                   /locus_tag="GYMC61_0268"
FT                   /product="hypothetical protein"
FT   gene            274369..275196
FT                   /locus_tag="GYMC61_0269"
FT   CDS_pept        274369..275196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76966"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76966.1"
FT                   /translation="MKKLKFHLFSLVLLFSLFFFNDFSSAKEVDNISKSEKLTKQERKY
FT                   LKDVTGHTEEEIDMLPLEVAKQLIKDKAVIQDSKTEIFSFENGVNNSGDFTTMGTISSS
FT                   TMKLWGTVYKVTSDRTNYDKFYIYGNFQWLKSPFYELVDKMTFGFPSSAGFFLPTSNGK
FT                   VTQHQHRYSQDPQGNGNWIDYAIDYLPSDWEPNAGVAGEFDLRSSTEFTLHKGYMGQYV
FT                   YVPTKNNGTINIKIEYGHQLYIGEPSVSVFPAGLSITPSKSVDTASYALTLSY"
FT   gene            275747..275926
FT                   /locus_tag="GYMC61_0270"
FT   CDS_pept        275747..275926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76967"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76967.1"
FT                   /translation="MEYIYLLILPIIGVLWFLNLASFLKNLNSDENTLNQTMIGAVLTF
FT                   LFVFLYMYGFLGTH"
FT   gene            complement(276434..277318)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0271"
FT                   /product="hypothetical protein"
FT   gene            277324..278022
FT                   /pseudo
FT                   /locus_tag="GYMC61_0272"
FT                   /product="hypothetical protein"
FT   gene            278305..279282
FT                   /locus_tag="GYMC61_0273"
FT   CDS_pept        278305..279282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76968"
FT                   /inference="similar to AA sequence:KEGG:GK2375"
FT                   /protein_id="ACX76968.1"
FT                   /translation="MKRASVWMLLCLFFMLSGCANPSFPPVADSLSVVISLDVKAETVT
FT                   FLNAKNGSKIARWNINEPFQGGALSPDGRTLLLYGRDLDRVYRYDLAGGKPLSEWKTGN
FT                   GIVSAAPSPDGRTWFFGDSTHHAVRVVSRGGKEIARLSVGRSPMTLLVNRQGTELYAID
FT                   FQDGRAFVIDASRLRVIRSFSVPKFALGGLMREQEGELWVGGHGSGNKVEKNVHVYSLQ
FT                   DGRLLRTMAAPIMPVDFVETGRGVFVLSHGSNTVYQFLPSGKRLNSVLVGANPFAMEAA
FT                   GSRLYIASYDSDEIIVVDEATLRPLARWKTGDGPLQLFIREGRT"
FT   gene            279279..279953
FT                   /locus_tag="GYMC61_0274"
FT   CDS_pept        279279..279953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0274"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gka:GK2374 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76969"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX76969.1"
FT                   /translation="MSERTVLIVDDEEEMRLLVGMYLENAGFRCLEAGDGEEALVLLSQ
FT                   HPVDAVLLDVMMPKQDGFAVCARIREQSDVPILFLTALGEEWDKVKGLKLGGDDYIVKP
FT                   FSPGELIARLEAVLRRVQRVRENDGRLQFGDLAIDEKGRTVTVGGKPVKLTLKEFELLL
FT                   FLAKHRGQVFSRDDLLVKVWGYDYTGNARTVDTHVKTLRMKLKDAARHIQTVWGIGYKF
FT                   EG"
FT   gene            279956..281362
FT                   /locus_tag="GYMC61_0275"
FT   CDS_pept        279956..281362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0275"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gka:GK2373 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76970"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX76970.1"
FT                   /translation="MKRLRLGQKLWLSIGAAVVVTLAFSFGLLNYFYRTVYMKEVERTL
FT                   IAEGTSLARDYRGGAVTEAYRRQIEWYDEKSTATILLIDNPRELSACFPFPVHYDALVS
FT                   GRDRETLLAGKPVVKTGYEKRFGRRVMAVVVPLLDGKRLEGAIYLYLPLADVQEATKRA
FT                   AATFWPLAAIFAAALLVVGRRMVRQMTEPLQAMEQAAERMAEGRYEADIPVRSDDEIGR
FT                   LAEAFNQMADAIAKEDERKREFLANVSHELRTPLSYMKGYSEALLAGLAKTKEEEKAYL
FT                   RLIHRETERMERLVRDLLDLARLEGQSVPLERAPVAFAQVIEDVIATYEPIAAQKRIEL
FT                   ACELDYDIIVNGDANRLEQVVRNLLDNAIRYTPEGGVVTVRLSRLSEAEGELVIQDTGK
FT                   GIPKDQLPFLGQRFFRVDRARTRKEGGTGLGLAIVKQIVSLHDGAIRFDSDLGRGMTVF
FT                   VRLPLVREEE"
FT   gene            281390..282013
FT                   /locus_tag="GYMC61_0276"
FT   CDS_pept        281390..282013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0276"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   gka:GK2372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76971"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ACX76971.1"
FT                   /translation="MYNQYKIRRQVEDMGSPEKEQAPMTYKEYATWPEGKRCEVLDGNI
FT                   ISMAPSPTPEHQSVSLQLSIEFGMHLRGKDCRVLAAPIDVYLFEDHRKGWMDENVRNWV
FT                   CPDLVVICDKNKIQKNRIVGAPDLVVEILSPATAKIDRMDKRIAYERAGVKEYWIVDPA
FT                   NQVVEVYLRGKTGRLELHGVYNRDDAVLVHVLKDFVIDLRNIFQ"
FT   gene            complement(282108..282242)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0277"
FT                   /product="hypothetical protein"
FT   gene            282429..284477
FT                   /locus_tag="GYMC61_0278"
FT   CDS_pept        282429..284477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0278"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: gka:GK2371 methylmalonyl-CoA mutase small
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76972"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACX76972.1"
FT                   /translation="MSDVAKMKEAAFPAPTVEEWEREAEKSLKGKPLERLVSMTYENIA
FT                   VKPLYTRRDVEALGPLEQYPGFGRYVRGARPEGYRGEPWKVSQEISAASPSDWNEAVKH
FT                   DLERGQTEIHLALGRLPFAVESVDDVAAMFDGVPLDRYSLRVDAGARSLSFLALLAAYL
FT                   EERGVPLSSVRGAIGMDPLGAWAEQGTLPCSLLRLYDEMAEATKWAKEQMPAVRTILVR
FT                   GEPYHNGGANAVQELAFALAAAVEYIRAGLDRGLTVDDIATRMQASFAVGADFFMEIAK
FT                   LRAARRLFAQVIEAFGGGESARRIELHVRTSPFTKTVYDPYVNMLRAAAEAFAAVVGGA
FT                   DGVHVSPFDEAIGLADEFSRRIARNTQLILLEEAHVANVIDPAGGSYYVETLTAKLAEE
FT                   AWKLFQRVEEKGGMAKALEDGFVQTEVEAVAKRRLDRVKTRKEKIVGTNVYANLEETPV
FT                   EKPKQDAANVAPPLDEKRVAEIRSALVGGKWMEAAIRAARRRATAREIAAALADGNASV
FT                   RIAPIHAWRLAEPFEQLRKAAEEYAERTGSRLSVHLINIGPLVRHQARADFIAGLFAAG
FT                   GVAAERSDGFASVAEAVEWVRNTNGTHYIVCGADDDYPAFVPALAEAFKQAKPNAKLYV
FT                   AGKPPEELERTYADAGVDGSIHLGSNAYDVIVAFLTERGVALDGEVR"
FT   gene            284461..286656
FT                   /locus_tag="GYMC61_0279"
FT   CDS_pept        284461..286656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0279"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein; KEGG: gka:GK2370 methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76973"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACX76973.1"
FT                   /translation="MAKYVDFTNMTLSAIAADVDEKQWRDAVERRVQASIDELLFQTNE
FT                   HIAVKPLYTKEDIDGLDFLDYMPGLPPYLRGPYPTMYVVRPWTIRQYAGFSTAEESNAF
FT                   YRRNLAMGQKGLSVAFDLATHRGYDSDHPRVVGDVGKAGVAIDSVLDMKILFDGIPLDQ
FT                   MSVSMTMNGAVLPIMAFYIVTAEEQGVTQDKLSGTIQNDILKEYMVRNTYIYPPEMSMR
FT                   IIADIFAYTAKYMPKFNSISISGYHMQEAGAPADLELAYTLADGLEYVRTGLKAGIDID
FT                   SFAPRLSFFWAIGMNYFMEVAKLRAARLMWAKMMKTFNPKNPKSLALRTHSQTSGWSLT
FT                   EQDPFNNVVRTLIEAHAAAMGHTQSLHTNALDEAIALPTDFSARIARNTQLYLQEETGI
FT                   CRTIDPWAGSYYVETLTNELMKRAWAHIEEIESLGGMAKAIETGIPKMRIEEAAARRQA
FT                   RIDSGAETIIGVNKYRPEKEEPIDILEVDNTAVRQRQIERLNVLKATRDNEQVEAALDA
FT                   ITKAAETGEGNLLELAVQAARVRATLGEISYAIEKVANRHRAAIRSISGVYSSEYKNEA
FT                   QLERVKRRVEQFAELEGRRPRILIAKMGQDGHDRGAKVIATAFADLGFDVDIGPLFQTP
FT                   EETARQAVENDVHAVGISSLAGGHKTLVPQLVEELGKLGRDDILVVVGGVIPPQDYAFL
FT                   YEHGAAAIFGPGTVIPEAAEKVLDEIYARLGYEEVNQ"
FT   gene            286653..287801
FT                   /locus_tag="GYMC61_0280"
FT   CDS_pept        286653..287801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0280"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="TIGRFAM: LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; KEGG: gka:GK2369 arginine/ornithine transport
FT                   system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76974"
FT                   /inference="protein motif:TFAM:TIGR00750"
FT                   /protein_id="ACX76974.1"
FT                   /translation="MNGEEKRREQASGQSAVSDGQPRRPEWADGNGLSSYVQAERPPAP
FT                   KRLVRRKERSVKEYVQGVLAGDRTILAQAITLVESNAARHMDLAQQVLNELLPHVGRSI
FT                   RIGITGVPGAGKSTFIEAFGTFLCEQGHRVAVLAVDPTSSLTGGSILGDKTRMEALARN
FT                   PLAFIRPSPSGGALGGVHRKTRETMMLCEAAGYDIILVETVGVGQSEFVVRGMVDFFLL
FT                   LALTGAGDELQGMKRGIMELVDAIVINKADGDNKEKAKAAQKEYNQFLHYLRPATPGWE
FT                   TKAYTCSALLGEGIADMWRVIQTFVETTKRSGVFFDRRRQQQKDWMHAMIKEYIETRFF
FT                   ADPIVKEKLPMLENSVISGAKPVTAAVRELIEAYERKRGGEL"
FT   gene            287834..288271
FT                   /locus_tag="GYMC61_0281"
FT   CDS_pept        287834..288271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0281"
FT                   /product="protein of unknown function DUF1094"
FT                   /note="PFAM: protein of unknown function DUF1094; KEGG:
FT                   gka:GK2368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76975"
FT                   /inference="protein motif:PFAM:PF06491"
FT                   /protein_id="ACX76975.1"
FT                   /translation="MFQFQFPLYNDIVEQARREAVEAGFEELRTPEDVDAAFRRPGTTL
FT                   VLINSVCGCAGGIARPAAAHAVHYDKRPDHLVTVFAGQDKEATARAREYFVGEPPSSPS
FT                   FALLKDGKLCAMLHRHDIEGNEPVAVVQKLQALFDEYCEEV"
FT   gene            288323..288508
FT                   /pseudo
FT                   /locus_tag="GYMC61_0282"
FT                   /product="hypothetical protein"
FT   gene            288512..289258
FT                   /locus_tag="GYMC61_0283"
FT   CDS_pept        288512..289258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0283"
FT                   /product="HIRAN"
FT                   /note="PFAM: HIRAN; KEGG: gka:GK2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76976"
FT                   /inference="protein motif:PFAM:PF08797"
FT                   /protein_id="ACX76976.1"
FT                   /translation="MRPFVLWLIWQNECTRQRYHIGNLLHDGDKYVFYYERSRKRRGLF
FT                   EALENGYQPHLSFPDIGKKYVSNRLFGPFERRLPDRRRPDFLEILRTYGLPRDCTDMDM
FT                   LRATGGKLATDSYEFVAPIYVSGNHFDFDFYVAGWRYYEGDQVVQHLKVGDEVHFRLEP
FT                   ENRQDSKAVEVLTDEGCKLGYIPAFYSEFMFNLIQNNGRYMARIESIHVEAFPQRKVNI
FT                   SVYGELLPSCQTQDLDMLHEISLEVI"
FT   gene            289363..289662
FT                   /locus_tag="GYMC61_0284"
FT   CDS_pept        289363..289662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0284"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: afl:Aflv_1199 predicted nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76977"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACX76977.1"
FT                   /translation="MTYGMSPVVFKRLMAYFAGEKDIQKVVLFGSRARGTARYNSDIDL
FT                   CVDYTGKQKWKIKEDIDEIVGIYSCDVLFFDALNEAIRREIERDGKTIYEKSPS"
FT   gene            289905..291809
FT                   /locus_tag="GYMC61_0285"
FT   CDS_pept        289905..291809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0285"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; restriction modification
FT                   system DNA specificity domain; KEGG: gwc:GWCH70_3440 N-6
FT                   DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76978"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACX76978.1"
FT                   /translation="MVYERELSHFMDKLRSEANISVIDSVQTIASIASVKFLELDKERY
FT                   SLPDELSLGVILKEGAFLAEKVKAVLNEIEAHVPFLKGVYEFSDLFGRLSNNTLYHLLS
FT                   RIHSFAFTKEQWKQWIESLFVYAGNMAGVEGVELITPAGVNELGIRLLNMEGGEFYDGA
FT                   SGLSGTLCAASEYARRHHCEVALYGQEINQRAWALGKLRLLFHDRTDARLAKGDTLTEP
FT                   AFVEGNKLKKFDYIMMNFPFGMRINSYEQLMNDRYDRFVYGRLPRTSADMAFILHALSS
FT                   LKENGKAVLVVTNGTLFRGGPEAVIREHLLAADLIESVIALPSSLLDGAAIQINLLVLN
FT                   KNKSAEREGNILFINAENYYGERRRGRRYLRQEDIERIVAIYHEGLEIDEVSKFVSVRE
FT                   IEEANLLSNRYLQSSEWTIEPYGKVKFYHDHIKNLPCVQPLKRIGTFYRGINISAKDAE
FT                   TENGPYKVIKLSDVQNGEVLIDQLASYEITNNAKIESYLVQEGDVIISVRGAGIKIAVI
FT                   PPHEGDILISHNFIGIRPHRHVDPFYLKIFLESPVGQYLLLSKQAGTNVTILNMKDLEN
FT                   IPIPVRPFEEQKEIIMSYLEEQKHIQDMMKQLEKQRLESSLKLYEKMGIRSTFTLMQS"
FT   gene            291973..293466
FT                   /locus_tag="GYMC61_0286"
FT   CDS_pept        291973..293466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0286"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: gwc:GWCH70_1644 N-6
FT                   DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76979"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ACX76979.1"
FT                   /translation="MATIGFEEKLWSAADKLRNNMDAAEYKHVVLGLIFLKYVSDTFQE
FT                   KWEELMKEDPDFAEDRDAYMADGVFWVPETARWSYIAERSKSPEIGKIVDEALDAIEKE
FT                   NDSLKGVLPKNYSRPELDKRILGEIIDLFSNIDVGGSGAKEKDVLGRVYEYFLGKFAAS
FT                   EGKGGGEFYTPKCVVKLMVEMIQPFKGYVYDPACGSGGMFVQSMKFVEEHAGNKFDISI
FT                   YGQESNPTTWKLAKMNLAIRGIENNLGPKHADTFHEDLHPTLKADYILANPPFNDSDWG
FT                   QPKLIDDPRWKFGIPPAGNANYAWLQHMIDKLSQNGKAAVVLANGSLSSMTSGEGEIRK
FT                   NIVNADLVDAIIALPDKLFYTTQIPVCIWILNRNKKHPRKTLFIDARKFGQLVTRKLRE
FT                   LTDEDIRKIADTYINWQNNENYEDVQGFCKSATIDDIREHNYILTPGRYVGIEEEEEDG
FT                   ESFEEKMERLTATLAKQFQKSRQLEEEIRKQLGGIGYEI"
FT   gene            293456..294745
FT                   /locus_tag="GYMC61_0287"
FT   CDS_pept        293456..294745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0287"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: vei:Veis_3010 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76980"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ACX76980.1"
FT                   /translation="MRYDGWKETRLIDVIDINPRTPLRKGTLAKKVSMQDVAEFTRKIQ
FT                   SYEIAEFTSGSKFKNGDTLLARITPCLENGKTAYVDILEDNEIAFGSTEFIVLRAKEGI
FT                   TDSKFVYYLAISPEFRNVAIKSMTGSSGRQRVQSDVLANTVICLPPLQEQKRIANLLSA
FT                   IDDKIELNNEMNKTLEELAQTIFKRWFVDFEFPNENGEPYKSSGGKFVESELGMIPEGW
FT                   RVATIGDLGDVVGGGTPSKKREDYFTQNGIPWITPKDLSNSKNRYVERGSVDITEEGLK
FT                   NSSAKLLPKGTVLFSSRAPIGYIAIAKNEVTTNQGFKSVIPHKDIGSEFVFQVLKYNKD
FT                   LIESRASGTTFKEISGGELKKVPIVLPKMEVIQRYNEAVRSLGKLICNNEEEINALISM
FT                   RDSLLPKLMSGEIRVVDAEREVEVCLQKSS"
FT   gene            294724..297735
FT                   /locus_tag="GYMC61_0288"
FT   CDS_pept        294724..297735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0288"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: gwc:GWCH70_1642 type I site-specific
FT                   deoxyribonuclease, HsdR family; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family; PFAM: protein
FT                   of unknown function DUF450; helicase domain protein; type
FT                   III restriction protein res subunit; SMART: DEAD-like
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76981"
FT                   /inference="protein motif:TFAM:TIGR00348"
FT                   /protein_id="ACX76981.1"
FT                   /translation="MFTEEQLEQAVIEYFQELGYPYMPAKELKRDKKDVLLLDRLEEAL
FT                   VKLNPEVPVEIIREVMRKIHYFETNDVLTNNKMFHKYLTEAVVVPELVNGETVYHHVRL
FT                   IDWETPENNDFLVVNQLEVIEKGQEKIPDIVLYVNGLPLVIAELKSTSREEVDIEDAYK
FT                   QLKNYMNVHIPSLFYYNAFLVISDGVQARAGTITAPLDRFMAWKKINIEDDVIENRELE
FT                   TLIFGLFEPKRFLDVIKNFTLFANEAKIMAAYHQYYGMKKAVASTIQAIHTDKRAGVIW
FT                   HTQGSGKSYSMVFLAGNLVRQEQLKNPTIVVITDRNDLDGQLFETFCGASEFLRQTPLQ
FT                   AETRSHLKELLEHRQTGGIVFSTIQKFEEETGLLSERENIIVMVDEAHRSQYGVDPKYD
FT                   IETGEQKYGYAKYLREALPNATYIAFTGTPIETTDRSTTGLFGDVIDVYDMTQAVEDGA
FT                   TVKIYYESRLAKVKLDEKKMNEIDQEYWRMQVHEGVGDYIIEQSQKSLSRMEQIIGDQD
FT                   RIREVVTDIIHHYEEREHLVKGKAMIIAYSRNTAFAMYKEIMRQRPDWKDKVKIVMTEN
FT                   NQDPEELAKLVGNKQTRKQREKEFKDVDHPFKIVIVVDMWLTGFDVPALDTMYIDKPMK
FT                   AHNLMQAIARVNRVYPGKTGGLIVDYIGLKKNLMEALQTYTKRDQDKVQENTQARDIAL
FT                   NILEVLRNMFHSFDYRAFFGDSDKKRYEVIRDGAEFVQQTEKRKLLFMTETKKLKDVYK
FT                   ICTGLLSKEQKEEISYFIAVRSFIMKSSRTGTPDLKEVNERIAKMLEEAILEDEVMVLT
FT                   QAVSSESFDLLNEENIKKLRALPQKNIASTILMRVLKQKLQDVKKTNMTVSQTFSKRFE
FT                   KILEKYNNRNDYTDVYEVFEELLKFKEELQAAIEEGKQLGLTEEEKAFFDVLGSDPDIK
FT                   KLMEDEVLIQIAKDLAKTVKENRTHDWDKKAQAQARMRLEIKKVLRKYDYPPNKQPKAV
FT                   EDVLEQAKLQCMNM"
FT   gene            297925..298110
FT                   /locus_tag="GYMC61_0289"
FT   CDS_pept        297925..298110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76982"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76982.1"
FT                   /translation="MRKTHISMGLSIRVHAAAREYLKQKEGCSPLTFVTNAGKGLNDAN
FT                   FMFNVCQVHPIFMIIQ"
FT   gene            298110..299408
FT                   /locus_tag="GYMC61_0290"
FT   CDS_pept        298110..299408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76983"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76983.1"
FT                   /translation="MISRPFITFEPLERDWELFITFPYLTPSQVMQCDVHHLHFKIKCN
FT                   EMNSFISSAQLWPNSSENKLWIVPKQSYSFSFATRKDEECYEKLGLFWPEYIKGFQNHT
FT                   YLFRPINQSFCMIEPRELSLSDTFYMMSRKKIEFPREMDVTPLNQKYGWFAYKIRLPFL
FT                   LAEPLIEWFRQFGYDLKPPYYYLDIVVPSIFGRKGEAMLIGTGKCRIQISFRDFQPQKY
FT                   SLVHIQPDYTSREYPLSSSYVDIILHKKGFHTFYIKKHEGKMLHLFYDPNANPYFSERL
FT                   ESGVVVDQRTLALCEEKSILKYTTVSVTDPLLFPYWIKEKNRFARELSQGGEFFHPSVE
FT                   KLFIPGVWAFDFSAQEMCDLAHPDWRKVLLAYMQLEQTKCCWISNEQYRFLEFLLQDVG
FT                   DKMLRAKLAYYVKTYRNKVPKIVKEFIDGRRSS"
FT   gene            299405..301387
FT                   /locus_tag="GYMC61_0291"
FT   CDS_pept        299405..301387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Golgin subfamily A member 6 (Golgin
FT                   linked to PML) (Golgin-like protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76984"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76984.1"
FT                   /translation="MKTIFGIVEKERKPNKKYVFVKVLAEYRDHQLIEVQEARLHYPSE
FT                   GEVIWSPAPEDIHAGKVGFYTVEERNEEEYTGRPVYSKFIVRKELENLKYYEVFPIPFS
FT                   LAQNHDIVYLIQNGFDAPQQFSSEILLLTNDDYLVGPYRVKQTKEQKWVIDSSDDKLLE
FT                   IRKKGMHLVKYNDKNVGIERYFVSAMLASPVEDYLDCATNARIMRYALKTLKDQQQVQE
FT                   ISRKVISQLSELVSDLPPQVRYERIMQAIELLDKYQITKEDIGQFEEELLQYPVIQRKI
FT                   EVELEERFAAEKARIEDEHRKVLNETEQLRRKKEHLLVEMEEIERQIKEREERLKKADK
FT                   ALELKIKEMKDNIFQTLADLLPFMNLGLNVSVHNASDDRNHSEWVVKDVDETTVYYEDI
FT                   NHLMTSIAENLCMIGMQENKAWLTAKTIIGAILFRKPVVVKGEFSFELSQAIGWAVAGN
FT                   DHLTVFPDIRNFTNKTLINSFSCYTRPDCVKSLHLCQIENSPAELYLQSFLDHWRVSID
FT                   ESLPELILISIKEESELTDSFIQKLSFSPVISANEMITTPDIRLLRKTHRLVFGSIPAR
FT                   LLVEGKILKEKSSEFNNFVEIVQEVMSFTKQKEAFKKWFRLLEDERFEEEAVSVWVVKV
FT                   LLQPYVAREQAKKILEEFDSENILI"
FT   gene            301409..302362
FT                   /locus_tag="GYMC61_0292"
FT   CDS_pept        301409..302362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76985"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76985.1"
FT                   /translation="MLIDAWENIIIQFRQIKRHVLSLVHFYAFEDYKMNPVHFQRLIPP
FT                   LQRLLKGRFFEDLRNVMKEEDQTEAQSLLELLSGLGEILKLANGYYLPLPPRCVELPVS
FT                   KSLVVLSNPEGKSDKYYGCGNGYMEEGSHVPTLMIDEWMPSPTVNEFIETLKLQNPVKL
FT                   NDEPTELFLPQKRRKWHPFQMNLASKSDCYIARYALKNSQPLYFWVENMGRGDARYYKI
FT                   PEYYLETAKYALEYKAQVKTTIKCAKIREDVIYVRLFKKFPVFEQKMAMLFCFPLSFIK
FT                   PIEWIVPLWHYSDFIWVLRRLGIDEDSIRWEGVEMG"
FT   gene            302359..307722
FT                   /locus_tag="GYMC61_0293"
FT   CDS_pept        302359..307722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0293"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; Protein
FT                   of unknown function DUF1998; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   cpy:Cphy_0588 DEAD/DEAH box helicase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76986"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACX76986.1"
FT                   /translation="MMEFTINSVSARLHQKLREYIEAQYPISHPSLLLERRELLDSPGV
FT                   ISKEPYIEATPVYELGPAYEQMNLPAHCKEAMTYFSELSPSVGIYKRPYVHQQEALESF
FT                   LVDGHDLVVATGTGSGKTESFLHPILNSLIDEGFNRREQFQTHAVRALILYPMNALVSD
FT                   QITRLRQLFGDERVSKYFRDHFGRHPLFGMYTSRTPYPGERTKEKDDYQLKEIIDYYLD
FT                   IEKHRPQLALEMKKRGKWIAKNLTNFRSGKKGDWKSRYLTSPDDRELFTRHEMQTTPPD
FT                   ILVTNYSMLEYMLMRPIERPIWEKTRQWLAEDEANTLILVLDEAHMYRGTSGAEVALLI
FT                   RRLQARLGITRDRLRCILTSASLGAEDDNSAAIEFAEQLTGKLKKRSFKLIKGVKEKRK
FT                   PGRIGTTEEAYAFALLDSEQFTNRIHQYDTLRSNLQAVAKRLGWGDVPHNLDELPSYLY
FT                   KSLDGFGPLELIIEQISGNAKKFSDIAKLVFPSVDMKVAQKATSHLLMLANAAKDNERV
FT                   LLPVRIHLFFKGVSGIYVCTNPKCEEKRVKGNDSILGKMYDSPKLQCTCSKEARVYELL
FT                   THRKCGTAFIRGYISKKDGNYLWAEKGKGIVGEELTEIHLLVEPPHEKIQKGERSVRPV
FT                   WLDIRTGYLMKSPPEDPEGYLKLYLPHDEANKNKKKKQTITFQQCPCCMRKVQGTITDL
FT                   KTKGEQPFANLVREQFLLQPPVKLNKQLPNEGRKVLLFSDGRQKAARLARDIPHEVELD
FT                   SFRQSILLAAQKLIDQDIEPKLSGALYCSLLQVIDEHKLYFFEGQDRKSLAYHVQILHE
FT                   DFDGDYEELIENGDIELLPRFKTELLRQLCHPLYSVYTTATGYVEPVKREMARVERKLK
FT                   EILSKEDIYVLTMLFIQEMLDRVAIDSTIHFYERLKIRGFGGDDWGVEKGYIPKNLENI
FT                   IHLYVQSEEHKKEIVDALFKLCTESEGRYYLSPRKLKLIPGIYTTWYKCNDCKEMNIVA
FT                   AKNKCVNCLSENIEILDVNSKRLDSEKGFWRSPIQKILTNHEKISNITVEEHTAQLSQK
FT                   DAKIAIATTEEYELRFQDIILDVLEGPVDILSCTTTMEVGVDIGSLTAVGLRNVPPQRE
FT                   NYQQRAGRAGRRGTALSTVVTYAQGGPHDYYYFQQPEKMISGSARKPIVYIDNKKITKR
FT                   HLNAFLIQTYFHENVSASAVASSILSSSLGDTKSFFEGTPPFNYEQFKKWLNDNIACRF
FT                   RDYPVIFDLIPDEVVSTGGILGGGDMAERKWDIVKEACNELVSELERNYEKVKHTIQPI
FT                   DGDDIAEVNPNDKFLDFLFNHGLLPTYAFPQDLCSFYIEGKDERTGRIIVKQRPQLEIN
FT                   RALSEYAPGRQIVVDKKTYRIGGIYVPNPHDPLKPAKDLLLDSLPVITYCESCLFVSLD
FT                   PIQTKKCSVCGGELKNSPLLRPTGFSPEKGMEVKEGDREQEFTYAVPPQLPIPVSGEKL
FT                   SLKAYSGSERLQYANEMNKQLIVMNKGTDRQEGFEICTDCGAIWPAGESEHKLAHDVPY
FT                   RLKTHLGQRDSRCRGSIMKVFLGNIFNSDLLLLRMSFDEKVDFHPNHQWVHDGLKTIGE
FT                   ALVLAASRVLDIDYNELLSGYRILPLETKSSQHLYQADVYLFDTLSGGAGYSHIAGEML
FT                   PDIIKMAREILHECENHCETSCYKCLRHYSNQFYHHQLNRFVALELLDYIVKGELKVLT
FT                   LTEQQKVLAPIKRMLEIHNEKFEEFEEGGRYLIKVKSKGNRLIGAKNNIERMLVCAYSQ
FT                   PAIAYVSAYEVLHDLPNVYLNVVEGKQQLLV"
FT   gene            307775..307930
FT                   /pseudo
FT                   /locus_tag="GYMC61_0294"
FT                   /product="hypothetical protein"
FT   gene            307917..308213
FT                   /locus_tag="GYMC61_0295"
FT   CDS_pept        307917..308213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0295"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: gwc:GWCH70_1381 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76987"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACX76987.1"
FT                   /translation="MYGISPVVFKRLMAYFAGEKDIQKVVLFGSRARGTARYNSDIDLC
FT                   VDYTGKQKWKIKEDIDEIVGIYSCDVLFFDALNEAIRREIERDGKTIYEKARS"
FT   gene            complement(308348..308980)
FT                   /locus_tag="GYMC61_0296"
FT   CDS_pept        complement(308348..308980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK1143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76988"
FT                   /inference="similar to AA sequence:KEGG:GK1143"
FT                   /protein_id="ACX76988.1"
FT                   /translation="MDKKTIAHRFSFDRRLLGRLYWFPFLAYGLCVGLMVIFSARSDEP
FT                   FLPYTVIQGIAVPIAGWHLVFLYRHLYDEGAKEAVLWYYRKAVVLDLLRYAVLHGGCIV
FT                   LLVLAVIWIHGTMFLTAPVLVHLFLLFSFYQLIGLAMLCVFRSLDVALSVIVVYTFMEV
FT                   ATQGTFMPWPHLFLFQAPADSLSLLLPMMWLGAGIVIAAILIGREFW"
FT   gene            complement(308973..309842)
FT                   /locus_tag="GYMC61_0297"
FT   CDS_pept        complement(308973..309842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0297"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gka:GK2364 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76989"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX76989.1"
FT                   /translation="MLTVTIEGLTKIVKKKAILSDVSLTISGVYGLLGPNGAGKTTLMR
FT                   ILAGLLDFNEGRVLLGDEPISTGTRVKRVNEIGYLPQEFMIYPELTMYEVLEHLAVLQG
FT                   EHPATCRPKIEQVIEQVNLSSHMHKPMRELSGGMRRRVGIAMLLLREPSILLFDEPTAG
FT                   LDIRERVRFRNLLKRLGHDHTIVISSHLVEDIEFLCTKIGVLDRGVVLFEGSPDELKQK
FT                   AAPYTYELDVPFEELDPIMAANEVVQMNEEPSHVVVRVLSEEPIGRRVAPRLMDGYLAL
FT                   LKEAEAHG"
FT   gene            complement(309823..311844)
FT                   /locus_tag="GYMC61_0298"
FT   CDS_pept        complement(309823..311844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76990"
FT                   /inference="similar to AA sequence:KEGG:GK2363"
FT                   /protein_id="ACX76990.1"
FT                   /translation="MRWNFLVLFYLKKLLRSKLYVGASILFFVLLLIRFLLFFSDDMNS
FT                   GMEYSGELPSEVFMLVQIVSIFYIVFFYLLYSKELLYGVSSWFADGYRILLEKMSALFA
FT                   VHTLCQGIMLMMAYAVFSLVYIFIGIEPSDLYLSLLRFLAVYLFGPLVFTVLYGVIIAM
FT                   LFGTKRISFFAILFVWILTGPMTTELFIDVSQTVHARDWASLLFIGKHMIQHVYDSYIG
FT                   FEVDRGGEWKFAAWLLALAALSLLSSIRWTQTKKERNTVLKALLVFPFLIVLTAYNSLQ
FT                   TNTKAFTRADQTTELEEYRQMKQEVKADLRYRIQSYDLSLHGSRAVVRVALSHLETNRP
FT                   TFQLYHLYPLHSIEADHQPVKFTRNGDLVTVWLPKRTLTLTFSYEIVDTALIPHTNGRI
FT                   VLLADRAWYPKKRAAHMYRIDEYRVAGTRAWDGAFTDQFFPGETYTFTLDVDGDVLFCN
FT                   VPKRGKVYRGKAQAVTLIKGQGHQLVYQGYEITYPADWPHMAERAPTVIRQLEKTFHYV
FT                   QQIASTAVPSLPKSIVFSSWGLSSFMANDHLVYNTSFFSIGTYHVERDYYEKILRLSVP
FT                   PKGSRIMYNEWISLATRWLMQKNGLPVIDWSSKSEWFESQPRSVQKQIESIYDDFQPLG
FT                   VDQKQQFLRTWYENMDDAWTWDRVFEMMQEVKGVDGHH"
FT   gene            complement(311958..312353)
FT                   /locus_tag="GYMC61_0299"
FT   CDS_pept        complement(311958..312353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK1140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76991"
FT                   /inference="similar to AA sequence:KEGG:GK1140"
FT                   /protein_id="ACX76991.1"
FT                   /translation="MIVNRKKKWKSKWASLSLAAAVIATAGAAGAASATAFLDGSSTYK
FT                   NTSPLTASRNDTGNIKAVNNGANTQTRGYAYKLINWWPDSVVASTNWLNPGQEETRSFT
FT                   QTKDDKYYGQIVGQTIGSRGYVTITVK"
FT   gene            complement(312522..313931)
FT                   /locus_tag="GYMC61_0300"
FT   CDS_pept        complement(312522..313931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK1138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76992"
FT                   /inference="similar to AA sequence:KEGG:GK1138"
FT                   /protein_id="ACX76992.1"
FT                   /translation="MKWVFISRMASRLKAEAIFILVFSGALMFDCLNPHTINPAEWILY
FT                   TKYLVPIGMAVWLLFSFRLHVSLFASTPIHWIAMNDIMRNPQKIVFCQALIAFVCFFAL
FT                   QMALAGIIACAVVINYSAGWDLFTFLFPLYLIHFLLPFLWAWMIGLSTSAVYAYHSPKK
FT                   AMLLVGVLVLWIIVLFSLEYRNPSFSLWVNHRWPYIDPLFSLTFQKERMLIKLAYILSS
FT                   IAVYGVFRSMRRSFAGLAAGVTLVIFVTFFLQHAQSKFQLDDILLANDVKLYQQIKHQD
FT                   QTKNIPLHGYWKIKEIEVNPKSTHPIKVTLSLHPKERTVRFSINEQFQIDHIQGGGKRL
FT                   PFQQQGNVVQVETNGAPSMTIYYQHTFGSTFYPLTSGVTLLPFEANWYPQSVDSTLYHL
FT                   DSSGTLHSNVETKTCTRVKMIVGKEKYRWRGDHPLCLSMINGPYKQIQVQHTRFLVYKP
FT                   FLTTTRNLSNS"
FT   gene            314086..315459
FT                   /locus_tag="GYMC61_0301"
FT   CDS_pept        314086..315459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0301"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gwc:GWCH70_1919 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76993"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX76993.1"
FT                   /translation="MKDFPIRFVLTDEAITPSAGLALVGYLLHQTKLNKRVNALRPPTV
FT                   RRDVHISHSDVIRSMIGLLATGKTDFDHIEAYRQDDIFSTSMGIQHVPSSPTLRQRLDQ
FT                   LACLPMTETILWEESMRLLIQRHATLSPCWAKGKTTWLPLDIDGSPFDNSDTKKEGVSR
FT                   TYKGFDGFTPLFAYAGKEGYIVHAELRPGKQHVQDNMPSFLTTAIRRARQLTSSRLLVR
FT                   MDAGNDAEANVHVCLKEDVDFVIKRNLRRESKALWFQIASQKGKRVDDGQTEGVQTYEL
FT                   CLPQTAAIDGNTYTYVQVTQVTERTMERNGQVMLVPNYEVESYWVRLKGYEHVRMSDVL
FT                   ALYHDHATCEQFHSELKSDLDLERLPSGKMKTNALVLVMGAFVYNLLRLIGQDLLSDPR
FT                   HPLHHKVKRRRIKTIIQTVITMAGRLVRRSRQLWMKLTRRSGYSILLLNVYQKWKEAR"
FT   gene            315807..315902
FT                   /locus_tag="GYMC61_0302"
FT   CDS_pept        315807..315902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76994"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX76994.1"
FT                   /translation="MCDVLFFDALNEAIRREIERDGKTIYEKARS"
FT   gene            316102..317076
FT                   /locus_tag="GYMC61_0303"
FT   CDS_pept        316102..317076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0303"
FT                   /product="protein of unknown function DUF939"
FT                   /note="PFAM: protein of unknown function DUF939; KEGG:
FT                   gka:GK2353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76995"
FT                   /inference="protein motif:PFAM:PF06081"
FT                   /protein_id="ACX76995.1"
FT                   /translation="MKIGYRTLKTAVGAALAIAIAQLIGLHNFASAGIIVILCVQVTKK
FT                   RSLETARARFAACVVAIGFAALFFAVFGYHPWTIGLLLLLFIPVTVRLKVNEGIATSSV
FT                   IILHLYAAKEITWGLVANEILLVAVGIGVALLMNMYMPSVEKQLKEYQRIVEDLFRIIL
FT                   KEIVRYLRTNELDWDGKELPLAAETLDKAKKLAMRHADNQLWRNEDEYVRYFRMRERQL
FT                   EIIEHMLPLVTSLTYTVEQRMMIADFIDELSDAIHPGNTADRFLRRLAEMREQFKAMPL
FT                   PKTREQFEERAALFHLVRELERYLIIKSEFHPGNERKPQRLKA"
FT   gene            317145..317651
FT                   /locus_tag="GYMC61_0304"
FT   CDS_pept        317145..317651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0304"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   gka:GK2352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76996"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACX76996.1"
FT                   /translation="MRVWLAICLVITAVLGAPFQTAAEAKPLVIVNKAINKLALVRDGR
FT                   IEAVYPVATGVNADLTPEGMFTVTVKAKHPYYRKKNIPGGAPNNPLGTRWIGFNARGTD
FT                   GRTYGIHGTNNPASIGGYVSQGCVRMHNRNVEQLYERVPIGANVLILRSNESFYAIAKR
FT                   YGAVQ"
FT   gene            complement(317703..317795)
FT                   /locus_tag="GYMC61_0305"
FT   CDS_pept        complement(317703..317795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76997"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2294"
FT                   /protein_id="ACX76997.1"
FT                   /translation="MSRKTQKFVVYLMLICMLLTTLLAGISMWF"
FT   gene            318009..318434
FT                   /locus_tag="GYMC61_0306"
FT   CDS_pept        318009..318434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0306"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /note="TIGRFAM: methylmalonyl-CoA epimerase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; KEGG:
FT                   gka:GK2350 lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76998"
FT                   /inference="protein motif:TFAM:TIGR03081"
FT                   /protein_id="ACX76998.1"
FT                   /translation="MQVKKVDHIGIAVRSIDKALPFYTDVLGLPFLGIEEVESEQVKVA
FT                   FLQAGEAKLELLEPLSPESAVAKFIEKRGEGIHHVALGVEDITERIRELKEHGIRMIQD
FT                   APKRGAGGAWVAFMHPKSTGGVLYELCERTNRTEGHQ"
FT   gene            318431..319981
FT                   /locus_tag="GYMC61_0307"
FT   CDS_pept        318431..319981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0307"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: gka:GK2349
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACX76999"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACX76999.1"
FT                   /translation="MSDMYDKINELYDRRREIELGGGDEKIEQQHAKGKLTARERIDLL
FT                   LDEGTFVELNPFIEHRCTDFGLGEKKGPGDGVVTGYGKINGRTVFVFSQDFTVFGGALG
FT                   EMHAKKITNIMDLAAKTGAPVIGLNDSGGARIQEGVLSLDGYGHIFYRNAIYSGVIPQI
FT                   SVIMGPCAGGAVYSPAITDFVFMVEKTSQMFITGPKVIEAVTGEKISAEDLGGARVHNT
FT                   ISGNAHFAAANEEEALAEVRRLLGYLPSNNNEKPPFGPIPDGDDYRPDLADVVPIDAVR
FT                   PYDVRHVIAQVVDDGSFMEVQKDFAKNIVIGFARIKGEVVGLVCNQPKFMAGGLDIDSS
FT                   DKAARFIRFCDSFNIPIITFEDVTGFFPGVKQEHGGIIRHGAKILYAYSEATVPKITVI
FT                   LRKAYGGAYVALNSKSIGADVVYAWPNAEVAVMGPQGAANIIFAGEIEKSPNPEETRAQ
FT                   KIAEYREKFANPYVAAKYGMIDDVIDPRDTRIKLIQALEMLRNKHEERPKKKHGNIPL"
FT   gene            320088..320505
FT                   /pseudo
FT                   /locus_tag="GYMC61_0308"
FT                   /product="hypothetical protein"
FT   gene            321552..323210
FT                   /locus_tag="GYMC61_0309"
FT   CDS_pept        321552..323210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0309"
FT                   /product="transposase"
FT                   /note="KEGG: gka:GK1903 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77000"
FT                   /inference="similar to AA sequence:KEGG:GK1903"
FT                   /protein_id="ACX77000.1"
FT                   /translation="MNVKVKGVYRNGYLNIISVLVKKLDIPHLIDHLVPVDPQCQTRVS
FT                   DAVQAILYNLFDGRQALVHLERWAQEIDLEKLIRPGLHPSWLNDDALARHLDRLYEADI
FT                   HKVISTCLIHIYRKEGLSLRAFHADTTDKTVYGAYESASLEALQITHGYNRHHRWQKQI
FT                   GFGLVGNEDGIPFYGDVHDGNLSDKAWNPEVLSRIHEQFKQAKIDDEWIYVADSAAMTK
FT                   DTLAQTKAARAFLITRGPSSLRIVKQALAEADSPHIPWSEPFTLAERNGATYRVWETAA
FT                   TYEGHPVRLIVVESSALDQRKGKTLEKERVKEAELLREEQVRWERHPFSCREDAEQALT
FT                   SLKASLRPRFHRVEAAVEEIVRPKKRRGRPKKGAEPETETLYTLRLNVEFDQQAWEQAR
FT                   RKASRFVLVTTVPKEWKGQQMDAQEILKLYKGQISVEMNFAFLKDPFFTDEIDVKKPER
FT                   VAVLGYLFLLALAIYRVFQRRVRQFITPERPLKGAGGHKLTRPTGQAIFQLFQYVNVIL
FT                   LELPDGRIQRALDRSLNPDQRRILQGLGMDESIYV"
FT   gene            complement(323319..324197)
FT                   /locus_tag="GYMC61_0310"
FT   CDS_pept        complement(323319..324197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0310"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gwc:GWCH70_3382 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77001"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77001.1"
FT                   /translation="MQEHFHFTTDPAKLQKQYAAIFCFVSAQLSLIQMYLHRRNRHLVK
FT                   QKDEVVMAVHLLGKLLGFSSERAWHRFVTGNLFTNGSFLERSRYNRRCRALGFAVKWIR
FT                   HELAKRGQHHAYAVVDSLPLPLCHPARMQRVKRFRGIADMGYCASKKQWYYGFKLHLQV
FT                   TNQGLAMGYVVTEASCHDVKAAETVMTQIPHPYNFGDKGYISRALREKLYEEHQAAFWT
FT                   PSRHNQKHGPSKAWEEWIKKKRKVIETVFSILVDQYRITDIRANSIAGFEVALDGILVA
FT                   YSLVTLGLVER"
FT   gene            complement(324741..325541)
FT                   /locus_tag="GYMC61_0311"
FT   CDS_pept        complement(324741..325541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0311"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: gwc:GWCH70_3192 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77002"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACX77002.1"
FT                   /translation="MYKTFYSLSREPFAKETDPSEAYQGAAFQEALRALEYVKRTRGIG
FT                   LLIGEPGAGKTFALRALKESLNPSLYHVVYFPLSTGGVMDFYRGLALGLGEEPKYRKVD
FT                   LFRQIQQAIERLHHERRITPVFILDEMHLAKDAFLQDIAILFNFEMDSTNPFVLILAGL
FT                   PHLQGKLRLNQHRPLDQRIIMRYRMGPMEKEEVAGYIEHRMKQAGAKHPIFTPSALEAI
FT                   ALQSRGWPRVINTLATTCLLYGHQLKKDVIDEEVVRMAAEEMGY"
FT   gene            complement(325534..326784)
FT                   /locus_tag="GYMC61_0312"
FT   CDS_pept        complement(325534..326784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0312"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Transposase-like
FT                   Mu; KEGG: gka:GK1916 IS1604-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77003"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACX77003.1"
FT                   /translation="MDESMRHDIALFRYGLIAPLVNGQVEPKAYLNEVGGRVHSIPHQG
FT                   DKPIAAKTILDWCARYKKGGFDALKPKRRSDRGRSRRLSPDDEDHILALRKEHPTMPVT
FT                   LFYEQLTKQGDIPTTLSYFTIYRLLKKHNLVGKEILPMPERKRFAYDQINELWQGDLSH
FT                   GPTIRVHGKAQKTFLIAYIDDCSRLVPYAQFFPSEKFDGLRIVTKEAVLRCGKPKRIYS
FT                   DNGKIYRSEVLQYACAEMGITLIHTQPYDPQSKGKIERFFRTVQTRFYPLLELNPPKSL
FT                   DELNERFWKWLEEEYHRKPHASLDGKTPHEVFQSQVERVVWIEDIDWLDAIFLKREHRK
FT                   VKADGTITLNKQLYEVPPRFIGQSIELRYDERGVYVYEDGKRVAEAIRVRLEDNAYVKR
FT                   HRSPFAAVSAKEGEQDV"
FT   gene            complement(326926..327488)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0313"
FT                   /product="hypothetical protein"
FT   gene            complement(327687..327839)
FT                   /locus_tag="GYMC61_0314"
FT   CDS_pept        complement(327687..327839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_B0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77004"
FT                   /inference="similar to AA sequence:KEGG:BCAH820_B0288"
FT                   /protein_id="ACX77004.1"
FT                   /translation="MTNKFLSIFGLDKKKDNNCCSFEIEEVKEEEKEKKETCCSVDSSS
FT                   EKNNR"
FT   gene            complement(327855..328745)
FT                   /locus_tag="GYMC61_0315"
FT   CDS_pept        complement(327855..328745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0315"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: bcu:BCAH820_B0289 permease"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77005"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ACX77005.1"
FT                   /translation="MWDIVWNTTKEFISLAKNLLILFVLITYLINILEYIIPFDKLEKS
FT                   LFAKNRFLANISGALLGFVTPFCSCSTIPMLVTMFDKNVPFQTAMTFLFTSPLLDPWIL
FT                   TMMAYILGWKVTIIYTFVTLVISMIIGWLLDKWGFKKYVKNVRIKGIESPQLEGSRKVD
FT                   WKKAWKDTLSLLKSVYIHILVGSLIGAFIKEAIPHSLLEVVSKGSQWWVIPLAAIVGVP
FT                   LYIRLSTMLPVSQSLIAKGLPLAPTMALLIGGAGASLPEIIMLSSLFKKQLLIAFIASV
FT                   FIMATFSGYLFLIIN"
FT   gene            complement(328869..329148)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0316"
FT                   /product="hypothetical protein"
FT   gene            complement(329218..330405)
FT                   /locus_tag="GYMC61_0317"
FT   CDS_pept        complement(329218..330405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0317"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   afl:Aflv_2105 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77006"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77006.1"
FT                   /translation="MNRLAHHQGIHKFFFALGLALHFSKPVLKHLVHIVDALTTKGFSG
FT                   TLTDLHHWSFHPNHRTTLSHFFTKSPWDEETLLRKLQQWILHRIKRIAKRENQPLFVSI
FT                   DDAICQKTKPSSRATHAIQGCDWHYSHKDHQSVWGHSLVWLMVHTFTQAFPFAFRLYDK
FT                   KAGRSKIDLAIEMLSSIKVKLTQPVYVLMDSWHPSKTLIEACLKQGFHVIAMLKTNRIL
FT                   YPKGVAVQAKQFARYIEPKDTRLVTVGQERYRVYRYEGAIHGLDDAVVLLAWKADQPMT
FT                   PEHLHCVLSTDRELGDEDILRYYAQRWTIECFFRQAKDQLKLDGYWVRHVRAVKRYWAV
FT                   VLLASVYSIAESRQTLSAGLELLRSRKDHSVVEFIDDAAKQEIPIDVIKKQLHVA"
FT   gene            complement(330545..331006)
FT                   /locus_tag="GYMC61_0318"
FT   CDS_pept        complement(330545..331006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0318"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bcu:BCAH820_B0290 transcriptional
FT                   regulator, MarR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77007"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACX77007.1"
FT                   /translation="MDNIFSGKNNQHLVCIREMLQILIRRFGLLQKEGAECCGLTLVQS
FT                   HVLYEINRLGNPSLNDITDVLGLDKSTVSRHVQGLVEQGLIERRQSAIDRRYVELILTE
FT                   QGKKYEDQISNQMLKYLDEIMSHIAEEKRDQVNESISLLLMAMKNSSCC"
FT   gene            complement(331424..332836)
FT                   /locus_tag="GYMC61_0319"
FT   CDS_pept        complement(331424..332836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0319"
FT                   /product="transposase"
FT                   /note="KEGG: gwc:GWCH70_2050 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77008"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2050"
FT                   /protein_id="ACX77008.1"
FT                   /translation="MLQIIKTQYQIIVYLMGVILGKSLNLEDLDEPIQKPYRKLQVDDL
FT                   PIIDVPETLDYRKLLADYEAQHGRPLRPIQRRANAKHRVPDSLTCPRCQAPSSYLYANN
FT                   GGNGQYPCKVCQCRFNHRNRFTKQAVFRCPHCKKTLEKIKERKEYNIYKCKNNDCPFDQ
FT                   ANLRRMTKKERQQFQQDPQAFKVRYLFREFLFDFLPLASSSLIKPKVDLSRLAASPHVL
FT                   GLVLTYYVNFGMSSRETAAAMKDIHGVSISHQTVLNYANSVALWIKPFVDRFPYELSGS
FT                   FCGDETYIRVKGRWHYLFFMFDAVKKIVLSYRVSPNRDTLSAIKAIDDVLRKLASLPDD
FT                   LSFVVDGNPIYLLAQHFFAQHGISFDVRQVIGLTNEDPVSEEFRPLKQIIERFNRTFKG
FT                   NYRPTHGFGAEEGSVSFVTLFVAYFNFLRPHSALEGRVPVVIPELAELPHMPARWTKLI
FT                   AMAQDFLQQEAA"
FT   gene            333029..333436
FT                   /locus_tag="GYMC61_0320"
FT   CDS_pept        333029..333436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_B0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77009"
FT                   /inference="similar to AA sequence:KEGG:BCAH820_B0299"
FT                   /protein_id="ACX77009.1"
FT                   /translation="MKKKLLVELFPKYLVQSEITECTPESVCCDTVSDESGAEMQELKQ
FT                   RLLKQFKDQVIVQIYNYQVHLDLVLAQKKLTSILEERGFKAIASNAEKAIQYATPAVIV
FT                   NGKLLSLSTFPRLKEIYQYINDEIMITRGAS"
FT   gene            complement(333451..333779)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0321"
FT                   /product="hypothetical protein"
FT   gene            complement(333857..334229)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0322"
FT                   /product="hypothetical protein"
FT   gene            334549..335673
FT                   /locus_tag="GYMC61_0323"
FT   CDS_pept        334549..335673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0323"
FT                   /product="peptidase T-like protein"
FT                   /note="TIGRFAM: peptidase T-like protein; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; peptidase M42
FT                   family protein; KEGG: gka:GK2347 tripeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77010"
FT                   /inference="protein motif:TFAM:TIGR01883"
FT                   /protein_id="ACX77010.1"
FT                   /translation="MVNEQRLVDEFLELVQIDSETKHEGDIAKVLKQKFEALGLEVIED
FT                   DAAAKTGHGAGNLICTLAATKDGVDPIYFTSHMDTVVPGKGVKPSIQDGYVVTDGTTIL
FT                   GADDKAGLAAMLEAIRALKEQNIPHGVIQFIITVGEESGLVGAKALDPSLIQAKYGYAL
FT                   DSDGKVGNIVVAAPTQAKLKVVVHGKTAHAGVAPERGVSAITIAAKAIAKMPLGRIDEE
FT                   TTANIGRFEGGTQTNIVCDRVDILAEARSLVPEKMEAQVAKMKEAFETVAAEMGGRADV
FT                   EVEVMYPGFKFSDGDHVVEIAKRAAAKIGRPCKLERSGGGSDANIIAGFGIPTVNLAVG
FT                   YEEIHTTNERMPIEELVKLTEMVIAIVEEVANAE"
FT   gene            335790..336275
FT                   /locus_tag="GYMC61_0324"
FT   CDS_pept        335790..336275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0324"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: gka:GK2346 chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77011"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACX77011.1"
FT                   /translation="MDKYVIFRVEREQYAVSIAYVVSIEKMTEPTAVPHMPDYMAGVVR
FT                   IRGELVPVLDMRELLYGRAIEETDQTRLIVAAVDGLSVAFIVDEAKEIADIEPEAIKPL
FT                   QLMSAERTPYVVGMAAQDDRLLTVLDPRVLFAHLEEADAIREQVAAAQAAVRAGETV"
FT   gene            336358..336549
FT                   /locus_tag="GYMC61_0325"
FT   CDS_pept        336358..336549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77012"
FT                   /inference="similar to AA sequence:KEGG:GK2345"
FT                   /protein_id="ACX77012.1"
FT                   /translation="MVRPFGPYPGGFYPPYFGGYGHYPYGYYPYWHGGYGGYHHFPYGM
FT                   YDGHYPFSPYGFPHYGGY"
FT   gene            336711..338120
FT                   /locus_tag="GYMC61_0326"
FT   CDS_pept        336711..338120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0326"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding; KEGG: gka:GK2344 6-phosphogluconate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77013"
FT                   /inference="protein motif:TFAM:TIGR00873"
FT                   /protein_id="ACX77013.1"
FT                   /translation="MAKQQIGVIGLAVMGKNLALNIESKGYSVAVYNRSREKTDEFLQE
FT                   AKGKNIVGTYSIEEFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTY
FT                   FKDTQRRNKELAELGIHFIGTGVSGGEEGALKGPAIMPGGQKEAHELVRPIFEAIAAKV
FT                   DGEPCTTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAYFLLKHVLGMDANELHEVFADWN
FT                   KGELNSYLIEITADIFTKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIIT
FT                   ESVFARFISAMKDERVKASKVLAGPAVKPFEGDRGHFIEAVRRALYMSKICSYAQGFAQ
FT                   MKAASEEYNWNLRYGDIAMIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDPYFKDIVE
FT                   RYQDALREIVATAAMRGIPVPGFASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVD
FT                   KEGIFHTEWLK"
FT   gene            338410..345511
FT                   /pseudo
FT                   /locus_tag="GYMC61_0327"
FT                   /product="hypothetical protein"
FT   gene            complement(341924..343111)
FT                   /locus_tag="GYMC61_0328"
FT   CDS_pept        complement(341924..343111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0328"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gka:GK2942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77014"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77014.1"
FT                   /translation="MNRLAHHQGIHKFFFTLGLTLQLSKPVIKHLIHIVDALTTKGFSG
FT                   TLTDIHHWSFHPNHRTTLSHFFTKSPWDEERLLGKLQEWILRRIERLVERKNQPLFVSI
FT                   DDTICQKTKPSSRATHAIQGCGWHFSHKDHQSVWGHSLVWLMVHTLTQAFPFAFRLYDK
FT                   KAGKSKIDLAIEMLSSLKVKRAQPVYVLMDSWYPSKKLIEACLKQGFHVIAMLKTNRIL
FT                   YPKGIAIQAKQFARYVESEDTRLVTVGQERYRVYRYEGAIHGLDDAVVLLAWKADQPMA
FT                   PEHLHVVLSTDRELGDEDILRYYAQRWTIECFFRQAKDQLKLDGYRVRHIRAVKRYWAV
FT                   VLLSCVYSIAESRQNLSAGLELLRSRKDHSVVEFIYDAAKQDIPIDVIKKQLRIA"
FT   gene            complement(345709..346509)
FT                   /locus_tag="GYMC61_0329"
FT   CDS_pept        complement(345709..346509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0329"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: gwc:GWCH70_3192 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77015"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACX77015.1"
FT                   /translation="MYKTFYSLSREPFAKETDPSEAYQGAAFQEALRALEYVKRTRGIG
FT                   LLIGEPGAGKTFALRAWKESLSPSLYHVVYFPLSTGGVMDFYRGLALGLGEEPKYRKVD
FT                   LFRQIQQAIERLHHERRITPVFILDEMHLAKDAFLQDIAILFNFEMDSTNPFVLILAGL
FT                   PHLQGKLRLNQHRPLDQRIIMRYRMGPMEKEEVAGYIEHRMKQAGAKHPIFTPSALEAM
FT                   ALQSRGWPRVINTLATTCLLYGHQLKKDVIDEEVVRMAAEEMGY"
FT   gene            complement(346502..347345)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0330"
FT                   /product="hypothetical protein"
FT   gene            347536..348899
FT                   /pseudo
FT                   /locus_tag="GYMC61_0331"
FT                   /product="hypothetical protein"
FT   gene            complement(348988..349101)
FT                   /locus_tag="GYMC61_0332"
FT   CDS_pept        complement(348988..349101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77016"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77016.1"
FT                   /translation="MNRLAHHQGIHKFFMALESVKTLWRTFFRFTTGVVNH"
FT   gene            349481..350854
FT                   /locus_tag="GYMC61_0333"
FT   CDS_pept        349481..350854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0333"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gwc:GWCH70_1919 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77017"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77017.1"
FT                   /translation="MKDFPIRFVLTDEAITPSAGLALVGYLLHQTKLNKRVNALRPPTV
FT                   RRDVHISHSDVIRSMIGLLATGKTDFDHIEAYRQDDIFSTSMGIQHVPSSPTLRQRLDQ
FT                   LACLPMTETILWEESMRLLIQRHATLSPCWAKGKTTWLPLDIDGSPFDNSDTKKEGVSR
FT                   TYKGFDGFTPLFAYAGKEGYIVHAELRPGKQHVQDNMPSFLTTAIRRARQLTSSRLLVR
FT                   MDAGNDAEANVHVCLKEDVDFVIKRNLRRESKALWFQIASQKGKRVDDGQTEGVQTYEL
FT                   CLPQTAAIDGNTYTYVQVTQVTERTMERNGQVMLVPNYEVESYWVRLKGYEHVRMSDVL
FT                   ALYHDHATCEQFHSELKSDLDLERLPSGKMKTNALVLVMGAFVYNLLRLIGQDLLSDPR
FT                   HPLHHKVKRRRIKTIIQTVITMAGRLVRRSRQLWMKLTRRSGYSILLLNVYQKWKEAR"
FT   gene            351189..351848
FT                   /locus_tag="GYMC61_0334"
FT   CDS_pept        351189..351848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0334"
FT                   /product="Fibronectin-binding family protein"
FT                   /note="PFAM: Fibronectin-binding family protein; KEGG:
FT                   pjd:Pjdr2_0255 fibronectin-binding family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77018"
FT                   /inference="protein motif:PFAM:PF07299"
FT                   /protein_id="ACX77018.1"
FT                   /translation="MLEKFILNHQYNFIKKQVEMLKQNINQNIDNDVLANIREMSLNKV
FT                   VSQFSNLNEEQYRLLSEINKIKTELEFDEYIKRIYDYTKHFPYLSEVKLRKLFKNVKKL
FT                   NIPRNIFNEDKPLTYVSWNDLGSFRKFFIYQFNNKIVGFQSRITLCNKKGYCAFCNSFE
FT                   ELVLISSNSKHNNQTSYYKAFGHYVCLDSERCNKNITDTKQLDEFVRKLYLTRGAR"
FT   gene            352115..353773
FT                   /locus_tag="GYMC61_0335"
FT   CDS_pept        352115..353773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0335"
FT                   /product="transposase"
FT                   /note="KEGG: gka:GK1903 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77019"
FT                   /inference="similar to AA sequence:KEGG:GK1903"
FT                   /protein_id="ACX77019.1"
FT                   /translation="MNVKVKGVYRNGYLNIISVLVKKLDIPHLIDHLVPVDPQCQTRVS
FT                   DAVQAILYNLFDGRQALVHLERWAQEIDLEKLIRPGLHPSWLNDDALARHLDRLYEADI
FT                   HKVISTCLIHIYRKEGLSLRAFHADTTDKTVYGAYESASLEALQITHGYNRHHRWQKQI
FT                   GFGLVGNEDGIPFYGDVHDGNLSDKAWNPEVLSRIHEQFKQAKIDDEWIYVADSAAMTK
FT                   DTLAQTKAARAFLITRGPSSLRIVKQALAEADSPHIPWSEPFTLAERNGATYRVWETAA
FT                   TYEGHPVRLIVVESSALDQRKGKTLEKERVKEAELLREEQVRWERHPFSCREDAEQALT
FT                   SLKASLRPRFHRVEAAVEEIVRPKKRRGRPKKGAEPETETLYTLRLNVEFDQPAWEQAR
FT                   RKASRFVLVTTVPKEWKGQQMDAQEILKLYKGQISVEMNFAFLKDPFFTDEIYVKKPER
FT                   VAVLGYLFLLALAIYRVFQRRVRQFITPERPLKGAGGRKLTRPTGQAIFQLFQYVNVIL
FT                   LELPDGRIQRALDRSLNPDQRRILQGLGMDESIYV"
FT   gene            complement(354059..355681)
FT                   /locus_tag="GYMC61_0336"
FT   CDS_pept        complement(354059..355681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0336"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gka:GK3116 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77020"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77020.1"
FT                   /translation="MAYLQLAHNEWDPKAKYAKAKVIYSFGREDEVDRAVLERLAKSIS
FT                   RFLSPEQAWEIETLTGEVSDDFQFQSSKRLGGAWLLDQLWRQLGLGEILHSLFASRHHQ
FT                   IPLERLIFAMVANRALHPSSKLAMEEWVEKDVHIPHLPQVASHQLYRAMDELLAVQPEL
FT                   ERQVFHAVADLLNLEVDLIYFDTTSSYFEVDPSETPEGESLRKQGFSKDKRPDLVQIVI
FT                   GLAVTREGVPIRAWVWPGNTMDMTVIKQVKQDLIGWKLGRVISVMDRGFSSEENLRILQ
FT                   QAGGHYIVGEKMRSGKAAVEEALNRRGRYQQVRENLHIKEIIVGDGEARQRYVLVYNPS
FT                   EAERQRKEREKLLESLKEELEGLRQLPNEAHHKATCRLRSHPSYGKYLRQLKDGTLRID
FT                   KQAVREAEKYDGKYLIRTSDDTLSAEDVALGYKQLVDIEQAFRTLKSTLELRPMYHRLE
FT                   DRIRAHVLLSWLALLLVRIVEIRTHESWPKVRDECERLMLGHFSSKNGDLYQRTELTAK
FT                   QALFLAALGLEPPPKILGIHPRT"
FT   gene            355898..356329
FT                   /pseudo
FT                   /locus_tag="GYMC61_0337"
FT                   /product="hypothetical protein"
FT   gene            complement(356388..357140)
FT                   /locus_tag="GYMC61_0338"
FT   CDS_pept        complement(356388..357140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0338"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: gka:GK0784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77021"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACX77021.1"
FT                   /translation="MRAEVKEICKALHLAYIADRFEEVRFETKEQFLRDVLALELSCRQ
FT                   EAKQARLIKKAKFRELKWLKDYEWSGHIHWPATTSREELCDLRFLERKQNVLLLGSPGT
FT                   GKTHLATALGIQACQQGHEVRFFRVADLVAQLEEALKNGTLGRLKRSLDPCELLILDEL
FT                   GYVPFQKQGSELLFHIIADCYERKSVMVTSNLEFGQWNRVFGDNRLTAALVDRLVHHAH
FT                   ILAFTGESYRLRNALSAIQPSSASGLEP"
FT   gene            complement(357137..358300)
FT                   /locus_tag="GYMC61_0339"
FT   CDS_pept        complement(357137..358300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77022"
FT                   /inference="similar to AA sequence:KEGG:GK0783"
FT                   /protein_id="ACX77022.1"
FT                   /translation="MLAMPEMNRIRKLREKKGLSIAEISRETGYNWRTVKKYADGDISV
FT                   QPTIKRKKGMMEEEGYGQIIGLTQLFRQAGGVPKALRIDNLSAAIVSIRKGGERRFTEA
FT                   FEKFQLYYRFDVQVCNPYSGHEKGNAERKVYYTRNLCFIPAPLMESDPELVEWLHRKMV
FT                   EDRNRPHYEKGRWIEELWQEEQPELLALPEQDLPIFSLDHAYVNQYGEVMVDGKAFVVH
FT                   GLSVPNRVLVKKEWNRFVVFSSDGDVHLEAPRPYTNVKREIPWKEIFAEWETKPRVVGH
FT                   SRYRTYLPEAIRTYLAGPPPQVVARLKGLRALLDRHTLYEIAQWLEESQRWDLAPHEIG
FT                   VLMEAKHSYYPDKWEESYTPSVLIDYETDLTVYDQRLHPAREGGVQR"
FT   gene            complement(358668..360593)
FT                   /locus_tag="GYMC61_0340"
FT   CDS_pept        complement(358668..360593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0340"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gka:GK2343 ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77023"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACX77023.1"
FT                   /translation="MSMKQLLFRNLKQNIQHYYLYVFALMFASALYFAFVTLQYDPSLD
FT                   AIKGGVKGAAAVRTGAVLLIVIVAVFLLYANALFIKRRSHEIALLQLIGMTKRNIFFML
FT                   AAENVILYYGTLIIGILVGFAASKLLMMILFKIIDIPLAASLSFSGRALVQTLIVFSVI
FT                   DVLMMGMNRLFLKKQTILSLFRTTSTTEAKHVSVWNMVVGMVGIILIGSGYGISTKLFS
FT                   SDWKSVQGLFMAMAFILGAVIIGTYLFFKGTISFLFHLWRKQKGGYLSINDVLSVSSLM
FT                   FRMKSNTLLLTIITTVSAIAIGLISLSYISYYSAEQSAKNNVAADFAFTDKKDAARFTA
FT                   ALRSHDIRYRETIIDVIEAPTDISMILDIADQSRLQFQPSAAPLSVISDTSTGRIDVKP
FT                   NEALLTGYQDMLRQFLPFKETGTIRLEENGRMVPLHYLGMKKDYYVNYHFTYGMPTVIV
FT                   DQTMFDRLQKETDPQKKKVHIGIHLTDETNIERADQLFQRMEFSSIADSRLMMSRHQKQ
FT                   TFGLIMFVVTFLGLAFLVTSGCILYFKQMGAGEEERPNYTILRKLGFTEKDLLGGIRRK
FT                   QLFYFGIPLLLGLSHSYFAVRSGWFFFGTELWTPMLTVMAIYTACYSLFGVLSVRYDKK
FT                   LIREAL"
FT   gene            complement(360590..361345)
FT                   /locus_tag="GYMC61_0341"
FT   CDS_pept        complement(360590..361345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0341"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gka:GK2342 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77024"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX77024.1"
FT                   /translation="MVILEATNIHKTYGTKKNLQEVLKGIDLRVEKGEFLAIMGPSGSG
FT                   KTTLLNVLSSIDRVSEGAIFIEGNNVVAMKDRELAEFRKRHVGFIFQEYHLLDTLTVKE
FT                   NVLLPLSITKTPKREAEKKFAELAAELGIIDIQNHYPSEISGGQKQRAAAARAFIHEPS
FT                   IIFADEPTGALDSKSASDLLHKLQQLNKKRKTTIIMVTHDPVAASFSGRVVFIKDGQLY
FT                   TQLYKGTETRQQFFQAIMQTQGVLGGVRP"
FT   gene            complement(361439..362443)
FT                   /locus_tag="GYMC61_0342"
FT   CDS_pept        complement(361439..362443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0342"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   gka:GK2341 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77025"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX77025.1"
FT                   /translation="MIKDYLWERKSWMALFLFLELFILFVAYLDPTIPLSSILYIVFLT
FT                   TIIFVVFVIIRWKKETAFYQRLQEWERGLDPVSALRAASPLEKIVERVLASQTDQWKQE
FT                   LKEHLATLEQEKDELLSWIHEMKTPLTAMRLIIERVGDENTKAQLLYEWLRIHLLLDQQ
FT                   LHQRRLPHMENDLYIEQVELEPLLINEIKPLQSWCMQKGIGFDLQLDVRSVLSDAKWLS
FT                   FIIRQIITNAVKYSESSDIVVKSFMKNGHVRLQIQDFGLGIDPKDLPRIFEKGFTSTTE
FT                   HQNEAATGMGLYLAKKAAKPLLLDFHVESTPGRGTTFTIIFPQENDIIRTHRM"
FT   gene            complement(362443..363129)
FT                   /locus_tag="GYMC61_0343"
FT   CDS_pept        complement(362443..363129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0343"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gka:GK2340 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77026"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX77026.1"
FT                   /translation="MNILLIEDDVTLFQEIKARLEQWSYDVCGIRDFGCVMEEFSACKP
FT                   HLVIIDIQLPKFDGFHWCRQIRAHSNVPILFLSSRDHPTDMVMSMQLGADDYIQKPFHF
FT                   DVLIAKIQALLRRVYNYNAGPVQLQTWCGATVDYEKSTVSNEHGTVELTKNELLILKHL
FT                   LAKKNQIVARTELIKRLWEDERFVSDNTLTVNVNRLRKKLDELGLGRFIETKVGQGYMA
FT                   TEEGSH"
FT   gene            363610..364278
FT                   /locus_tag="GYMC61_0344"
FT   CDS_pept        363610..364278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77027"
FT                   /inference="similar to AA sequence:KEGG:GK2339"
FT                   /protein_id="ACX77027.1"
FT                   /translation="MGIFMRSRKRGCYYLLKRAHCRSKYDAKTMRFLGTVPLIAAPRSL
FT                   AIGDGKIFFTDNSRTLTGSIAVYDMKTKKQWRIPKVFINPLIGYDEKQNVLYVGQEGTS
FT                   DHDLYAVRLSDWHVSQLLSFPGGDDAFFMNGGEIFYGKARINPAQPGALVAAEFPEPLR
FT                   AASRQYIITSRAIYNRATGTKIADLSSEALLATAGDDGMIFTYRKVATNHYLIKQKLSQ
FT                   "
FT   gene            364826..366193
FT                   /locus_tag="GYMC61_0345"
FT   CDS_pept        364826..366193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0345"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG: gka:GK2337
FT                   beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77028"
FT                   /inference="protein motif:PRIAM:3.2.1.86"
FT                   /protein_id="ACX77028.1"
FT                   /translation="MSQQRKSIIPDNFLWGGAVTSFQTEGAWNEGGKGLSIVDARPIPK
FT                   GHSDWKVAVDFYHRYKEDIALFKELGFTAYRTSIAWTRIFPDGEGEPNEAGLAFYDAVF
FT                   DELRANGIEPVITLYHFDLPLALAKTYNGFASRKVVDLFERYARTIFERYRGKVNYWLT
FT                   FNEQNLVLEQPHLWGAICPEDEDPEAFAYCVCHNVFIAHAKAVKALREIAPEAKIGGMV
FT                   TYLTTYPATCRPEDALANVQAKELFIDFFFDVFARGAYPRYVTNRLEKKGICLPLEAGD
FT                   EELLRSQTVDFLSFSYYQSQIVRHQEQDERIIKGLEPNPYLPKTKWGWAIDPIGLRIAL
FT                   KDVYARYEMPIFITENGIGLEEELNEDGTVEDDERIDYLRRHIEQMKMAMEEGVEVIGY
FT                   LMWGATDLLSSQGEMRKRYGVIFVNRDDENLRDLKRYKKKSFYWFQRIIRTNGEEL"
FT   gene            complement(366279..366548)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0346"
FT                   /product="hypothetical protein"
FT   gene            complement(366808..367425)
FT                   /locus_tag="GYMC61_0347"
FT   CDS_pept        complement(366808..367425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0347"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: gka:GK2335
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77029"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ACX77029.1"
FT                   /translation="MKVYDVTAPIYEGMPVYKNKPEKQPKRTTITNGYVTESRIDMDVH
FT                   TGTHIDAPLHMVEGGATFETIPLNDLVGPCKLFDLTHVNDRITKDDIAHLDIQEGDFVL
FT                   FKTKNSFEDAFHFEFIFVAEDAARYLADKQIRGVGIDALGIERAQEGHPTHKTLFSDGV
FT                   IIIEGLRLKDVPEGRYFMVAAPLKLVGTDAAPARVLLFDREP"
FT   gene            complement(367525..369009)
FT                   /locus_tag="GYMC61_0348"
FT   CDS_pept        complement(367525..369009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0348"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: gka:GK2334 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77030"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ACX77030.1"
FT                   /translation="MNPKSIIVIFGATGDLAKRKLFPSLYRLYEKGHLHEQFAVVGVAR
FT                   RPLSAEEFRNYVRDSVETAFHQKLADGRFTSHFYYHPFDVTEAESYQRLKSLLEQLDGT
FT                   YETEGNRIFYLAMAPEFFGTVTSRLQSEGLTETRGFKRLVIEKPFGHDLASAEKLNDEI
FT                   RRVFSEREIYRIDHYLGKEMVQNIEVIRFSNAIFEPLWNNRFIANIQITSSETLGVEDR
FT                   GRYYDHSGALRDMVQNHMLQMVALLAMEPPIKLTTDDIRHEKVKVLRALRPIAHDEVDR
FT                   YFVRGQYGRGVIHGKNVPAYREEPNVDPDSNTETFVAGKLLIDNFRWAGVPFYIRTGKR
FT                   MAEKSTKIVVQFKDVPMNLYYRTNETIAPNLLVIHIQPDEGITLHLNGKKTGESTTITA
FT                   PFQLDYCNNCIDGINTPEAYEKLLYDCMRGDATNFTHWDEVAASWQFVDPISEVWANTK
FT                   ASDFPNYAAGSMGPAAADELLKKDGFHWWPIEHPRS"
FT   gene            369248..370171
FT                   /locus_tag="GYMC61_0349"
FT   CDS_pept        369248..370171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0349"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: gka:GK2333 ribonuclease Z; TIGRFAM:
FT                   ribonuclease Z; PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77031"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ACX77031.1"
FT                   /translation="MELLFLGTGAGVPAKERNVSSVALQLLDERGATWLFDCGEATQHQ
FT                   ILHTAIRPRRIEHIFITHLHGDHLFGLPGLLGSRSFQSGETPLTVFGPKGIRAFVETAL
FT                   AVSGTKLRYELNIVEIDEGVIFDDERFSVIAKRLDHGMPSYGFRVVEKDLPGPLLVERL
FT                   QALGVRPGPIYQEIKQGKTVVLDDGTVIDGREFVGPPQKGRIVAVLGDTRFCEAAIELA
FT                   RDADVVVHEATFAAAEQRLARDYFHSTTTDAAEVARRAGAKRLILTHISSRYQGAAALQ
FT                   LVAEARSVFPNTELAVDFASFSIPRG"
FT   gene            complement(370168..371190)
FT                   /locus_tag="GYMC61_0350"
FT   CDS_pept        complement(370168..371190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0350"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   gka:GK2332 NADPH dehydrogenase NamA"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77032"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACX77032.1"
FT                   /translation="MNTMLFSPYTIRGLTLKNRIVMSPMCMYSCDTKDGAVRTWHKIHY
FT                   PARAVGQVGLIIVEATGVTPQGRISERDLGIWSDDHIAGLRELVGLVKEHGAAIGIQLA
FT                   HAGRKSQVPGEIIAPSAVPFDDSSPTPKEMTKADIEETVQAFQNGARRAKEAGFDVIEI
FT                   HAAHGYLINEFLSPLSNRRQDEYGGSPENRYRFLSDVIDAVREVWDGPLFVRISASDYH
FT                   PDGLTAKDYVPYAKRMKEQGVDLVDVSSGAVVPARMNVYPGYQVPFAELIRREADIPTG
FT                   AVGLITSGWQAEEILQNGRADLVFLGRELLRNPYWPYAAARELGAKISAPVQYERGWRF
FT                   "
FT   gene            complement(371331..372173)
FT                   /locus_tag="GYMC61_0351"
FT   CDS_pept        complement(371331..372173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0351"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: gka:GK2331 pyrroline-5-carboxylate reductase;
FT                   TIGRFAM: pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77033"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ACX77033.1"
FT                   /translation="MMNNERTIALIGAGSMAEALIAGMTKAFCHPAHIVVANRQNRARL
FT                   EELARQYGVCTAGCAQEAVKQADIVILAMKPKDVVEAMNAIAPTLRAHQLILSLLAGIT
FT                   TETIERLAGRNIPVVRAMPNTSAAVGLSATAIAGGRFAAKEHLEVAKQLFETVGIVAVV
FT                   PEKDLHAVTGLSGSGPAYLYYLVEAMEKAAADIGLERDVAKRLILQTIIGAAEMLKASD
FT                   KHPSVLRREVTSPGGTTEAGIGVLEQYRFQEAVIACIRRATARSEELGSALLAAIAEA"
FT   gene            372680..373651
FT                   /locus_tag="GYMC61_0352"
FT   CDS_pept        372680..373651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0352"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gka:GK2330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77034"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX77034.1"
FT                   /translation="MNEERVYRITVPTPFPVGDVHMYVIAGDRLTLVDAGVKTEEAWQL
FT                   FVKQLGEVGYAPEDIEQIVITHHHPDHVGLLDYFPHAPIIGHPKADPFLRRERSFMERY
FT                   VQFFQEFFTECGVDRRLFSQLSKEGGSLRYASRRGLDIMVTEGDAVPGMPGWQVIETPG
FT                   HAQSHIALYREADGLLIGGDHLLVHISPNPMMEPPAEGETGRPKPLLQYNESLQKMLQY
FT                   DIVRSLNGHGDDATDIPALVRERLGKQRQRAERVLEMVKERPHTVFDVCQKLFPTAYER
FT                   QLMLTMSETIGQLDYLEANGYVTKKQEAGRYVYEAAGVSVCG"
FT   gene            373642..374430
FT                   /locus_tag="GYMC61_0353"
FT   CDS_pept        373642..374430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0353"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: gka:GK2329 short chain
FT                   dehydrogenase/reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77035"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX77035.1"
FT                   /translation="MRLKGRHVVITGASGGIGEQIAYEAARQGAVPVLLARSEERLKEA
FT                   SARIEAQTGIRAPYASLDVSDRGMIEAVVSQLIADLGAIDVLVNNAGFGVFRYVEDIDL
FT                   DEMERMFAVNVFGLIACTKAVYSHMKERGSGHIINIASQAGKIATPKSSVYSATKHAVV
FT                   GFTDSLRLEAGRFGIFVTTVNPGPVETNFFSTADESGEYVRNVSRWMLRPEAVAKRVVA
FT                   AMMTPTREVNMPRWMDLGSRLYRLAPGLVEKVAKRAFFQK"
FT   gene            complement(374577..374774)
FT                   /locus_tag="GYMC61_0354"
FT   CDS_pept        complement(374577..374774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77036"
FT                   /inference="similar to AA sequence:KEGG:GK2328"
FT                   /protein_id="ACX77036.1"
FT                   /translation="MNERWLQKQARNCLRHYGYDDDMMPLDEDDWRELCTRIAAAKERQ
FT                   PNADIYELVHDAVYRFIAGS"
FT   gene            complement(374847..375065)
FT                   /locus_tag="GYMC61_0355"
FT   CDS_pept        complement(374847..375065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0355"
FT                   /product="Iron sulphur domain-containing, CDGSH-type"
FT                   /note="PFAM: Iron sulphur domain-containing, CDGSH-type;
FT                   SMART: zinc finger CDGSH-type domain protein; KEGG:
FT                   gtn:GTNG_2257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77037"
FT                   /inference="protein motif:PFAM:PF09360"
FT                   /protein_id="ACX77037.1"
FT                   /translation="MANVQIKVNDNGSLRVTGDVELLDGEGKPFVTKQTFSLCRCGLSN
FT                   NKPFCDGSHKGRFQSVVRAPSPESSES"
FT   gene            375150..375494
FT                   /locus_tag="GYMC61_0356"
FT   CDS_pept        375150..375494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0356"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   gka:GK2326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77038"
FT                   /inference="protein motif:PFAM:PF01521"
FT                   /protein_id="ACX77038.1"
FT                   /translation="MSVSITFTDAAKRALASIVAQSERQLKLAFDTDGCGCLVDGVPAL
FT                   WLVDKADEDDVVVETNFMPVLVERSRLIFFDEAMTIDVKPGTTVFQLKSPGQTLNGHMP
FT                   LVEVKSGHER"
FT   gene            375484..375723
FT                   /locus_tag="GYMC61_0357"
FT   CDS_pept        375484..375723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77039"
FT                   /inference="similar to AA sequence:KEGG:GK2325"
FT                   /protein_id="ACX77039.1"
FT                   /translation="MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVW
FT                   LLQNEMTFETKEFPTLEAAIAWLGEHMPHITEVL"
FT   gene            complement(375796..375915)
FT                   /locus_tag="GYMC61_0358"
FT   CDS_pept        complement(375796..375915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77040"
FT                   /inference="similar to AA sequence:KEGG:GK2324"
FT                   /protein_id="ACX77040.1"
FT                   /translation="MTKNRAQKGKPSADTVKPTIAKEELEKAIHPTKRQNSPQ"
FT   gene            375995..376231
FT                   /locus_tag="GYMC61_0359"
FT   CDS_pept        375995..376231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77041"
FT                   /inference="similar to AA sequence:KEGG:GK2323"
FT                   /protein_id="ACX77041.1"
FT                   /translation="MKKQIRRKKEQEALTIADRLGAAAEAKLLAKKRALAEEEARRRAA
FT                   EEARRREEARRREEQKSFAELLEESELDWRKFK"
FT   gene            376247..377488
FT                   /locus_tag="GYMC61_0360"
FT   CDS_pept        376247..377488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0360"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gka:GK2322 cyanate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77042"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX77042.1"
FT                   /translation="MKPNAAASRASSFPFWTAGAVVALAANLRAPLTTVGPLVPELQRE
FT                   LGLSHAAAGALTTIPLLAFAFLAPVAAAFARRFGMERTLFFSLIVLLVGELLRPLSSIG
FT                   WLFAGTVLIGAAIAVDNVLMPVLVKESFPERVGLMMGIYTVTMNMSAAFASGIAVPLAD
FT                   GWGLGWQGSFRFWALFAALALVVWLTQARRRESDGAPAGSRRSALWRSWLAWQVTLFMG
FT                   LQSFFFYCVVTWLPELGQSKGLAADTAGWLLFFFQFAQLPMMFVSPMLAERMDNQKVLI
FT                   GSAVLLMTFGTIAFLAGQGWLLWIGALFSGIGAGMAFSLAMMLFTLRTRRPLAAAQLSA
FT                   MAQSVGYLLAAAGPPLFGALYDAAGRFTAPLGMLLAVCAAMMAFGLGAARNQYVEEDGS
FT                   AFVGAAGPFGKKSP"
FT   gene            complement(377673..378593)
FT                   /locus_tag="GYMC61_0361"
FT   CDS_pept        complement(377673..378593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0361"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: gka:GK2321
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77043"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACX77043.1"
FT                   /translation="MNKRRIGTSDLYVSEIGLGCMSLGTDENHAIYLIHEALERGINYL
FT                   DTADLYDRGLNEEFVGKAVKGKRDQVIIATKVGNRWRRDGSGWDWDPSKAYIKQAVKES
FT                   LRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRWYGISSIRPNVIREYVKRS
FT                   NIVSVMMQYSLLDRRPEEWFPLLREHHISVIARGPVARGLLTSRPLEQASSAAKEQGYL
FT                   DYSYEELQALIPKLKEKSEKHRSLTATALQFCLYDPVVAAVIPGASQLRQLEENIAAAS
FT                   APPLGRDEYEWLKQATKRSVYEAHR"
FT   gene            378714..379274
FT                   /locus_tag="GYMC61_0362"
FT   CDS_pept        378714..379274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0362"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gka:GK2320 ADP-ribose
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77044"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACX77044.1"
FT                   /translation="MELYEKTIRREKLFSGRIIELYVEEVELPNGQKSRREVVKHPGAV
FT                   AVLPLLPDGKIVLVRQYRKALERALVEIPAGKLEHGEEPLASAHRELEEETGYRAQSMR
FT                   HLISFYTSPGFADELIHLYVAEGLEKAEDGAGLDEDEFVELLEVTLEEALEMLQQRDIY
FT                   DAKTAYALQYLQLRRALGEQNAE"
FT   gene            379264..380454
FT                   /locus_tag="GYMC61_0363"
FT   CDS_pept        379264..380454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77045"
FT                   /inference="similar to AA sequence:KEGG:GK2319"
FT                   /protein_id="ACX77045.1"
FT                   /translation="MPNKKNERGLGRYYADLHIHIGRTASGRPVKITGARTLTLENILH
FT                   EAAEVKGIDLVGVIDSHVPEVLNELERAMEKHGWREHEGGGVSAGKVTLLLGSEIEVYD
FT                   DHCHGPIHVLVFLPTVQTMRTFSGWLGKRVKNVSLSSQRIYVSSRELQAAAKEQGGWFI
FT                   PAHAFTPFKSLYGKGVKHSLTEVFDPDWIDAIELGLSADTAMADQIAELHRYPYLTNSD
FT                   AHSLRKIAREYEEVRLAAPTFAEFEKALRGEDGRAIVANYGLNPKLGKYHQTVCERCLA
FT                   PAAPDVDSCAACGHHRFVKGVFDRLAELKTAERGPKRPPYIYQVPLEFIPGLGPKAYEK
FT                   LLARFGTEMSVLHEAAEEEIAETVGEKLAQLIVLARSGALHIEAGGGGRYGKVREG"
FT   gene            380679..381344
FT                   /locus_tag="GYMC61_0364"
FT   CDS_pept        380679..381344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0364"
FT                   /product="stage II sporulation protein M"
FT                   /note="TIGRFAM: stage II sporulation protein M; PFAM:
FT                   protein of unknown function DUF95 transmembrane; KEGG:
FT                   gka:GK2318 stage II sporulation protein M"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77046"
FT                   /inference="protein motif:TFAM:TIGR02831"
FT                   /protein_id="ACX77046.1"
FT                   /translation="MRTHPLKSAIAFHWREHASLYVFVIVLFLMGVIFGAIVVNSLGFS
FT                   QKQDLYYYLTQFFGQVSKDNIASAHDMFRQSYMHNVKYTALMWVLGISVIGLPIILVLL
FT                   FFKGVVVGFTVGFLVNQMGWRGFLLSFVSIMPQNLVAIPLMIVMGVISISFSLHMVRNQ
FT                   FMKRPHGSMFPMVMRYAAAMAAVALGLLLSSAVEAYLSPALMKQAVQWTMSLIIMNII"
FT   gene            381442..381894
FT                   /locus_tag="GYMC61_0365"
FT   CDS_pept        381442..381894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0365"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: gka:GK2317 FUR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77047"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACX77047.1"
FT                   /translation="MEDRVERIKKQLHSAGYKLTPQREATVRVLLEHEEDHLSAEDVYL
FT                   LVKEKSPEIGLATVYRTLELLTELKIVDKINFGDGVSRYDLRKEGAAHFHHHLICLECG
FT                   SVAEIQEDLLEDVEAIVEEKWKFKIKDHRLTFHGICHRCQQKHEEK"
FT   gene            381995..382207
FT                   /locus_tag="GYMC61_0366"
FT   CDS_pept        381995..382207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77048"
FT                   /inference="similar to AA sequence:KEGG:GK2316"
FT                   /protein_id="ACX77048.1"
FT                   /translation="MKTVWQMVKVFLLFTGCTILFYYSLVWFNREYEYYHRYDEPKGSA
FT                   VKVSAAESAPPSWLDRLLFFYRDGE"
FT   gene            382214..383110
FT                   /locus_tag="GYMC61_0367"
FT   CDS_pept        382214..383110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0367"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: gka:GK2315 site-specific tyrosine
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77049"
FT                   /inference="protein motif:TFAM:TIGR02225"
FT                   /protein_id="ACX77049.1"
FT                   /translation="MEYELKDFLHYLTVERNLAHNTIVSYERDLKKYVRYLRQVEQLQA
FT                   WGEVERLHILHFLKFLSEQGQSARTIARHLASIRSFHQFLLREKIAAQDPTVHIETPQF
FT                   ERTLPKVLSVEEVEALLAAPQVSTPFGLRDKAMLELLYATGMRVSELVQLNLADVHLTM
FT                   GFVRCYGKGRKERIVPIGRMAIEALAHYLERGRPQLVNPRRRATEALFLNHYGQRLTRQ
FT                   GFWKILKRLAKEAGIEKELTPHTLRHSFATHLLENGADLRAVQELLGHADISTTQMYTH
FT                   VTKTRLKDVYKQYHPRA"
FT   gene            383249..384430
FT                   /locus_tag="GYMC61_0368"
FT   CDS_pept        383249..384430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0368"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="KEGG: gka:GK2314 phosphopentomutase; TIGRFAM:
FT                   phosphopentomutase; PFAM: Phosphopentomutase domain
FT                   protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77050"
FT                   /inference="protein motif:TFAM:TIGR01696"
FT                   /protein_id="ACX77050.1"
FT                   /translation="MKATYRRVFLIVMDSVGIGEAPDAEKYNDKGADTLGHIAEYRGGL
FT                   YMPNMAKLGLSHIREIKGVPKVDRPLAYYTKMKEASAGKDTMTGHWELMGLRIDKPFRV
FT                   FPNGFPDELIAELERRTGRNVIGNKPASGTAIIEELGEEHMKTGAIIVYTSADSVLQIA
FT                   AHEQVVPLDELYRICEIARELTRDEPYMVGRVIARPFIGTPGHFERTANRHDYALKPFG
FT                   KTVMNELKDAGYEVIAIGKIADIYDNEGVTQSLRTTSNMDGMDKLVDTLGMDFTGLSFV
FT                   NLVDFDAKYGHRRDPKGYGDALEEFDARLADVLPRLTADDLLIITADHGNDPIHHGTDH
FT                   TREYVPLLVYSPRFRGGKPLPVRETFADVGATIADNFQVNRPPYGTSFLADLA"
FT   gene            384460..385287
FT                   /locus_tag="GYMC61_0369"
FT   CDS_pept        384460..385287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0369"
FT                   /product="purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /note="TIGRFAM: purine nucleoside phosphorylase I, inosine
FT                   and guanosine-specific; inosine guanosine and xanthosine
FT                   phosphorylase family; PFAM: purine or other phosphorylase
FT                   family 1; KEGG: gka:GK2313 purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77051"
FT                   /inference="protein motif:TFAM:TIGR01700"
FT                   /protein_id="ACX77051.1"
FT                   /translation="MDRQAIEKTAGHLRPLMPTPPEIGLILGSGLGVLADEIEEAVRIP
FT                   YEDIPGFPVSTVEGHAGRLVYGRLEGATVVAMQGRFHYYEGYSLQEVTFPVRVMKALGV
FT                   RELIVTNAAGGINERFQPGDFMIISDHINLLGTNPLIGPNDPELGPRFPDMTEAYSRRL
FT                   RELAKETAARLGVRVHEGVYVANTGPSYETPAEIRMIRTLGGDAVGMSTVPEVIVARHG
FT                   GIEVLGISCISNMAAGMSDAPLHHDEVVETAERVKTDFLRFVKAIVAEMAKSK"
FT   gene            385284..386603
FT                   /locus_tag="GYMC61_0370"
FT   CDS_pept        385284..386603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0370"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /note="TIGRFAM: pyrimidine-nucleoside phosphorylase; PFAM:
FT                   glycosyl transferase family 3; Pyrimidine nucleoside
FT                   phosphorylase domain; Glycosyl transferase, family 3-like;
FT                   KEGG: gka:GK2312 pyrimidine-nucleoside phosphorylase
FT                   (PYNP)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77052"
FT                   /inference="protein motif:TFAM:TIGR02644"
FT                   /protein_id="ACX77052.1"
FT                   /translation="MKKVIAMRMVDLIAKKRDGKALTKEEIEWIVRGYTNGDIPDYQMS
FT                   ALAMAIYFRGMTEEETAALTMAMVHSGEMLDLSSIRGVKVDKHSTGGVGDTTTLVLGPL
FT                   VASVGVPVAKMSGRGLGHTGGTIDKLESVPGFHVEISKDEFIRLVNENGIAIIGQTGDL
FT                   TPADKKLYALRDVTATVNSIPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKKLDEARR
FT                   LARAMVDIGKRVGRRTMAVISDMSQPLGYAVGNALEVKEAIETLKGNGPHDLTELCLTL
FT                   GSHMVYLAEKAPSLDEARRLLEEAIRSGAAIAAFKTFLAAQGGDASVVDDLDKLPKAAY
FT                   TSTVTAAADGYVAEMAADDIGTAAMWLGAGRAKKEDMIDLAVGIVLHKKIGDRVQKGEA
FT                   LATIHSNRPDVLDVKEKIEAAIRLSPQPVARPPLIYETIV"
FT   gene            386769..387944
FT                   /locus_tag="GYMC61_0371"
FT   CDS_pept        386769..387944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0371"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; beta-lactamase; Penicillin-binding
FT                   protein 5 domain protein; KEGG: gka:GK2311
FT                   D-alanyl-D-alanine carboxypeptidase (penicilin binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77053"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACX77053.1"
FT                   /translation="MKTKVTRLLLLPFLLFLPLSAHAEAKEMKEAKVKLADEAKSAILI
FT                   ERDTGKVLYEKNAHEPLPPASMTKIMTMLLVMEAIDEGKLSYDEKVRASEYAASMGGSQ
FT                   IFLEPGEEMTVDELLRGIAIGSANDASVAMAEQIAGSEEAFVEMMNEKAKQLGLKNTHF
FT                   ANATGLPAEHHYSSAYDMAMMARELLKYEDITKYTSKYEDYLRENTDKKFWLVNTNRLV
FT                   KFYPGVDGLKTGYTAEAKYCLTATAKKNGMRVIAVVFGAPTPKSRNAQITKMLDYAFSQ
FT                   YRTHPVYKRNETVARVNISKGKRSSVEAVTSEPVSVLTKKGQSVEQIEKVIKVKDNVKA
FT                   PVRKGDELGVLILKQDGKEILHSPIVAKQTVEEASFWDLFKRVFGRFVQAG"
FT   gene            388070..388420
FT                   /locus_tag="GYMC61_0372"
FT   CDS_pept        388070..388420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0372"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-sigma F factor antagonist;
FT                   anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   gka:GK2310 anti-sigma F factor antagonist (stage II
FT                   sporulation protein AA)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77054"
FT                   /inference="protein motif:TFAM:TIGR02886"
FT                   /protein_id="ACX77054.1"
FT                   /translation="MSLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRH
FT                   IVLNLGQLTFMDSSGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEA
FT                   DEQFALQALGVA"
FT   gene            388421..388861
FT                   /locus_tag="GYMC61_0373"
FT   CDS_pept        388421..388861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0373"
FT                   /product="anti-sigma regulatory factor, serine/threonine
FT                   protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: gka:GK2309 anti-sigma F factor; TIGRFAM:
FT                   anti-sigma F factor; PFAM: ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77055"
FT                   /inference="protein motif:TFAM:TIGR01925"
FT                   /protein_id="ACX77055.1"
FT                   /translation="MRNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIKTVVS
FT                   EAVTNAIIHGYNNDPNGIVSISVIIEDGVVHLTVRDEGVGIPDIEEARQPLFTTKPELE
FT                   RSGMGFTIMENFMDEVIVESEVNKGTTVYLKKHIAKSKALCN"
FT   gene            388869..389627
FT                   /locus_tag="GYMC61_0374"
FT   CDS_pept        388869..389627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0374"
FT                   /product="RNA polymerase, sigma 28 subunit, SigF"
FT                   /note="TIGRFAM: RNA polymerase sigma-F factor; RNA
FT                   polymerase sigma-70 factor, sigma-B/F/G subfamily; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 3 domain protein;
FT                   Sigma-70 region 4 type 2; sigma-70 region 4 domain protein;
FT                   KEGG: gka:GK2308 sporulation sigma factor SigF"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77056"
FT                   /inference="protein motif:TFAM:TIGR02885"
FT                   /protein_id="ACX77056.1"
FT                   /translation="MPMDVDVKQDQSPIKDQEMKELIRRSQEGDQEARDEIIEKNMRLV
FT                   WSVVQRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQRFLRDD
FT                   GTVKVSRSLKEMGNKIRKAKDELSKTRGRAPTVTEIADHLGISPEDVVLAQEAVRSPTS
FT                   IHETVYENDGDPITLLDQIADADEASWFDKIALKKAIEELDERERLIVYLRYYKDQTQS
FT                   EVASRLGISQVQVSRLEKKILQHIKDKMDG"
FT   gene            390031..390654
FT                   /locus_tag="GYMC61_0375"
FT   CDS_pept        390031..390654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0375"
FT                   /product="stage V sporulation protein AA"
FT                   /note="KEGG: gka:GK2307 stage V sporulation protein AA"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77057"
FT                   /inference="similar to AA sequence:KEGG:GK2307"
FT                   /protein_id="ACX77057.1"
FT                   /translation="MANTVFIKPRHRVQVKPGAVVTLGQAAQIAAPDGGLIRRLKTIPL
FT                   YRIQPSDKNIVIIDMMQMIRAVFDVDSSLDVQMIGPSQTIIEVVYEKRKVSTASFVLVW
FT                   LLLFVGSAMAIMNFHEDVSMQRVHRHLYEMMTGQAVDKPLLLQIPYSLGLGIGMILFFN
FT                   HWFRKRINEEPSPLEVEMFNYQQAIDQYVILHENKESMRHLDDA"
FT   gene            390641..391072
FT                   /locus_tag="GYMC61_0376"
FT   CDS_pept        390641..391072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0376"
FT                   /product="stage V sporulation protein AB"
FT                   /note="KEGG: gka:GK2306 stage V sporulation protein AB"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77058"
FT                   /inference="similar to AA sequence:KEGG:GK2306"
FT                   /protein_id="ACX77058.1"
FT                   /translation="MTTLEILLVVFVGFAGGLAVGTGFVAFLVVLGVIPRLTQLTKTPE
FT                   RIHAYEWGAVAGAIVGGWMSLRHSVWHLSKYWLVPIGLLHGVFVGMLAAALTEVLNVWP
FT                   ILAKRIGVDDKIVILLMAIAFGKVAGSLFHWLYFVDYFR"
FT   gene            391091..391519
FT                   /locus_tag="GYMC61_0377"
FT   CDS_pept        391091..391519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0377"
FT                   /product="SpoVA protein"
FT                   /note="PFAM: SpoVA protein; KEGG: gka:GK2305 stage V
FT                   sporulation protein AC"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77059"
FT                   /inference="protein motif:PFAM:PF03862"
FT                   /protein_id="ACX77059.1"
FT                   /translation="MGLKSDYVREVKAFQPSPPYAANAVKAFFAGGALCALAQWLADWY
FT                   GGTFAASPLEAHLWASMVMAGLAIVLTAVGKYDDFSQFAGAGATMLITGLANAIASAAI
FT                   EHRSEGWTAGVAGQMLKAGGAAIIYGLVAAYVLGLVWP"
FT   gene            391538..392566
FT                   /locus_tag="GYMC61_0378"
FT   CDS_pept        391538..392566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0378"
FT                   /product="stage V sporulation protein AD"
FT                   /note="TIGRFAM: stage V sporulation protein AD; PFAM: Stage
FT                   V sporulation AD family protein; KEGG: gka:GK2304 stage V
FT                   sporulation protein AD"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77060"
FT                   /inference="protein motif:TFAM:TIGR02845"
FT                   /protein_id="ACX77060.1"
FT                   /translation="MKRVGKQTWVFDDGVYIQAAAAAVGPLEADGPLGSYFDVCHRDLY
FT                   CGEATWELAERRLMREAVDCCLQKAGVSAEEVDLFLAGDLLNQNATSNYVARELPIPFL
FT                   CLFGACSTSMQTLAAAAAFVAGGLADRALAATSSHNATAERQFRYPTELGVQKPKTATF
FT                   TVTGAGAALVGRAPGRWRVRAATIGKVVDAGLKNPLDMGAAMAPAAADTIEQHFRDLGV
FT                   SPGDYDLIVTGDLSRVGSVIVRELLAESGYDVTDVYNDCGLMIYRPDQKVFAGGSGCAC
FT                   SAVVTYGYLLQELARGTFRRLFVVATGALLSQTMVQQKQSIPAIAHGVVIEAAGQEPDL
FT                   PP"
FT   gene            392606..392956
FT                   /locus_tag="GYMC61_0379"
FT   CDS_pept        392606..392956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0379"
FT                   /product="SpoVA protein"
FT                   /note="PFAM: SpoVA protein; KEGG: gka:GK2303 sporulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77061"
FT                   /inference="protein motif:PFAM:PF03862"
FT                   /protein_id="ACX77061.1"
FT                   /translation="MEYVRAFLAGGLLCAIVQLIIDRGKWTPAGVAGSLVVFGVLLGFG
FT                   GVYDPFVAWAGAGATMPLCGFGYWLAKGAMAEPRPEGFVETGAAVFRFAGALFAFIVAG
FT                   SFAAALTCKPKG"
FT   gene            392959..393573
FT                   /locus_tag="GYMC61_0380"
FT   CDS_pept        392959..393573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0380"
FT                   /product="stage V sporulation protein AE"
FT                   /note="KEGG: gka:GK2302 stage V sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77062"
FT                   /inference="similar to AA sequence:KEGG:GK2302"
FT                   /protein_id="ACX77062.1"
FT                   /translation="MMEKRRVILVTDGDEFACRAIERVAAEIGGRCISRSQGNPTKLSG
FT                   EQLVELILQTPHDPVFVMFDDCGALGEGAGEQALRYVATHEQIQVLGALAVASNTHQHE
FT                   WTKVHVSIDRDGVMTEYGVDKEGFRDLEIGRINGDTVYCLDRLNIPLIVGIGDIGKMGY
FT                   RDHAKYGAPITRKAVELILERSGGHAGKRKETESADREAAR"
FT   gene            393521..394999
FT                   /locus_tag="GYMC61_0381"
FT   CDS_pept        393521..394999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0381"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   gka:GK2301 stage V sporulation protein AF"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77063"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ACX77063.1"
FT                   /translation="MPEKEKKPKAPIAKRLVDNAKFLQQRIGVGTSFDLGVRKIYVLNR
FT                   EVHIYYCNGLCDTQYIIELLKQIVRVNDDERQASQAWQIIENRLVHQQVSPVTSLDEAV
FT                   DKLLSGLIIVLIEGESTGFAVDVRSYPGRQPQEPDTEKVVRGARDGYVENIIVNTALTR
FT                   RRIRDERLRFEILQVGERSKTDVCIAYIQDVADPGLVELVKKELQQINVDGLTMGDKTV
FT                   EEFLVKQGYNPYPLVRYTERPDVAATHLLEGHVLIMVDTSPSVIITPTTFFHHVQHAEE
FT                   YRQSPGVGTFVRWVRFLGILTSLFLLPLWVLFVLEPSLLPESWAFIGPNKQTNIPIIVQ
FT                   ILLADFGIEFLRMAAIHTPTPLSTAMGLIAAVLIGQIAIDVGLFVPEVILYISVAAIGS
FT                   FATPSYELSVANKISRLALVILVALFKVPGLVIGTTVYLLWLASIRSLNTPYLWPFIPF
FT                   DPAAFMQIVVRRSVAGARVRPSIVHPQDRQKQPS"
FT   gene            395313..396632
FT                   /locus_tag="GYMC61_0382"
FT   CDS_pept        395313..396632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0382"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: gka:GK2300
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77064"
FT                   /inference="protein motif:TFAM:TIGR01048"
FT                   /protein_id="ACX77064.1"
FT                   /translation="MFLHGTSRVNEQGHLEIGGVDVVELAKTYGTPLYIYDVALIRARA
FT                   RAFKEAFQRHGVRAQVAYASKAFSAVAIVQLAAEEGLSLDVVSGGELYTALAAGFPPER
FT                   IHFHGNNKSRDELAMALEHGIGCIVADNFYELELIEELAESSGRTVPVLLRVTPGVEAH
FT                   THDYILTGQEDSKFGFDLNNGQADEAFRRVMASAAFQLLGVHCHIGSQIFETAGFVLAA
FT                   QKVFAKLAEWNKAHGFVPAVVNLGGGFGIRYTEEDDPIPVTAYVDCIVEEVKRQAEACR
FT                   LPLPEIWIEPGRSLVGDAGTTIYTIGSRKEVPNVRTYIAVDGGMSDNIRPALYGAKYEA
FT                   ALANRVFGEPTEVVSIAGKCCESGDMLIWDIALPEAKPGDYLAVFCTGAYGYSMANNYN
FT                   RLPRPAVVFVENGDAQLVVKRETYEDLIQYDLPVKTKVKK"
FT   gene            complement(396706..397584)
FT                   /locus_tag="GYMC61_0383"
FT   CDS_pept        complement(396706..397584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0383"
FT                   /product="protein of unknown function DUF1002"
FT                   /note="PFAM: protein of unknown function DUF1002; KEGG:
FT                   gka:GK2299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77065"
FT                   /inference="protein motif:PFAM:PF06207"
FT                   /protein_id="ACX77065.1"
FT                   /translation="MKRTIASSLLWAVLLASPGIAAADAAPGDVIVTLGENLTNEQKQK
FT                   VLDEMKAPDGAQTITVSNVEEHKYLDGLIPKAQIGTRAISSSMITIKEPGSGLHVETHN
FT                   ITWVTKEMYTNALITAGVKDADIYITAPFPVSGTAALTGLMKAYEISSDQAIPDDVKKV
FT                   ANEEMVQTAKLADSIGADKAVALLAKIKQEIANNPPQTDADLRALIEKIANDLGITLSE
FT                   NEINNLISLFHKMQNAHINWDQVNDQLSKAKEQLSAFLQSEEGKTFIQTLIDIFKEIWN
FT                   AIKSAFSSNQQ"
FT   gene            397769..398209
FT                   /locus_tag="GYMC61_0384"
FT   CDS_pept        397769..398209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0384"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: gka:GK2298 peptidyl-prolyl
FT                   cis-trans isomerase (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77066"
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /protein_id="ACX77066.1"
FT                   /translation="MAKKGYILMENGGKIEFELFPNEAPVTVANFEKLANEGFYNGLTF
FT                   HRVIPGFVSQGGCPRGNGTGDAGYTIPCETDNNPHRHVTGAMSMAHRGRDTGSCQFFIV
FT                   HEPQPHLDGVHTVFGQVTSGMDVVKTMKNGDVMKEVKVFDEP"
FT   misc_binding    398372..398504
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 114.00"
FT   gene            398712..399854
FT                   /locus_tag="GYMC61_0385"
FT   CDS_pept        398712..399854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0385"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: gka:GK2297 riboflavin-specific deaminase
FT                   (diaminohydroxyphosphoribosylaminopyrimidine deaminase;
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase );
FT                   TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   bifunctional deaminase-reductase domain protein; CMP/dCMP
FT                   deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77067"
FT                   /inference="protein motif:TFAM:TIGR00326"
FT                   /protein_id="ACX77067.1"
FT                   /translation="MHNDEHYMRLALDVAKAGVGQTSPNPAVGAVVVNGGTVVGLGAHL
FT                   KAGEPHAEVYAIRMAGEKARGATVYVTLEPCSHYGKTPPCADLLIQAGVRRVVVATTDP
FT                   NPLVAGKGIAKLRQAGIDVDVGVLKDEADELNRMFFHYIAAKTPFVTLKFACSLDGKIA
FT                   TATGESKWITSSAAREDVHRLRAQHDAILVGVNTVLTDNPKLTVRFGEKRKNPLRIILD
FT                   TKLRTPLDAHVVADKEAETWIITGGVSREQAAAYERLGVRVFSMPTAQTDVRDVLRLLG
FT                   EQGVMSLFVEGGSRVHDSFLRAGAVNEVIAYIAPKLIGGRGAPTPVGGLGFARLAEAVE
FT                   LDIRRIETIGPDIKIVAAPKRKEESLCSLALLKRSARSNK"
FT   gene            399809..400453
FT                   /locus_tag="GYMC61_0386"
FT   CDS_pept        399809..400453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0386"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="KEGG: gka:GK2296 riboflavin synthase subunit alpha;
FT                   TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77068"
FT                   /inference="protein motif:TFAM:TIGR00187"
FT                   /protein_id="ACX77068.1"
FT                   /translation="MFTGIIEEIGTIEQMKQTGDAIVMTIGAKRVLEDVRLGDSIAVNG
FT                   VCLTVTSFTERQFTVDVMPETVKATALKTLKPGSKVNLERAMAAGGRFGGHFVTGHVDG
FT                   VGRIIRQWPKANAVYYEIEVPASLRAYMIEKGSVAVDGTSLTIFGLSERTFIVSLIPHT
FT                   REATILGEKRPGDLVNIECDMIGKYVAAFLNAKATPTSKLTVEFLEQHGYK"
FT   gene            400474..401667
FT                   /locus_tag="GYMC61_0387"
FT   CDS_pept        400474..401667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0387"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; GTP cyclohydrolase II; PFAM:
FT                   34-dihydroxy-2-butanone 4-phosphate synthase; GTP
FT                   cyclohydrolase II; KEGG: gka:GK2295 bifunctional
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77069"
FT                   /inference="protein motif:TFAM:TIGR00506"
FT                   /protein_id="ACX77069.1"
FT                   /translation="MFDTIEAALSALKNGEVIIVCDDEDRENEGDFVVLAEKATPDVIN
FT                   FMITHGRGLVCVPITEELAERLELEPMVTHNTDAHGTAFTVSVDYKTTTTGISAYERAA
FT                   TIQALLDPNVKASDFKRPGHVFPLIAKKGGVLRRAGHTEAAVDLARLCGATPAGVICEI
FT                   IKEDGTMARVPDLRQIADQFGLKMITIKDLIAYRSQREKLVKREVDVWLPTEFGEFRAI
FT                   GYTNVLDGKEHVALVKGEIIPDEPILVRVHSECLTGDVFGSYRCDCGPQLHAALRQIEA
FT                   EGRGVLLYMRQEGRGIGLMNKLRAYKLQEQGYDTVEANEKLGFPADLRDYGIGAQILKD
FT                   LGVTKMRLLTNNPRKIAGLKGHGLEVVERVPIQMPAKKENEKYLRTKHEKLGHMLHF"
FT   gene            401688..402152
FT                   /locus_tag="GYMC61_0388"
FT   CDS_pept        401688..402152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0388"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="KEGG: gka:GK2294 6,7-dimethyl-8-ribityllumazine
FT                   synthase; TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77070"
FT                   /inference="protein motif:TFAM:TIGR00114"
FT                   /protein_id="ACX77070.1"
FT                   /translation="MRIIEGNLVGTGLKIGIVVSRFNEFITGKLLSGAIDGLTRHGVSD
FT                   SDITVAWVPGAFEIPLVAKKMAESKQFDAVITLGAVIRGATSHFDYVCSEAAKGVSHAA
FT                   LASGVPVIFGVLTTDTIEQAIERAGTKAGNKGWEAAVSAIEMANVLRTLA"
FT   gene            402274..402630
FT                   /locus_tag="GYMC61_0389"
FT   CDS_pept        402274..402630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0389"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gka:GK2293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77071"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX77071.1"
FT                   /translation="MLIRYRKNYEKIAMGLLSFMPTEKDLRRLQQTMKQYETNNDWQLF
FT                   LWKEGDDIVGIIGVLLRAPDVVEIQHISVNPSHRHQGIGKQMVKALKEVYPGRRLCANE
FT                   WTASFFDKCHACNE"
FT   gene            complement(402653..403192)
FT                   /locus_tag="GYMC61_0390"
FT   CDS_pept        complement(402653..403192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0390"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   gka:GK2292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77072"
FT                   /inference="protein motif:PFAM:PF03745"
FT                   /protein_id="ACX77072.1"
FT                   /translation="MYPKAYIEYLVHFHSDRDYFECHEILEEHWKQDGRNKGWLVLIQM
FT                   AVAFYHYRRGNVLGALRLIRRARALLDEAQEMIRRLGLDDEALARLLDETAGRITRGEP
FT                   YESVELPIRDRSLYEQCQAACARRQLVWGQASDLANLDLVDKHRRRDRSDVIAAREQKK
FT                   RAKAEGVGFPPPPPPA"
FT   gene            403394..404143
FT                   /locus_tag="GYMC61_0391"
FT   CDS_pept        403394..404143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0391"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpA"
FT                   /note="PFAM: chromosome segregation and condensation
FT                   protein ScpA; KEGG: gka:GK2291 segregation and condensation
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77073"
FT                   /inference="protein motif:PFAM:PF02616"
FT                   /protein_id="ACX77073.1"
FT                   /translation="MQLPYNVKIEAFEGPLDLLLHLINRYEIDIYDIPVAQITEQYMAY
FT                   IHAMQELELDIASEYLVMAATLLAIKSKMLLPPSNEEAVDGDIEWGDDGDPREELTQRL
FT                   LEYKKFKEAARELKRREEERALLFTKPPSDLSAYADEKKAAPLDVNVYDMLGALSKLLR
FT                   RKKLQKPMRAKISRQDISVEQRMAEILHELKQANGRKNFYELFPSYDRSYIVVTFLAIL
FT                   ELMKQDEIIVEQERNFSDLFLAVKPAG"
FT   gene            404155..404976
FT                   /locus_tag="GYMC61_0392"
FT   CDS_pept        404155..404976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0392"
FT                   /product="chromosome segregation and condensation protein,
FT                   ScpB"
FT                   /note="TIGRFAM: segregation and condensation protein B;
FT                   PFAM: chromosome segregation and condensation protein ScpB;
FT                   KEGG: gka:GK2290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77074"
FT                   /inference="protein motif:TFAM:TIGR00281"
FT                   /protein_id="ACX77074.1"
FT                   /translation="MAAAVRCGGPLFFCCLFAHAMIRRRVDSHWGEKTWETTKTGGKEE
FT                   GRQRVWRGRRAMEQNEREKKGAGALKPAKAIVEALLFAAGDEGLSLSQIAAVLEVSELE
FT                   AKAVIEELQQDCRREERGIQLVELGGVFLLATKKEHAPYLKKLVEAPGASPLSQAALET
FT                   LAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTGRPILYGTTPEFLD
FT                   YFGLKTLEELPPLPEWADDGESEREADLFFEKLAENLSDGQPEYGKLKKNG"
FT   gene            404995..405396
FT                   /locus_tag="GYMC61_0393"
FT   CDS_pept        404995..405396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77075"
FT                   /inference="similar to AA sequence:KEGG:GK2289"
FT                   /protein_id="ACX77075.1"
FT                   /translation="MNVCRLYGEELQKSQSNTFEDYFNRSEVTYRDGGEERTLSVLYLR
FT                   HFEAALLDWLPYESDPLFTANGRDIHLRDIIALVCLWKNPAYRQRKRVYIHDEEELRRY
FT                   FAEVDAKTLQALVSEWAETGECRLPERSA"
FT   gene            405753..407066
FT                   /locus_tag="GYMC61_0394"
FT   CDS_pept        405753..407066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0394"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: Manganese/iron superoxide dismutase-like;
FT                   KEGG: gka:GK2288 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77076"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACX77076.1"
FT                   /translation="MDDQVLFAQYAARVNEWGNQVKETLALRGASTDGASSLLEFIAEH
FT                   DGEWTEEAVRELQRLADDVYVGALRQYVMEAAAWGRQVEQALSARRMAEDVGLSSLLAY
FT                   IDGHGDEWTEEAIYELQRLVDDVYTRAVRLADSSAAEREEEATQEQVEGESVSPELESE
FT                   NKENEDGWLDTSGTAERVEDAKEPAFMAELSDSLPDIADGEPGQADNVTDGKRRWVDAD
FT                   DGGEPRQQVAPGRHVLPPLPYRYDALEPHISEEIMRLHHTKHHQSYVDGLNKAERMMAE
FT                   ARRTNNFDLLKHWEREAAFHGSGHYLHTIFWYNMHPEGGGEPRGELRAQIERDFGSFAA
FT                   FRRHFTEAAKSAEGVGWALLVWAPRAHRLEILQAEKHQLMAQWDVIPLLVLDVWEHAYY
FT                   LQYKNDRAAYIEHWWNVVNWRNVEERFHEARKLRWQPF"
FT   gene            407416..408564
FT                   /locus_tag="GYMC61_0395"
FT   CDS_pept        407416..408564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0395"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: gka:GK2286 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77077"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACX77077.1"
FT                   /translation="MNKQKQLIALILALAAGIMAFVPERMRAMDGVSAKSAILIEQHSG
FT                   RVLFAKDAYTKRRIASITKIMTAILAIESGKMDDTVTVSARAVRTEGSSIYLRQGEKIK
FT                   LRDLVYGLMLRSGNDAAVAIAEHVGGSVEGFVFLMNQKAAEIGMRDTEFANPHGLDDAE
FT                   NHYSTAYDMALLMQYAMKNKEFRRISGTKVYRAPAPPGEDGARVWRNKNKLLTSLYEYC
FT                   TGGKTGYTKRAHRTLVTTASKGGIDLIAVTLDAPDDWNDHIAMYEYGFSHYHIAKVSSE
FT                   RVVDKISDPFYRGRLQAVRDLRYPVTDKEESGLQVKVYLLKPRKEWKKYPERAPTEVGK
FT                   AVLYLHQKAVDSVPLLYEPGKEGSGRGFLWQAFRFLGVRSDG"
FT   gene            408557..409153
FT                   /locus_tag="GYMC61_0396"
FT   CDS_pept        408557..409153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0396"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   gka:GK2285 spore maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77078"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACX77078.1"
FT                   /translation="MVNLIWVMMAVIGIVFAAANGTMDEVNKAVFESAKEAVTISIGMV
FT                   SILVFWLGLMAIAERAGLLDKAARLFMPLVRRLFPEVPPGHPALGYIVSNMVANMFGLG
FT                   NAATPMGIKAMEQLKKLNGGRDEASRSMVTFLAMNTSGITLIPATVISIRMTYGSAAPG
FT                   EIIGTTIVASTISTIGAVLIDRYYYWKRMRKGRKP"
FT   gene            409153..409686
FT                   /locus_tag="GYMC61_0397"
FT   CDS_pept        409153..409686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0397"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   gka:GK2284 spore maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77079"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACX77079.1"
FT                   /translation="MAIVQLLSVWLIPALIAFILLYGTAKKVPTYEAFVEGGKEGIEIA
FT                   FSLIPYLVGMLVSVAIFRASGALDAMMEVIKPLADAIGLPAEVVPLAALRTLSGTAALG
FT                   MTTDLIATYGPDSFIGRLASTIQGSTETTLYVLTVYFGAVGVKKMGDALKVGILADILS
FT                   FIVSVFIVLFVFGR"
FT   gene            409819..410550
FT                   /locus_tag="GYMC61_0398"
FT   CDS_pept        409819..410550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0398"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein; KEGG:
FT                   gka:GK2283 ribosomal large subunit pseudouridine synthase B
FT                   (pseudouridylate synthase) (uracil hydrolyase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77080"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACX77080.1"
FT                   /translation="MERLQKVIARAGIASRRKAEELILQGRVKVNGRVVKELGVKVGPR
FT                   DDVEVDGIPIEREEPVYYLLYKPRGVISSVKDDRGRKVVTDFFKDLDKRIYPIGRLDYD
FT                   TSGLLLLTNDGDFANLLMHPRYEIEKVYIAKVKGIPTHEQLKRLEQGVQLEDGMTAPAK
FT                   VKLLSADRKKGTAIVEIRIHEGRNRQVRRMFEAIGCEVLKLKRERYAFLDLKGLRPGEY
FT                   RELTPHEVKLLRVLAQSGGRK"
FT   gene            410694..411218
FT                   /locus_tag="GYMC61_0399"
FT   CDS_pept        410694..411218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0399"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   gka:GK2282 thiol-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77081"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACX77081.1"
FT                   /translation="MKKQQRLVMRTAILLVLLAAIGYTIYTNFFTEKTAVAVGSTAPDF
FT                   VLTDLKGHEHRLSDYRGKGVFLNFWGTWCKPCEREMPYMNELYPIYKKKGVEILAVNVG
FT                   EPKLSVEKFAERFGLTFPIVIDRQDQVLNAYNVGPLPTTFLIDKKGEVKQIITGTMTKE
FT                   DIERHLESIKP"
FT   gene            411232..412896
FT                   /locus_tag="GYMC61_0400"
FT   CDS_pept        411232..412896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0400"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: gka:GK2281
FT                   cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77082"
FT                   /inference="protein motif:PFAM:PF05140"
FT                   /protein_id="ACX77082.1"
FT                   /translation="MEHVKCECGHVNPHGTAFCESCGKPLADLGEKLILDMRYEGSARR
FT                   SQTYKKTMIDQIWAFFSSVKVGVALIVITLIASAIGTIFPQQMYIPPNVDPAEYYKQQY
FT                   GWAGKLYYELGFNNLYGSWWYILLIALIGVSLVICSLDRVVPLYRALKRQGVKRHPRFL
FT                   ERQRLFGVSHVSDLDKTMAVLKERLAARRYHVREEDGHLLAEKGRFSRWGPYVNHIGLI
FT                   IFLIGAMLRSVPGMYIDRVMWIPEGETKEIPGTNGRYFLKSEKFIFETYEKGKDNEVFN
FT                   AAIDRVGNGMIAKNYQTNVVLYKRVGPVIPGAKPKLEKVKEYPIRVNEPLEFDHYALYQ
FT                   VDFRLNEPKAMSFQLADKQSGKTFGTVTVDLYDPKESYNLGHGYRVELLSYFPDFEFDE
FT                   DGNPSTKSRVPNNPAFVFKMYAPDRPKGEVSFVAIQQTIEPFGNNKYKMAFAGLQTRNV
FT                   SGLTVRRDFTLWILGVGGAIFMIGLIQGMYWNHRRIWVQRVNGELWIAAHTNKNWFGLK
FT                   NELRRLLDGTGVMMPADQLENDKKAGQGGQVHGHGTA"
FT   gene            412877..414070
FT                   /locus_tag="GYMC61_0401"
FT   CDS_pept        412877..414070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0401"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG: gka:GK2280
FT                   cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77083"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ACX77083.1"
FT                   /translation="MDMVQLSSTLLYIAFVLYLIGTFFFGGAIRDKRKERQEKDRWSQL
FT                   GISVTIIGFLAQVGYFVTRWIAAGHAPVSNLFEFTTFFGMMLVAAFIIIYFIYRLSVLG
FT                   LFALPVALLVIAYASMFPREISPLIPALQSDWLHIHVTTAAAGEAILAISFVAGLIYLI
FT                   RVVDQSKPSKRTFWLEVVMFCLITTLGFVIVSTAFGLSGYEAKFTWVDKNKQTVEVIYD
FT                   MPALVGPHKGELMKESAGRMEPLVEMPAIINAKKLNTVIWSLIAGTALYIMLRLLLRKR
FT                   VAAALKPLVKNVNLDLTDEISYRAVAIGFPVFTLGALIFAMIWAQIAWTRFWGWDPKEV
FT                   WALITWLFYAAFLHLRLSKGWHGEKSAWLAVIGFAIIMFNLVAVNLVIAGLHSYAGT"
FT   gene            414167..414892
FT                   /locus_tag="GYMC61_0402"
FT   CDS_pept        414167..414892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0402"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gka:GK2279 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77084"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX77084.1"
FT                   /translation="MEKQEKTIRILVVDDEERIRRLLKMYLERENYVIDEAGDGNEALE
FT                   KALTNDYDVILLDLMLPGKDGIEVCKEIRAQKTTPIMMLTAKGEESNRVQGFEVGTDDY
FT                   IVKPFSPREVVLRVKALLRRAANAAYAPVETTAKDVLVFPHLTIDNDAHRVTVDGKEVS
FT                   LTPKEYELLLFLARSPDKVFDREQLLKEVWHYEFFGDLRTVDTHIKRLREKLNKASPQA
FT                   GKMIVTVWGVGYKFEAVND"
FT   gene            414892..416685
FT                   /locus_tag="GYMC61_0403"
FT   CDS_pept        414892..416685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0403"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: gka:GK2278 two-component sensor histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold domain protein; PAS fold-4 domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77085"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACX77085.1"
FT                   /translation="MWLFRSVVGKLWFTILLLVSCVLFILSILLIKFLEDYYVQEAEND
FT                   LTRLATKVAEVMHDHRDEQLARSIAWTLVDNRTKAVIVADESHYWYSPGDAGLDNMPLS
FT                   SIRQDRDLRRVLTDGKTVKKRLYMPERHPKEKLPRDMIIVGVPMSMPDGSRGAVFVYQS
FT                   LEAIADATERTKELIFLAAFIAIVMTTFFAFFLSTRITAPLRKMRQAAFEMARGHFDMK
FT                   VPILTNDEIGGLAMAFNQMGRRLQFNINALNQEKEQLASILSSMADGVITFNRDGEILI
FT                   TNPPAERFLQAWYFEQGNDAEAMAPLPPQVKELFARVVREEKEQSTEVTLQGRTWVILM
FT                   TPLYGKTMVRGAVAVLRDMTEERRLDKLRKDFIANVSHELRTPIAMLQGYSEAIIDDIA
FT                   ASEEEKKEMAKVIYDESLRMGRLVNDLLDLARMEAGHIELEYEQVKLVPYIERVIRKFY
FT                   GLAKEKQIELTAEFRDRDIEIALDPDRIEQVLTNLIDNAIRHTESGGTVRLIIEPSGDG
FT                   VTIHVQDSGSGIPEEDLPFVFERFYKADKARTRSRSGTGLGLAIAKNIVEAHKGLITVH
FT                   SKLNEGTTFSFYLPARGPKGA"
FT   gene            416825..418027
FT                   /locus_tag="GYMC61_0404"
FT   CDS_pept        416825..418027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0404"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: gka:GK2277 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77086"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ACX77086.1"
FT                   /translation="MKRWILKNAAVYAETGNIEQGYVLIEGEKVAAIGPMSSCPTDAGA
FT                   EVIDLSSRFSIVPGFIDVHIHGAAGADVMDATPEALYKMANALPAEGTTSFLATTMTAP
FT                   SEQIEAALRNVARYMAEANRPGAAEVLGVHLEGPFLSPKRAGAQHPRHLADPDISLFQH
FT                   WQKAAGGHIRLVTLAPERNGGLELAAYLKQTGVIASIGHSDAVYDEVKAAVHAGVTHAT
FT                   HLFNGMRGIHHREPGVAGAVLMFEEVMCELIADGLHVAPPMVRFAYRNKGSDGLILITD
FT                   AMRAKCLGDGRYELGGQEVTVRGQEARLADGTLAGSVLKLGEAIRRVLDYTGCTLEEVI
FT                   RMASWNPAKQLGLLDRKGSLRPGKDADVVVLNERYEVMMTFCRGALAYRKPDERSGERW
FT                   P"
FT   gene            418018..418779
FT                   /locus_tag="GYMC61_0405"
FT   CDS_pept        418018..418779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0405"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="TIGRFAM: glucosamine-6-phosphate isomerase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   gka:GK2276 N-acetylglucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77087"
FT                   /inference="protein motif:TFAM:TIGR00502"
FT                   /protein_id="ACX77087.1"
FT                   /translation="MAMKLLKAADYAEMSRQAADIIIKQVKEKPNAVLGLATGSTVLGV
FT                   YRELAADHRQHGTSYRLVRTVNLDEYVGLGPDHPNSYRYYMNQHLFAQLDIPLHQTHVP
FT                   DGLAADLDEECRRYERLIDELGGIDLQLLGIGRNGHIGFNEPGTPFSTATHVVELTELT
FT                   REANARFFPSLDDVPRYAITMGIATILRSRRIVLLASGEEKAEAMARLLEGVVTPDLPA
FT                   SALHLHPDVTIIADREALSLIPKEKRWVDAP"
FT   gene            418776..419507
FT                   /locus_tag="GYMC61_0406"
FT   CDS_pept        418776..419507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0406"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: gka:GK2275 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77088"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACX77088.1"
FT                   /translation="MIDKQSPIPIYYQLEQYMKEKIEKGEWQPGEMIPSERELAEMYDI
FT                   SRMTVRQAVNNLVNDGYLIRRRGKGTFVAAQKIEQPLKGLTSFSEDMRARGMEPGTIVL
FT                   GFETVPASQKLAEGLGVTEGDDLYEVRRLRLADGLPMALETLYIPVNLVPGLTRDVVSG
FT                   SVYEFIEKEKGMIIGSAVQTLEASVARKVEAEHLKMKEGAPVLLLERRTYLDDGRPMEV
FT                   VKSVYRGDRYKFMIEMKRGGS"
FT   gene            419507..420871
FT                   /locus_tag="GYMC61_0407"
FT   CDS_pept        419507..420871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0407"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system EIIC; Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site; KEGG: gtn:GTNG_2202
FT                   PTS system, N-acetylglucosamine-specific enzyme II ABC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77089"
FT                   /inference="protein motif:TFAM:TIGR01998"
FT                   /protein_id="ACX77089.1"
FT                   /translation="MLGFLQRLGKALMLPIAVLPAAGLLLRLGQPDLLNIPFIAAAGDA
FT                   VFSNLALIFAIGVAIGFSKDGNGAAALAGAIGYFVLTKGAAAIDKDINMSVLGGIISGV
FT                   IAGLLYNRYHDIKLPDWLGFFGGRRFVPIVTSLVMLVLALIFGYVWPPIQDGINAVGHW
FT                   IVGAGAVGVGIFGFLNRLLIPVGLHHVLNSFVWFVFGEYNGKTGDLSRFFAGDPDAGIF
FT                   MAGFFPIMMFGLPAAALAMIAAAKKERRKAVAGALLGVALTSFLTGITEPIEFLFMFLS
FT                   PLLYVVHAVLTGLSLAVATMLDIHHGFTFSAGAIDFFLNYGIAKKPYLLIVQGLVYAVV
FT                   YFVVFYFLITKLDLKTPGREEEVEGEFTDSGAAQSGVKYEDLAAKYIEALGGKDNLAQI
FT                   DNCVTRLRLKVKDMSKVNEAELKRLGAKGVLRLNQTDLQVVVGTDVEFLANAMRK"
FT   gene            420921..421838
FT                   /locus_tag="GYMC61_0408"
FT   CDS_pept        420921..421838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77090"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2201"
FT                   /protein_id="ACX77090.1"
FT                   /translation="MKRLLDCNASDFRRMTGKQLKQSIQASEGRVIVAEVVGEFAPLYP
FT                   AVTNAELATAFGADLLLLNWFDVFRPVVNGLDTNEPNQMVERLKQLTGRPVGVNLEPVD
FT                   PNAKQLEELAALPKGRMATAESLQQAKQLGFDFVCLTGNPKTGVTNDEIVKAIETARSI
FT                   LGEDALVMAGKMHAAGVADEAGSGIVSEEVVVRFIHAGADVVLMPAPGTVPGVTLDKTE
FT                   KLVQVAHEHGALAMLTIGTSQEGADESTIRQIALASKMAGADLHHIGDAGYHGIAVPEN
FT                   IMAYSITIRGRRHTYIRMARSPLR"
FT   gene            422064..422813
FT                   /locus_tag="GYMC61_0409"
FT   CDS_pept        422064..422813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0409"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; KEGG:
FT                   gka:GK2273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77091"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACX77091.1"
FT                   /translation="MIAEPLFHLILIFSVLLPLVSLTVLALLGVAEKEVDYWQLEHARL
FT                   RLEKELQESKYMQLHQQIRPHFFFNALNAFLSLARLGKNEEMIRGMEHFALFLRDSYET
FT                   KQPLIPFKQEWAHTSNYLAVQQLRFGSRLSVSVQMDPDGERALIPSYTLQTLVENAFKH
FT                   GLEKKAGEKCLAIDFRRQGNWVYLRVCDNGNEGKELSIANGGVGLDNLRKRFALLFDLP
FT                   TQLVLQKDERGWTEALVVWPYVPGDEG"
FT   gene            422817..423518
FT                   /locus_tag="GYMC61_0410"
FT   CDS_pept        422817..423518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0410"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   Helix-turn-helix, AraC domain; response regulator receiver;
FT                   KEGG: gka:GK2272 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77092"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX77092.1"
FT                   /translation="MKVLIVDDEYLELEQLTYLVKRKYPHWEVWPAEDAAEAKRLAASH
FT                   RFRLALIDIHLPGQSGLDLAYELKQKQPDLALIIITAYQDFAYAKRAIQLEVLDYLVKP
FT                   LIESEFDQALSKFEQKHPEALVSSPLIRAALEYVHCHYAQKISLTEVAAAVHVHPAYLS
FT                   RLFVEEIGIHFKDYVNRYRIEKAKELLTKKPDWSMARIAEETGFSSQHHFSHLFRKYVG
FT                   IPPTKYKETNG"
FT   gene            423518..424807
FT                   /locus_tag="GYMC61_0411"
FT   CDS_pept        423518..424807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77093"
FT                   /inference="similar to AA sequence:KEGG:GK2271"
FT                   /protein_id="ACX77093.1"
FT                   /translation="MDWYMLLFMACVLLLAAVPHIGRCSFIGAEALGLSKGVNALLLRF
FT                   ASGELLLFGCYAFIHGGVAAGVVTAMAVWAAVFVLWRSAAAVRYRSLTEEGDRWPDCCF
FT                   TARALFFFRFFVRLLSIGRLLTVVVLCAYLLQQLFRFSPTFLFIWFVYVYVFTVLAGWL
FT                   GMRKIGTVLLYIVYIVMGMVPFAYYLTGGVARQYEMIVRTVPASLDVNMVSLFVLFWAV
FT                   LAAAAGQWLADEYVWDIASILKKERVALTFSMAAFCLAPLPLAVAALCVPYAAAASTAA
FT                   ILKRWLLHSSVLIAWPLTIALLAALSLSLSLSLHSVVQIFWHRWSRHLSWTYVISFLLV
FT                   LALFFIAPLLPMRMVMFSTALLASSCFGLAALRTGEKPMGVIGMIGWVCLFAIAWRWGM
FT                   RHNVLEAIAWNGIGGFLFTQIYQLIQKIKK"
FT   gene            424889..425794
FT                   /locus_tag="GYMC61_0412"
FT   CDS_pept        424889..425794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0412"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: gka:GK2270
FT                   acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77094"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ACX77094.1"
FT                   /translation="MSFVPCTTAIYAFSKNHQPVRTVQSGETFVIETYDCFQNQITSSE
FT                   TPFDSIDWNHINPATGPIYIEGAEPGDILAVKIEQIRLKGQGVMAVGPGLGVLGDRIPQ
FT                   FEAKMIPVEENRAVFDEHLSIPLNPMIGVIGVAPSGEDVSCGTPGPHGGNMDTKLITTG
FT                   ATVYFPVFVKGALFALGDLHAAMGDGEIGVSGIEISGEVTVTVRVMKGYSLNHPLLQND
FT                   DGIATIVSAKTLDEAVKQSVEEMVNLLLPHTPLTLNHLTMVLSAVGQTQISQVVDPLVT
FT                   ARFFVPRFVLEAYGIRLFED"
FT   gene            425808..427172
FT                   /locus_tag="GYMC61_0413"
FT   CDS_pept        425808..427172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0413"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   gka:GK2269 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77095"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACX77095.1"
FT                   /translation="MAQLETNTSVESLGYKQELKRSLTFVDLLIYGMVFMVPIAPFGIY
FT                   GYVAQGSKGMVALAYLIGMVGMIFTALSYARMAEAFPIAGSVYSYAQRGMNEYVGFMAG
FT                   WVILLDYIFVPALLYLVSAAALADIVPQVPIYVWLVLFIAMNTIINILGIEMTAKANKV
FT                   IVVLELIVLAVFVITGIIAIIKGVNGAQFTFKPLYDPNHFSAETVMGAVSVAVLSFLGF
FT                   DAVSTLAEETRDGKSSIGKAIIFALLVVGALFIVQTWVAALIWPDYTTFKNADVAFYQI
FT                   AELAGGPWLKWTTIIATALSWGIANALVAQAAISRILYSMGRDRKLPSVLAKVHPKFQT
FT                   PYVSTLLVAVISLIVTTVFASQIDKLASLVNFGALTAFLFLHVSVMNYFLRKQKSNDYI
FT                   NHLLFPLIGFVIIGYVWMNLDPLSKKLGLIWIAIGLVYLVFLRLTNKDSRLSGEL"
FT   gene            427359..427973
FT                   /locus_tag="GYMC61_0414"
FT   CDS_pept        427359..427973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0414"
FT                   /product="protein of unknown function DUF1696"
FT                   /note="PFAM: protein of unknown function DUF1696; KEGG:
FT                   gtn:GTNG_2200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77096"
FT                   /inference="protein motif:PFAM:PF08000"
FT                   /protein_id="ACX77096.1"
FT                   /translation="MFGKVAADVLGLSDIGSVIQPKDYDKVDADDYVMHEDGEKIYFLI
FT                   KSKSDEYCFTNRALIHLDGTSAASKKRTLRRYDYYKHPISDVSLETAGTVDLDAEIKFK
FT                   IGPHSYSIDVHKKHIEELKDLYKSLLAIAEICHENEMKFHYAERSLELATKVFANMRGD
FT                   GANVSADFQAVNEYAFRWLTEAKKNYTVKDFGFVFDKYIQQ"
FT   gene            428122..428586
FT                   /locus_tag="GYMC61_0415"
FT   CDS_pept        428122..428586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0415"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bca:BCE_0596 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77097"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACX77097.1"
FT                   /translation="MDKHQQAIITVSAYITNDTGEVLLVKSYDRSDTWEMPGGQVEPGE
FT                   PLDRAVHREVYEETGVDIRLIGVSGVYYNETKNIINIVFKATYVKGNVSPQPEEIQKAK
FT                   FVLIDESNIDEYVTWPHLKSRVLDAMKRECSVPYETWVMNPSRLSARVGR"
FT   misc_binding    428670..428869
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 128.50"
FT   gene            429010..429966
FT                   /locus_tag="GYMC61_0416"
FT   CDS_pept        429010..429966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0416"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: gka:GK2266
FT                   ferric ion ABC transporter (ferric ion-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77098"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACX77098.1"
FT                   /translation="MKRWTWPAVVAVFFLLAAVLVGCGGANGSTEPAKKEEPKTEQAAF
FT                   PVTVKDGLGEDVTIKAEPKKIVSLIPSNTEIAYALGLGDKIVGVSDFDNYPEDVKTKTK
FT                   IGGMEFNVEKIISLKPDLVLAHASSAHNSRDGLKQLKDAGITVLVVNDAKSFDDVYASI
FT                   ELIGKATGTTDKAKQVIKDMKEKLAQIQEKAKQIPADKQANVWIEVSPPPQLYTAGKGT
FT                   FMDEMLQVISAKNVAGSLEGWPMVTEEKAVAYKPDVIITTYGGAKQVFARAAWKDVPAV
FT                   KNKRVYDVNTDLVSRPGPRLVEGVEELAKAIYPDVFK"
FT   gene            429953..430987
FT                   /locus_tag="GYMC61_0417"
FT   CDS_pept        429953..430987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0417"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gka:GK2265 ferric ion ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77099"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACX77099.1"
FT                   /translation="MCSSKTWMYILAVTAAMLSLLVGISTGSLSIPFSSIVRILASEWF
FT                   GMPLPSDIPADWVPIVMAIRLPRVVLAFLVGASLALAGAAFQGLLKNALADPYTLGVSS
FT                   GASVGAVLVIFLGWQWPLFGTFTLPIVSILCGMATLVAVLAFTRAVEPQLSVETIILAG
FT                   IIFGAFFSAFISLMIALTGEELRQIISWLMGSVAMRGWKYSGLLLPFFLIGAAVLLANG
FT                   RELNAFAFGEAAALHVGVDVTRRKVIILTAAALLTGAAVSVSGTIGFVGLVVPHMVRLV
FT                   CGPNYRGLLPLSLLYGGAFLVLADVAARTIIEPRELPIGVITALIGAPLFAVLFFRKMK
FT                   RKMG"
FT   gene            430984..432456
FT                   /locus_tag="GYMC61_0418"
FT   CDS_pept        430984..432456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0418"
FT                   /product="protein of unknown function DUF105"
FT                   /note="PFAM: protein of unknown function DUF105; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: gka:GK2264
FT                   ferric ion ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77100"
FT                   /inference="protein motif:PFAM:PF01955"
FT                   /protein_id="ACX77100.1"
FT                   /translation="MMMLEVRAVSHRYGPKQVLDRVTFSVEKGELFGIVGPNGSGKTTL
FT                   LKLICKELPLASGEIKIHGQPLLALSAKQWARFAAVLPQTAEAAAGYTVRETVALGRYA
FT                   HQRGLFPTWTKEDEAAVQEALRAVGLADKIDEPLERLSGGERQRAYLARALAQKPQLLL
FT                   LDEPTNHMDVSGQVRLLDRLAEAARSRDLTVVAVFHDMNVASLYCDRVLVLKEGKTAAL
FT                   GTPTDVMTPALLEEVFAAPIVRLAHPAAAKPMFSFVPKGKQEESSAGGLRLSFLDDAAV
FT                   LASCQPLRVLSSALIGAGFQWATHFVNRQVGLDYDCGDAEGDMRRYLEQHGFSPERTIG
FT                   MMTAVDVRDAVWLQKEGEAFSVAVMATAGVGNAVDAARAWQHKPLAARPGTINMVIVID
FT                   GVLTEAAFVQAMMTATEAKVKALADRSVCDPETRTLATGTSTDSLAVAATQTGRTFAYA
FT                   GTATELGRAIGRLVYEATIEALDRYKRRRGRR"
FT   gene            432453..433427
FT                   /locus_tag="GYMC61_0419"
FT   CDS_pept        432453..433427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0419"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: gka:GK2263
FT                   cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77101"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ACX77101.1"
FT                   /translation="MTHLLAMTLALLLDALLGDPRWLPHPVRGMGTLIAWLDRRWNQGT
FT                   KRRAKGAAAVAVVLAAVYGVSALVVYVGYALSVYVGVAIEAALIFTTIATKSLAEAAED
FT                   VRRPLEAGDLPEARRALSMIVGRDTERLDEAGITRACVETVAENTSDGITAPLFYAALG
FT                   GAPLAMLYRAVNTCDSMLGYKNETYREFGWAAARLDDALNYIPARMTALVMVLVCGGRR
FT                   LRLALSILFRDARRHPSPNSGWPEAAMAGLLGVQLGGTNTYGGVVSERPTLGDPDVPLR
FT                   SVHIRQAVGIMIRTVLAFTLLLLWIGGMIVALAGAWGESARVV"
FT   gene            433384..434454
FT                   /locus_tag="GYMC61_0420"
FT   CDS_pept        433384..434454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0420"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /note="TIGRFAM: L-threonine-O-3-phosphate decarboxylase;
FT                   PFAM: aminotransferase class I and II; KEGG: gka:GK2262
FT                   histidinol-phosphate aminotransferase 1 (imidazole
FT                   acetol-phosphate transaminase 1) (cobalamin biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77102"
FT                   /inference="protein motif:TFAM:TIGR01140"
FT                   /protein_id="ACX77102.1"
FT                   /translation="MRWPAHGANPRALYEQCGLAPPNEYIDFSVNTNPYRLPPSAWPSG
FT                   EEWIRWAGEYPDSEAKALRELVAKQEQIRPGQVLVTNGAAEAIYLLAALLAGRRVGILE
FT                   PTFSEYRRACLAYGCEVKSLLAEENRGFSYDIDQAAVWAAECDAVFFCHPNNPTGTVMP
FT                   ERDLRSLVAAADQAGTYIVVDEAFYPFWRGGFTAMRWLDRYPRLIVLRSLTKIHHLAGA
FT                   RLGYVAADEAVIASLKTHQPPWSTNCIAQQLALRFMAMESFVKWTKERIAAERERVFRS
FT                   LPAGRYAVSPSVVNFYLLRPLSGRTEDLFFYLLQQGIVPRHTMNFPGLDGRYVRLAVKT
FT                   QVENDRLLEALARWSG"
FT   gene            434451..435008
FT                   /locus_tag="GYMC61_0421"
FT   CDS_pept        434451..435008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0421"
FT                   /product="cobalbumin biosynthesis protein"
FT                   /note="PFAM: cobalbumin biosynthesis protein; KEGG:
FT                   gka:GK2261 bifunctional cobalamin biosynthesis protein
FT                   (cobinamide kinase; cobinamide phosphate
FT                   guanylyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77103"
FT                   /inference="protein motif:PFAM:PF02283"
FT                   /protein_id="ACX77103.1"
FT                   /translation="MMVFISGAARSGKSEAAEACAIRLSRGGRLHYIATAQAMDEEMEA
FT                   RIRRHQERRAAQAAHWTVWEAPFSSQEIAASLRPDDVVLLDCLTAWLAYELFSGEHWKT
FT                   EEDDRATARRLLDGVRAWDAACRAVVIVSNELFAGGVPDDPGTFRYMKTLGSLHQQLVA
FT                   EAAAAAVVECGLLRVKKGRWPG"
FT   gene            435005..435793
FT                   /locus_tag="GYMC61_0422"
FT   CDS_pept        435005..435793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0422"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /note="PFAM: cobalamin-5-phosphate synthase CobS; KEGG:
FT                   gka:GK2260 cobalamin-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77104"
FT                   /inference="protein motif:PFAM:PF02654"
FT                   /protein_id="ACX77104.1"
FT                   /translation="MKQAWNGWLLALQLFTTIPIRRSIEWNAAHVRWLVRCMPLAGALI
FT                   GALSAGVYALFSSFSFSSPLVWALLLLWLGIWMAGGMHADGFMDVSDAFFSYRDVKRRQ
FT                   EIMSDSRVGAFAVLSLICLLSFRWLFLYESLQTGVPPALFAAVPLLSRAGAAWLLSVGK
FT                   LAKPTGMAASLREYSSWRDAIWALGLAFVLLSLLCASTAISVQTGAALAAAAVVLAAAA
FT                   KPWAEKQFGGITGDVLGALIEGGETVLWGVIWLLHSSVMG"
FT   gene            435751..436383
FT                   /locus_tag="GYMC61_0423"
FT   CDS_pept        435751..436383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0423"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: gka:GK2259
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77105"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACX77105.1"
FT                   /translation="MGRHLALTLIRHGMTEQNRRRAYIGWTDAPLAAAERNRLCRLQLE
FT                   RPYPVDCMVTSDLHRCRETAALLFGGRGADWCTSRWRELHFGAWEGKTFAELEAEPAYR
FT                   QWLASPFSAAPPGGERYADFQARIKQALAETIAFAERAGARHVAVITHGGPIRLLLEQY
FT                   APDARSFWEWEVPFAGGYTLESTIERWKGGERCISLSAVRFKENENG"
FT   gene            436335..436751
FT                   /locus_tag="GYMC61_0424"
FT   CDS_pept        436335..436751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77106"
FT                   /inference="similar to AA sequence:KEGG:GK2258"
FT                   /protein_id="ACX77106.1"
FT                   /translation="MHFVIGGAFQGKRKWVRERYGINDGVHIVWHNGYLEPYRPPDGIE
FT                   TAKTVVFDGLEAAIRPCPDPDEWESYFRAWQRWEAAVSGRTVVWIGTDVTQGVVPVDPQ
FT                   ERRWRDAVGMCYQRLASLCCRVDRIWCGLAERLK"
FT   gene            436766..437344
FT                   /locus_tag="GYMC61_0425"
FT   CDS_pept        436766..437344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0425"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: gka:GK2257
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77107"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACX77107.1"
FT                   /translation="MKLYTRTGDQGKTSLVGGRVDKDHLRVEAYGTIDEANSFIGWALA
FT                   LLAGDERFRDLCAELQKIQHELFDCGGDLAIVNGKLPYKVTEAMVTFLEERIDAHVQEA
FT                   PPLQKFILPGGSKAAAALHMARTVARRAERCIVSLQKAEPINDVVLKYMNRLSDYLFAA
FT                   ARVVNARLGVKDIEYERSAIVFRDKEEKQ"
FT   gene            437341..437829
FT                   /locus_tag="GYMC61_0426"
FT   CDS_pept        437341..437829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77108"
FT                   /inference="similar to AA sequence:KEGG:GK2256"
FT                   /protein_id="ACX77108.1"
FT                   /translation="MTRRLAWTAVCLALSAIGSFIKLPTFVGSIALDSAPALVAAGVLG
FT                   PRAGAAVAGLGHLVSALVGGWPLGPFHWLVGLEMAGLGALFSVLYQRGWKIGSAVVFFI
FT                   GNAFLAPLPLAVSFSWPFVFAVIPPLSAAAAVNVLIAVAIMPVVVRLAAKAGVEAPHA"
FT   gene            437822..438538
FT                   /locus_tag="GYMC61_0427"
FT   CDS_pept        437822..438538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77109"
FT                   /inference="similar to AA sequence:KEGG:GK2255"
FT                   /protein_id="ACX77109.1"
FT                   /translation="MRDVLFLPFADGMELAVAADGSAAVGDKPGDVVSAPADVVAYFAA
FT                   RVALMELVSVGAEAKAVVLQNFIADDRWEALCRGVRRTCRELGIDLPITGSTESNFPTV
FT                   QSALGVTAIGTVANERKRIGITPEEAKFAVIGRPLVGSAVLSHPEWVAPLPLFAALLRT
FT                   PYIYELIPIGSKGIYYEWTQLLAANGRQGRACACPLPLFSSGGPATSVLVSYDPDGERE
FT                   IKKQAGSLFFPLHVEW"
FT   gene            438653..439198
FT                   /locus_tag="GYMC61_0428"
FT   CDS_pept        438653..439198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0428"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   gka:GK2254 RNA polymerase sigma factor SigX"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77110"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACX77110.1"
FT                   /translation="MDPVFEQLYEKYHDDLFNFLFYMVRNREQAEDLVQEVYVRVLRSY
FT                   KRFKGQCSEKTWLLSIARHVAIDFFRKQKRRRQWAGSAEWSEEQIGADEPIPEEMAIQN
FT                   EEIQLMYRGLARCTVDQRLVLVLRFIQSLSIAETAEALGWTESKVKTTQHRALKALKQY
FT                   MEEEAKQEGWRCEKAQLE"
FT   gene            439176..440270
FT                   /locus_tag="GYMC61_0429"
FT   CDS_pept        439176..440270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0429"
FT                   /product="negative regulator of sigma-X activity"
FT                   /note="KEGG: gka:GK2253 negative regulator of sigma-X
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77111"
FT                   /inference="similar to AA sequence:KEGG:GK2253"
FT                   /protein_id="ACX77111.1"
FT                   /translation="MKKLNWNERCIEHGLEQLPVIKDRRTKEEVYVRLVRAQRMARWKR
FT                   RWLPAVASAAVLASAVYAGPHFIVPTRSDKNEASSSPVQTLEADGASSHPKAMMAASEP
FT                   ANAVVIALPDERIGQVVPVVVPLPGRFASAERLSAALGELARSPLREASAWLDGVKMAP
FT                   AAGDGRVWVVRVPASHRVFAASHEEQRLFFDAVMETVRQMGGRSIRFFTGEEEGLDLPV
FT                   LGRLKTTKINQQKRMYYQNRSSSFGYTVLIPAPGSARSFPEALKQMKKSTIHGLEPAIP
FT                   PGVEVDSVDVDARHATVRLHLSARPSAEEAASMAEAVLLTAKEFGLLDVTFESSGLSTL
FT                   GPYPLGKPINVPVGPNAALLATGP"
FT   gene            440380..440472
FT                   /locus_tag="GYMC61_0430"
FT   CDS_pept        440380..440472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77112"
FT                   /inference="similar to AA sequence:KEGG:GK2249"
FT                   /protein_id="ACX77112.1"
FT                   /translation="MEMGDVMRRLLAVAGVAVCVGLLFLVGANG"
FT   gene            440556..441368
FT                   /locus_tag="GYMC61_0431"
FT   CDS_pept        440556..441368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0431"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /note="TIGRFAM: histidinol phosphate phosphatase HisJ
FT                   family; PFAM: PHP domain protein; KEGG: gka:GK2248
FT                   histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77113"
FT                   /inference="protein motif:TFAM:TIGR01856"
FT                   /protein_id="ACX77113.1"
FT                   /translation="MLTDYHNHLERGTLTLDYLRQFTDAAVKKGIQHFGISEHAYHFYQ
FT                   TRNILSNPWVDARRCYDMDDYVRLFHEAWDAGLDVKMSIEMDYTPGKHEEMAAFIRSYE
FT                   FDYVIGSIHWVDDFGIDLAEYRHEWERRDLYDTYRKYFDQVVTLAESNLFDIIGHLDLV
FT                   KIFQYVPEDEEFLLEQYDRATTALANSKTCVEISTAGLRKPVGELYPDPRLLKMCYDKG
FT                   IPIVLSSDAHVPEHVGADFDKAVELARSVGYTELMTFSKGERKAVPLG"
FT   gene            complement(441630..443204)
FT                   /locus_tag="GYMC61_0432"
FT   CDS_pept        complement(441630..443204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0432"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: gka:GK2247 D-3-phosphoglycerate dehydrogenase;
FT                   TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77114"
FT                   /inference="protein motif:TFAM:TIGR01327"
FT                   /protein_id="ACX77114.1"
FT                   /translation="MFRVLVSDAISEEGLAPLCASAQIDIVQKKTTEAEEELHTFDALL
FT                   VRSATKVTEELLEKMPNLKIIGRAGVGVDNIDVDAATKRGIVVINAPNGNTISAAEHTF
FT                   AMMAALVRRIPQAHISVKSREWNRSAFVGNELFGKKLGIIGFGRIGSEVAKRARAFGMS
FT                   VHVYDPFLTKERAEKLGVSIHSLDEVLAVADIITVHTPLTKETRGLLGTENLAKTKKGV
FT                   YLINCARGGIIDEQALIPFLESGHVAGVALDVFEQEPPGDHPLLAFDNVIVTPHLGAST
FT                   VEAQLNVATQVAEELLHFFEGRPVTSSINLPALSKDVYEKIQAFYHLGRKLGLIASQFM
FT                   NIPVQELSVTYAGTVADLETTYITRSLLAGFLRPRVASTVNEVNAAMVAKERGITYGEK
FT                   FSDETHGYANCISLTVHGENKTFTIKGTHVPNYGDRIVHFDGVAIDFAPEGHLLYIQHQ
FT                   DRPGMIGKVGNVLGAHDVNIATMQVGRQEAGGKAMMILSLDKPVDDEVLQALAQIDDIE
FT                   TVKRLEA"
FT   gene            complement(443426..443929)
FT                   /locus_tag="GYMC61_0433"
FT   CDS_pept        complement(443426..443929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0433"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: gka:GK2246
FT                   inorganic pyrophosphatase (pyrophosphate
FT                   phospho-hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77115"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACX77115.1"
FT                   /translation="MAFENKIVEAFIEIPTGSQNKYEFDKERGIFKLDRVLYSPMFYPA
FT                   EYGYLQNTLALDGDPLDILVITTNPTFPGCVIDTRVIGYLNMVDSGEEDAKLIGVPVED
FT                   PRFDEVRSIEDLPQHKLKEIAHFFERYKDLQGKRTEIGTWEGPEAAAKLIDECIARYNE
FT                   QKNK"
FT   gene            complement(444094..444342)
FT                   /locus_tag="GYMC61_0434"
FT   CDS_pept        complement(444094..444342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0434"
FT                   /product="ferredoxin (4Fe-4S)"
FT                   /note="KEGG: gwc:GWCH70_2195 ferredoxin (4Fe-4S)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77116"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2195"
FT                   /protein_id="ACX77116.1"
FT                   /translation="MPKYTIVDKETCIACGACGAAAPDIYDYDEDGIAYVTLDDNQGIV
FT                   EVPEILIDDMMDAFEGCPTESIKVADEPFDGDPNKFD"
FT   gene            444597..445643
FT                   /locus_tag="GYMC61_0435"
FT   CDS_pept        444597..445643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77117"
FT                   /inference="similar to AA sequence:KEGG:GK2244"
FT                   /protein_id="ACX77117.1"
FT                   /translation="MRHGYASFLLAHCLRRFNGERTLAAVYHLFSGKKSAQTLQDSKWF
FT                   QLEPLFGTWKNVTMAALEEAAMALVEQRLALSAKQRTYTLTAAGEEWLAEQAALFPRHL
FT                   NGWRYHEAEPLFWQRLSLIGQTLSNLVYGRRFAPICRDERTLQWVKQYLLAKGSRQMLA
FT                   ETLYQELIRLLEAVSEEAAVIFTLRLTSAVRIGWTMEQIAAHLQKDALYVQFQFRNVLH
FT                   YIMAEAEAGRAPMMAELMSGLAPAVLTQSAQKTYEWLRKGKTIEDISKLRRLKRSTIED
FT                   HVVEIAANVSGFSIAPFVDDEKEAAIRAAAQALRTRKLKEIREALDGKVSYFEIRLVLA
FT                   KEVGRWTS"
FT   gene            445631..447142
FT                   /locus_tag="GYMC61_0436"
FT   CDS_pept        445631..447142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0436"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="KEGG: gka:GK2243 ATP-dependent DNA helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family; PFAM:
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77118"
FT                   /inference="protein motif:TFAM:TIGR00614"
FT                   /protein_id="ACX77118.1"
FT                   /translation="MDELTKTLRMKFGHASFRPGQREVAEDVLAGRDVLAMLPTGSGKS
FT                   LCYQLPAYLLQGSVLIVSPLVSLMEDQVEQLRRRGEKRVIAFHSLLDAEEKWQALASLA
FT                   EFRFIYASPEMLQSAKFLTALRRVCISLFVVDEAHCISQWGYDFRPDFLKLGEIRRALG
FT                   APPCLALTATAPPEVQEDIIRTLGMDGARRHIHSVDRPNIALCVEHCSSTEDKAARLAD
FT                   YAKRLEGPGIIYFSSRQWAEEMARRLEQCGAGRVAYYHAGMDGEQRLLVQQQFVYGQLD
FT                   IVCCTSAFGMGVNKENVRFVLHFHMPAQLEAYVQEIGRAGRDGAPSLAVLFYADGDRTM
FT                   AQAVAEAELLSPRELREWCRRLPEGAGWEAAMATLEAAGFTDVQKRLLAYFLEREQRAM
FT                   PGWLTAEAKERLYGRMAAAIEARRRWKRKKLQEMDEWVHLSSCRRQALVRAFGEELTDQ
FT                   RNVCCDRCGLRLDVYMRAARHPAAAPIGHWREELWRMFFSGGAAR"
FT   gene            447139..447708
FT                   /locus_tag="GYMC61_0437"
FT   CDS_pept        447139..447708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0437"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: gka:GK2242
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77119"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACX77119.1"
FT                   /translation="MRRQSEQIQHMTDREVLFHLYVTQGLLLLAAGGCSLFLFDWAEWR
FT                   RLWRFDLTDVLLYGAGGAALVLAVDFLAMRYLPDDWHDDGGVNEKIFRGRSIPHLFFLC
FT                   ALIAVTEEWLFRGVVQTHWGLGAASVVFALLHVRYLEKWFLFLMVMLVSLFLGMLYEQT
FT                   GSLWVTITAHFLIDFVLALHIRSGEE"
FT   gene            447713..448255
FT                   /locus_tag="GYMC61_0438"
FT   CDS_pept        447713..448255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0438"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: gka:GK2241 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77120"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACX77120.1"
FT                   /translation="MGRTEESRTRRSLRLDESAPSSRIKRRRKKEEQKRKYVPSRLLLF
FT                   LFLILPAAVLAIHHVQSKSGSVTVVRHEERGGETVRIIRDDEVKGTEQAAKPKQKGAAD
FT                   RGSVGGWEKTEQWGKTDDEQGKIITHVVAANETLYSIAMKYYGTPDAIDLIKKENGLST
FT                   GRLQPGQTLRIPLRGEQ"
FT   gene            448365..448811
FT                   /locus_tag="GYMC61_0439"
FT   CDS_pept        448365..448811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77121"
FT                   /inference="similar to AA sequence:KEGG:GK2240"
FT                   /protein_id="ACX77121.1"
FT                   /translation="MVHFPDEFPIDEVAKEMLLAVIEKKKKWERLEKRVLLLQAAAFSG
FT                   LAVFLLYLLAKAAAFETWSERVAWFFAAPAHVLILLLLSTVYWAAVYYKGKSEKAEDDF
FT                   QALRCEIIQKSIDLWKDEEQWSRRHRLFEWMKREYDINLYYEQS"
FT   gene            complement(448839..449408)
FT                   /locus_tag="GYMC61_0440"
FT   CDS_pept        complement(448839..449408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0440"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: manganese containing catalase; KEGG:
FT                   gka:GK2239 spore coat peptide assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77122"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ACX77122.1"
FT                   /translation="MWIYEKKLQYPVRVSTCNPRLAKYLIEQYGGADGELAAALRYLNQ
FT                   RYTLPPKVIGLLNDIGTEELAHLEMIATMVYKLTKDATPEQLKEAGLEPHYVDHERALF
FT                   YHNAAGNPFTATYIQAKGDPITDLYEDIAAEEKARATYQWIINMSDDPDLNDGLRFLRE
FT                   REIIHAQRFREAVEILKEERSHKKVF"
FT   gene            complement(449444..449704)
FT                   /locus_tag="GYMC61_0441"
FT   CDS_pept        complement(449444..449704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0441"
FT                   /product="CotJB protein"
FT                   /note="KEGG: gtn:GTNG_2176 CotJB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77123"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2176"
FT                   /protein_id="ACX77123.1"
FT                   /translation="MKQMPKEYYEQLEELQAVDFALVELTLYLDTHPTDYQAIQQFNQL
FT                   AQKRKQLKKQFEAAYGPLEQFGHSYSNYPWNWDDTPWPWQV"
FT   gene            complement(449701..449931)
FT                   /locus_tag="GYMC61_0442"
FT   CDS_pept        complement(449701..449931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0442"
FT                   /product="CotJA protein"
FT                   /note="KEGG: gtn:GTNG_2175 CotJA protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77124"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2175"
FT                   /protein_id="ACX77124.1"
FT                   /translation="MFTTRKQYEPYISPFDPCPPIRVKTYVTAPNLYVGFQPPNLPQFP
FT                   LREALMKGTLWQVFYDPYYSPYETKTKGDGS"
FT   gene            450038..450430
FT                   /locus_tag="GYMC61_0443"
FT   CDS_pept        450038..450430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77125"
FT                   /inference="similar to AA sequence:KEGG:GK2237"
FT                   /protein_id="ACX77125.1"
FT                   /translation="MGRLSMTAMAAVLYTYLFFRWLPPLEPFSPTLFLTQLLFSPFRTW
FT                   LAFACFLLGVAANGALLSIAVTGTVRLLSGRRLRLGQWLLSLAALGHFYWAFQFHWRLA
FT                   ALFFVFSFFYGMMTLRGRQTMPHRWP"
FT   gene            450588..451178
FT                   /locus_tag="GYMC61_0444"
FT   CDS_pept        450588..451178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0444"
FT                   /product="Negative regulator of genetic competence"
FT                   /note="PFAM: Negative regulator of genetic competence;
FT                   KEGG: gka:GK2236 adaptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77126"
FT                   /inference="protein motif:PFAM:PF05389"
FT                   /protein_id="ACX77126.1"
FT                   /translation="MRLERLTHNKIKIFLTFDDLLDRGLTKDDLWKDTFKVHQLFRDMI
FT                   EEASEELGFEVNGSIAVEVYSLPAQGMVVIVTNEGDYDDMEEEFADDYIEMQVTLDESD
FT                   DIFYEFQTFEDVIQLAHRLHAVGCLDGTLYSYQGRFYLHVPEEPPIPLDNFVALLAEFG
FT                   NPATITIHRVQEYGKRLIERRAIEQLVRYFRAN"
FT   gene            451338..452609
FT                   /locus_tag="GYMC61_0445"
FT   CDS_pept        451338..452609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0445"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   gka:GK2235 NAD-specific glutamate dehydrogenase (NAD-GDH)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77127"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACX77127.1"
FT                   /translation="MAADKHTEEKEQQYDVLASTQIVIHRALEKLGYPEEVYELLKEPI
FT                   RVLTVRIPVRMDDGSVKIFTGYRAQHNDAVGPTKGGVRFHPDVTEREVKALSIWMSLKC
FT                   GIVDLPYGGGKGGIVCDPRTMSFRELERLSRGYVRAISQIVGPTKDIPAPDVFTNSQIM
FT                   AWMMDEYSRIREFDSPGFITGKPLVLGGSHGRETATAKGVTICIREAAKKRGLSLKGAR
FT                   VVVQGFGNAGSYLAKFMHDAGAKVVGISDVYGALYDPNGLDIDYLLERRDSFGTVTKLF
FT                   KNTISNQELLELDCDILVPAAIENQITAENAPRIKASIVVEAANGPTTLEATEILTQRG
FT                   ILLVPDVLASAGGVTVSYFEWVQNNQGYYWTEEEVEQRLEKVMVKAFNNVYEMAQTRRV
FT                   DMRLAAYMVGVRKMAEACRFRGWV"
FT   gene            452699..453691
FT                   /locus_tag="GYMC61_0446"
FT   CDS_pept        452699..453691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0446"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: gka:GK2234
FT                   thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77128"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACX77128.1"
FT                   /translation="MKEEKIIIVGGGPCGLAAAIALQDAGFSPLVIEKGNIVHSIYRFP
FT                   THQTFFSTSDRLEIGGVPFITENQKPTRNQALAYYREVVVRKQVRVNTFEEVKAVKPQE
FT                   DGAFLIETTKGTYRAQYVVIATGYYDHPNYMNVPGEELPKVMHYFKEAHPYFNTDCVVI
FT                   GGKNSSVDAAMELVKAGARVTVLYRGNEYSKSIKPWILPEFDSLVKKGVIRMEFRAHVK
FT                   AITEDAVVYEVDGETKTIKNDFVFAMTGYRPDHRFLMNIGVQIDPESGRPHYDPETMET
FT                   NVPGVFIAGVIAAGNDANEIFIENGRFHGDAIAACIAKREREGAAKQLQ"
FT   gene            453910..454881
FT                   /locus_tag="GYMC61_0447"
FT   CDS_pept        453910..454881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0447"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: gka:GK2233
FT                   L-asparaginase (L-asparagine amidohydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77129"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ACX77129.1"
FT                   /translation="MTKRKVVLLTTGGTIASKRNERSGRLRAGALSGEELAAMCHLPKE
FT                   IEIIVESVFQLPSMHLTFSHWLELKKRIEAHFTDPSVDGIVVTHGTDALEETAYFLDLT
FT                   IDDPRTIVVTGSQRAPSDLGSDVYINIRHAIYAACAEPLRGAGTVVVFNERIFAAKYVK
FT                   KEHASNIQGFNAFGFGYLGIIDNDEVYVYQKPIRREYYKLVRPLPPVDIVKCYLEADGK
FT                   FIKAARESGVAGIVLEGVGRGQVAPKMVDEIVKAIEAGIKVVVTTSAEEGAVYTTYDYP
FT                   GSAYDLHKKGVILGSDYDAKKARIKLAVALAADAAVDGLFAY"
FT   gene            454970..455647
FT                   /locus_tag="GYMC61_0448"
FT   CDS_pept        454970..455647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77130"
FT                   /inference="similar to AA sequence:KEGG:GK2232"
FT                   /protein_id="ACX77130.1"
FT                   /translation="MFSLISAGVAPGVALLSYFYLKDEYEAEPLSFVLRMFLFGVLLVF
FT                   PIMFIQYVLAAEGIVASPAAEAFLSAALLEEFVKWFVVYFFVYDHDEFDEPYDGIVYSA
FT                   SVSLGFATLENILYLLANGVETAIARALLPVSSHALFSVIMGFYFGKAKFAVKKRRYYL
FT                   WASFLLPFFLHGVYDWLLLAKERWGYYMGLFMLALWWAALRKVKQAKGYARPQAVPPVK
FT                   SQA"
FT   gene            455739..456542
FT                   /locus_tag="GYMC61_0449"
FT   CDS_pept        455739..456542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0449"
FT                   /product="spore cortex-lytic enzyme"
FT                   /note="TIGRFAM: spore cortex-lytic enzyme; PFAM: cell wall
FT                   hydrolase SleB; Peptidoglycan-binding domain 1 protein;
FT                   KEGG: gka:GK2231 sporulation specific
FT                   N-acetylmuramoyl-L-alanine amidase (spore cortex-lytic
FT                   enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77131"
FT                   /inference="protein motif:TFAM:TIGR02869"
FT                   /protein_id="ACX77131.1"
FT                   /translation="MARKWVLFIALAVWTCMYPSGHAFAFSPQVIQRGAVGDDVIELQA
FT                   RLQYLGFYNGKIDGVFGWRTYWALRNFQYEYGLPVDGLAGSETKRKLVNASKYYEQFVK
FT                   EQIRQGNDFTHYGGIPLSQQVKKRGGGSAGSVRAAKTTASNVPKGFSQNDIRLMANAVY
FT                   GEARGEPYIGQVAVAAVILNRLEHPSFPDTVAGVIFQPGAFTAVADGQIWLTPNETAKK
FT                   AVLDAINGWDPTGGAIYYFNPATATSSWIWSRPQIKRIGNHIFCK"
FT   gene            456558..457901
FT                   /locus_tag="GYMC61_0450"
FT   CDS_pept        456558..457901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0450"
FT                   /product="germination protein YpeB"
FT                   /note="TIGRFAM: germination protein YpeB; PFAM: Propeptide
FT                   PepSY amd peptidase M4; KEGG: gka:GK2230 sporulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77132"
FT                   /inference="protein motif:TFAM:TIGR02889"
FT                   /protein_id="ACX77132.1"
FT                   /translation="MVRNLLIAALVVAVVGTGYWGYREHQEKNAILIHAENNYQRAFHD
FT                   LAYQIDLLHDKLGATLAMNSHASLSPALAEVWKIASEAHTDVGQLPLSLLPFNKTQEFL
FT                   SKIGEFSYRTAVRDLEKEPLTEEEHKTLEALYKSAGAIRQELRNVQHLVLENNLRWMDV
FT                   ELALATNDEKGDNIIIDGLKAVEKNVDTFSSSSEFGPSFIGLANEEKGFVRAKGRPISK
FT                   DEAKRIAREFLGLKGTEKIKVTESGNGADERFYSLTIHAPKTKGDIYMDVTKNGGYPIW
FT                   ALNSRPIGKPKISLHEAANRGMAFLRRHQFTGFELYDSTQYDNVAVLTFVKSENGVRIY
FT                   PEAIQMKVALDNGHVVGFTARDYLSSSIPRPLPKPTLTVEAAKKKLNPHLKVMEERQAV
FT                   IMNDLQKPVLCYEFLGTLGDETYQLFINAATGLEEKVEKLESVEPNYR"
FT   gene            458055..458723
FT                   /locus_tag="GYMC61_0451"
FT   CDS_pept        458055..458723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0451"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG: gka:GK2229
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77133"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ACX77133.1"
FT                   /translation="MIKIGDSIRLEPSDGSARQYRSKALAVADGAVHISYPIDEQSGKT
FT                   VYLLNGMQFKATFVGQDGGLYMFDTEVKGKIRDPLPMVVLAYPGEEYVVRIQRRRYVRV
FT                   KANVDAAVHPSDSEFAPFVTMTVDISAGGAALLVPPAHAPLLRPGMAVELWLVLAMRSG
FT                   EYHYVQTKASIVRMADDERGMAKMSVEFTDLAPQDRVRLIRYSFERQLEERKWENEQNK
FT                   "
FT   gene            458776..458955
FT                   /locus_tag="GYMC61_0452"
FT   CDS_pept        458776..458955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77134"
FT                   /inference="similar to AA sequence:KEGG:GK2228"
FT                   /protein_id="ACX77134.1"
FT                   /translation="MKRIEQLLWKLVVIQTICLLIAQWLVLYTPAALYIGKVYEYEGVA
FT                   KPEKTKTVETAVDR"
FT   gene            459054..459728
FT                   /locus_tag="GYMC61_0453"
FT   CDS_pept        459054..459728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0453"
FT                   /product="cytidylate kinase"
FT                   /note="TIGRFAM: cytidylate kinase; PFAM: cytidylate kinase
FT                   region; KEGG: gka:GK2227 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77135"
FT                   /inference="protein motif:TFAM:TIGR00017"
FT                   /protein_id="ACX77135.1"
FT                   /translation="MKRRISIAIDGPAAAGKSTVAKRIARRLSYVYIDTGAMYRALTYR
FT                   ALACGVDIHDEQALLSLLRDTSIELKPSPHGQIVLVNGDDVTDIIRGEAVTNAVSLVAK
FT                   HPLVREEMVARQRSLAEGGGVVMDGRDIGTHVLPNAEVKIFLKASVEERARRRHEENLA
FT                   RGFPSDLEKLKEEIARRDRLDSERETAPLRKAPDAVEIDTTSLSIEEVVERIMEIVNER
FT                   IG"
FT   gene            459725..460318
FT                   /locus_tag="GYMC61_0454"
FT   CDS_pept        459725..460318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0454"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: gka:GK2226
FT                   1-acylglycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77136"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACX77136.1"
FT                   /translation="MTVDFYSFAKGIVKGVLTPLYRIQTIGVEQFPKEGGVLLCANHIS
FT                   NLDPPVVGITAPRPIRFMAKEELFRAPVVKTLVKSLHAFPVKRGMNDRQALRTGLEVLK
FT                   QGEVLGIFPEGTRSKDGRLKKALPGVGFFALRTDAAVVPCAIVGPYRPFAPLKVVYGAP
FT                   IDMAPLRARKASPEEAADYIMDHIRRLLEEHQRA"
FT   gene            460498..461661
FT                   /locus_tag="GYMC61_0455"
FT   CDS_pept        460498..461661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0455"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   gka:GK2225 30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77137"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACX77137.1"
FT                   /translation="MTEEMNVQVNVYEVGDIVRGKVVKLEDKQVLVEVENSKQSGIIPI
FT                   SELSNLHIEKPSDAVAVGDEVTAKVKKVEEGKDGEEGLLILSKRAVDAERAWEDLERKF
FT                   ANGETFETVIKDIVKGGLVADVGVRGFIPASLVEPHYVEDFSDYKGKTLSVKVVELDRE
FT                   KNRVILSHRAVVEEEQARQQKELLSRLEPGQVLDGVVRRIADFGVFVDVGGFDGLVHIS
FT                   QLSHTRVAHPSEVVKEGDAVKVKVLAVDPENGRLSLSIKEALPGPWEGLSEKVKPGDVV
FT                   TGTVKRLASFGAFVEVFPGVEGLVHVSQIANRRIGSPHEVLKEGDVVKAKVLDVNEADH
FT                   RLSLSIRALLEEEAAAPAEDYSQYTRTSETRGFQLGEVIGEQLKKLK"
FT   gene            complement(462018..462152)
FT                   /locus_tag="GYMC61_0456"
FT   CDS_pept        complement(462018..462152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_1223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77138"
FT                   /inference="similar to AA sequence:KEGG:Bcer98_1223"
FT                   /protein_id="ACX77138.1"
FT                   /translation="MGKDRQEKKLKQSRRVESDRDQSLSYKGAARLDTPEEARERNEH"
FT   gene            462278..462874
FT                   /locus_tag="GYMC61_0457"
FT   CDS_pept        462278..462874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77139"
FT                   /inference="similar to AA sequence:KEGG:GK2224"
FT                   /protein_id="ACX77139.1"
FT                   /translation="MEGAYFYFFFWTLWIAATFLMKKTVERTKLAVFSLFMISSASMTV
FT                   KISPIHMAASFFVLFFSSCYVAVTQRPCGWLRMALSASGLAFAYAAFRLLALFDPVWIW
FT                   LDGQWMLGWWMALISSLFHRRISARLLCLALGGCQGEVVYAMSILRMAPGYVLGSFSFL
FT                   DALAISASSLLVWESIRFFSLQLEEKRPVRRTRQP"
FT   gene            462871..463773
FT                   /locus_tag="GYMC61_0458"
FT   CDS_pept        462871..463773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77140"
FT                   /inference="similar to AA sequence:KEGG:GK2223"
FT                   /protein_id="ACX77140.1"
FT                   /translation="MNEYTFPILYGVAAGVLTRLYLLRTDYRQYPTYLHGRTIHIALGA
FT                   IAAGLGTVAVPAIMEKEFAAITFLALAASQFRDVRNMERNTLNELDQYELVPRGKTYIE
FT                   GIAIVFEGRNYLVIFVSFLSTLFYLVWDIWAALAASIIGLMTARRFMSGSRLKDIAEVQ
FT                   YVKPHFEGAGLYVDNIYIMNIGLSARREEILRYGMGFILTPKNFNARTTIANLGQRQAI
FT                   LHDVSTALGIYRDSGTPALVPLAKRDLNDGRVGIFILPQVEDVEKAKAVIENVPVLESA
FT                   IRMPKKRRWKRKGWSGDDA"
FT   gene            463763..463948
FT                   /locus_tag="GYMC61_0459"
FT   CDS_pept        463763..463948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77141"
FT                   /inference="similar to AA sequence:KEGG:GK2222"
FT                   /protein_id="ACX77141.1"
FT                   /translation="MTHEKMILAVITMNGGRVAGGAPIFICQTKEEMEQIAANLEAILD
FT                   GIAHELSEGLLIIVKH"
FT   gene            464157..465467
FT                   /locus_tag="GYMC61_0460"
FT   CDS_pept        464157..465467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0460"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="TIGRFAM: ribosome-associated GTPase EngA; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Miro domain protein; KEGG: gka:GK2221
FT                   GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77142"
FT                   /inference="protein motif:TFAM:TIGR03594"
FT                   /protein_id="ACX77142.1"
FT                   /translation="MANPVVAIVGRPNVGKSTIFNRIVGERISIVEDVPGVTRDRIYSR
FT                   AEWLNHSFYLIDTGGIDIGDEPLLVQIRQQAEIAIDEADVIIFMTNGRDGVTAADEEVA
FT                   KLLRRSNKPVVLAVNKIDNPEMRDLIYDFYALGFGEPYPISGAHGTGLGDLLDAVVRHF
FT                   PKGGGQEYEEDVIKFCLIGRPNVGKSSLVNAILGEERVIVSDIAGTTRDAVDTSFVREG
FT                   QEYVIIDTAGMRKRGKIYESTEKYSVLRALRAIERSDVVLVVLNAEEGIIEQDKKIAGY
FT                   AHEAGRGVILVVNKWDAIEKDDKTMVEFERKIRDHFPFLDYAPILFVSAKTKQRLHKLL
FT                   PLVRLVSDNHAMRVQTNVLNEVIMDAVAMNPTPTHNGRRLKVYYMTQVAVKPPTFVAFV
FT                   NDPELMHFSYERFLENRIRDAFGFEGTPIKIIARPRK"
FT   gene            465918..466952
FT                   /locus_tag="GYMC61_0461"
FT   CDS_pept        465918..466952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0461"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE domain protein; NADP oxidoreductase coenzyme
FT                   F420-dependent; 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding; KEGG: gka:GK2220 NAD(P)H-dependent
FT                   glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77143"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACX77143.1"
FT                   /translation="MENIAVLGAGSWGTALALVLADNGHHVRLWGHRTEQINEINEKRT
FT                   NEKYLPGVRLPDAIIGYDDLCAALDDVAIVVLAVPTKAIRTVLADVRACLAKPITIVAV
FT                   SKGIEPGTHKRVSEMVAEEMGEWLADVVVLSGPSHAEEVVLRHPTTVAVSSPNMEAARR
FT                   IQDIFMNHHYFRVYTNPDLIGVEVGGALKNIIALAAGISDGLGYGDNAKAALITRGLAE
FT                   IARLGCALGANPLTFAGLAGVGDLIVTCTSVHSRNWRAGYMLGQGKKLDEVLESMGMVV
FT                   EGVRTTKAAYELAKELGVKMPITEALYDVLFAGKDPKEAVDSLMARGKKEEMDDLNNIF
FT                   AEQE"
FT   gene            467134..467337
FT                   /locus_tag="GYMC61_0462"
FT   CDS_pept        467134..467337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77144"
FT                   /inference="similar to AA sequence:KEGG:GK2219"
FT                   /protein_id="ACX77144.1"
FT                   /translation="MSPALAKMWIAIASMVFMFISVGFIYLSRYKVKMKWLRFLLALVA
FT                   YILLIFAGIIIIFVVFSGPTPQ"
FT   gene            467355..468077
FT                   /locus_tag="GYMC61_0463"
FT   CDS_pept        467355..468077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77145"
FT                   /inference="similar to AA sequence:KEGG:GK2218"
FT                   /protein_id="ACX77145.1"
FT                   /translation="MKRIARLLLSCICLALLSGCLYPQERLKQNQIPYKDQVAAVQSAV
FT                   DEYRKATGGLLPIKTRDMNTPMYLKYPVDFQKLVPRYMQEPPGNAYESGGVFQYMIIDA
FT                   ETNPTVKLLDLRLAERIRDLKLRLSMYTDKHKYPPFQDVVAPGVFTLDYKKLGYKEPPY
FT                   VVSPFSGNNLPFVIDGNGEIYIDYRSDLYAALKKYPHHYKPGDDIRPILTDHSLFVPAY
FT                   SLPYTIDAKTNEPIFFTK"
FT   gene            468234..469712
FT                   /locus_tag="GYMC61_0464"
FT   CDS_pept        468234..469712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0464"
FT                   /product="stage IV sporulation protein A"
FT                   /note="TIGRFAM: stage IV sporulation protein A; PFAM:
FT                   Sporulation stage IV protein A; KEGG: gka:GK2217 stage IV
FT                   sporulation protein A (spore cortex formation and coat
FT                   assembly)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77146"
FT                   /inference="protein motif:TFAM:TIGR02836"
FT                   /protein_id="ACX77146.1"
FT                   /translation="MEKVDIFKDIAERTGGDIYLGVVGAVRTGKSTFIKRFMELVVIPN
FT                   IKNEADKARAQDELPQSAAGKTIMTTEPKFVPNQAVTVKVDEGLEVNIRLVDCVGYAVP
FT                   GAKGYEDENGPRMIHTPWYEEPIPFQEAAEIGTRKVIQEHSTIGVVITTDGTIGEIPRQ
FT                   DYVEAEERVISELKEVGKPFIMIVNTVRPHHPETEALRRELAEKYDIPVLAMSVESMRE
FT                   ADVYNVLREALYEFPVLEVNVNLPSWVMVLREDHWLRESYQEAVRDTVKDIKRLRDVDR
FT                   VVQQFAEYDFIEKAALAGIEMGQGIAEIDLYAPDELYDQILKEIVGVEIRGKDHLLQLM
FT                   QDFAHAKAEYDQIADALKMVKQTGYGIAAPALSDMSLDEPEIIRQGSRFGVRLKAVAPS
FT                   IHMIKVDVESEFAPIIGTEKQSEELVRYLMQDFEDDPLSIWNSDIFGRSLSSIVREGIQ
FT                   AKLALMPENARYKLKETLERIINEGSGGLIAIIL"
FT   gene            470487..470759
FT                   /locus_tag="GYMC61_0465"
FT   CDS_pept        470487..470759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0465"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   gtn:GTNG_2149 DNA binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77147"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACX77147.1"
FT                   /translation="MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLI
FT                   GFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK"
FT   gene            470888..471454
FT                   /locus_tag="GYMC61_0466"
FT   CDS_pept        470888..471454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0466"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: gka:GK2214 GTP cyclohydrolase I; TIGRFAM: GTP
FT                   cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77148"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ACX77148.1"
FT                   /translation="MPEINFAQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFA
FT                   GLQEDPKQHFQTVFSEEHEELVLVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLS
FT                   KLARAVEAVARRPQLQERITATIADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKT
FT                   VTTAVRGVFETDANARAEVLSLIKA"
FT   gene            471467..471691
FT                   /locus_tag="GYMC61_0467"
FT   CDS_pept        471467..471691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0467"
FT                   /product="tryptophan RNA-binding attenuator protein"
FT                   /note="PFAM: tryptophan RNA-binding attenuator protein;
FT                   KEGG: gka:GK2213 transcription attenuation protein MtrB"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77149"
FT                   /inference="protein motif:PFAM:PF02081"
FT                   /protein_id="ACX77149.1"
FT                   /translation="MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQ
FT                   FTEHTSAIKVRGKAYIQTRHGVVESEGKK"
FT   gene            471754..472587
FT                   /locus_tag="GYMC61_0468"
FT   CDS_pept        471754..472587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0468"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase subunit 1;
FT                   KEGG: gka:GK2212 heptaprenyl diphosphate synthasecomponent
FT                   I (spore germination protein C1)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77150"
FT                   /inference="protein motif:PRIAM:2.5.1.30"
FT                   /protein_id="ACX77150.1"
FT                   /translation="MAVRIFFGGTRVRRVNDIMVKLASLKEQIERLLDHPYLRAHVPAP
FT                   AVDEDRLLLSLSMMTDAPAAPNEPDRCIIAMMLMQIALDTHDQVTDRGGDLRTRQLVVL
FT                   AGDLYSGLYYDLLARSGDVALIRLFAEAVREINEQKVRLYEKKVERIETLFAAVGTIES
FT                   ALLAKLAERIGAPQWGGFSGHYLLLRRLLLEQEAFVRTGSSMLFEQMAHIAFPWAKGLT
FT                   KEQKRHLLRLGERYIDHCKEALLAANLPMNDLLRFRMAELAGGFQAIVKKSVEEG"
FT   gene            472592..473296
FT                   /locus_tag="GYMC61_0469"
FT   CDS_pept        472592..473296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0469"
FT                   /product="2-heptaprenyl-1,4-naphthoquinone
FT                   methyltransferase"
FT                   /note="TIGRFAM: 2-heptaprenyl-1,4-naphthoquinone
FT                   methyltransferase; ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12;
FT                   putative methyltransferase; KEGG: gka:GK2211
FT                   ubiquinone/menaquinone biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77151"
FT                   /inference="protein motif:TFAM:TIGR02752"
FT                   /protein_id="ACX77151.1"
FT                   /translation="MHQSKEERVHRVFEKISAHYDRMNSVISFRRHLKWREDVMRRMNV
FT                   QKGKRALDVCCGTADWAIALAEAVGPEGEVYGLDFSENMLKVGEQKVKARGLGNVKLIH
FT                   GNAMQLPFPDNSFDYVTIGFGLRNVPDYMTVLKEMHRVTKPGGMTVCLETSQPTLFGFR
FT                   QLYYFYFRFIMPLFGKLLAKSYEEYSWLQESAREFPGRDELAEMFREAGFVDVEVKPYT
FT                   FGVAAMHLGYKR"
FT   gene            473312..474274
FT                   /locus_tag="GYMC61_0470"
FT   CDS_pept        473312..474274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0470"
FT                   /product="heptaprenyl diphosphate synthase component II"
FT                   /EC_number="2.5.1.30"
FT                   /note="KEGG: gka:GK2210 heptaprenyl diphosphate
FT                   synthasecomponent II (spore germination protein C3);
FT                   TIGRFAM: heptaprenyl diphosphate synthase component II;
FT                   PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77152"
FT                   /inference="protein motif:TFAM:TIGR02748"
FT                   /protein_id="ACX77152.1"
FT                   /translation="MKLKAMYSFLSDDLAAVEEELERTVRSEYGPLGEAALHLLQAGGK
FT                   RIRPVFVLLSARFGHYDFERIKHVAVALELIHMASLVHDDVIDDADVRRGRPTIKARWS
FT                   NRFAMYTGDYLFARSLERMAELDSPRAHQVLAKTIVEVCHGEIEQIKDKYRFDQPLRTY
FT                   LRRIRRKTALLIAASCQLGALAAGAPEAVANRLYWFGHYVGMSFQITDDILDFTGTEEQ
FT                   LGKPAGSDLQQGNVTLPVLYALCDEQVRAKITAVNADTDVEEMAAVLAAIKQTDAIERS
FT                   YALSDRYLEKALRLLGELPANEARTLLHDLALYIGKRDY"
FT   gene            474373..474822
FT                   /locus_tag="GYMC61_0471"
FT   CDS_pept        474373..474822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0471"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="KEGG: gka:GK2209 nucleoside diphosphate kinase;
FT                   PFAM: nucleoside diphosphate kinase; SMART: nucleoside
FT                   diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77153"
FT                   /inference="protein motif:PRIAM:2.7.4.6"
FT                   /protein_id="ACX77153.1"
FT                   /translation="MAERTFIMVKPDGVQRNLIGEIVARFEKKGFQLVGAKLMQVSREL
FT                   AEQHYAEHKERPFFGELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRG
FT                   DFGLTVGKNVIHGSDSPQSAEREISLFFKEEELVSYSKQINAWLY"
FT   gene            474895..475665
FT                   /locus_tag="GYMC61_0472"
FT   CDS_pept        474895..475665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0472"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: gka:GK2208 chemotactic methyltransferase;
FT                   PFAM: MCP methyltransferase CheR-type; SMART: MCP
FT                   methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77154"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ACX77154.1"
FT                   /translation="MDDYAQFIAKVKRKTGIDLSLYKEAQMRRRLASLYMKKGLKSFAE
FT                   LFAAMEKEPALWHECLDRMTINVSEFYRNAKRWEVLEHTILPRLLAENPRPNVWSAACS
FT                   TGEEPYTLAMVLAKRLPLHRVSVLATDIDDNALARARLGLYSERSLVELPEEMRKKFFT
FT                   KEGEYYKIDEKIKQTVKFQKHNLLADPFPRNMDLIVCRNVLIYFTEEAKRMLYRKFHDA
FT                   LRTGGVLFVGSTEQIFNPGLYGFEVEETFFYRKK"
FT   gene            475764..476930
FT                   /locus_tag="GYMC61_0473"
FT   CDS_pept        475764..476930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0473"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="KEGG: gka:GK2207 chorismate synthase; TIGRFAM:
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77155"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ACX77155.1"
FT                   /translation="MRYLTAGESHGPQLTAILEGVPAGLELRAEHINKELARRQKGYGR
FT                   GRRMQIEKDEVKITGGVRHGKTLGSPIALVVENRDFKHWQTIMAVEPIDDEAEVKRKVT
FT                   RPRPGHADLNGALKYGHRDMRNVLERSSARETTVRVAAGAVAKRILEEVGIRVAGHVIE
FT                   IGGVRAKKLDYRSLEELQAVTEESPVRCFDPEAGQKMMEAIDWAKKNGDSIGGIVEVIV
FT                   EGVPAGVGSYVHYDRKLDAKIAAAIVSINAFKGVEFGIGFEAARRPGSEVHDEIIWSPE
FT                   QGFSRRTNRAGGFEGGVTTGMPIVVRGVMKPIPTLYKPLQSVDIETKEPFAASIERSDS
FT                   CAVPAASVVAEAVVAWEVAAAIVEQFGQDRMDLIKENVERARRYAKEF"
FT   gene            476933..478033
FT                   /locus_tag="GYMC61_0474"
FT   CDS_pept        476933..478033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0474"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase; KEGG: gka:GK2206
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77156"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ACX77156.1"
FT                   /translation="MIERTIETATKRYPLLLGDGAARVLPSLLRSLSCPPGTKLFIVTD
FT                   DTVAPLYLDEVRALLAAAEYDVYAYVIPSGEAAKSFDHYYACQTAALQCGLDRRSVIIA
FT                   LGGGVVGDLAGFVAATYMRGIRYIQMPTTLLAHDSAVGGKVAINHPLGKNMIGAFHQPE
FT                   AVVYDTSFLRTLPERELRSGFAEVIKHALIRDRRFYDWLRAEIKTLADLRGEKLAYCIE
FT                   KGIDIKASVVREDEKETGVRAHLNFGHTLGHALESELGYGALTHGEAVAVGMLFAVFVS
FT                   ERFYGRSFAEHRLADWFAGYGFPVSLPTTVQTRRLLEKMKGDKKAYAGTVRMVLLCEIG
FT                   DVEVVELEDDNLLTWLDEFSRQGGKG"
FT   gene            478030..478410
FT                   /locus_tag="GYMC61_0475"
FT   CDS_pept        478030..478410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0475"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="KEGG: gka:GK2205 chorismate mutase; TIGRFAM:
FT                   chorismate mutase; PFAM: Chorismate mutase of the AroH
FT                   class"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77157"
FT                   /inference="protein motif:TFAM:TIGR01796"
FT                   /protein_id="ACX77157.1"
FT                   /translation="MIRGIRGAITVDRNDAEEIVAATETLLREMIRANDVAASDVSFVL
FT                   ISVTDDITAAFPAQALRRLDGWTYVPVMCTREIPVPGSLPRCIRVMMTVATEKQQEEIC
FT                   HVYLKGAVVLRPDLSLTKKTEM"
FT   gene            478646..480172
FT                   /locus_tag="GYMC61_0476"
FT   CDS_pept        478646..480172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0476"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: gka:GK2204 anthranilate synthase component I;
FT                   TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77158"
FT                   /inference="protein motif:TFAM:TIGR00564"
FT                   /protein_id="ACX77158.1"
FT                   /translation="MSADGLAAFLAEANEFRTIPIVRKFVADVIEPLGVFANLREEAVF
FT                   LLESKDDESPWARYSFIGVAPFLTLESETGETFSVKDENGNEQITAPTLKEAFQWVERT
FT                   LAVKPLAETVPFTGGAVGFLGYDFISAIEKVPRHKNRDVPMKTAYFVFCESLFAFDQKK
FT                   RELLVIHYIRLSGNETEEEKIEAYRAAERRMADLAAKAARPQAEQPLLPAESESGRTAS
FT                   FAKAVSNYDKKQFLRDVEAVKRYIAAGDVFQAVLSQRFCVPVQAGGFAIYRLLRYINPS
FT                   PYMFYFQLDGVEIVGSSPEKLIQVHRRRVEIDPIAGTRRRGRSPEEDERLADELYHDPK
FT                   ERAEHYMLVDLARNDIGRVAKYGTVEVPVLLQIGKFSHVMHLISKVVGELDDNVHPIDA
FT                   LLAAFPAGTVSGAPKVRAMQILQELEPTARGLYAGAIAYIGFDGNIDSCIAIRTAVVKD
FT                   GYAYVQAGAGIVADSVPELEWKETRNKASALMNAIEQAERLFAKGERAVC"
FT   gene            480166..481185
FT                   /locus_tag="GYMC61_0477"
FT   CDS_pept        480166..481185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0477"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: gka:GK2203 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77159"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ACX77159.1"
FT                   /translation="MLKQLLVKCAEGKALTEDEAYAAMNIIMSGEATDSQIASLLSMLR
FT                   LRGETVDELVGFVRAMRDRMTAIEASDDVIDTCGTGGDGAATFNVSTAAAIVISSLGVK
FT                   VAKHGNRAVSSKSGSADVLERLGIDIQTSPSAAKQALETKGLAFLFAPLYHAAMKHAAG
FT                   PRKEIGFRTVFNLIGPLANPARCKRQVVGVYSTCYAEKLAEAMRRLGSEHVLFVTGRDG
FT                   LDECSIAAETDVVELKDGAIRRFVIAPEDAGLPRGELADVQVRDPEESAALLEAVMAGT
FT                   APESAINIVALNAGAALYAAGKAETIAEGVAMAKEAILSKTAYEQLQRLRAKEVVHDA"
FT   gene            481175..481954
FT                   /locus_tag="GYMC61_0478"
FT   CDS_pept        481175..481954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0478"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   gka:GK2202 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77160"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ACX77160.1"
FT                   /translation="MMLEQILAAKREEVETLTLPAPLPERKRRPFAAALRRPRRMLGLI
FT                   AEVKKASPSKGIIRPNFDPVAIAKAYERAGADAISVLTDERYFQGHRRYLRAVKEAVNV
FT                   PVLRKDFIIDRRQVEESVRLGADAILLIGEALPPETLEGLYHEAYSLGLECLVEVHAKE
FT                   TLERIFDRFTPEIVGINNRDLHTFVTTLEATKTLAPLIPPSCVIVSESGIGSFNDVKTV
FT                   KSYGAQAMLVGESLMRQDDVERAVYRLFGEEDGDDSN"
FT   gene            481941..482585
FT                   /locus_tag="GYMC61_0479"
FT   CDS_pept        481941..482585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0479"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: gka:GK2201 N-(5'-phosphoribosyl)anthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77161"
FT                   /inference="protein motif:PRIAM:5.3.1.24"
FT                   /protein_id="ACX77161.1"
FT                   /translation="MIRIKYCGNRSAEDVQTAIASGADYLGFIFAESRRNVSPSEVQQW
FT                   LAPHKLGAKQLVGVFVNAPVRRIAAVAAELPLHVIQCHGRETPAELAAVKEAVPLSVWK
FT                   AIHHGDGALAAMRQYAGIADGYVVDSRAAGAWGGTGVAFDWEAVPHYLEEAARQGVPCF
FT                   IAGGITPDNIERLLVYRPDGIDISSGIETDGRKDPTKMKQIEEKIKNHGCR"
FT   gene            482946..484163
FT                   /locus_tag="GYMC61_0480"
FT   CDS_pept        482946..484163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0480"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: gka:GK2200 tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77162"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ACX77162.1"
FT                   /translation="MMERVPNEYGRFGDFGGKFVPETLMLPLEEIEAELDKALADESFK
FT                   QEYIRILQHYSGRPTPLTFAPNLTRQVGGAKIYLKREDLNHTGAHKINNAIGQALLAKR
FT                   MGKKKLIAETGAGQHGVAAATVAAHFGMDCIVFMGEEDIKRQELNVFRMKLLGAEVVPV
FT                   SSGNRTLKDATNEAIRYWVAHCDDHFYMIGSVVGPHPYPKMVREFQRVIGDEAKEQFLA
FT                   REGKLPDVIVACVGGGSNAIGMFYPFLQDDVRLVGVEAAGKGIDTPHHAATITKGTKGV
FT                   IHGAMTYLLQDEYGQILEPYSISAGLDYPGVGPEHAYLASIGRVRYESATDDEAVAAFQ
FT                   LLAQTEGIIPAIESAHAVAKAVELAREMPPDETVLICLSGRGDKDVQTMMRHLGAREGE
FT                   DIATVR"
FT   gene            484138..484953
FT                   /locus_tag="GYMC61_0481"
FT   CDS_pept        484138..484953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0481"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: gka:GK2199 tryptophan synthase subunit alpha;
FT                   TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77163"
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /protein_id="ACX77163.1"
FT                   /translation="MKTLPLSVNPPLFIPFIVAGDPAPDVTIDLALALEEAGADILELG
FT                   VPYSDPLADGPTIQRAAARALDGGMTLPKAIQLIGEMRKKGVNIPIILFTYYNPVLQLG
FT                   EESFFALARENGADGVLIPDLPFEESGPLRELGERFGLPLISLVAPTSKQRIERIASAA
FT                   QGFLYCVSSLGVTGVRETLPETLGDFLREVKRHSRVPVAVGFGISAPEQVAMLKEVCDG
FT                   VVVGSALVQKVEQLAPRLQAPDEREAAVAEFSAYARSLAAPLREAYSSR"
FT   gene            484985..486082
FT                   /locus_tag="GYMC61_0482"
FT   CDS_pept        484985..486082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0482"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; aminotransferase
FT                   class V; KEGG: gka:GK2198 histidinol-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77164"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACX77164.1"
FT                   /translation="MQVKESLRGLSPYQPGKSIEEVKREYGLPEIIKLASNENPYGSSP
FT                   AAKAAIAAELDRLAVYPDGYARTLREKVAKHLGVKETQLLFGNGSDEVVQILCRAFLEP
FT                   GANTVMAAPTFPQYRHNAIIERAEVREVPLVDGRHDLEAMLAAIDENTRIVWICNPNNP
FT                   TGTYVNDTELRAFLDRVPPHVLVVVDEAYYEYATAPDYPQTVPLLNEYEQLVVMRTFSK
FT                   AYGLAALRVGYGVASETLIRAVEPAREPFNTSTIAQAAAAAALDDQAFIRACVERNRAE
FT                   LERYYRFCEENGLKYYPSQTNFLFIDFGLDGDEVFRYLLERGVIVRSGQALGLPTGVRV
FT                   TVGTKEQNDRVLELVSQLLREKQLA"
FT   gene            486170..487273
FT                   /locus_tag="GYMC61_0483"
FT   CDS_pept        486170..487273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0483"
FT                   /product="Prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="PFAM: Prephenate dehydrogenase; amino acid-binding
FT                   ACT domain protein; KEGG: gka:GK2197 prephenate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77165"
FT                   /inference="protein motif:PRIAM:1.3.1.12"
FT                   /protein_id="ACX77165.1"
FT                   /translation="MEGKVFIVGLGLIGGSIALAIKKAHPEAMIIGYDVNERQLGLARS
FT                   LKVIDEAARSPEDGYGQADLIVLAVPVMQTEALLSSMPLERLKRGVIVTDVGSTKQRIV
FT                   QGARRLLDHGVAFIGGHPMAGSHKSGVAAARAHLFENAFYILTPTDDVPPQQVEALKQW
FT                   LAGTKAQFVILTPKEHDRITGVISHFPHLIAASLVHQAREYECENALVSRLAAGGFRDI
FT                   TRIASSNPEMWRDIFIHNKHELLALFDRWIAEMERLRSFVEEENSIAIYHYFLEAKQFR
FT                   DGLPSRTKGAIPSFYDLYVDVPDYPGVISEVTGYLAEENISITNIRIIETREEIYGVLR
FT                   LSFQSEDDRARAKACLAKHTNYATYEG"
FT   gene            487301..488584
FT                   /locus_tag="GYMC61_0484"
FT   CDS_pept        487301..488584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0484"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   gka:GK2196 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77166"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACX77166.1"
FT                   /translation="MQLPTNVSSLRGMIEVPGDKSISHRAVMLGALASGRTVIDHFLPG
FT                   ADCLSTIDCFRKLGVDIRQDGTTVVVEGAGPGGLREPAAVLDVGNSGTTARLLLGILAG
FT                   QPFHACLVGDESIAKRPMGRVTKPLREMGARIDGREGGNYTPLSIRGGALRPLRYTSPV
FT                   ASAQVKSAVLLAGLFTDGVTSVTEPHRSRDHTERMVRLFGGEVNVDGLTVSVAGPQRLR
FT                   GTHIYVPGDISSAAFFLVAGAIVPNSEITLKNVGLNPTRTGIIDVLTQMGADIAIDNVR
FT                   NEETEPVGDITVRTSTLRAVEIGGDLIPRLIDEIPIIALLATQAEGTTVIKDASELKVK
FT                   ETDRIHTVVTELKKLGADIEATDDGMMIRGKTPLYADGIVVDSHGDHRIGMMLAVAACI
FT                   AKGTVRLERSEAVAVSYPAFFADLRSLL"
FT   gene            488873..490129
FT                   /locus_tag="GYMC61_0485"
FT   CDS_pept        488873..490129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0485"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: gka:GK2195 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77167"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACX77167.1"
FT                   /translation="MTRVEQIIRLVENGNVDQALALVPKVKKYGSDEEKYALADCLYGW
FT                   GMPEEAKELLEELAARYPDDGDIRLFLAEVYTELEAEEEALAILSEIDEDDPQFVRACL
FT                   LAADLYEMQGLAEVSERKLRQAYEKAPDEPIVQFALAELYFSHGEYSKSVPLYEQVRKT
FT                   NKEMAGVLITERIAEALSRSGEFEAALPYYEEALNEKMDSRTLFAYGFTALQAGYTQTA
FT                   IDKLSALKELDPDYTPLYLYLAKAYEQEGRLVQSYETALEGVGVDEWNKELRLYAGKLA
FT                   LKLNKPEEAEEHLKKALEIDGGYIEALTVLSALWLNEQRYEDVVALLEQAMADGEYDPQ
FT                   FEWDLGRAKHRLEMYDDALNHYGEAYNFFKHNVEFLEEYGYFLIEEGNRAAAKEIFQQI
FT                   VRLDPTHTEAAEMLLELEE"
FT   gene            490186..490719
FT                   /locus_tag="GYMC61_0486"
FT   CDS_pept        490186..490719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0486"
FT                   /product="Protein of unknown function UPF0302"
FT                   /note="PFAM: Protein of unknown function UPF0302 ;
FT                   conserved hypothetical protein; KEGG: gka:GK2194
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77168"
FT                   /inference="protein motif:PFAM:PF08864"
FT                   /protein_id="ACX77168.1"
FT                   /translation="MTHVSVNEKKEFIRWFLSHYQLKRRECVWILNYLMSHDQLMQKVH
FT                   FVENAQYCPRGIIMSTHCVDDVPFRFYKGNVMTTDAEKSFHDIRLNRDEDIYIQLNFRA
FT                   SFHSPQYVAVLEENPYAPKQAQVSENDQRLAEQFLERSIYEFRRGRLMKLIDEALDRHD
FT                   EEAFRRLTDELNKL"
FT   gene            490808..491263
FT                   /locus_tag="GYMC61_0487"
FT   CDS_pept        490808..491263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0487"
FT                   /product="Protein of unknown function DUF2487"
FT                   /note="PFAM: Protein of unknown function DUF2487; KEGG:
FT                   gka:GK2193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77169"
FT                   /inference="protein motif:PFAM:PF10673"
FT                   /protein_id="ACX77169.1"
FT                   /translation="MKWTGEDVALYERERDYIDTALLPLLPVAFGQGAKRLASGGELVG
FT                   LIAAEVERQLKGRLFLMPSFVYFADEPRALLTERLADWTNRLRREGMKHLFYVTCDRAW
FT                   QEGEEADRVWFVPVVPLESMGESYKHELVREQAAELLRFLIGRWAQE"
FT   gene            491408..491917
FT                   /locus_tag="GYMC61_0488"
FT   CDS_pept        491408..491917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0488"
FT                   /product="Rieske (2Fe-2S) iron-sulphur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   gka:GK2192 menaquinol-cytochrome c reductase iron-sulfur
FT                   subunit (Rieske iron-sulfur protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77170"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACX77170.1"
FT                   /translation="MSDNKHRVTRRQFLNYTLTGVGGFMAAGMLMPMLRFAFDPILKDE
FT                   AGTEMVAVADVKEITTEPKRFDFKVKVKDAWYESEEPKSAWVYKDEKGEIIALSPICKH
FT                   LGCTVDWNTDKEHPNQFFCPCHYGRYEKDGTNVPGTPPQAPLDRYEYKVKDGKLYLGKA
FT                   KPRKEA"
FT   gene            491921..492595
FT                   /locus_tag="GYMC61_0489"
FT   CDS_pept        491921..492595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0489"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: gka:GK2191
FT                   cytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77171"
FT                   /inference="protein motif:PFAM:PF00033"
FT                   /protein_id="ACX77171.1"
FT                   /translation="MLNKLYDWVDERLDITPLWRDIADHEVPEHVNPAHHFSAFVYCFG
FT                   GLTFFVTVIQILSGMFLTMYYVPDIKNAWESVYYLQNEVAFGQIVRGMHHWGASLVIVM
FT                   MFLHTLRVFFQGAYKKPREMNWIVGVLIFMVMMGLGFTGYLLPWDMKALFATKVGLQIA
FT                   EATPLIGPAIKTLLAGDPEIVGAQTLTRFFAIHVFFLPAALLGLMAAHFLMIRRQGISG
FT                   PL"
FT   gene            492645..493409
FT                   /locus_tag="GYMC61_0490"
FT   CDS_pept        492645..493409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0490"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: gka:GK2190
FT                   menaquinol-cytochrome c reductase cytochrome b/c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77172"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACX77172.1"
FT                   /translation="MHRGKGMKFVGDSRVPAVRKPNIPKDYSEYPGKTEVFWPNFLLKE
FT                   WLVGSVFLVGFLCLTVAHPSPLERIADPTDTTYVPLPDWYFLFLYQLLKYSYASGPYTV
FT                   VGAIIIPGLAFGALLLAPFLDRGPERRPWKRPVATGMMLLALAAMIYLTWEAVVTHDWK
FT                   KAAEQGKIRAEVKIDTNAEGYKIAQANTCTSCHGQNLSGGAGPSLIGTGLKPEEIAKIA
FT                   REGKGNMPPGVFKGTDEELKKLSEFIAGLKAE"
FT   gene            493485..494108
FT                   /locus_tag="GYMC61_0491"
FT   CDS_pept        493485..494108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0491"
FT                   /product="protein of unknown function DUF1405"
FT                   /note="PFAM: protein of unknown function DUF1405; KEGG:
FT                   gka:GK2189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77173"
FT                   /inference="protein motif:PFAM:PF07187"
FT                   /protein_id="ACX77173.1"
FT                   /translation="MMAWLYALLASRPVVWLLLFVNAAGTIYGYYWYRYQLADTPPVFL
FT                   PFVPDSPTASLFFLVVLVAWLFGRSAPLFEALALVTLVKYGIWAVVMNVLVWRVTGTLD
FT                   WAGWMLIVSHGAMAIEGMLYARFYRFRFLHLMLAAVWTLHNDVIDYVFGMMPRYSVLAD
FT                   YANEIGYFTFWLSIASIAAAYQLGVRLRRQPLLPGGMSFRQASE"
FT   gene            494459..495247
FT                   /locus_tag="GYMC61_0492"
FT   CDS_pept        494459..495247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0492"
FT                   /product="sporulation protein YpjB"
FT                   /note="TIGRFAM: sporulation protein YpjB; PFAM: Sporulation
FT                   protein YpjB; KEGG: gka:GK2188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77174"
FT                   /inference="protein motif:TFAM:TIGR02878"
FT                   /protein_id="ACX77174.1"
FT                   /translation="MKRIGLAMLLSLAFLWPAPIGAAGQTNGWEQLDDISDEALQLAKN
FT                   GRFAEAKEVLRYFSERFFALGAKERLKSADELRAVTVTHEQAVKAMTAPISAEDKVAAI
FT                   TQFRLVVDAIHSTYQPLWTEMEPAVMEAFAAVEKAAQQGEQKAYAAALRQLLDRYTLIE
FT                   PSVKIDVPPDIATKVDDDLEALQAAAFWQRGEDEQREQLADARQDLEALFAGVKKDEAD
FT                   PSLIWVMISTGGVIVLTLTYVGWRKYKGEKEEKRARQPED"
FT   gene            complement(495385..496257)
FT                   /locus_tag="GYMC61_0493"
FT   CDS_pept        complement(495385..496257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0493"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="PFAM: Protein of unknown function DUF2179; protein
FT                   of unknown function DUF161; KEGG: gka:GK2187 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77175"
FT                   /inference="protein motif:PFAM:PF10035"
FT                   /protein_id="ACX77175.1"
FT                   /translation="MIFGLKIKNCLFILLGAAIFAFGLVHFNMQNNLAEGGFTGITLLL
FT                   YFLFGLDPAITNLALNIPLFFIGWKLLGRQTFLYTVIGTVAVSVFLSIFQRYMIHMPLR
FT                   HDMTLAALFAGVFIGVGLGIIFRYGGTTGGVDIIARLVHKYKGISMGKTMFAFDATVIT
FT                   LSLLLYLSYREAMYTLVAVFIAARVIDFLQEGGYAAKGATIISEKSEEIANRILTEMER
FT                   GVTVLKGRGSYTKRDRDVLYCVVAKNELPRLKSVIISVDPHAFVAVTDVHDVLGEGFTL
FT                   DEQKRPLEP"
FT   gene            496418..496753
FT                   /locus_tag="GYMC61_0494"
FT   CDS_pept        496418..496753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0494"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   gka:GK2186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77176"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ACX77176.1"
FT                   /translation="MQEKTMKQMQQEVDDYISQFKEGYFSPLAMLARLTEELGELAREV
FT                   NHYYGEKPKKATEQEKTVEEELGDLLFVLICFANSLGIDLQAAHDRVMDKFRTRDRDRW
FT                   TRKEEGS"
FT   gene            496750..497547
FT                   /locus_tag="GYMC61_0495"
FT   CDS_pept        496750..497547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0495"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="KEGG: gka:GK2185 dihydrodipicolinate reductase;
FT                   TIGRFAM: dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase; oxidoreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77177"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ACX77177.1"
FT                   /translation="MTIRIVIAGPRGRMGREAVALVQQTDHFELAAVIDRRYDGQNLAE
FT                   IDGFSGVNAPIYTDAARCFAEVKPDVLIDLTTPEAGKRHTELALRYGVRPVVGTTGFTP
FT                   EDIERLTKLAEEKEIGAIIAPNFAVGAVLMMKFARMAAKYFTDVEIIELHHDQKLDAPS
FT                   GTALKTAQLIAEVRPSKKQGHPNEKETLAGARGAEYDGIPIHSVRLPGFVAHQEVIFGG
FT                   NGQTLTIRHDSFDRRSFMSGVKLAVETVMHLHTLVYGLEHILE"
FT   gene            497579..498013
FT                   /locus_tag="GYMC61_0496"
FT   CDS_pept        497579..498013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0496"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="KEGG: gka:GK2184 methylglyoxal synthase; TIGRFAM:
FT                   methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77178"
FT                   /inference="protein motif:TFAM:TIGR00160"
FT                   /protein_id="ACX77178.1"
FT                   /translation="MKIALIAHDQKKAEMVAFATAYAPVLANHELYATGTTGLRIQEST
FT                   GLPVHRFQSGPYGGDQEIGAMIARNEMDLVIFFRDPLTAQPHEPDISALMRLCDVYAVP
FT                   LATNIGTAELLIRALERGDLAWRSIVRGRTKGGEESKTER"
FT   gene            498019..498729
FT                   /locus_tag="GYMC61_0497"
FT   CDS_pept        498019..498729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0497"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: gka:GK2183
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77179"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ACX77179.1"
FT                   /translation="MMETCDLLAFGAHPDDVEIGMGGTIAKYVRRGYRIVICDLTQAEL
FT                   SSNGTVDERRREAAEAARRLGVSERFNLGLPDRGLYVEEEAIRQIAAVIRRYRPRLVFA
FT                   PYWEDRHPDHGRCARLVEEAVFSAGIRRYGAGELGDAHRVRAVYYYMINAFCRPHFLID
FT                   ISETIDDKLDSLRAYESQFQKRPGSVDTPLTNGYIEMIESRERWFGQQIGAAYAEGFLT
FT                   KTPIHLSNLFEEER"
FT   gene            498726..499862
FT                   /locus_tag="GYMC61_0498"
FT   CDS_pept        498726..499862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0498"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: gka:GK2182
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77180"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX77180.1"
FT                   /translation="MKLKIGIVCYPTVGGSGVVATELGKLLAERGHEIHFISSSMPFRL
FT                   NKVYGNIYYHEVSVNQYSVFQYPPYDLALASKIAEVAKRERLDVLHAHYAVPHAVCAVL
FT                   ARQMVGELPIITTLHGTDITVLGYDPSLSDMIKFGIEQSDIVTAVSDALARQTYELLDV
FT                   QATIHTVYNFVDERVYRRREAGHLRREYGIRDDERVVIHVSNFRKVKRVPDVVRAFAIV
FT                   RRHVPAKLLLVGDGPEMTVVCRLVKELGLQDDVRFLGKQDKLEELYSISDVMMLLSEKE
FT                   SFGLVLLEAMACGVPCIGTAIGGIPEVIEDGKTGFLCPLGDVKEAARQAMALLTDCRLH
FT                   AEMARQAVQTVERKFRSADIVGQYEQLYASLAARKVKR"
FT   gene            499859..501073
FT                   /locus_tag="GYMC61_0499"
FT   CDS_pept        499859..501073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0499"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   KEGG: gka:GK2181 tRNA CCA-pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77181"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="ACX77181.1"
FT                   /translation="MKPPFEQALGIIRQLKRHGYEAYFVGGAVRDLLIGRPIGDVDIAT
FT                   SALPEEVMRLFPKTIDVGSKHGTVVVVHEGTAYEVTTFRTDGDYEDHRRPESVTFVRSL
FT                   EEDLKRRDFTMNAIAMDERGTIIDPFGGQEAIERRLICTVGAADERFREDALRMMRAVR
FT                   FVSQLGFALAEDTKSAIVQNAPLMAHISVERMTMEMEKLLAGPFVAEALPLLADTGLFA
FT                   YLPGLAAKEQLLRSAAAFRWPWLTKREERWALLCRALDVKDIRPFLRAWKLPNKVIDEA
FT                   GAILAALDDVPRPEAWTNEQLFSAGLERALSVEAVRAALCGAPSEPHHEELRRRFAALP
FT                   IKTKGELAVNGKDVIRWAGKPAGPWVKETLDAIWRAVVSSEVENEKERIYAWLMERNRT
FT                   HEKNC"
FT   gene            501031..502020
FT                   /locus_tag="GYMC61_0500"
FT   CDS_pept        501031..502020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0500"
FT                   /product="bifunctional BirA, biotin operon
FT                   repressor/biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: gka:GK2180 biotin [acetyl-CoA carboxylase]
FT                   synthetase; transcriptional repressor of the biotin operon;
FT                   TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; biotin
FT                   operon repressor; PFAM: biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix type 11 domain protein; biotin protein
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77182"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACX77182.1"
FT                   /translation="MAHGAQSDTRKKLLELFAEANGEFLSGQKISEQLGCSRAAVWKHI
FT                   EELRKEGFELEAVRRLGYRIISTPDKVTANEIQLGLKTEKLGHTIHFFDEVDSTQRIAA
FT                   RLAYEGAPEGTLVVAEEQKAGRGRLDRKWFSPKGTGIWMSLILRPAIPPQRAPQLTLLA
FT                   AVAVSQAIQEVTGLVPDIKWPNDILLDGRKCVGILTELQADPDRVHSVIIGIGINVNQT
FT                   IEQFPEDIRAIATSLAIEKGGPVKRAPLIQEILFRLERLYEQYLAHGFRPIKLLWEGYA
FT                   VSIGKPVTARTLNGVIHGIARGITDDGLLILEDEQKNIHYIHSADIQF"
FT   gene            502287..503126
FT                   /locus_tag="GYMC61_0501"
FT   CDS_pept        502287..503126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0501"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: gka:GK2179 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77183"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ACX77183.1"
FT                   /translation="MKAKTDFFHMKQAGEPIVMVTAYDFPSAKLAEQAGVDMILVGDSL
FT                   GMVVLGYDSTIPVTVDDMIHHTKAVRRGAPNTFIVTDMPFMSYHASKEEALQNARRIMQ
FT                   ESGANAVKVEGADEVVDMIAALTKAGVPVVAHLGLTPQSVGVLGGYKVQGKDAESAKKL
FT                   LDDAKQCEQAGAIALVLECVPKQLGAAMARELTIPVIGIGAGAEVDGQVLVYHDLLGYG
FT                   VTRVPKFVKQYASIQETIVEALANYVDDVKLRQFPEPAHTFTMKEEEWVALYGGKQG"
FT   gene            503123..504025
FT                   /locus_tag="GYMC61_0502"
FT   CDS_pept        503123..504025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0502"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: gka:GK2178 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77184"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACX77184.1"
FT                   /translation="MIVMDQIAAMQALMRQYRCEGKTIGFVPTMGYLHEGHTSLIDRAR
FT                   AENDIVVLSVFVNPLQFGPNEDFARYPRDFERDRRIAEQHGVDVLFHPEADEMYPEPLT
FT                   VRAIVQARADVLCGRSRPGHFDGVATVLIKLFNIVMPDRAYFGMKDAQQVAVVDGLIRD
FT                   LNFPIELVPVPTVREADGLAKSSRNVYLSPQERSEAPALYAALQAAASAVERGERSAAA
FT                   IRRMVREHIEAHTHVEIDYVEVCSYPDLTPLETLAGTVLIAVAVRFASARLIDNIMIEL
FT                   PKTGEQGDGKGEQACFARS"
FT   gene            504007..504390
FT                   /locus_tag="GYMC61_0503"
FT   CDS_pept        504007..504390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0503"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: gka:GK2177 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77185"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACX77185.1"
FT                   /translation="MFRTLMNAKIHRARVTEANLDYVGSITIDEDILDAVGIVANEKVQ
FT                   VVNNNNGARFETYVIPGERGSGVFCLNGAAARLVQKGDVIIVISYVLVPEEKIAAHRPK
FT                   IAIMDENNRIVQLIAEEPAHTVL"
FT   gene            504438..507167
FT                   /locus_tag="GYMC61_0504"
FT   CDS_pept        504438..507167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0504"
FT                   /product="DnaQ family exonuclease/DinG family helicase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gka:GK2176 bifunctional ATP-dependent DNA
FT                   helicase/DNA polymerase III subunit epsilon; TIGRFAM: DnaQ
FT                   family exonuclease/DinG family helicase; DNA polymerase
FT                   III, epsilon subunit; PFAM: Exonuclease RNase T and DNA
FT                   polymerase III; SMART: Exonuclease; helicase c2; DEAD-like
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77186"
FT                   /inference="protein motif:TFAM:TIGR01407"
FT                   /protein_id="ACX77186.1"
FT                   /translation="MATRFVIIDLETTGNGPKKGDRIIQLGMAVVEDGLIVERFASFFN
FT                   PEQPIPLFIQQLTNINEQMVEGAPLFADKAGEIAALMHGAYFVAHNVDFDLPFLQAELE
FT                   RAGWPPFAGPTIDTVELARIVLPTAESYKLGDLARQLGLRHDRPHQADSDAEVTAKLFI
FT                   ALLKRLSRLPLMTLEQLRGLARHLKSDIYLLLDAVIAKKRNKAPADRTVAVYRGIALKQ
FT                   PAPEPDESDRRPALASFAAFCEQEPPLPLPGYKRRAGQWEMMRLVYEALSTSQHALIEA
FT                   GTGLGKSLAYLIPAAFFACEQQERVVISTHTLQLQEQLIRRDWPVLRQIAPFPLRVAVL
FT                   KGKQNYLSLDKFASFLSEPSDTYDAALLKCQVLVWLLETDSGDLDELNVSSGARLLLSA
FT                   LAIGEEEDGGRHHFFARAKERSERADVVITNHALLLHDLTGPAPLLPPFRHLIIDEAHR
FT                   LEDAAARCFGEQIGYVSFRLLTAKIVQTIAKWQEAEQDAPNGALVRCQQRLEELQFEGD
FT                   ELFRLLRRYALDKKPARAGRCRYRFSPTDEQSRAWQAAVELCWRLRHLAAALSAEAKPL
FT                   LSADTSGDFPPSALLSADLAALNRQMAALVRLLTEKEPGVVRWIEADEKGAANAVRLYS
FT                   QPVDLADFFADQLFMKKRSVVLTSATLTVRGRFTYMAARLGLEDFYPLCRSFPPPFRYE
FT                   EQAALFVPADMPLVSAVPLEDYAEAVAASVLAIARRLGRRVLVLFPSYELLKLTVDALK
FT                   TEEEGEPFVLIAQGVQSGSPAKLLRTFLQFEHAVLFGTSSFWEGVDLPGSALDVLVIAR
FT                   LPFAPPDDPVMEAKSERIRLEGGDPFSELALPEAVLRFKQGFGRLIRTEDDKGAVFVLD
FT                   RRLMASPYGADFLASLPPLSVHEGALSELLDKAETWLS"
FT   gene            507502..507672
FT                   /locus_tag="GYMC61_0505"
FT   CDS_pept        507502..507672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77187"
FT                   /inference="similar to AA sequence:KEGG:GK2174"
FT                   /protein_id="ACX77187.1"
FT                   /translation="MESKIEVLATVKVQHSDDLYKIVDCLNRTLKRDNLMFGLALDEND
FT                   KRQAIFTIYRT"
FT   gene            507678..508154
FT                   /locus_tag="GYMC61_0506"
FT   CDS_pept        507678..508154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0506"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4; KEGG:
FT                   gka:GK2173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77188"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ACX77188.1"
FT                   /translation="MKKWGWFTLLFFGFLIWQAWSIYDEAMAPKRLMVEHALARAKEAA
FT                   GLADVKKVYTYYGDEACTVFIGRTKQGKAVVVWVPEKEENVVVKGVGSGISEAEARAIL
FT                   QRDRRPRRIIDATLGMEKGVPLWELTYIDAEGRYSFYYLHFADGAFLKRYSFQQ"
FT   gene            508176..509357
FT                   /locus_tag="GYMC61_0507"
FT   CDS_pept        508176..509357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0507"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gka:GK2172 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77189"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACX77189.1"
FT                   /translation="MKLAKRVASLTPSATLAITAKAKELKAAGYDVIGLGAGEPDFNTP
FT                   QHIIAAAIKAMNEGHTKYTPSGGLPALKEEIIKKFARDQGLSYEPAEIIVCVGAKHALY
FT                   TLFQVLLDEGDEVIIPTPYWVSYPEQVKLAGGVPVYVEGLEENDFKMTPDQLKQAITPK
FT                   TKAVIINSPSNPTGMIYTAEELKALGEVCLAHGVLIVSDEIYEKLIYGGAKHVSIAELS
FT                   PELKEQTIIINGVSKSHSMTGWRIGYAAGPKDIIQAMTDLASHSTSNPTSIAQYAAIAA
FT                   YSGPQEPVEQMRQAFEERLNIIYDKLVQIPGFTCIKPQGAFYLFPNARKAADMAGCRTV
FT                   DEFVAVLLEEAKVALVPGSGFGAPDYVRLSYATSLEALETAIERIRRFMEARA"
FT   gene            509586..510881
FT                   /locus_tag="GYMC61_0508"
FT   CDS_pept        509586..510881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0508"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: gka:GK2171
FT                   asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77190"
FT                   /inference="protein motif:TFAM:TIGR00457"
FT                   /protein_id="ACX77190.1"
FT                   /translation="MKTTTIAEVNQYAGQQVTIGAWLANKRSSGKIVFLQLRDGTGFIQ
FT                   GVVEKANVSEEVFQRAKTLTQETSLYVTGTVRIDERSPFGYELSVADLQVIQEAVDYPI
FT                   TPKEHGVEFLMDHRHLWLRSRRQHAIMKIRNEIIRATYEFFNDRGFVKVDAPILTGSAP
FT                   EGTTELFHTKYFDEDAYLSQSGQLYMEAAAMALGKVFSFGPTFRAEKSKTRRHLIEFWM
FT                   VEPEMAFYEFEDNLRLQEEYVSYLVQSVLERCRLELGRLGRDVSKLELVKPPFPRLTYD
FT                   EAIKLLHEKGLTDIEWGDDFGAPHETAIAESFDKPVFITHYPTSLKPFYMQPDPNRPDV
FT                   VLCADLIAPEGYGEIIGGSERIHDYELLKRRLEEHHLPLEAYEWYLDLRKYGSVPHSGF
FT                   GLGLERTVAWICGVEHVRETIPFPRLLNRLYP"
FT   gene            510949..511650
FT                   /locus_tag="GYMC61_0509"
FT   CDS_pept        510949..511650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0509"
FT                   /product="primosome, DnaD subunit"
FT                   /note="TIGRFAM: primosome, DnaD subunit; PFAM: DnaD and
FT                   phage-associated region; KEGG: gka:GK2170 chromosome
FT                   replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77191"
FT                   /inference="protein motif:TFAM:TIGR01446"
FT                   /protein_id="ACX77191.1"
FT                   /translation="MEKKKVAEWLAQGSIAVPKLLLGHYKQLGLGEGELVLLLHMQSFF
FT                   EEGVLFPTPAELAERMTVSAAECMEMVRRLLQKGMIAIEEHTDEQGIRNEKYTLEPLWE
FT                   KLVHHLYTHAVQQGELGRQEEEESLYTVFEQEFGRPLSPFECETLAMWIDQDGHEPAII
FT                   KAALREAVLSGKLNFRYIDRILFEWKKNGIRTIEQAHDYGKKFRKPSSRSAKQTAGEFK
FT                   QTIPFFNWLDS"
FT   gene            511754..512425
FT                   /locus_tag="GYMC61_0510"
FT   CDS_pept        511754..512425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0510"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: gka:GK2169 endonuclease III (DNA-(apurinic or
FT                   apyrimidinic site) lyase); TIGRFAM: endonuclease III; PFAM:
FT                   HhH-GPD family protein; helix-hairpin-helix motif;
FT                   iron-sulfur cluster loop; SMART: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77192"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACX77192.1"
FT                   /translation="MLTKQQIRYCLDEMAKMFPDAHCELVHRNPFELLIAVVLSAQCTD
FT                   ALVNKVTKRLFEKYRTPHDYIAVPLEELEQDIRSIGLYRNKARNIQKLCAMLIDKYNGE
FT                   VPRDRDELMKLPGVGRKTANVVVSVAFGVPAIAVDTHVERVSKRLGFCRWDDSVLEVEK
FT                   TLMKIIPKEEWSITHHRMIFFGRYHCKAQSPQCPSCPLLHLCREGKKRMRKREEKAANQ
FT                   K"
FT   gene            complement(512529..515234)
FT                   /locus_tag="GYMC61_0511"
FT   CDS_pept        complement(512529..515234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0511"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; Fibronectin type III domain
FT                   protein; KEGG: gka:GK2168 penicillin-binding protein 1A/1B
FT                   (pbp1) (penicillin-insensitive transglycosylase
FT                   (peptidoglycan TGase); penicillin-sensitive transpeptidase
FT                   (dd-transpeptidase))"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77193"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACX77193.1"
FT                   /translation="MSGEYRSRVERKQAAKQTKQKKAKTKKGIAWLKTVAIAILFIIVI
FT                   AAVGGVAAVAYFVKDAPPLDEAKIKDPLSSIVCDMNGKKVAELGGYKRTYISYKDVPKV
FT                   LEDAVLATEDARFYEHHGIDVVRLAGAVLANIKEGFGAEGGSTITQQVVKMTFLSPEKT
FT                   LKRKAQEAWLALQLEQKYSKHEILEMYLNKIYYSDGIYGVARAAEYYFGKTDLKKLTLP
FT                   EAALLAGMPQSPNRYNPYDHPEAAKKRRDTVLSLMAKHGFISLEEAEKAKQVPIQSMLA
FT                   ERKKPQSSVPYDAFIDEVIKEVTDKANVNVFEDGLKIYTTLDQDVQTYVEKLLNSDKYF
FT                   TNKKDLQSGIAVVDTKTGAIRALGGGRHRDHVEFGFNYAIKPVGQPGSTIKPILDYGPA
FT                   IEYLKWSTAHILVDEPYTYSNGTPIRNAGGGYMGPITLRTALAKSRNIPALKTFQAVGK
FT                   ERAMEFANRLGMGFSEVYEPYAIGGVSNYVSPLQMAGAYTAFGNNGIYTKPYAVTKIVF
FT                   PDGTEMDLQPKPKRVMHDYTAYMITDVLKTVIRSGTGVLANVPGLELAGKTGTTNYGED
FT                   GAKFGLQRDDVPDSWIVGYTPNYTAAIWVGFSKRSSTAKLSIEEQKIPKYLLKNLMSHI
FT                   DDGSGEFKQPDSVVKLPIKKGTNPPKLAGKYTPESEITYELFVRGTEPTETANDVPEEL
FT                   PAVKGLTAVYDQAANAISVSWSYDEQTDEMIFEVRVKDGQGQTNTITTKDRSITISNPT
FT                   PGWTYTIAVYAKDGERMSKPAIASVHVPGGEDQTPAPQQPGDDSQGNGGQNGGTDQGNS
FT                   GNNGNENGQGNNNEQNGGASGGQENGNSGGANPNNGQTNGTNNQGTNNQGTNNSGQTNG
FT                   TNGGTGSNSGTPPVSPPLKNGSGAGLGTRP"
FT   gene            complement(515268..515870)
FT                   /locus_tag="GYMC61_0512"
FT   CDS_pept        complement(515268..515870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0512"
FT                   /product="recombination protein U"
FT                   /note="TIGRFAM: recombination protein U; PFAM:
FT                   Recombination protein U; KEGG: gka:GK2167 Holliday
FT                   junction-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77194"
FT                   /inference="protein motif:TFAM:TIGR00648"
FT                   /protein_id="ACX77194.1"
FT                   /translation="MALKYPSGKEYRGNKPNAARRPAADYANRGMTLEDDLNATNEYYR
FT                   ERGIAVIHKKPTPVQIVRVDYPKRSAAVITEAYFRQASTTDYNGVYRGKYIDFEAKETK
FT                   NKTAFPLKNFHAHQIRHMEQVVAHGGICFAILRFSLLNETYLLDASHLIAWWNKQEAGG
FT                   RKSIPKQEIERHGHSIPLGYQPRIDYISVVDNVYFTR"
FT   gene            516095..516337
FT                   /locus_tag="GYMC61_0513"
FT   CDS_pept        516095..516337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77195"
FT                   /inference="similar to AA sequence:KEGG:GK2166"
FT                   /protein_id="ACX77195.1"
FT                   /translation="MEKRLVKKEEIEKQLQEIVALIEQVDAKMEKVIADVIEERYAQNQ
FT                   AQLGRLEGQIAGVEQRLEKEKQSAALPLSSKLYFV"
FT   gene            516455..516838
FT                   /locus_tag="GYMC61_0514"
FT   CDS_pept        516455..516838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0514"
FT                   /product="Domain of unknown function DUF1798"
FT                   /note="PFAM: Domain of unknown function DUF1798; KEGG:
FT                   gka:GK2165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77196"
FT                   /inference="protein motif:PFAM:PF08807"
FT                   /protein_id="ACX77196.1"
FT                   /translation="MEKELKALTKRLQQYNEQLLLIARRARERNEEPDFFGDVKPMAEE
FT                   VQAVAERWKDAASRWVRHARPKYVHERQIEAAADHMAKLCVEAFYPSVPERRIKQYSQA
FT                   VAYTLALVKERLDDTSEAGKERL"
FT   gene            complement(516922..517092)
FT                   /locus_tag="GYMC61_0515"
FT   CDS_pept        complement(516922..517092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77197"
FT                   /inference="similar to AA sequence:KEGG:GK2164"
FT                   /protein_id="ACX77197.1"
FT                   /translation="MGRGVHFNHKLKGHDHEKPKHGKPAPPKHTERVEYEINTVATAEG
FT                   GPVSITTGKDT"
FT   gene            complement(517212..517412)
FT                   /locus_tag="GYMC61_0516"
FT   CDS_pept        complement(517212..517412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77198"
FT                   /inference="similar to AA sequence:KEGG:GK2163"
FT                   /protein_id="ACX77198.1"
FT                   /translation="MNVTELKHKFMAVKHCEPAEANELLDFARRLYLRGEISLAEYRDL
FT                   VRELEKAGASQPDEAGEYAGL"
FT   gene            517606..517950
FT                   /locus_tag="GYMC61_0517"
FT   CDS_pept        517606..517950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77199"
FT                   /inference="similar to AA sequence:KEGG:GK2162"
FT                   /protein_id="ACX77199.1"
FT                   /translation="MHRYPRPVSPPVYGPYGSGGHYSPYFHYGVSSFPSAPVHWPHLPS
FT                   GHAAPPSYPMPYPKPGPLLPPPRPSFLAQFKNSDGTYDINKMMSTVGQMINTVNQVNGV
FT                   LKGLLGTFKK"
FT   gene            complement(518034..518291)
FT                   /locus_tag="GYMC61_0518"
FT   CDS_pept        complement(518034..518291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0518"
FT                   /product="sporulation-specific SASP protein
FT                   (sigma-G-dependent sporulation specific SASP protein)"
FT                   /note="KEGG: gka:GK2161 sporulation-specific SASP protein
FT                   (sigma-G-dependent sporulation specific SASP protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77200"
FT                   /inference="similar to AA sequence:KEGG:GK2161"
FT                   /protein_id="ACX77200.1"
FT                   /translation="MMEQTLAYLREVLSNYLDHHGDTPKRIYKKLISKPYRGEGEFVRD
FT                   LTQEESAFLDRILPHEIRYAMDERDYKRVYQLNEVYELLI"
FT   gene            complement(518288..518473)
FT                   /locus_tag="GYMC61_0519"
FT   CDS_pept        complement(518288..518473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77201"
FT                   /inference="similar to AA sequence:KEGG:GK2160"
FT                   /protein_id="ACX77201.1"
FT                   /translation="MAKLPDFKQLNDRLINEPSDEPMLVIKTNLDPDRVTEENPYVQGR
FT                   TNTSKEFVSFFEGGGR"
FT   gene            518521..518721
FT                   /locus_tag="GYMC61_0520"
FT   CDS_pept        518521..518721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77202"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77202.1"
FT                   /translation="MYASFWPRQGKQMANNKGVIAVTDCNDNWKRKNKYTNNREEIANE
FT                   WVIKKGTPEEGERSGNSLHKQ"
FT   gene            complement(518837..519301)
FT                   /locus_tag="GYMC61_0521"
FT   CDS_pept        complement(518837..519301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0521"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gka:GK2159
FT                   heat shock protein class I (low molecular weight)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77203"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACX77203.1"
FT                   /translation="MNESFQPPANGGGHHPFHHLRKMMNQWFDERPLQKLFETLDDYFA
FT                   QTFVAAYIPIEVKETKHDYQIIVRLPDIKREQISLQWQEDGLQLIIDHHEWIESSDSHG
FT                   HVYERRHAQRRVARLIPFPYPVAEHEVKASFQNGTLTIQLPQKRKYIDID"
FT   gene            519533..519655
FT                   /locus_tag="GYMC61_0522"
FT   CDS_pept        519533..519655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77204"
FT                   /inference="similar to AA sequence:KEGG:GK2158"
FT                   /protein_id="ACX77204.1"
FT                   /translation="MHWVHWLVTLFFSGTAVSLLSYQALEIVQAIVDWIVDRHS"
FT   gene            519826..520500
FT                   /locus_tag="GYMC61_0523"
FT   CDS_pept        519826..520500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0523"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gka:GK2157 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77205"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX77205.1"
FT                   /translation="MNGRILLIEDEAGLARFLELDLKHEGFDVHVCADGREGLELALSE
FT                   QWDLILLDVMLPSLNGMEVCRRIRAAKSTPIMMITARDSVFDRVMGLDNGADDYIVKPF
FT                   AIEELLARIRALFRRVHPEANAQVLTFKDLVVDVQARTVKKGDEFIELTKREYDLLVAF
FT                   MQNINVVLTRDALLDKVWGFDAEVETNVVDVYVRYLRQKLDEHDKERYIQTVRGTGYVM
FT                   RP"
FT   gene            520497..521894
FT                   /locus_tag="GYMC61_0524"
FT   CDS_pept        520497..521894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0524"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gka:GK2156 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77206"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX77206.1"
FT                   /translation="MKREAIRRLSLKGKLTVLSAGAIFVTYFVFTFLQYHMVKQWLLKE
FT                   EEKTMEQTVAEIETYYAEKRNLSWEEIRRSRAFLERLNERYQLIRVTDEKGNVIVSVSN
FT                   GAAVSLSPSEMPDKRKMDEHFINNERFLLLRQPLHIGNLHGTIEIARRLARFQQVTNTL
FT                   FLIMTAIGFLAMAASAVAGRFVAQSFVRPLQTLAKTMADIQNNGLKRRIDVPPARDEIA
FT                   ELMVMFNGMMDEIERSFAMQRQFVEDASHELRTPLAILQGHLSLLQRWGKHNPEILEES
FT                   LEAAVKEAERLKRLVLELLDLSRAEAITVPDEVAPMDAAAAVGQVVKNFRVLHPDFQFL
FT                   IDQPDKPIARAAMAKHHFEQLLFILLDNAVKYSQRVKQIAISLREEGPFVIVSIRDYGI
FT                   GIPKEELKNVFLRFYRVDKARSREQGGAGLGLSIAKEIIDKYGGQIALESEVGKGTTVE
FT                   LAIPKAE"
FT   gene            521912..522067
FT                   /locus_tag="GYMC61_0525"
FT   CDS_pept        521912..522067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77207"
FT                   /inference="similar to AA sequence:KEGG:GK2155"
FT                   /protein_id="ACX77207.1"
FT                   /translation="MGHPHEEEAASKKVIHHLVEKFRKRGVKIATCKPRTMMSLSCLDE
FT                   IDKMRG"
FT   gene            522083..522637
FT                   /locus_tag="GYMC61_0526"
FT   CDS_pept        522083..522637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0526"
FT                   /product="glycerol-3-phosphate responsive antiterminator,
FT                   GlpP"
FT                   /note="PFAM: glycerol-3-phosphate responsive
FT                   antiterminator; KEGG: gka:GK2154 transcriptional
FT                   antiterminator of glycerol uptake operon"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77208"
FT                   /inference="protein motif:PFAM:PF04309"
FT                   /protein_id="ACX77208.1"
FT                   /translation="MEAKQRIIPAIKTMKQFDAFLSSGYTVGVLLEVHIAQLKSIFAYA
FT                   RRHGKELIVHVDLVQGLSHDEHAAEYLCQEFRPHGLISTKAGVIMKARQKRVLAVQRIF
FT                   LLDSHALEKSYQLIAKTNPDCIEVIPGAMPHIIREVKERTGKPIYAGGLIRTVDDVERA
FT                   LAAGAAAVTTSNETLWRHYNG"
FT   gene            522796..524469
FT                   /locus_tag="GYMC61_0527"
FT   CDS_pept        522796..524469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0527"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG: gka:GK2153
FT                   glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77209"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACX77209.1"
FT                   /translation="MAFSSKHRSDVLQAMSEKQYDLLIIGGGITGSGIALDAISRGMTV
FT                   ALVEMQDFAAGTSSRSTKLVHGGLRYLKQFEVKLVAEVGRERAIVYENGPHVTTPEWML
FT                   LPIYRGGTFGKWSTSIGLWLYDRLAGVKQSERRTMLNARQTLEKEPLLKRDGLIGGGYY
FT                   VEYRTDDARLTIEVIKKAVELGADAVNYVKAEQFLYDERGRAIGARCRDMLGGLLYDIR
FT                   AKKVVNAAGPWVDALRDKDGSKTGKRLRLTKGVHIVIDQKRFPLKQAVYFDTPDGRMVF
FT                   AIPRDGKTYVGTTDTFYDDDPAHPAMTEEDRDYLLQAIHYMFPSVGVTADDVESSWAGV
FT                   RPLIYEEGKDPSEISRKDEIWTSPSGLITIAGGKLTGYRKMAETVVDLVAKQLEKEEGK
FT                   AFGPCRTKQLPISGGDVGGSHRLPAFIAEKAEEAVRYGLTKEAGARLARQYGTNVDRLF
FT                   ALSQQYDRSSGLTRETFIRLVYAIEEEMAAKPVDYFIRRTGALLFDIDSVRREKEEVMA
FT                   FMARYLGWTGEERDVYEKELDKELRRAVLGRSGVNDPLKE"
FT   gene            524555..526744
FT                   /locus_tag="GYMC61_0528"
FT   CDS_pept        524555..526744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0528"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   gka:GK2152 alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77210"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ACX77210.1"
FT                   /translation="MSVAYNPQTKQFHLRAGKASYVMQLFRSGYLAHVYWGKAVRDVRG
FT                   ARAFPRLDRAFSPNPDPSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRY
FT                   KTHRIYKGKPRLNGLPATYVEHEPEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRSA
FT                   RFENKGGERLKLLRALSMSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRG
FT                   ASSHQQNPFIALAAKNADEHQGEVYGFSFVYSGNFLAQVEVDQFRTARVSMGINPFDFT
FT                   WLLQPGESFQTPEVVMVYSDQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATY
FT                   FDFNEEKIMDIARTAAELGIELVVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLNGLAK
FT                   QVNELGLQFGLWVEPEMVSPNSELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDY
FT                   IIETISNVLASAPITYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMDEITSR
FT                   FPHILFESCSGGGGRFDPGMLYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVS
FT                   AVPNHQVGRVTSLKTRGHVAMSGNFGYELDITKLTETEKQMMKQQVAFYKDVRRLVQFG
FT                   TFYRLLSPFEGNEAAWMFVSADRSEALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEG
FT                   LGVYGGDELMYAGVALPYRSGDFISMMWRLKAVQR"
FT   gene            complement(526803..527588)
FT                   /locus_tag="GYMC61_0529"
FT   CDS_pept        complement(526803..527588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77211"
FT                   /inference="similar to AA sequence:KEGG:GK2151"
FT                   /protein_id="ACX77211.1"
FT                   /translation="MKDTVKSLKQELQTITHWEHSQKDLWFWEKLGRLPFQVLDKLTPK
FT                   VVHRKLGQLLDELGSYIQSGGQYLVNEGKVLDKLGVSSLAEVPHLPLETMDRVCDELID
FT                   ARVTFAQLQGAATGIGGALTLAVDIPALLGLALKTLQEIAIVYGYDPKEKEERVFVVKC
FT                   LQFAAADIVGKKAILDELSSFSNERGRVFSELQGWREVMMTFRDQYGWKKLFQAVPIIG
FT                   VIFGSLFNKSFMEDIAETGKMLYRKRRIIEKLKQFEPGI"
FT   gene            527956..529974
FT                   /locus_tag="GYMC61_0530"
FT   CDS_pept        527956..529974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0530"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: csc:Csac_1018
FT                   beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77212"
FT                   /db_xref="GOA:C9S0R2"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9S0R2"
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /protein_id="ACX77212.1"
FT                   /translation="MNVLSSICYGGDYNPEQWPEEIWYEDAKLMQKAGVNLVSLGIFSW
FT                   SKIEPSDGVFDFEWLDKVIDILYDHGVYINLGTATATTPAWFVKKYPDSLPIDESGVIF
FT                   SFGSRQHYCPNHPQLITHIKRLVRAIAERYKNHPALKMWHVNNEYACHVSKCFCENCAV
FT                   AFRKWLKERYKTIDELNERWGTNFWGQRYNHWDEINPPRKAPTFINPSQELDYYRFMND
FT                   SILKLFLTEKEILRGVTPDIPVSTNFMGSFKPLNYFQWAQHVDIVTWDSYPDPREGLPI
FT                   QHAMMNDLMRSLRKGQPFILMEQVTSHVNWRDINVPKPPGVMRLWSYATIARGADGIMF
FT                   FQWRQSRAGAEKFHGAMVPHFLNENNRIYREVTQLGQELKKLDCLVGSRIKAEVAIIFD
FT                   WENWWAVELSSKPHNKLRYIPIVEAYYRELYKRNIAVDFVRPSDDLTKYKVVIAPMLYM
FT                   VKEGEDENLRQFVANGGTLIVSFFSGIVDENDRVHLGGYPGPLRDILGIFVEEFVPYPE
FT                   TKVNKIYSNDGEYDCTTWADIIRLEGAEPLATFKGDWYAGLPAVTRNCYGKGEGIYVGT
FT                   YPDSNYLGRLLEQVFAKHHINPILEVAENVEVQQRETDEWKYLIIINHNDYEVTLSLPE
FT                   DKIYQNMIDGKCFRGGELRIQGVDVAVLREHDEAGKV"
FT   gene            530312..531601
FT                   /locus_tag="GYMC61_0531"
FT   CDS_pept        530312..531601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0531"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pjd:Pjdr2_4699 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77213"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACX77213.1"
FT                   /translation="MKKILTLFLVSILLLTACSSKTKNGGAADSTKSTNEITVWTWDPN
FT                   FNVKAMKIAEEFYKKENPNFKLKIIENAQEDIVQKLNTSLSSGTTKGLPNIVLIEDYRA
FT                   QSFLKAYPDAFYDLSKYFKAEDFAEYKLAPTSLNGKHYGLPFDTGVAGLYVRTDYLQKA
FT                   GYTVDDLQGLDWNKYIEIGKKVKQATGKYMLALDPKNLGIIREMIQTSGSWYVKEDGVT
FT                   PNLADNEPLKEAFRTYKEIVNAGISKPISDWSQFVASFNSGAVASIPTGNWITASVKAE
FT                   ASQAGKWAVVPFPKQSGIPNSVNATNLGGSSWYVLNIPGKEKAAEFLAKTFGSNVEFYE
FT                   ALNKEIGAIGTYKPAANSEAYKAADEFFGGQKVTADFSKWMKEIPQVNYGAHTYVIEDI
FT                   LAAALQDYLKGKDLDKVLEDAQKQAEQQVK"
FT   gene            531840..532775
FT                   /locus_tag="GYMC61_0532"
FT   CDS_pept        531840..532775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0532"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pjd:Pjdr2_4698
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77214"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX77214.1"
FT                   /translation="MIPPTKVNLDLIIKTDRNINQKHRIKNTIIGWSFVILATIMICTF
FT                   YFYPMAQALILSLQSGSGTNLTFVGLKNYARLFSDPTFLTTVKNTVIYLIIQVPIMIIL
FT                   ALFLAVLLNNPKLKLRGLFRTAIFLPCVTSLVAYSVIFKYLFSQDGLINVMLMKFSLIS
FT                   EPINWLADPFWAKVTIIIALTWRWTGYNMIFYLSALQNIDHSIYEAAKIDGASPVQQFF
FT                   KITIPLLKPMILFTSITSTIGTLQLFDEVMNITQGGPGNATMTISQYIYNLSFKYTPDF
FT                   GYAATVSYAIVIMIVFFSIIQFKVAGDKNE"
FT   gene            532768..533592
FT                   /locus_tag="GYMC61_0533"
FT   CDS_pept        532768..533592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0533"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pjd:Pjdr2_4697
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77215"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX77215.1"
FT                   /translation="MSSLKNVFNYTVLTIASIVSVFPFLWMVVSATNKSVEVTKGRLLP
FT                   GSHFMENFRNLLDSTNLVNALMNSAKIAIITTLLAMLVSSLAGYGFEIFKSKTKDFLFN
FT                   FLLLSMMIPFAALMVPLFRMFGTISQIFPSIGIDTMTAVIFPTITTAFLIFFFRQSTKM
FT                   FPKEIIEAGRIDGLSEWGIFFRLYVPTMKTTYAAAAIITFMSSWNSYLWPLVILQSPEN
FT                   QTVPLLISNLGSSYSPDFGMIMTAIVIATLPTALIFFFMQKHFVAGMLGSVK"
FT   gene            533614..536655
FT                   /locus_tag="GYMC61_0534"
FT   CDS_pept        533614..536655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0534"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel;
FT                   glycoside hydrolase family 2 sugar binding; glycoside
FT                   hydrolase family 42 domain 5 loop region; glycoside
FT                   hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; KEGG: bha:BH2723 beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77216"
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /protein_id="ACX77216.1"
FT                   /translation="MKKTLTTPTLEWLSDPRVFGVNRLPAHSDHIYYETLEEAKNGVSM
FT                   SMRYELNGNWKFHYAVNPASRPAKFYQLDFDCSNWGDISVPGHIQLQGYGTPQYVNTMY
FT                   PWDGHCDARPPEVPMDYNPVGSYIKIFNLPERMKGKPVYISFQGVESAFYVWLNGQFVG
FT                   YSEDSFTPAEFELTPFIKDGENKLAVEVYQYSTGSWLEDQDFWRFSGIFRDVYLYTVPD
FT                   IHVYDLHVRAELDSSYTRGMLTADLTFLSPVPAGSRFIAELYDAKGDLVAKKDGELHSE
FT                   KGTFSIAVDEPELWSAEKPYLYKLYIQIFNEFGQLVEVVPQKVGFRRFEIINKVMHLNG
FT                   KRIVFKGVNRHEFHCRRGRAITKEDMLWDIKTLKRHNINAVRTSHYPNQSYWYELCDEY
FT                   GIYVINEMNLETHGTWQKMGRVDPTWNVPGNNREWQDIVMDRAISMFERDKNHPSILIW
FT                   SCGNESYAGEVLLNVANYFRSVDPSRLVHYEGVFHAREYNDISDIESRMYAKPHEIEKY
FT                   LTENPDKPYISCEYMHAMGNSLGGMYKYTDLEQKYPMYQGGFIWDFIDQALVKKDRYGK
FT                   EFLAYGGDFGDRPTDYGFCTNGIVYANRELSPKMQEVKYLYQNFKLSPDQYGVNIRNES
FT                   LFTDTSEYDLEYVLFLEGRELYRSKLNVSVAPQEEKRVEFDWPLGMMADAGEYCIHASF
FT                   KLKEKTLWADAGYEVAFGQFVFQIGSKEFVVPSGKLKVVHGDVNIGVHGKDFTIMFSKQ
FT                   AGSLVSMNYAGKEMIAAPPAPLFWRATTDNDRGFLQDFYSGLWYAASLARKCVKVDVKE
FT                   EAAQVNVTFTYKFSINPELEVKIGYTVYADGSIRVKVVYHGVENLPSMPIFAVSFKVPA
FT                   DYNQLEWYAMGPEENYVDRSKGARLGIFRNQVSDNVSRYLKPQESGNRTGVRKVSLTNN
FT                   NGQGIKISSITEPLECNFSPYTAFELEHANHHYELPNIHYTVVTVAGRQMGVGGDDSWG
FT                   APVHDEYVIKADQDMEFEFVIHKV"
FT   gene            536917..537048
FT                   /locus_tag="GYMC61_0535"
FT   CDS_pept        536917..537048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77217"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77217.1"
FT                   /translation="MVVEAMFSVLIGQYGTREIGGDSIIEFESDTRYILSYLFVALD"
FT   gene            537295..538485
FT                   /locus_tag="GYMC61_0536"
FT   CDS_pept        537295..538485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0536"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: Galactokinase
FT                   galactose-binding domain; GHMP kinase; GHMP kinase domain
FT                   protein; KEGG: gka:GK2150 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77218"
FT                   /inference="protein motif:TFAM:TIGR00131"
FT                   /protein_id="ACX77218.1"
FT                   /translation="MAVSFGLTETFKNVFGGGEERVRIFFAPGRVNLIGEHTDYNGGHV
FT                   LPCALEIGTYALVRQTDEPFVRLYSQNFSETGVITVSYDDLSYRSEHGWANYPKGILAA
FT                   FQALSPLETGLDILYYGTIPNGAGLSSSASIELVTAVMLNELFRRGLDQLELVKMSQTV
FT                   ENKYVGVNCGIMDQFAVGMGKQDCAILLNCQTLEYRYLPLVLNDCSIVIANTNKKRGLA
FT                   DSAYNERRATCEAALAKLQSVRNIASLGELTSAELARYAHLLSPLEQKRARHAVMENER
FT                   TLEAARALERGDLIHFGELMKQSHLSLRNDYEVTGVELDTLVEAAWSHEGTVGARMTGA
FT                   GFGGCTVNIVKKACVQDFIERVGNAYAEKIGYEASFYVVEVGDGARELTELEEMSR"
FT   gene            538482..539468
FT                   /locus_tag="GYMC61_0537"
FT   CDS_pept        538482..539468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0537"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; dTDP-4-dehydrorhamnose
FT                   reductase; 3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   Male sterility domain; KR domain protein; polysaccharide
FT                   biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: gka:GK2149 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77219"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACX77219.1"
FT                   /translation="MILVCGGAGYIGSHAVYRLLEKGERVVVVDNLQTGHREAVHPDAV
FT                   FCQGDIRDRDFLREVFRQHDIEAIIHFAANSLVGESMEEPLKYYDNNVYGTQVLLEVMR
FT                   EFGVKQIVFSSTAAVYGEPKQIPIVETDPTEPTNAYGETKLAMEKMMKWADRAYGIRSI
FT                   SLRYFNVAGAYGTTIGEDHNPETHLIPLILKVPLGQREEIYIFGDDYDTPDGTCIRDYI
FT                   HVLDLVNAHWLALEKLRSGADSDVYNLGNGNGFSVKEVIEAARQVTGHPIPARVVARRL
FT                   GDPARLVASSEKAKRELGWEPKYPSITDIVASAWEWHQARPNGYRGV"
FT   gene            539471..540997
FT                   /locus_tag="GYMC61_0538"
FT   CDS_pept        539471..540997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0538"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="KEGG: gka:GK2148 galactose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77220"
FT                   /inference="protein motif:TFAM:TIGR01239"
FT                   /protein_id="ACX77220.1"
FT                   /translation="METIFAAIEQLIRYAEQRGLLAPEDVVYARNRLLATLRLTEWQPA
FT                   EVKDVPLASPAPVLDAMIDWAYEQGLLETNTTTERDIWDARLMDCVMPRPSEVIRAFYE
FT                   RYRRDPQEATDWFYSLSQASNYIQTARIANNQHWKVSTIYGELDITINLAKPEKDPKEI
FT                   AKLKEMPSSSYPKCVLCKENEGYEGTWRHPARSNHRVIPITLLDEQWYFQYSPYVYYNE
FT                   HCIVFHAEHVPMKMERKTLERLLDFVEKFPHYFIGSNADLPIVGGSILVHDHFQGGCYT
FT                   FAMEKAEIEECIPLPSFPSVAAGIVRWPMSVIRLTGPKEDVLDAAAFLYETWRTYSDPS
FT                   VEIMAYSGDVPHNTITPIARRRGDLFELDIVLRNNRTSAEHPYGIFHPHEELHHIKKEN
FT                   IGLIEVMGLAVLPARLAVELETLADYLVHRTKKEDWDESMHKHWDWCEAIHSAYPDITK
FT                   DNVHDILRHEVGQRFVTVLEHAGVFKRDKRGKDAFRRFIQHAVERMSSLV"
FT   gene            541054..542076
FT                   /locus_tag="GYMC61_0539"
FT   CDS_pept        541054..542076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0539"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: gka:GK2147 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77221"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACX77221.1"
FT                   /translation="MATLKEIAEKVGVSVATVSRVLNYDVTLSVSDETRRRIFEVAQEL
FT                   NYKTLRERSQQARESFRFGLIHWYSERQEIDDPYYMAIRLGVEKECFDRGIELVKLFKQ
FT                   HGAYPIERMEALDGIIAVGKFGPKEVEVFAAGAKQIVFVDCSPDEHRFDSVVIDLRQAT
FT                   VTVLDYLLRLGHTKIGYIGGREYVDGETPIRDEREAAFYEYLYVKGLYDSRYVWIGAFT
FT                   AEDGYRLMKEAVSGGDLPTAFFIASDSMAIGALRALHEAGIAVPEEAAIVGFNDIPTAA
FT                   FLHPPLSTVKVYTEFMGETAVELLIERLTTKRAICKKVVVPTELVIRSSSEGNEKGSGR
FT                   "
FT   gene            complement(542093..542536)
FT                   /locus_tag="GYMC61_0540"
FT   CDS_pept        complement(542093..542536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0540"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gka:GK2146
FT                   heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77222"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACX77222.1"
FT                   /translation="MALIPYDPFRHLESIRRDMNRFFASDFPSLFTHMDEQHWMPRIDM
FT                   HETANEYVVSCDLPGLERKEDVHIDVQNNMLTISGTIQRHHDVREEQMHRRERFFGRFQ
FT                   RSITLPADAATENIRATYKNGVLDIHIPKTTTGTKKRVDIEFH"
FT   gene            complement(542601..542891)
FT                   /locus_tag="GYMC61_0541"
FT   CDS_pept        complement(542601..542891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77223"
FT                   /inference="similar to AA sequence:KEGG:GK2145"
FT                   /protein_id="ACX77223.1"
FT                   /translation="MTYPFSALLDGYRRLWPNRSLAAGPLDEQESQTLLYETIRQELRD
FT                   EWTHPRVRQSSEVKFYYAVKRVAASDLPDGMKVALIQAYLTVMEQLQANHT"
FT   gene            543497..545042
FT                   /locus_tag="GYMC61_R0036"
FT   rRNA            543497..545042
FT                   /locus_tag="GYMC61_R0036"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            545431..548357
FT                   /locus_tag="GYMC61_R0037"
FT   rRNA            545431..548357
FT                   /locus_tag="GYMC61_R0037"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            548728..548802
FT                   /locus_tag="GYMC61_R0038"
FT                   /note="tRNA-Asn2"
FT   tRNA            548728..548802
FT                   /locus_tag="GYMC61_R0038"
FT                   /product="tRNA-Asn"
FT   gene            548807..548897
FT                   /locus_tag="GYMC61_R0039"
FT                   /note="tRNA-Ser1"
FT   tRNA            548807..548897
FT                   /locus_tag="GYMC61_R0039"
FT                   /product="tRNA-Ser"
FT   gene            548912..548983
FT                   /locus_tag="GYMC61_R0040"
FT                   /note="tRNA-Glu3"
FT   tRNA            548912..548983
FT                   /locus_tag="GYMC61_R0040"
FT                   /product="tRNA-Glu"
FT   gene            548993..549068
FT                   /locus_tag="GYMC61_R0041"
FT                   /note="tRNA-Val2"
FT   tRNA            548993..549068
FT                   /locus_tag="GYMC61_R0041"
FT                   /product="tRNA-Val"
FT   gene            549249..549325
FT                   /locus_tag="GYMC61_R0042"
FT                   /note="tRNA-Met2"
FT   tRNA            549249..549325
FT                   /locus_tag="GYMC61_R0042"
FT                   /product="tRNA-Met"
FT   gene            549331..549406
FT                   /locus_tag="GYMC61_R0043"
FT                   /note="tRNA-Asp1"
FT   tRNA            549331..549406
FT                   /locus_tag="GYMC61_R0043"
FT                   /product="tRNA-Asp"
FT   gene            549740..549815
FT                   /locus_tag="GYMC61_R0044"
FT                   /note="tRNA-Phe1"
FT   tRNA            549740..549815
FT                   /locus_tag="GYMC61_R0044"
FT                   /product="tRNA-Phe"
FT   gene            549977..550052
FT                   /locus_tag="GYMC61_R0045"
FT                   /note="tRNA-Thr2"
FT   tRNA            549977..550052
FT                   /locus_tag="GYMC61_R0045"
FT                   /product="tRNA-Thr"
FT   gene            550059..550143
FT                   /locus_tag="GYMC61_R0046"
FT                   /note="tRNA-Tyr1"
FT   tRNA            550059..550143
FT                   /locus_tag="GYMC61_R0046"
FT                   /product="tRNA-Tyr"
FT   gene            550153..550226
FT                   /locus_tag="GYMC61_R0047"
FT                   /note="tRNA-Trp1"
FT   tRNA            550153..550226
FT                   /locus_tag="GYMC61_R0047"
FT                   /product="tRNA-Trp"
FT   gene            550244..550316
FT                   /locus_tag="GYMC61_R0048"
FT                   /note="tRNA-His1"
FT   tRNA            550244..550316
FT                   /locus_tag="GYMC61_R0048"
FT                   /product="tRNA-His"
FT   gene            550332..550406
FT                   /locus_tag="GYMC61_R0049"
FT                   /note="tRNA-Gln2"
FT   tRNA            550332..550406
FT                   /locus_tag="GYMC61_R0049"
FT                   /product="tRNA-Gln"
FT   gene            550412..550483
FT                   /locus_tag="GYMC61_R0050"
FT                   /note="tRNA-Gly3"
FT   tRNA            550412..550483
FT                   /locus_tag="GYMC61_R0050"
FT                   /product="tRNA-Gly"
FT   gene            550493..550566
FT                   /locus_tag="GYMC61_R0051"
FT                   /note="tRNA-Cys1"
FT   tRNA            550493..550566
FT                   /locus_tag="GYMC61_R0051"
FT                   /product="tRNA-Cys"
FT   gene            550629..550714
FT                   /locus_tag="GYMC61_R0052"
FT                   /note="tRNA-Leu3"
FT   tRNA            550629..550714
FT                   /locus_tag="GYMC61_R0052"
FT                   /product="tRNA-Leu"
FT   gene            550928..551290
FT                   /locus_tag="GYMC61_0542"
FT   CDS_pept        550928..551290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0542"
FT                   /product="integrase domain protein SAM domain protein"
FT                   /note="PFAM: integrase domain protein SAM domain protein;
FT                   KEGG: gwc:GWCH70_2825 integrase domain protein SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77224"
FT                   /inference="protein motif:PFAM:PF02899"
FT                   /protein_id="ACX77224.1"
FT                   /translation="MLISDDIREIEYTFEELLEIFIEDCELRNLREHTIKYYRSELNAF
FT                   VKLLKEQEIELRVSEWTGETIKRNVIMYMKEKGLKTVSINSRLRAMRAFFNFLEGRNLI
FT                   KSNPMKDIKLLKDRLP"
FT   gene            551529..552737
FT                   /locus_tag="GYMC61_0543"
FT   CDS_pept        551529..552737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0543"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: gka:GK2025
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77225"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACX77225.1"
FT                   /translation="MRVLYERCCGLDVHKKSITACVLTPEGKEIRTFGTMTDDLEELVE
FT                   WLKQKQVTHVAMESTGVYWKPIYNLLEAEPIDVLVVNAQHLKAVPGRKTDVKDAEWIAD
FT                   LLRHGLLIPDRAQRELRELVRYRRSLIEERAREFNRIQKVLEGANIKLASVVSDISGVS
FT                   AQQILRALIEGTDDSAVLAQLAKGRLKQKIGELRRALKGIMGPHQRMMLSEQCRHIEYL
FT                   DEAIARLSREIEERTRPFHEALELMETIPGVGRQSAEQIIAEIGTDMSRFPTAAHLASW
FT                   AGMAPGNHESAGKRLSGRTRKGNKKLRACLVECARAAARTKNTYLSAKYHRIAKRRGAN
FT                   RASVAVGRTILEIIYSVLTRKEPYRELGADYWDQQREAAIVRQTVKRLEGLGYEVKLEK
FT                   TSA"
FT   gene            552812..553063
FT                   /locus_tag="GYMC61_0544"
FT   CDS_pept        552812..553063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_1449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77226"
FT                   /inference="similar to AA sequence:KEGG:Sbal195_1449"
FT                   /protein_id="ACX77226.1"
FT                   /translation="MLIGVFRIEHLLLLQEKINVYLSFIESGEIYTTYTPSKGRKFEIK
FT                   ICFKESIPDSCILFLQQASKIIADAGFFLTYSVGLENE"
FT   gene            553273..553737
FT                   /locus_tag="GYMC61_0545"
FT   CDS_pept        553273..553737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0545"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   gtn:GTNG_2796 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77227"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ACX77227.1"
FT                   /translation="MMQYTITPIAFVKNNRKDVEDDNWGSVISIIELSDEIDDSALQGI
FT                   SEFSHLDIIFYFDRVTDDKIQYGARHPRNNKEYPKVGIFAQRGKNRPNKLGLTTVELLE
FT                   HKGRTLKVRGLDAIDGTPIIDIKPVMKEFLPKGEVRQPAWSVSLMERYWD"
FT   gene            554131..554220
FT                   /pseudo
FT                   /locus_tag="GYMC61_0546"
FT                   /product="hypothetical protein"
FT   gene            554813..555274
FT                   /locus_tag="GYMC61_0547"
FT   CDS_pept        554813..555274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77228"
FT                   /inference="similar to AA sequence:KEGG:GK2903"
FT                   /protein_id="ACX77228.1"
FT                   /translation="MAGCSGQTDRYAIEGYVVRKEGGSILVVSSDPQDFRSTGGLKEFY
FT                   NAILVSSAPARVNIGQKVQVWIDGGIAESYPGQGKAGKVLVVPSSPRDGASLSEEEAIR
FT                   QALKQEESRLEHMIPVIRAVHYDKQADTWMIQIKDAHERTEFDVRIKDE"
FT   gene            complement(555388..555558)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0548"
FT                   /product="hypothetical protein"
FT   gene            complement(555613..556227)
FT                   /locus_tag="GYMC61_0549"
FT   CDS_pept        complement(555613..556227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77229"
FT                   /inference="similar to AA sequence:KEGG:GK2902"
FT                   /protein_id="ACX77229.1"
FT                   /translation="MEALLTQILDRLDQLHSSVGVLTSDVNEMKNQLNKIEARAGSIEE
FT                   RVNSIEARVDSIESRVNNIEANMATKDELAELRSKVDDIEAKMATKDELAELRSTVNGL
FT                   QSNVNEIQAKMATKEELAELQSKVNEFQFKVNELQSNVNEIQAKMATKDDLVPIRQAVM
FT                   EIDQIVKRIEVNQERHEHILAILSKRSIEHEASIASLRQAQ"
FT   gene            556854..557795
FT                   /locus_tag="GYMC61_0550"
FT   CDS_pept        556854..557795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0550"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: gka:GK2901
FT                   ferrichrome ABC transporter (substrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77230"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACX77230.1"
FT                   /translation="MLQKKWTSLLAVLMALFVLLVPLAQPAAPVEAASKTRVFKTELGK
FT                   LVIKGTPKRIVTLSMAGTDAVVTLGLKPVGYTISNSGTVPTYLRNKLKGVPSVGALSAP
FT                   SLERIAALKPDLIIIDHEFEFHKAIIPQLKKIAPVAGFRANSYKEAMNQLLVLGDILGR
FT                   KAKAKSFVNQFYKELKSQQAKLKDKNLRVLGFFVNKDGINVWQDNSFSGSIFTALKADY
FT                   AFKEKGDEYSDFKTVSLERILEIDPDVLFAYTDPGKNDLKKVKANPIWSQLKAVKKKRV
FT                   VEVNRDLWSRSRGPLAAKLIVKEAASILKRYQ"
FT   gene            557826..558824
FT                   /locus_tag="GYMC61_0551"
FT   CDS_pept        557826..558824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0551"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gka:GK2900 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77231"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACX77231.1"
FT                   /translation="MTYGKKAIWISVIAGLGIVLLMIVSLVSGPFFVPIPKVLDVLLHD
FT                   DGSKARTVVWNLRFPRALLAVLIGANLAVAGAMMQCLTKNPMAEPKIMGVSAGAAAMVV
FT                   LIEYFFAGLPLLFFSPLVFLGAAVGGALVYSLSLKRGTLSPVRLTLAGVAVSAFLHAIT
FT                   VGILVLLGQDAAAVYAWLAGGLNGLTWRHVSLIAPWSLAGLLLSIMIASKMDLLELGDD
FT                   TAKGLGVHVGILKTVMAVMIIILAGSAVSVSGVIGFIGLIIPHIVRKMVGVNYTYIVPV
FT                   SALCGGMLLLTADLLARLAAQPIELPVGVFTAAIGCPYFLYLIRKQGEWNA"
FT   gene            558817..559797
FT                   /locus_tag="GYMC61_0552"
FT   CDS_pept        558817..559797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0552"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gka:GK2899 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77232"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACX77232.1"
FT                   /translation="MRKRDVGLVAGLALLLVIIVPLGACFGDVKIPVSQVWEAFFNRKS
FT                   SLNGEIVWEYRLPRILVGLFVGANLAVSGALLQAVTQNPLAAPNVIGMTAGASLFAVLA
FT                   LLIIPHFPVSGLPFVTFFGALFAGLCVYAFAWKKGMDKGRFALSGIAFDALFQAVITGI
FT                   LVFATKGIDAAVIWLAGSLWGRTWEHVFLIAPWSVVGLGLAYLCYRRMNVLQLHDDVAA
FT                   SLGMRVQAARFLIFLIAVGLCGSAVAVSGPIGFLGLVIPHLARLLTRADYQLLIPVSAL
FT                   LGAILMISADTAGRTIAAPIEIPVGILTAFIGAPYFLFLLRRAKL"
FT   gene            559832..561334
FT                   /locus_tag="GYMC61_0553"
FT   CDS_pept        559832..561334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77233"
FT                   /inference="similar to AA sequence:KEGG:GK2898"
FT                   /protein_id="ACX77233.1"
FT                   /translation="MVSSFAAVSLAIAGAAESEAYAAKPAKLAIESAQPVNASTVKEYI
FT                   VKGKGLKGAKIKIVITDGKASVTHDTVVQKSGSFEAPVNVSTLRDGTLTVSVTQIIKGQ
FT                   KHSRVQKKIIKDTKAPSVPVITNKGWINAKQQNAYAVQGTAEPHSAVQVLLSDGKQRIT
FT                   KTVRADGKGRFRAVIDARRLAEGEITVSAVSVDSAGNQSGQSKKVLRKDVSIEAPELLN
FT                   EGYINAFNYEAYPVTGTGTPGEKVVVEADDGKKSVSASGLVDEDGNYEVEINTSSLKDG
FT                   KITIRVKTIDQAGNESRMASVVLIKSLSSPAKPSIDNKGYVNAGADATAYEVTGKGEPG
FT                   AEVEVTLSDGTNEISTVGTVEENGRYRVEADISPLSDGLITITAVQTSVTGNVSPEATA
FT                   TVWKDTAVAAPSLNALPAVTSQNQAAYTIAGTAESNALVQVIITDGQKSLVERTSADSN
FT                   GNFSKTIDLSAFNNGQLIIIVTQEDKAQNHSEATTATVTKGQ"
FT   gene            561554..562085
FT                   /pseudo
FT                   /locus_tag="GYMC61_0554"
FT                   /product="hypothetical protein"
FT   gene            562098..562385
FT                   /locus_tag="GYMC61_0555"
FT   CDS_pept        562098..562385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK2883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77234"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77234.1"
FT                   /translation="MSAGRSLDEHFLPFYCAGLRFGAAVGVTRRENVRDKGMRLLPLGV
FT                   RLMKPQREQYKRMAACERKAAMLVLVEMPNLLSFGPDVLLFLPLFLLEGL"
FT   gene            complement(562589..563215)
FT                   /locus_tag="GYMC61_0556"
FT   CDS_pept        complement(562589..563215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0556"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   gka:GK2882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77235"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACX77235.1"
FT                   /translation="MGIGTIFSFLGVAVLLTLAPGPDILFVIAQSLSQGKQAGIATALG
FT                   LCTGLLVHISAATLGVSAVIYQSALAFAIVKYAGAAYLLYLAWQAFREKDSSLAFGRQK
FT                   PMAYASLYKKGIVMNVLNPKVSLFFLALLPQFVDPSAGRVPQQMLLLGAVFLAQALAVF
FT                   TLVSIGAEKLRHWLLANTAITKRIHWLKGAIFALIGIQIAFSERS"
FT   gene            complement(563346..564296)
FT                   /locus_tag="GYMC61_0557"
FT   CDS_pept        complement(563346..564296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0557"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: gka:GK2881
FT                   cation efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77236"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACX77236.1"
FT                   /translation="MAPTLYDFHHLPHVKTQNESKKALWVTLLLTMFFTAVEIIGGLIS
FT                   NSLALLSDSAHMASDVLALGLSMVALYMATRPPNRRFTFGFLRFEIITSFLNGLTLAVI
FT                   ALWILWEGIQRFLHPEPINFRLMLGIAAIGLVVNLTLTIVLSRSTKEEDNLNVQSALWH
FT                   FIGDLISSIGVIVSALLIYFTGWTVFDPIISLVIAAIIFTGGAKIMRESYLILMEAVPD
FT                   GFDLEQIRADIRKIEGVEDVHDMHLWAISTDHYSLSAHVFVNERIQPLCVILAVNEMLK
FT                   EKYGIEHATIQVEHAMLHDHGRYGRAFLEKKASHE"
FT   gene            564473..566515
FT                   /locus_tag="GYMC61_0558"
FT   CDS_pept        564473..566515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0558"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: gtn:GTNG_2782 glycogen branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: alpha
FT                   amylase all-beta; glycoside hydrolase family 13 domain
FT                   protein; alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77237"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACX77237.1"
FT                   /translation="MYGHHFASERMRSSLIAANPTDLEVYLFHEGRLYQSYELFGAHVI
FT                   RDGGAVGTRFCVWAPHAREVRLVGSFNDWNGANSPLTKVNDEGVWTIVVPENLEGHLYK
FT                   YEIITPDGRVLLKADPYAFYSELRPHTASIVYDLKGYEWNDSSWQRKKRRKRIYDQPMV
FT                   IYELHFGSWKKKPDGRFYTYREMADELIPYVLERGFTHIELLPLVEHPLDRSWGYQGTG
FT                   YYSVTSRYGTPHDFMYFVDRCHQAGLGVIIDWVPGHFCKDAHGLYMFDGAPTYEYANEK
FT                   DRENYVWGTANFDLGKPEVRSFLISNALFWLEYYHVDGFRVDAVANMLYWPNNDRLYEN
FT                   PYAVEFLRQLNEAVFAYDPNVLMIAEDSTDWPRVTAPTYDGGLGFNYKWNMGWMNDMLK
FT                   YMETPPHERKYAHNQVSFSLLYAYSENFILPFSHDEVVHGKKSLLNKMPGSYEEKFAQL
FT                   RLLYGYMMAHPGKKLLFMGSEFAQFDEWKFEGELDWVLFDFELHRKMDEYVKQLIACYK
FT                   RYKPFYELDHDPRGFEWIDVHNAEQSIFSFVRRGKKDGDLLVIVCNFTNQAYDDYKVGV
FT                   PLLAPYREVLNSDAAEFGGSGHVNGKRLPAFSEPFHGKPYHVRMTIPPFGISILRPVQK
FT                   RGERKQNEEEVHRHVIGRRARKPASLADEKHRETSRAVWGEVPDH"
FT   gene            566484..567566
FT                   /locus_tag="GYMC61_0559"
FT   CDS_pept        566484..567566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0559"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: gtn:GTNG_2781
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77238"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ACX77238.1"
FT                   /translation="MPFGGKYRIIDFTLSNCTNSGIDTVGVLTQYQPLLLHSYIGIGSA
FT                   WDLDRRNGGVTVLPPYSASSGVKWYEGTANAIYQNMNYIEQYDPDYVLVLSGDHIYKMD
FT                   YQQMLDYHIAKQADATISVIEVPWEEASRFGIMNTNENMEIVEFAEKPANPKSNLASMG
FT                   IYIFNWPLLREYLQIDNADPHSSHDFGKDVIPRLLRENKRLVAYPFKGYWKDVGTVKSL
FT                   WEANMDLLDEHNELDLFDRSWRIYSVNPNQPPQYIAPEAEVSDSLINEGCVVEGTVERS
FT                   VLFQGARIGKGAVVKESVIMPGATVGEGAYVERAIVTPEIVIPPHSTVSPGDADDDVVL
FT                   VTTEWIKQRNKDTARKDGAQ"
FT   gene            567563..568597
FT                   /locus_tag="GYMC61_0560"
FT   CDS_pept        567563..568597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0560"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase,
FT                   GlgD subunit; KEGG: gtn:GTNG_2780 subunit of ADP-glucose
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77239"
FT                   /inference="protein motif:TFAM:TIGR02092"
FT                   /protein_id="ACX77239.1"
FT                   /translation="MNNNMMLGVIDATTYMEAMAPLVEQRSIAAVPFAGRYRLIDFVLS
FT                   SMVNSGIESVAIFPKYQYRSLMDHLGSGKNWDLNRKRDGLFFFPSPDLLFSGERRVGAF
FT                   AHFEQHIDYFLRSRQKYAVIANSYTVCNIDFDAVLERYIERGCDVTRVCHRGEPLEMYV
FT                   LETSLLLDLISVYKERGYRSIVDVVCDDCHSLSICDYEYSGYADVIDSLARYFQASMEL
FT                   LDRSVWEQLFLPSRPIYTKVKDEPPTKYRREGNVKRSMIANGCVIEGTVENSVLFRSVK
FT                   IGKGAVVKNSIVMQKCQIGDGCVLDGVIVDKDAKIEPGVVLQGTAERPFVVRKGTVQGE
FT                   VVNR"
FT   gene            568594..570051
FT                   /locus_tag="GYMC61_0561"
FT   CDS_pept        568594..570051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0561"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: Starch synthase catalytic domain protein; glycosyl
FT                   transferase group 1; KEGG: gtn:GTNG_2779 glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77240"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ACX77240.1"
FT                   /translation="MNVLFAVSECAPFAKSGGLADVVGALPKELRRLGVDVRVMMPKYE
FT                   TIALKWKERMGKVAELVVPVGWRRQYCGVEKLEHDGVVYYLIDNEYYFKRPQLYGHDDD
FT                   GERFAYFCRAVLDALPAISFQPDVIHCHDWHTGMIPFFLREQYRHDPFYADIRTIFTIH
FT                   NLQFQGLFPRGILEDLLNLDGRYFTVDHLEFYGSVSFMKGALVASDLITTVSPTYKEEI
FT                   QTAYYGERLDGLLRARRDDLLGILNGIDDEFYNPETDPFLAATYSVHTRERKKLNKRAL
FT                   QRRFGLPERDDAPVVAMVTRMTAQKGLDLVTCVFHDLMQEEMQLVVLGTGDWRFEQFFS
FT                   QMAAAYPDKVGVYIGFHEPLAHQIYAGADLFLMPSLFEPCGLSQMIALRYGTIPIVRET
FT                   GGLNDTVQSYNEFTGEGNGFSFTNFNAHDMLYTIRRALSFYRQPSIWERLMERAMRGDY
FT                   SWRRSAREYRKAYEQLNKKGEDALVRG"
FT   gene            570038..572452
FT                   /locus_tag="GYMC61_0562"
FT   CDS_pept        570038..572452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0562"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: gtn:GTNG_2778 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77241"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACX77241.1"
FT                   /translation="MFADKETFQRAFVTRVEALCGKPFAESTARDHYHVLGHMVREHIS
FT                   RHWIATNERCRAERRKQVYYLSIEFLLGRLLGSNLLNLGVRPMVEEGLRELGIRLEDIE
FT                   ECEADAGLGNGGLGRLAACFLDSLATLNLPGHGHGIRYKHGLFDQKIVDGYQVELPEQW
FT                   LRNGNVWEIRKEELAVEVRFWGRVEVSEQNGRLVFRHVDSENVMAVPYDMPVIGFGTNT
FT                   VNTLRLWSAEPAKTFPLHKDVMQYKRETEAISEFLYPDDTHDEGKLLRLKQQYFLAAAS
FT                   LGSITRSHRRQHGSLRRLHEYVAIHINDTHPVLAIPELMRILLDEEGMSWEEAWHITTH
FT                   TIAYTNHTTLAEALEKWPIRLFQPLLPRIYMIVEEINERFCRELWERYPGDWGRIEQMA
FT                   IVAHGMVKMAHLAVVASHSVNGVAKLHTEILKQREMRLFYEWAPHKFNNKTNGVTHRRW
FT                   LLKANPELSALITETIGPRWIREPEALIELKSYASDPAFQQALAAVKQQRKARLAARIY
FT                   EKTGILVDESSIFDVQVKRLHAYKRQLLNVLHIMHLYNRLKEDSHFSIYPRTFIFGAKA
FT                   SPGYYYAKRIIKLIHSVADKVNNDNQVNEQLKVIFLENYRVSLAEEIIPAADVSEQIST
FT                   ASKEASGTGNMKFMMNGAVTLGTLDGANVEIAEAVGEENMFLFGLTADEVLRYYEHGGY
FT                   RAHEYYHHDKRIKQVVDQLVNGFFPDVGDYFEPIYDSLLAQNDEYFVLRDFAAYAEAHE
FT                   RVEEAYRDPARWWRMSAVNIAHSGRFASDRTVAEYAAEIWGLLPSGERFST"
FT   gene            572599..573717
FT                   /locus_tag="GYMC61_0563"
FT   CDS_pept        572599..573717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0563"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; KEGG: gka:GK2880 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77242"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACX77242.1"
FT                   /translation="MDMTLTAKIKIYPTAEQAEVLKATLSAYRQACNAVSVVIFDTKVL
FT                   AQAKLHDMTYRLLRSNYALRSQMAQSVIKTVIARYRSLKSNGHEWTLVRFKKPEYDLVW
FT                   NRDYSIVQGLFSVNTLEGRIKVPFEPKGMEPYFDGSWTFGTAKLVYKHNKFFLHIPMTK
FT                   TIPTVDEHNIRQVVGVDVGVNFLAAAYDSQGKTIFFNGRKIKHMRAKYKRMRKTLQQKG
FT                   TASARRKLKTIGQRENRWMTDVNHAVTKALVRQYGERTLFVLEDLTGIREKTERVRIHD
FT                   RYETVSWAFYQFRQMLEYKARLHGSKVIVVAPHYTSLTCPKCGHTEKANRNKRTHTFCC
FT                   RTCGYTSNDDRIGAMNLQRKGIEYIVEGTTQA"
FT   gene            complement(573935..574729)
FT                   /locus_tag="GYMC61_0564"
FT   CDS_pept        complement(573935..574729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0564"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   gka:GK2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77243"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /protein_id="ACX77243.1"
FT                   /translation="MSAHEIDYRLYGDDMQFVEIELDPYESVVAEAGGMMMMDDGIVME
FT                   TVFGDGSSSGKGLLGRLVGAGKRLLTGESLFMTVFTNQGSGKRRVAFAAPYPGKIIPVD
FT                   LSELGGKLICQKDSFLCAAKGVSVGIEFQRKLGAGFFGGEGFIMQKLEGDGLAFLHAGG
FT                   TIHRRDLQPGETLRIDTGCLVAMTKDVNYDIEYVGNIKTAFFGGEGLFLATVTGPGAVW
FT                   VQSLPFSRLADRVLAAAPSAGGRSVGEGSILGGIGDWLDGDD"
FT   gene            complement(574829..575638)
FT                   /locus_tag="GYMC61_0565"
FT   CDS_pept        complement(574829..575638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0565"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: sporulation protein, yteA family; KEGG:
FT                   gka:GK2878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77244"
FT                   /inference="protein motif:TFAM:TIGR02890"
FT                   /protein_id="ACX77244.1"
FT                   /translation="MLMNEQLAALRSRLLDMKRETEDRLKQNDHFGMIRSHAHDAVGEL
FT                   ASYDNHPADEATELYEREKDLALKEHAERELREIERALGAIADGTYGTCRVCGRPIPYE
FT                   RLEALPTTLYCREHSPDQTVSQKRPLEEGVLMPPFGKFDFDDRTESVAYDAEDAWQEVA
FT                   RYGTSDTPSDLGKNVDSYSEVYAESEENVGYVEDLENFAAVDLHGQHVRVYPTREHELL
FT                   ENILDDEGIMSNIGDLPAYEKDPYTSTDSYRRYDERPSQQHFGETTP"
FT   gene            complement(575724..576653)
FT                   /locus_tag="GYMC61_0566"
FT   CDS_pept        complement(575724..576653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0566"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   gka:GK2877 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77245"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ACX77245.1"
FT                   /translation="MQSFTHMDHRPPARRDWRVFWRLTRPHTLTAAFVPVCVGTVLALG
FT                   ETSIDWLLFAAMMIASLLIQAATNMFNEYYDYQRGLDSPESVGIGGAIVRDGLKPKTVL
FT                   ALAFGCLGLAMLIGIYICAESSWWLAVVGTICMAAGYFYTGGPVPIAYTPFGELAAGFF
FT                   MGFVIILISFFIQTGHISGGAVLTAIPIAILVGAILLANNIRDLDGDREKGRKTLAILI
FT                   GRDWAIRLLAAMFAVAFLWTAALAAFQIVPFWALLALLSIPKAIAATRGFIGKIKPIEM
FT                   MPAMKATAQTNTQFGFLLAAGLLIAHWL"
FT   gene            576813..578198
FT                   /locus_tag="GYMC61_0567"
FT   CDS_pept        576813..578198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0567"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: gka:GK2876 menaquinone-specific
FT                   isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77246"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ACX77246.1"
FT                   /translation="MRNVAIGFRHHLQQQLHRLAVNAGRPFVSWTEPWEGVDPVSFFMQ
FT                   GPSCGFRERFFWADRTGGTILVGLGSVYAIETEKADSRFDDVEAGRRRWEKEMEPYGAA
FT                   DAPPLLFGGFSFDPYRPGTDMWRGFPAGKLVAPAALLAVRNGKTTLTVTVPTDKRGRDW
FT                   ERVGRLLERISDPMAAPKRLPRLVSDEEEEKERWLAAVREAIASIRAGALDKVVLARAR
FT                   RLAFAKTVDAAAVLQRLREQQPFAYIFAFEQDGRCFIGASPEQLVQKEGKMCRSVCLAG
FT                   SVRRGAAMEEDERLGAWLRADRKNNEEHQFVVQMIGRLFSSVCETVEMPPAPQLLKLPH
FT                   IQHLCTPVVGRGCRERSVLRLVEMMHPTPALGGTPRDRALEVIRALEPLDRGWYAAPIG
FT                   WVDGEGNGEWAVAIRSALLAGKEAMLFAGCGIVADSDPNSEYEETNVKMAPMLSALGVM
FT                   NDG"
FT   gene            578191..579924
FT                   /locus_tag="GYMC61_0568"
FT   CDS_pept        578191..579924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0568"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /note="TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   gka:GK2875
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77247"
FT                   /inference="protein motif:TFAM:TIGR00173"
FT                   /protein_id="ACX77247.1"
FT                   /translation="MADALSVYVAALVDGLAQAGVTEAVISPGSRSTPLAMAMAAHPGL
FT                   RLYMNIDERSAAFFALGLAKAKQRPVALVCTSGTAAANYGPAVVEAYYSRVPLVVLTAD
FT                   RPHELRDVGAPQAIDQLHLYGRYAKWFVDLALPEEADDMLRYARTMAARAVQTAAGAPC
FT                   GPVHVNAPFREPLVPHIDEAVWERVRSVSRAPQVWRGRPALPQESVSALYEQLSAAERG
FT                   LIVCGPLDRPGFAEAVTELARALDFPILADPLSQLRAGTHDKTYVLDSYDAILREETAA
FT                   SKLVPDVVLRFGAMPVSKPLFLWLKRHRAIRQIVVDDGGWRDPTLSADSFVQSDELILC
FT                   RQLLEWAKPKENKSAWSAIWREMNAIARAALERHLPKEEWFEGKVFTELADLLPAGAAL
FT                   FVGNSMPIRDADTFLFATDKPLRVLANRGANGIDGVVSSALGASVAANPLVLVIGDLSF
FT                   YHDLNGLLAAKMHSLSAAIVLLNNNGGGIFSFLPQARHKGAFETLFGTPTDLSFAHAVE
FT                   MYGGRHTVPHNWAEFRRHVSESLSSGGLHVIEVRTSRAENVRMHRLLWNEVAREIAKCL
FT                   E"
FT   gene            579936..580748
FT                   /locus_tag="GYMC61_0569"
FT   CDS_pept        579936..580748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0569"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: gka:GK2874
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77248"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACX77248.1"
FT                   /translation="MTMMVNGVCYHAEQYGEGEPLLLLHGFTGSADTWRPLAPFWPDFR
FT                   VMAVDLLGHGRTEAPKDARRYRIEHAAADLTALLDEWGVEQVNVLGYSMGGRLALAFAV
FT                   WHPHRVRRLVLESSSPGLKMEEERRARREADEALARKIETEGVRAFVDDWEKIPLFATQ
FT                   QALPDSVRAAIRRERLRHTATGLANSLRGMGTGVQPSFWERLGELAMPVLLVCGEHDEK
FT                   FCRIAAQMHERLPNSELICVKEAGHAIHVEQPGIFAKIVSEFMTKGEV"
FT   gene            580749..581567
FT                   /locus_tag="GYMC61_0570"
FT   CDS_pept        580749..581567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0570"
FT                   /product="naphthoate synthase"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: gka:GK2873 naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77249"
FT                   /inference="protein motif:TFAM:TIGR01929"
FT                   /protein_id="ACX77249.1"
FT                   /translation="MPFEWVKQYDYEDIIYETYNGIAKITINRPEVHNAFRPKTVNEMI
FT                   DAFTKARDDSNIGVIILTGAGGKAFCSGGDQKVRGHGGYVGEDEIPRLNVLDLQRLIRV
FT                   IPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGAGYLARIVG
FT                   HKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKAA
FT                   FNADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDFSQFPRFP"
FT   gene            581684..583156
FT                   /locus_tag="GYMC61_0571"
FT   CDS_pept        581684..583156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0571"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: gka:GK2872
FT                   O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77250"
FT                   /inference="protein motif:TFAM:TIGR01923"
FT                   /protein_id="ACX77250.1"
FT                   /translation="MTTMPNWLKQRAFLTPERIAVSDGRRTKTFAELYEAAAVWARRLA
FT                   QAGVKEGDVVALLMKNRIEMIEIIHALFFLGARVLLQNVRLTPYELGWQLDDSGARLVI
FT                   ADEELAGRLDGDGRVLTVGAVAALPEVDVSLKETCDLEAVATIMYTSGTTGTPKGVLQT
FT                   YGNHWWSAVGSALNLGLHERDCWLAAVPLFHISGLSIAMRSVIYGMPMRLQTSFDPKEA
FT                   NEWIMRGDVTIMSVVAAMLQRMVAELGEARYPDTFRCMLLGGGPAPRPLLEACKEKGIP
FT                   VYQTYGMTETASQIATLAPEYSLTKLGSAGKPLFPAELCILKDEKPAAPHEAGEIVVKG
FT                   PNVTKGYLHRPEATAQAIRGGWFFTGDIGYVDEDGFLYVLDRRSDLIISGGENVYPAEV
FT                   EAVLLSHPDVEEAGVTGVEDETWGQVPYAFVRLKRGASPDEAALRAFCRERLAKYKVPA
FT                   RIYFVDELPRNAAQKLLRRELKRLIPKTEQTF"
FT   gene            complement(583463..583660)
FT                   /locus_tag="GYMC61_0572"
FT   CDS_pept        complement(583463..583660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77251"
FT                   /inference="similar to AA sequence:KEGG:GK2871"
FT                   /protein_id="ACX77251.1"
FT                   /translation="MDKRASLIQALQTEMKRAALGTYPACIDSFARLWDYEFGSFDQLP
FT                   PEIERLVAHRAAELGWMDDV"
FT   gene            complement(583726..583887)
FT                   /locus_tag="GYMC61_0573"
FT   CDS_pept        complement(583726..583887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0573"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="PFAM: protein of unknown function DUF1540; KEGG:
FT                   gka:GK2870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77252"
FT                   /inference="protein motif:PFAM:PF07561"
FT                   /protein_id="ACX77252.1"
FT                   /translation="MAKDVLCEVHNCRYWAEGNRCSAEAIYVVSHAGKMASDSTETDCK
FT                   TFVPAHEA"
FT   gene            584214..584504
FT                   /locus_tag="GYMC61_0574"
FT   CDS_pept        584214..584504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0574"
FT                   /product="Uncharacterized conserved protein UCP020408"
FT                   /note="PFAM: Uncharacterised conserved protein UCP020408;
FT                   KEGG: gka:GK2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77253"
FT                   /inference="protein motif:PFAM:PF10087"
FT                   /protein_id="ACX77253.1"
FT                   /translation="MASLLVVGADHLGHITDKLERSGFREIIHLNGRKVNMVKRDIPEH
FT                   VDAILVMIDYVNHNLAKKVKEKAKSKDKPIYFAKRSWSSINAVLEQLEKHA"
FT   gene            584523..585011
FT                   /locus_tag="GYMC61_0575"
FT   CDS_pept        584523..585011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77254"
FT                   /inference="similar to AA sequence:KEGG:GK2868"
FT                   /protein_id="ACX77254.1"
FT                   /translation="MVPIHHETLDVWPYALRRFLRRVIQAYCDTAPSLRSPLCLLRLID
FT                   QHRSLLPLSMFPTPLHYGLVLAKVTDHLLQFFGSMEEAACKPLLLADGGLGEEADRELY
FT                   IVYRDRVRVLLWCEEEEAIRRCKETASSLCRKTIGRCPNELECCFLWTGGRRIEWIPA"
FT   gene            585158..587236
FT                   /locus_tag="GYMC61_0576"
FT   CDS_pept        585158..587236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77255"
FT                   /inference="similar to AA sequence:KEGG:GK2867"
FT                   /protein_id="ACX77255.1"
FT                   /translation="MKRMPWKVMATSAAASLLLASGCSAVGEKENGRSSEAPRLHVPVA
FT                   DDHFDTAGNMFAYSEFELSGEPLAEGLGLDLDTLDARKPDKPTKFDYTAGIESYEYSEE
FT                   AMYEVTEKSGLGLHLINGPIAKQRAEQRHKPADETLADRFYELADSVGYPREEIFRNMF
FT                   PTFIEYAGGDPHYAQKVDTDVYAENDDGTYVPVYQVDFQSLRWDRGKMDKVLTPSAYGG
FT                   VFLKQALWAGDFLGNFHQKDSDEEVEAKTPNDDQSGKVALGVSSADGMQGMILTEQIWN
FT                   KLAFIRDHLFYDAKQQALTKAAGSRYNPSGGFVYLPHAVEVAEGGSELAPDAAKLVVKD
FT                   PRSLLEDQWLMLWPAAEFFGMTDQRPENKNQNPAFLAVFDGKPFPKAAKENVDADPAND
FT                   RVADDPYSVNRDVLLQVFRNIDAMHFNEKAGAFVTEHDGRTQGNRVDTFQAGYTMEALR
FT                   IFERAIDGMPVGYASGESAKGLGTPEGKRALELIRRQADFIMHNLMRKDGLVANGYTIG
FT                   QGPDQDEPTLLAQLGAIRGLTAAFLATKDEAYRDAARLVYEAMDRHFWDQKWHVYHTGE
FT                   KEDKYTPWLAGALSGVFRVALQNLNNDQADETAKSLDRETIISRFVDFYDRIVDGPTLQ
FT                   EGMQASEFWDTGDVYIKGKKLGNTDRDHVPQVQAAGGPYGVAPVLRTVKVNVGSGNK"
FT   gene            587333..589291
FT                   /locus_tag="GYMC61_0577"
FT   CDS_pept        587333..589291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0577"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: gka:GK2866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77256"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ACX77256.1"
FT                   /translation="MRKWWFAAAIAALLAGCQDEKAWHEQPKVVRHAPAHGDNIAVSSD
FT                   GRYVYTANIDVDTVTIINAKTKTKEAEIPVGREPRQLALSPDGRTLYVSCMYDDEVDVV
FT                   SLDKRKVVDRWKTGIEPFGIVTSPDGAEVYVANYRSGTVSVFDAESGKRTKDIQAGDRP
FT                   RALALTADGRKLYVTQYLAAKVTVIDTKKRRAVKEIALAPSPDKADRKKSQGIPNTLEQ
FT                   IVIAPDGKKAYILHLLTNIDTPIQFEETVFPAISVIDATKDVELPDERKELFAAINVTD
FT                   VHNETIIVSNPYDVAFSPDGGKAYAVMSGSEDLVVFDLRRGGKATQILRRIHGNNPRGV
FT                   AISPDGETLYVHNAMSHDLAVIKTGGKSPYAKAKQESGTIRLIAKDSLSPLVREGKTIF
FT                   YSANSDEFAINITGNNWMSCASCHSDGDINGLTLMTAKGPRNVPSNILATKTGLFMWDG
FT                   SRDDFTDYIHTVQGEMGGMTAIDPSKPLPPNVQHMFDAILAYLNDPRSFPVPKSPYRKA
FT                   DGSLTAEAKEGERLFNGKGNCLSCHGGEYFTDSVKAVGPDGKLTTANTAYLHDIGTANP
FT                   KDRASKGDARARFTNPRTPKQWDTPTLRGVWATAPYLHDGSAKTIEEAIRRHRTKEVQT
FT                   LTPGEIAAIAAYVRSLQ"
FT   gene            complement(589398..590429)
FT                   /locus_tag="GYMC61_0578"
FT   CDS_pept        complement(589398..590429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0578"
FT                   /product="cytochrome bd-type quinol oxidase, subunit 2"
FT                   /note="KEGG: afl:Aflv_0394 cytochrome bd-type quinol
FT                   oxidase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77257"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0394"
FT                   /protein_id="ACX77257.1"
FT                   /translation="MTNELIAITVLWGFIFIYAVMATMDFGAGFWSMVYIHREKANATK
FT                   IANRYLSPTWEVTNVFIVAIVVALFSFFPGAAFLLGTVLLVPGSIILILLAIRSAFLVF
FT                   AHVAKEYEKALTYISGITGIIIPALLISVLPITHGEFIDIRKGVPTLDLERFFTSPHAY
FT                   SFMGFAISSTLFLSSLLLADYSLEAGDREAYRLYRRDAWITGPLSLLMAGGMMLTMRYE
FT                   AKWLYDRMMEYWPWLIGSVAMFAAAGIALLLPSSRHPHVRGRPRLAVIAIVIQYFLASY
FT                   AYGKAHLPYMVHPDVTIESAFTHPDTFRALFASYIVGFLILFPGFVYFWRLFMHDKRYV
FT                   RPK"
FT   gene            complement(590445..591794)
FT                   /locus_tag="GYMC61_0579"
FT   CDS_pept        complement(590445..591794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0579"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: afl:Aflv_0395 cytochrome bd-type quinol oxidase,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77258"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACX77258.1"
FT                   /translation="MDDVIIARSLFGTTMAFHIIFATLGVGIPIMILLAELLYQKTKDY
FT                   DYAVMAKRWTKGLAVLLGVAIPSGTIAGVQLSLLWPGFMEVIGKVMSLPFQIEIYAFFI
FT                   EALFMSIYVYAADRISPLMRIVSVFFVALGASASAILITNVHAFEGTPAGFRIENGEIV
FT                   DVDPWAAFFNPSFFVTAGHVVLSAYMTGAFVLASIAAYQLLRVSQNEQVRRFHQKALKL
FT                   SLTVGGVFSLLTAINGHESAQLLHQYQPEKLAAAEGLFETQSHAPLAIGGFTDAKTQSV
FT                   KWAIEIPWALSFLAGNRFDTVVKGLNDFPKEWWPPLFVHTLFNAMVGIGVLLLFLSAAA
FT                   LVWQKWRKRPAFPRWLLYSFVAAGPLSMIGIECGWIFACTGRQPWVIYRMMKTEEAVTQ
FT                   TGNLAVLFALFVAIYILLSIAVALVLRYYFRRHPVADELRKPPNEGTLPV"
FT   gene            complement(592077..593063)
FT                   /locus_tag="GYMC61_0580"
FT   CDS_pept        complement(592077..593063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0580"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   gka:GK2865 Mn/Zn ABC transporter (Mn/Zn-binding
FT                   (LipO)protein) (surface adhesin A)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77259"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACX77259.1"
FT                   /translation="MRATSIILSFLLAASALLYGCQSKPETKEGQTSNDQLTIYTTVYP
FT                   LEDFTKKIGGDAVNVKSVYPPGVEAHTFEPTTKTVQQIADADAFIYIGHGMEPFAEKLQ
FT                   ETLQNEHVRFLVATNGIELLESNHEQEHAHGEGHKDEHGEGHEEEHGHEHGDKDPHVWL
FT                   DPIRSIAIAKNIRDLLIELKPEKKDLFMQNFETLKMKLERLDGQFRSTVEKAPRKEILV
FT                   SHQAYGYWEDRYGIKQLSVSGLSPSNEPSQKELTQLIQTAKQHHIRYVIFEQNVHPKTA
FT                   EVIQNEIGAKPLRLHNLESLTDEDRKAHKDYFALMAENLRVLQKALH"
FT   gene            complement(593143..594327)
FT                   /locus_tag="GYMC61_0581"
FT   CDS_pept        complement(593143..594327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0581"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: afl:Aflv_0397 GTPase
FT                   (G3E type), CobW/P47K subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77260"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACX77260.1"
FT                   /translation="MNKIPVTVLSGYLGSGKTTLLHHILHNREGKKIAVIVNDMSEINI
FT                   DAELVRQNGFFRTEEKLIQIQNGCICCTLREDLIKAVDQLVENGEIDYIVIESSGISEP
FT                   IPVAQTFTYLDEELGIDLSRKCRLDTMVTVVDANRFWTDFSSGETLLDRQQAVDETDSR
FT                   EIADLLIEQIEFANVIVVNKIDLVSPEEVQKLQKVLQKLNPEAVIIPATFGQVPLDSIL
FT                   NTHLFDFEKASQSAGWIKELNEEHTPETEQYGISSFVYRRKRPFHPERLMNWLENWPTE
FT                   VVRAKGFIWLASWNDWCILLSQAGTSISMQAAGRWMASYPEEDIKQLLQEEEAWQEKWD
FT                   DTYGDRLTELVLIGIHMNADRIERSLDQCLLTDEEMKEDWTLLPNPFPSLIPSA"
FT   gene            complement(594415..594657)
FT                   /locus_tag="GYMC61_0582"
FT   CDS_pept        complement(594415..594657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0582"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   gka:GK2864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77261"
FT                   /inference="protein motif:PFAM:PF01809"
FT                   /protein_id="ACX77261.1"
FT                   /translation="MGQWLIWCIRFYQRFLSPLKPPTCRFYPTCSNYGIEAIRRFGAIK
FT                   GGWLTAKRILKCHPFHPGGLDPVPEPTHHLKRKNN"
FT   gene            594871..595347
FT                   /locus_tag="GYMC61_0583"
FT   CDS_pept        594871..595347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0583"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="PFAM: LuxS protein; KEGG: gka:GK2863
FT                   S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77262"
FT                   /inference="protein motif:PRIAM:4.4.1.21"
FT                   /protein_id="ACX77262.1"
FT                   /translation="MPSPVESFELDHCAVKAPYVRHCGVHKVGSDGVVNKFDIRFCQPN
FT                   KEAMDPAAIHTLEHLLAYTLRRHAAKYNHFDIIDISPMGCQTGFYLVVSGSPTVDEVID
FT                   LLEEAMKDALAATEVPAATERQCGQAKLHDLEAAKQLMRFWLSQEKEELKKVFG"
FT   gene            complement(595370..595528)
FT                   /locus_tag="GYMC61_0584"
FT   CDS_pept        complement(595370..595528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77263"
FT                   /inference="similar to AA sequence:KEGG:GK2862"
FT                   /protein_id="ACX77263.1"
FT                   /translation="MYWTLAVCLIIAAAVLALAVITTSKAYAYKHTVDPLPNERGGEQQ
FT                   AGPKQPQ"
FT   gene            595794..596234
FT                   /locus_tag="GYMC61_0585"
FT   CDS_pept        595794..596234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0585"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: gka:GK2861
FT                   starvation-induced protein controlled by sigma-B (general
FT                   stress protein 20U)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77264"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACX77264.1"
FT                   /translation="MATRLIDLVNKQIANWTVLYVKLHNYHWYVTGPQFFTLHEKFEEL
FT                   YNEAATHIDALAERLLALGGKPVATMKDCLKQASVKEAAGTETAEQMVASIVGDFETMI
FT                   GELKEGMKLADEVNDETTGDMLLGIHRSLEKHVWMLKSFLGR"
FT   gene            596387..596782
FT                   /locus_tag="GYMC61_0586"
FT   CDS_pept        596387..596782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0586"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /note="TIGRFAM: toxin secretion/phage lysis holin; PFAM:
FT                   Holin toxin secretion/phage lysis; KEGG: gka:GK2860
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77265"
FT                   /inference="protein motif:TFAM:TIGR01593"
FT                   /protein_id="ACX77265.1"
FT                   /translation="MNKPIPMVAVSLFGSFLSLFVGSVDSFVVILLALVIVDYLTGIAA
FT                   SAVEGKLSSQVGFRGIIRKLLIFVLVAASHLVDLAIGWNMHVIRDAIIFFYIANEFISI
FT                   VENAGRAGVPIPSVLRKAIELLKDEIK"
FT   gene            596844..597176
FT                   /locus_tag="GYMC61_0587"
FT   CDS_pept        596844..597176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77266"
FT                   /inference="similar to AA sequence:KEGG:GK2859"
FT                   /protein_id="ACX77266.1"
FT                   /translation="MADEQKKTYYVSMAHGEISQLKTASPWDFQIEATDEEITQLREYF
FT                   DQNYSTDWQAFWRTHVPYIQYHYDRENDAYDRTIVDIYKMIYELGNDEAKAHIRSMGIL
FT                   PDEKEE"
FT   gene            597235..597702
FT                   /locus_tag="GYMC61_0588"
FT   CDS_pept        597235..597702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0588"
FT                   /product="nucleoside triphosphatase YtkD"
FT                   /note="TIGRFAM: nucleoside triphosphatase YtkD; PFAM: NUDIX
FT                   hydrolase; KEGG: gka:GK2858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77267"
FT                   /inference="protein motif:TFAM:TIGR02705"
FT                   /protein_id="ACX77267.1"
FT                   /translation="MHEFRDYYGHRVRLAFADHPFSPSPGHVWVICRYGGRWLLTDHPR
FT                   RGLEFPGGKVEEGETAAEAAAREVMEETGGIVGRLEYIGQYKVEPDIVKNIYFADIAAL
FT                   VERGSYLETNGPVLLEALPDDIRTDDRFSYIMKDDVLSLSLAELKQRGLID"
FT   gene            complement(597821..598630)
FT                   /locus_tag="GYMC61_0589"
FT   CDS_pept        complement(597821..598630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0589"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gka:GK2857
FT                   nitrate/sulfonate/taurine/bicarbonate ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77268"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX77268.1"
FT                   /translation="MNPPNKRIEALHTEYLAVLRKEHRIIRLWQTVLLVAFFAVWEAAS
FT                   RFHWVDPLLFSSPSAIAKLFVEKMSDHSLFAHTWATLFETLLGFFIGTAGGALIGALLW
FT                   WFPRLAKTLDPYLVVFNAMPKVALGPILIVALGPGLTSIVAMGVVISIIITTIVVYSAF
FT                   QEVDPNYLKVLRTFGATRYQCFQEAVLPASFPAIISTLKVNVGLAWVGVITGEFLVSKQ
FT                   GLGYLIIYGFQVFNFTLVLMSLLIVALLSTLMYQLVALIEKKWGNRR"
FT   gene            complement(598614..599405)
FT                   /locus_tag="GYMC61_0590"
FT   CDS_pept        complement(598614..599405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0590"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gka:GK2856 nitrate/sulfonate/taurine/bicarbonate ABC
FT                   transporter (ATP binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77269"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX77269.1"
FT                   /translation="MFLVIDRLSHTYLTKTTAVTALDDVSLSVEKGEFVSFLGPSGCGK
FT                   TTLLSIIAGLIEPTEGTIFIEGNPLRTAETDVPTTRRAVGYMLQQDYLFPWKTIEENIL
FT                   LGLKITDTLTADTKERALALLAEIGLAGVESYYPSQLSGGMRQRAALVRTLATDPKLLL
FT                   LDEPFSALDQQTKLKLEELVWKTLKQYEKTAVLVTHDIEEAIAMSDRIFLFSPRPGRLV
FT                   RTFVIPDELRCRPPLAARQHPSFPALFQSIWKEMEALESAQ"
FT   gene            complement(599424..600116)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0591"
FT                   /product="hypothetical protein"
FT   gene            complement(600128..601516)
FT                   /locus_tag="GYMC61_0592"
FT   CDS_pept        complement(600128..601516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0592"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   bcl:ABC2865 site-specific recombinase for integration and
FT                   excision"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77270"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACX77270.1"
FT                   /translation="MKVAIYVRVSTDEQAKEGFSIPAQRERLRAFCASQGWEIVQEYIE
FT                   EGWSAKDLDRPQMQRLLKDIKKGNIDIVLVYRLDRLTRSVLDLYLLLQTFEKYNVAFRS
FT                   ATEVYDTSTAMGRLFITLVAALAQWERENLAERVKFGIEQMIDEGKKPGGHSPYGYKFD
FT                   KDFNCTIIEEEADVVRMIYRMYCDGYGYRSIADRLNELMVKPRIAKEWNHNSVRDILTN
FT                   DIYIGTYRWGDKVVPNNHPPIISETLFKKAQKEKEKRGVDRKRVGKFLFTGLLQCGNCG
FT                   GHKMQGHFDKREQKTYYRCTKCHRITNEKNILEPLLDEIQLLITSKEYFMSKFSDRYDQ
FT                   QEVVDVSALTKELEKIKRQKEKWYDLYMDDRNPIPKEELFAKINELNKKEEEIYSKLSE
FT                   VEEDKEPVEEKYNRLSKMIDFKQQFEQANDFTKKELLFSIFEKIVIYREKGKLKKITLD
FT                   YTLK"
FT   gene            complement(601586..602263)
FT                   /locus_tag="GYMC61_0593"
FT   CDS_pept        complement(601586..602263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0593"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: Peptidase S24/S26A/S26B, conserved region;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; KEGG: bcg:BCG9842_B1503 LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77271"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACX77271.1"
FT                   /translation="MTKEEIVEHLMKKAGYSSRRQFAEAIGIPPTTLNSMLTRGLGKAS
FT                   IDNVLKVCKGLGITVEELEMMEANGWSEPRRDQNKPHSIKLELPLYGSIAAGALSTVDP
FT                   VTKDNVEYIALPKHMLGKYSDSKDLFALKVNGESMNKIIPNGSYVVCKPIEIGELKEDD
FT                   IVIFSHDNEYSMKRFRKDEDNRLLIFSPESTFKKYHDIVVPYDTVNDLKIYAKVIWYAV
FT                   LLD"
FT   gene            602466..602684
FT                   /locus_tag="GYMC61_0594"
FT   CDS_pept        602466..602684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0594"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /note="KEGG: bcg:BCG9842_B1504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77272"
FT                   /inference="similar to AA sequence:KEGG:BCG9842_B1504"
FT                   /protein_id="ACX77272.1"
FT                   /translation="MYKNLKAEMARRGVMVKDIAELLNVRRSTASDKINGKFRFYYDEA
FT                   LKIKKEFFPDLDLEYLFASDGSKGKTA"
FT   gene            602769..602948
FT                   /locus_tag="GYMC61_0595"
FT   CDS_pept        602769..602948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77273"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77273.1"
FT                   /translation="MRKQKRTRRPQEVVVRCVGRKEPSKEALDRFIEIYVRMVKENESK
FT                   QKEVNTNAKTTQRV"
FT   gene            602923..603102
FT                   /locus_tag="GYMC61_0596"
FT   CDS_pept        602923..603102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afl:Aflv_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77274"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0640"
FT                   /protein_id="ACX77274.1"
FT                   /translation="MPKLPSAYDFAKLEEAIAFYTRTVAEVAKSRDYSLHDELMRFKRE
FT                   LHERIDREYDPAAL"
FT   gene            603153..603932
FT                   /locus_tag="GYMC61_0597"
FT   CDS_pept        603153..603932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0597"
FT                   /product="phage regulatory protein, Rha family"
FT                   /note="TIGRFAM: phage regulatory protein, Rha family; PFAM:
FT                   Phage regulatory protein, Rha-like; KEGG: pjd:Pjdr2_1581
FT                   phage regulatory protein, Rha family"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77275"
FT                   /inference="protein motif:TFAM:TIGR02681"
FT                   /protein_id="ACX77275.1"
FT                   /translation="MSDLVFIQNDEVLTDSLTVAEMFGKEHKNVKRDIENTINNIDVLK
FT                   TSEEARELGIDFSSLKFERCEYKAANGQIYTKFLLNFDAFMLVTMGYTTQRAMLVKVRY
FT                   INEFNRMKEALQKQQQVLQPKTQAEMLLLYAQQMVEQERKIKALEEDNARQNSRIEQLE
FT                   NKIEKRMTEEFEMQLVTPTQIGKMFEPALSGKEVNKLLQKAGLQWRVGGEWVATVEGKK
FT                   YSSSEPIQLESGKMVYQLKWQRRVKDIIQAEMEVTVK"
FT   gene            603929..604177
FT                   /locus_tag="GYMC61_0598"
FT   CDS_pept        603929..604177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0598"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: drm:Dred_0113
FT                   AbrB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77276"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ACX77276.1"
FT                   /translation="MKPLGIVRRIDHLGRITIPMEIRRVHGWNTGTPIEMFATDKGLLL
FT                   REYGAEQKKLAVIEGLKSLADMVDDDTALAIIGDIME"
FT   gene            604198..604461
FT                   /locus_tag="GYMC61_0599"
FT   CDS_pept        604198..604461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afl:Aflv_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77277"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0644"
FT                   /protein_id="ACX77277.1"
FT                   /translation="MNVLPKDEDLALKLKNCCQLSLHRALSAAMMDRIDEAERWVKEFE
FT                   RCKRDLDELIKRKKEHDQLVQLVETMKERGVDIAIIIGKGNE"
FT   gene            604461..604676
FT                   /locus_tag="GYMC61_0600"
FT   CDS_pept        604461..604676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_4410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77278"
FT                   /inference="similar to AA sequence:KEGG:BCAH820_4410"
FT                   /protein_id="ACX77278.1"
FT                   /translation="MYTPNYFNPSWDEYMNLLRWEARLAQEIELHSQRRNWNEVAVLKR
FT                   EKQKVAIRRKCLKAALQHRKTSPITI"
FT   gene            604733..604933
FT                   /locus_tag="GYMC61_0601"
FT   CDS_pept        604733..604933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77279"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2856"
FT                   /protein_id="ACX77279.1"
FT                   /translation="MIENPIISDRHPIRQEEPRVVGYCEGCGGEIVEVDDVIEFVDGLM
FT                   IHQDAWCAYDYCGKFGQAKQA"
FT   gene            605043..605978
FT                   /locus_tag="GYMC61_0602"
FT   CDS_pept        605043..605978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0602"
FT                   /product="phage-type endonuclease"
FT                   /note="TIGRFAM: phage-type endonuclease; PFAM: YqaJ viral
FT                   recombinase family; KEGG: bcy:Bcer98_2619 YqaJ"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77280"
FT                   /inference="protein motif:TFAM:TIGR03033"
FT                   /protein_id="ACX77280.1"
FT                   /translation="MEAVILANTNEMSHEEWLQARRKGIGGSDASAIAGLNKWKSPVAV
FT                   YLEKIGQAPGENVNSEAAYWGTMLEDVVAQEFSKRTGLKVRRKNAILQHPEHPFMIANV
FT                   DRLIVGRKEGLECKTASEHLKDEWKNDEVPAQYLIQCQHYMAITGFDSWWIAVLIGGNK
FT                   FIYKKIERDEEIIQYLIEIELNFWNNHVLKKNPPMFDGSDASSDLLKVLYPTAKFEEEI
FT                   ELPPGASELIAKYEQAKQEEEEAATRRKEAENQLKAMLGEYEKAFAGERIITWKNVRSS
FT                   RVDTKLLKAKYPEIYQEVVKETVSRRFSIK"
FT   gene            605988..606164
FT                   /locus_tag="GYMC61_0603"
FT   CDS_pept        605988..606164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77281"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77281.1"
FT                   /translation="MAKCKGCGKEIEWIKTPAGKAMPVDIEIITVVTAKGEVVKGHIPH
FT                   WATCPAAQQFKKK"
FT   gene            606180..607025
FT                   /locus_tag="GYMC61_0604"
FT   CDS_pept        606180..607025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0604"
FT                   /product="RecT protein"
FT                   /note="TIGRFAM: RecT protein; PFAM: DNA single-strand
FT                   annealing protein RecT-like; KEGG: bcy:Bcer98_2617
FT                   recombination and repair protein RecT"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77282"
FT                   /inference="protein motif:TFAM:TIGR00616"
FT                   /protein_id="ACX77282.1"
FT                   /translation="MATNQTLKTQLANKAKNTEAAPPSPAQTIAAYLKKMGPEIEKALP
FT                   KHMDADRMARIALTTIRTNPKLLECSVPSLLGAVMQAAQLGLEPGLIGHCYLVPFKNGK
FT                   TGQSDVQFIIGYKGMIDLARRSGNIESIYAHAVYSNDTFEYEYGLHPKLVHKPAMTNRG
FT                   EFIGAYAVAHFKDGGYQFEFMPKEEIEKRRKRSKAANNGPWVTDYEEMAKKTVIRHMWK
FT                   YLPISIEIQQAVVQDETVKKDITADPEPVDYIEAEAYEVIDPQPQSEEPRQEEIVFDAE
FT                   "
FT   gene            607015..607182
FT                   /locus_tag="GYMC61_0605"
FT   CDS_pept        607015..607182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_5816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77283"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_5816"
FT                   /protein_id="ACX77283.1"
FT                   /translation="MLNEQPQYKILLPRWIWEEAQNKEHFKRLVLEYMRRYPEYTVKSV
FT                   KDGFAICVRK"
FT   gene            607201..608121
FT                   /locus_tag="GYMC61_0606"
FT   CDS_pept        607201..608121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0606"
FT                   /product="XkdB"
FT                   /note="KEGG: bld:BLi01321 XkdB"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77284"
FT                   /inference="similar to AA sequence:KEGG:BLi01321"
FT                   /protein_id="ACX77284.1"
FT                   /translation="MPDSFYFPVYTGLLTPEHRERIGPAIWEFLWLVSKVTKEVQEEGE
FT                   TLGIVLGGRPVKLAEIAAELGGSERTVKRNIARLKDEGYIETVRAPYGEIYKVRKSKKF
FT                   THKSRSDKNGTSFDEREDKNGLSHDERSAKNGTSEHREVPYLSERSATSGTSNKDIKDI
FT                   KNITDRKIDDDIREAHMADRSKRAIANKYIQRRGKGLSLSPKDEEAIEGLLREPIPLDD
FT                   ILSLIDEVFDEYQPKFNGDGINSFEYVRKVVLSKYHEQKGESTDGGTIHKHRRGVSRPS
FT                   AEGGKTYEQILREAEAARRAWGWKG"
FT   gene            608063..608890
FT                   /locus_tag="GYMC61_0607"
FT   CDS_pept        608063..608890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0607"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   bcy:Bcer98_2615 DNA replication protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77285"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACX77285.1"
FT                   /translation="MSKSSEKPKQPDELGDGRGDYECHKCKDAEFIFYRDERGYEFARP
FT                   CECRERKAWRRRFKQALIPDEFVHANFENFRRSAPYQQDMYDMSLNYLQEFGTENGTKK
FT                   LSDKNLGFIAVLGEQRLRELPAGQRAEMKQQHNNFGVGKTHLQIALAKRLIKDGFNVLV
FT                   VSDVTFMDELSQAKRMNDEGETLNRLLQSAIDADVLVWDDIGKAKWSETKESLYYQIIN
FT                   ERYRKQKPIVFNSNEDRGTLSEKIGYASASRLLGQCGPYLLEVEGDDFRLKGA"
FT   gene            608894..609115
FT                   /locus_tag="GYMC61_0608"
FT   CDS_pept        608894..609115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77286"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77286.1"
FT                   /translation="MCVKCDGTGRLYTRVMSGAWLVTSCNCEDAEKVRQEEEIKMREWR
FT                   KRLAEACERLGITQDIVWEAGDHVGHPL"
FT   gene            609099..609266
FT                   /locus_tag="GYMC61_0609"
FT   CDS_pept        609099..609266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77287"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2845"
FT                   /protein_id="ACX77287.1"
FT                   /translation="MGILYEKVQLTKELKRQMMIRQLLDRGIREYDGQSVYDLDYYTLR
FT                   HVLAMQKLKN"
FT   gene            609414..609518
FT                   /locus_tag="GYMC61_0610"
FT   CDS_pept        609414..609518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77288"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77288.1"
FT                   /translation="MNRYMWDVFLTATAIVCVLGIVVLLIVLAYLVFA"
FT   gene            609548..610102
FT                   /locus_tag="GYMC61_0611"
FT   CDS_pept        609548..610102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0611"
FT                   /product="dUTPase"
FT                   /note="PFAM: dUTPase; KEGG: gka:GK0515 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77289"
FT                   /inference="protein motif:PFAM:PF08761"
FT                   /protein_id="ACX77289.1"
FT                   /translation="MNLAKLFELQRKLDEHIEKEHPRKPGEDRLAKKILALMVELGELA
FT                   NEARFFKYWSNDQKPRTRIEVVTSQKMVDGVIEPIVEYKNPLLEEYVDCLHFLLSIGLD
FT                   ENIGTLEWEQIEPWKRESIIDQFIDLFDCTVRLQTDITEYVVIWDYFIGLGEMLGFTWE
FT                   QIEEAYMQKHEENIARQERGY"
FT   gene            610116..610418
FT                   /locus_tag="GYMC61_0612"
FT   CDS_pept        610116..610418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0612"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77290"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77290.1"
FT                   /translation="MMTEQKNFSEIANEIIERFSTNGHDFSEVVNKIIGGVEPIISKMY
FT                   EVMRPVILIREYEREIQKMEKLIEYTRHSKKRNKHIRHLKCMQAELSGLYKEVEE"
FT   gene            610415..610735
FT                   /locus_tag="GYMC61_0613"
FT   CDS_pept        610415..610735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bai:BAA_3833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77291"
FT                   /inference="similar to AA sequence:KEGG:BAA_3833"
FT                   /protein_id="ACX77291.1"
FT                   /translation="MSGRKSKRKGYVGEREIVSLIPGAKRVPLSGSMGGEYGNDVILPN
FT                   GWRAEVKRRKSGMKQAYDWLEQSNPDVVLYRADRKPWIVLMTMDKLLELMGVGEDEPAH
FT                   DI"
FT   gene            610792..611322
FT                   /locus_tag="GYMC61_0614"
FT   CDS_pept        610792..611322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0614"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: structural maintenance of chromosomes protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77292"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77292.1"
FT                   /translation="MVGEDRYDEPFYECVVLSFGGASFRNRPHGIDTTVRTYQLTPEQL
FT                   ERLRAGENLDDILKEAKEVEQQKPKVIAYAKYEEVVAERDELKKQLEELKANMEKEVGH
FT                   WKELFETTMADKEQLHKENLILENEIQRLKELVSELTERNDRYSDEWIGLHKELRALRL
FT                   YALEKLQKDVYGA"
FT   gene            611338..611475
FT                   /locus_tag="GYMC61_0615"
FT   CDS_pept        611338..611475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77293"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77293.1"
FT                   /translation="MKKQKRKRKGYLLFRVEDGQKVWLYEELRKYELDARLKNGWKLVM
FT                   "
FT   gene            611475..611717
FT                   /locus_tag="GYMC61_0616"
FT   CDS_pept        611475..611717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afl:Aflv_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77294"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0656"
FT                   /protein_id="ACX77294.1"
FT                   /translation="MGKSLRKIKREREKFSSPFYPDVMTAWNRGFEAGAKQQNELDTKL
FT                   MLEWLGRIEEIPGIGPKTAARIRMHWLEFMRKVRT"
FT   gene            611763..612263
FT                   /locus_tag="GYMC61_0617"
FT   CDS_pept        611763..612263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0617"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /note="TIGRFAM: phage transcriptional regulator, ArpU
FT                   family; KEGG: gtn:GTNG_2838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77295"
FT                   /inference="protein motif:TFAM:TIGR01637"
FT                   /protein_id="ACX77295.1"
FT                   /translation="MTVNTIGILDNIITGVVRLVKYKQMSFLRDVDGEKTKEAVEAALE
FT                   KYRIYMLTVPDEYLPRVTQTYSLVPPSQTNAFHSSTESAVIRKVDFERERDEYMNRIVR
FT                   AVNRLTKLQRELIVRRYMSIEEPRDYDVYNEMCISESKYYRERERAFYKLAFALRIEVY
FT                   KDY"
FT   gene            612279..612497
FT                   /locus_tag="GYMC61_0618"
FT   CDS_pept        612279..612497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77296"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77296.1"
FT                   /translation="MKVVWSKSNEMWTGQIVLCRNGKYVVRYEGVATCPPWDRAGIDGP
FT                   YWRVVATCDTIEEAKKVAAERGWMTEN"
FT   gene            complement(612763..612873)
FT                   /locus_tag="GYMC61_0619"
FT   CDS_pept        complement(612763..612873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77297"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77297.1"
FT                   /translation="MMQDEIIWILTVINLCLNILNNLILLLKKEKIISEL"
FT   gene            613008..613226
FT                   /locus_tag="GYMC61_0620"
FT   CDS_pept        613008..613226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77298"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77298.1"
FT                   /translation="MVKYKVTYHFNKDLTATRIIEAESKEDAMIAAKAEKVVRFEERGV
FT                   LYEFNIEDVKMITVSEFAKVKAVKSIY"
FT   gene            613274..613681
FT                   /locus_tag="GYMC61_0621"
FT   CDS_pept        613274..613681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0621"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   bcy:Bcer98_2598 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77299"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ACX77299.1"
FT                   /translation="MPSRPLKPCNKIGCTNLTRDRYCEQHKHKEQQYKAERHRYYDEHI
FT                   RDQKAREFYHSREWQRVRQAALMRDNYLCQSCLKEKRITPADVVDHIVPVRVDWSLRLS
FT                   LGNLQSLCNACHNKKTAEDKKKYGEGRVKKF"
FT   gene            613771..614268
FT                   /locus_tag="GYMC61_0622"
FT   CDS_pept        613771..614268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0622"
FT                   /product="phage terminase, small subunit, , P27 family"
FT                   /note="TIGRFAM: phage terminase, small subunit, , P27
FT                   family; PFAM: terminase small subunit putative P27; KEGG:
FT                   bcb:BCB4264_A2620 phage terminase, small subunit, putative,
FT                   P27 family"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77300"
FT                   /inference="protein motif:TFAM:TIGR01558"
FT                   /protein_id="ACX77300.1"
FT                   /translation="MGRKAMPIQLHLLQGNKNRLTKKEIEQRVEAEKRLKPKANKVKPP
FT                   AWLSDEAKKEFKRIVKEMQDLDLLTNIDVDALALYCDAYVNYIECTRIIAEEGLMVEYT
FT                   NKAAETNKVPHPLLTKKKQLHEQMKSLAAEFGLTPASRAKLAMPKKEEREPTPEEKLFG
FT                   DI"
FT   gene            614268..615968
FT                   /locus_tag="GYMC61_0623"
FT   CDS_pept        614268..615968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0623"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: bcb:BCB4264_A2621 putative
FT                   phage terminase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77301"
FT                   /inference="protein motif:PFAM:PF03354"
FT                   /protein_id="ACX77301.1"
FT                   /translation="MLKQWMIDYCHDVLNGDIIACQKHKWACRRFLRDVEREGTDEFPY
FT                   VFDEEKALRFLNWMTLFKHTKGKLAGQRIEPAPIQIFVFSNIYGWVHKETGLRRFKKAY
FT                   WQVARKNAKSQSLACVGSYEAFAFGESMAEVYIGATKTEQSKIVWNEIKAQIQGCDFLR
FT                   GKYKIAYGKIEHLKSGSFIAALSKDAGKTGDGLNVQCGIIDEYHAHSTSEIYDVLVSGM
FT                   GARPQPLMMIITTAGFELKHPCYSVEYQYVSKILDPNNPIENDEYFVMINELDKDDDIK
FT                   DERNWEKANPILCSYEEGVNFLRGELKTALDVPEKMRNFLTKNMNRWVDMKDNGYMDMS
FT                   KWAECGQDFDLSIIEGLECTVGVDLSAKIDLTSVGFIFKKDGKYIVLSHSFMPEDTLER
FT                   KRKTDKVPYDLWVKQGWITTTPGAVVDYNFIKSYIKNFEQQYNVKVREICADPWNATQF
FT                   MQDMEAEGYTVVEIRQGFQTLGGATKDFREQVYQGNVIHNNNPVLTWAISNAVTKQDAN
FT                   ENIMLDKSRSTERIDPIAAVINAHVRAMLKTETIDINKITEEYLNMMGW"
FT   gene            615973..616167
FT                   /locus_tag="GYMC61_0624"
FT   CDS_pept        615973..616167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77302"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77302.1"
FT                   /translation="MAKALKSFVTKMLKSLLTEWLEDFLILIGVVIILYNTYHHFGETA
FT                   GNYLLGAIFLLFGFAFAKR"
FT   gene            616201..617442
FT                   /locus_tag="GYMC61_0625"
FT   CDS_pept        616201..617442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0625"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   portal protein; KEGG: ctc:CTC02131 portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77303"
FT                   /inference="protein motif:TFAM:TIGR01537"
FT                   /protein_id="ACX77303.1"
FT                   /translation="MGFVRSALKRRVKNESQTVDLNNPLLLQWLGIDPDTPKDQLAEAT
FT                   YFACLKILSESLGKLPLKMYQRTDRGIVKSDKEDVYYILKLRPNPYMTSSVFWSTVEMN
FT                   RNHYGNAYVWCRYDGPVLQDMWIMPSKHVVIVVDDQGILGKKNAIWYRYNDPYDGKLYV
FT                   FGNDEVLHFKTSATFDGITGMSVRDILKNTVDGALESQKFMNNLYKTGLTGKAVLEYTG
FT                   DLDPSARDRLVKGFEQFANGSKNAGKIIPVPLGMKLVPLDIKLTDSQFFELKKYTALQI
FT                   AAAFGIKPNQINDYEKSSYASAEAQNLAFYVDTLLYILKQYEEEITYKILSTQMINQGY
FT                   FFKFNVNVILRADIKTQIESLATAVQNAILKPNEARDYIDMPADDYGDVLMANGNYIPL
FT                   SMLGANYGVKGGEG"
FT   gene            617442..618176
FT                   /locus_tag="GYMC61_0626"
FT   CDS_pept        617442..618176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0626"
FT                   /product="peptidase S14 ClpP"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: cth:Cthe_1720
FT                   peptidase S14, ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77304"
FT                   /inference="protein motif:PFAM:PF00574"
FT                   /protein_id="ACX77304.1"
FT                   /translation="MPFWKFIVNQATETEPESVELRIEGDIVDDDEAWLYEWFGMPSTS
FT                   PNAFKEELSQFKGRDITVWIDSYGGSVFAAAGIYNALKEHDGKVTVKIDSKAMSAASVI
FT                   AMAGDEVLMSPMAVMMIHNPLTAAYGNMHDLRKVADILDTIKESIVNAYALKTGRSRSK
FT                   ISQMMDDETWMSANVAVKEGFADGILYQDQPLDVANMSQFAFNRLAVVNSANQSIRHAV
FT                   ELLNKQREQDEKERLLLELDLI"
FT   gene            618217..619323
FT                   /locus_tag="GYMC61_0627"
FT   CDS_pept        618217..619323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0627"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="TIGRFAM: phage major capsid protein, HK97 family;
FT                   PFAM: major capsid protein HK97; KEGG: ctc:CTC02129 phage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77305"
FT                   /inference="protein motif:TFAM:TIGR01554"
FT                   /protein_id="ACX77305.1"
FT                   /translation="MPKELRELLEQINNKKEEARKLLAENKIEEAKKLKEEIVALQEKF
FT                   DIAKDLYEQEKGKIQDKEPLKPTVQVKENEVEAFVNHIRTKFRNAMSEGSGTDGGYTVP
FT                   QDIQTKINELRQSKDALQNLITVEPVTTLSGSRVFKKRSQQTGFVEVPENGEIPEKATP
FT                   QFTVLTYNVKKYAGFFRVTNELLKDSTEAIVNTLIRWIGDESRVTRNKLILSILASKAK
FT                   TAIADVDDIKAALNVQLDPAFRYTSSIITNQDGFNWLDTQKDATGNYLLQPSVSSPTGK
FT                   QLFGVPVVMVSNKDLPSDTTSGTKAPIIIGDLKEGIVMFDRQEVEVMSSNVAMDAFQTD
FT                   VTLWRAIEREEVKMRDDEAFIFGQVTLS"
FT   gene            619366..619527
FT                   /locus_tag="GYMC61_0628"
FT   CDS_pept        619366..619527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77306"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77306.1"
FT                   /translation="MKVKALIDCIGIGYNLKKGDEANLPKKLAEKLIRFGYVEEVKAEE
FT                   AKEAKVEE"
FT   gene            619524..619802
FT                   /locus_tag="GYMC61_0629"
FT   CDS_pept        619524..619802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0629"
FT                   /product="uncharacterized phage protein (putative DNA
FT                   packaging)"
FT                   /note="TIGRFAM: uncharacterized phage protein (possible DNA
FT                   packaging); KEGG: dhd:Dhaf_1460 uncharacterized phage
FT                   protein (possible DNA packaging)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77307"
FT                   /inference="protein motif:TFAM:TIGR01560"
FT                   /protein_id="ACX77307.1"
FT                   /translation="MIVSLDEVKNWLRIDFSEDDALLTTLIKAAETYLKNATGVEYDEN
FT                   NHLAKLFCMTLISDWYENREMIGKASDQIRPIINSILMQLTYGGDTS"
FT   gene            619799..620128
FT                   /locus_tag="GYMC61_0630"
FT   CDS_pept        619799..620128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0630"
FT                   /product="phage head-tail adaptor"
FT                   /note="TIGRFAM: phage head-tail adaptor; PFAM: putative
FT                   head-tail adaptor protein; KEGG: dhd:Dhaf_1461 phage
FT                   head-tail adaptor"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77308"
FT                   /inference="protein motif:TFAM:TIGR01563"
FT                   /protein_id="ACX77308.1"
FT                   /translation="MNPGLFRHRITFQKCDENATNENGFPLEDSQRWQDVKTVWAMIKT
FT                   LQGREYYEAATTQNENTVRFVIRYTTGINPDMRIKYKDRTFEILSVINDDEQNITLTII
FT                   AKEVV"
FT   gene            620130..620489
FT                   /locus_tag="GYMC61_0631"
FT   CDS_pept        620130..620489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0631"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="TIGRFAM: phage protein, HK97 gp10 family; PFAM:
FT                   TP901-1 ORF40 family protein; KEGG: cbf:CLI_3264 HK97
FT                   family phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77309"
FT                   /inference="protein motif:TFAM:TIGR01725"
FT                   /protein_id="ACX77309.1"
FT                   /translation="MSLQLHGMQELLHRLEQLGTEADRVKQDALLAGAEIIQQAASERA
FT                   PRDTGKLAENIVISDVKEDGTVDIGPDRDRFYGLFLEFGTSKMAARPFLQPAFEESKEQ
FT                   VQQKMADVIRRELGL"
FT   gene            620486..620809
FT                   /locus_tag="GYMC61_0632"
FT   CDS_pept        620486..620809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77310"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1714"
FT                   /protein_id="ACX77310.1"
FT                   /translation="MSINKLIKDTLKPIGVPVDFQTYSGTATTYITFFEYNQFSALNAD
FT                   DEEQQTAHFIQVDVWSKGDYTAIVQQVKDLMTAAGFRRTFETELYEPDTKIFHKVLRFS
FT                   YAS"
FT   gene            620830..621399
FT                   /locus_tag="GYMC61_0633"
FT   CDS_pept        620830..621399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0633"
FT                   /product="phage major tail protein, phi13 family"
FT                   /note="TIGRFAM: phage major tail protein, phi13 family;
FT                   KEGG: bld:BLi01556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77311"
FT                   /inference="protein motif:TFAM:TIGR01603"
FT                   /protein_id="ACX77311.1"
FT                   /translation="MATIGLKNLHVAKLTKDDKTGVTYDAPQRLALAIEAKITPQVTSE
FT                   TLYADDKAAEVAESLGEIEVELGIDDLSSEMYALLLGKTANSDGVIEDKSTDTAPYVAL
FT                   GFSMPLSKGGEKLVWLYKGKFQLPEDQAKTKGDKVEFQTPTIKAKFVPREYDDKWRASV
FT                   VTTDTDVDQTVIQNWFNAVYQAPTTP"
FT   gene            621455..621745
FT                   /locus_tag="GYMC61_0634"
FT   CDS_pept        621455..621745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bld:BLi01558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77312"
FT                   /inference="similar to AA sequence:KEGG:BLi01558"
FT                   /protein_id="ACX77312.1"
FT                   /translation="MKITLFINGEEKTFTVPFVKARMFRRALEITKKYDLNDVDVETLD
FT                   VLVSYVVELFNNQFTIDDIYDGVPADKLIPTILDCINKVVGTVGKDKDPNA"
FT   gene            621817..621924
FT                   /locus_tag="GYMC61_0635"
FT   CDS_pept        621817..621924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77313"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77313.1"
FT                   /translation="MYLVDEMDIGFYFELLNYEEEKKERAERAVIERLL"
FT   gene            621942..627978
FT                   /pseudo
FT                   /locus_tag="GYMC61_0636"
FT                   /product="hypothetical protein"
FT   gene            623073..624035
FT                   /locus_tag="GYMC61_0637"
FT   CDS_pept        623073..624035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0637"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77314"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3094"
FT                   /protein_id="ACX77314.1"
FT                   /translation="MRKLSHEEFCQRVKEVHGDEYDVLGRYVNRRTKITVRHNKCGTIW
FT                   DVSPWPFTKGHGCPKCFGVNKKTTEMYKEEVKSLVGDEYSVLGEYKNTHAKIRFIHNEC
FT                   GHVFDMVAKAFLLGQRCPKCRLKKMSQRFRKTTEQFKKEVYEKVGDEYIVLSDYKGKDV
FT                   NVKMLHRKCGNTFEVTPNHFLSSMNSRCPHCKTSKGEEVIRKFLLENGYTFKSQYRIKE
FT                   CRNIRPLPFDFAIFNGDTLVCLIEFDGEQHFHPKFGRKEFERTIANDKIKNEFCAKNNI
FT                   PLIRIPYISADIKADLAKALQSMKIPSQACPETAGRCND"
FT   gene            627980..628843
FT                   /locus_tag="GYMC61_0638"
FT   CDS_pept        627980..628843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0638"
FT                   /product="phage-related putative tail protein"
FT                   /note="KEGG: afl:Aflv_0674 phage-related putative tail
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77315"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0674"
FT                   /protein_id="ACX77315.1"
FT                   /translation="MQRIIFTNARGQSVELKSSAPFLLQSIDGLGDVDADIQTQKAPFQ
FT                   DGSTYIDSVLQERAISLEIAILASDTATLLQQRQFLASVFNPKLGKGVLRYENGETIRE
FT                   IEAIPDGVPSFPAGKENRGPRFQKALVNLLCPEPFWLDSFYTSRQMSFLMGGLSFPLFL
FT                   GSRFSQRSFRRILQNKGDVPTPVTITFYGPAINPIVKNNTTGEFIRVNRELGESDKLII
FT                   DTTFGKKSVVIEDKNGVQTNVFNWIDLESSFFQLQVGDNELEYNSNNDSTKSRVVIAFR
FT                   NRYVGV"
FT   gene            628846..629748
FT                   /locus_tag="GYMC61_0639"
FT   CDS_pept        628846..629748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0639"
FT                   /product="phage-related putative tail protein"
FT                   /note="KEGG: afl:Aflv_0675 phage-related putative tail
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77316"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0675"
FT                   /protein_id="ACX77316.1"
FT                   /translation="MPEYSRFFDSTPEDERYYSADEFAEYFRRLLTNGIFNGGTNLQVG
FT                   CDGTNIMTYINEGFAWIEGYMYKIEGGPFYLTHDLPDTQYDRIDRIVLRLDKSLEVRAI
FT                   NAKVLKGTPSATPTPPALTRNDNVYEISLAQVRIEAGKSYIEAYQITDERLDNNVCGLV
FT                   NSLIQADTTEIFNQFQAHYNAKSAEFEENWQTWLDTKLPQFQQQWNDWFNTNTTNYDTS
FT                   WNTWFTQIQNAWNTFFSNAQGESYLTGADVGVTVASQEDFASHLADTTKHVTQAEKDAW
FT                   NAAQAKANDLEILYWMGAM"
FT   gene            629749..630078
FT                   /locus_tag="GYMC61_0640"
FT   CDS_pept        629749..630078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdj:Gdia_2569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77317"
FT                   /inference="similar to AA sequence:KEGG:Gdia_2569"
FT                   /protein_id="ACX77317.1"
FT                   /translation="MATTPKRLYIGQPGTTIGALYQVPATYKTIVKNIILCNTTGTDAK
FT                   IDIYFVPSGNGASAANKVISQYTVSANDTAVINLSAVLGSGDVISAAQVTANAITVYIS
FT                   GVEVS"
FT   gene            630081..630554
FT                   /locus_tag="GYMC61_0641"
FT   CDS_pept        630081..630554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0641"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cby:CLM_2504 tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77318"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77318.1"
FT                   /translation="MGMKKLEEYRVDFIDVIKRIMATNLTNKGVSASRTESLQALADKI
FT                   ANVNTGKRYATGTGWSGSTGIATITGLGFTPSIVKVKFATGGIGFLRFLIKESAGHYGG
FT                   YGKYLIGASSKIDNSNHYPDYALINDGSNQILSDGFKIMIGYVDISYGWEAWE"
FT   gene            630554..630817
FT                   /locus_tag="GYMC61_0642"
FT   CDS_pept        630554..630817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_2395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77319"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77319.1"
FT                   /translation="MQIGTRIIYNPYTGYVLNNSLYQMEGALRDDLRPDKIEFIDLPYG
FT                   YNENHFDTAIEYHVDVETKTIVVDAYIDPETGEIVYNNTAKP"
FT   gene            630889..632034
FT                   /locus_tag="GYMC61_0643"
FT   CDS_pept        630889..632034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0643"
FT                   /product="phage related protein"
FT                   /note="KEGG: afl:Aflv_0677 phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77320"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0677"
FT                   /protein_id="ACX77320.1"
FT                   /translation="MKPVRILTPILDLLAEIDNYESLLFTRRWHEVGEFELRINRHKRH
FT                   TELLQRGNLIMLGASRNKVGIIRHREIELDENGKASENWLIKGIALKGVMAQRITVPPA
FT                   GDSHDRASGAAEAVMKHYVNNHIVNPVDTKRKIDMIVIASDQQRGSSISWESRFKNLAD
FT                   ELIEISKTSGLGWDVFLDIQQKKWIFDVFEGRNLTVNQTENPPVIFSPQFESLKQLSFV
FT                   ESDYNYKNYGYIAGQGEGEDRRVVEVGEAEGLSRIETFIDARDVAEQDENQQALPEAEI
FT                   IAKLQQRGQQKLSEYAEEFFLEGQILTNSPFKYEIDYDLGDIVTIQNREWGVTRDARIT
FT                   EIKEIYEPGGFQIEATFGESRPTLVKKLKQELAQISGEVRK"
FT   gene            632070..632483
FT                   /locus_tag="GYMC61_0644"
FT   CDS_pept        632070..632483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0644"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /note="TIGRFAM: toxin secretion/phage lysis holin; PFAM:
FT                   Holin toxin secretion/phage lysis; KEGG: bwe:BcerKBAB4_5852
FT                   prophage LambdaBa02, holin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77321"
FT                   /inference="protein motif:TFAM:TIGR01593"
FT                   /protein_id="ACX77321.1"
FT                   /translation="MERLDVVFKTGAAALGAVVGYLFGGWSELLGILLAFVIMDYVTGV
FT                   LAASKEGTLRSAVGFKRIPKKIMIFVLVAVGHLIDRAVGTNGLFRDATIFFYLANELLS
FT                   IVENAGRIGLPVPEQIKQAVEVLKGRSEKGEGK"
FT   gene            632480..633163
FT                   /locus_tag="GYMC61_0645"
FT   CDS_pept        632480..633163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0645"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; Sporulation
FT                   domain protein; SMART: cell wall hydrolase/autolysin; KEGG:
FT                   bha:BH1294 N-acetylmuramoyl-L-alanine amidase (sporulation
FT                   mother cell wall hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77322"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ACX77322.1"
FT                   /translation="MMVRIVLDAGHGGHDPGAVANGLREKDLTLAIVKHIGKMLGEYEG
FT                   AEVHYTRTDDRFLELSERAAIANKLKADLLISVHINAGGGTGFESYIYNGNVSPATIAY
FT                   QNVIHQELMKAIGNVTDRGKKRANYAVLRETNMPAILTENLFIDNANDAAKLKSEQFLQ
FT                   QVAYGHVQGIVKAFGLKKKAKPQTKQKVSDGKLYRVQVGAFADPENAKRLADELKKKGY
FT                   PATIV"
FT   gene            complement(633229..633714)
FT                   /locus_tag="GYMC61_0646"
FT   CDS_pept        complement(633229..633714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sha:SH1929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77323"
FT                   /inference="similar to AA sequence:KEGG:SH1929"
FT                   /protein_id="ACX77323.1"
FT                   /translation="MAKLEKLVNLAKEHLEPGEQVVASVLGAYETKIMGKDTVMNGVFL
FT                   ATDRRLVFYGKRTFGGYDLEFFPYENISSTEIGKGLMGHKVSFFASGNKVKMKWIQQGD
FT                   FDKFINHVKQSIGKKPSSNNAAIASVADELKKFAELKEMGVITEEEFEAKKKQLLGI"
FT   gene            complement(633707..633913)
FT                   /locus_tag="GYMC61_0647"
FT   CDS_pept        complement(633707..633913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0647"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: afl:Aflv_0682
FT                   predicted transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77324"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX77324.1"
FT                   /translation="MRNRISYLIKARGLKQNHIAQKMGVTEQTFSNWCRNVTQPDLLES
FT                   YQLSKLLGVPMEELVEEEKEDNG"
FT   gene            634150..634533
FT                   /locus_tag="GYMC61_0648"
FT   CDS_pept        634150..634533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0648"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcr:BCAH187_A3980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77325"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77325.1"
FT                   /translation="MEGEGVFQSIFQAYAEHRKRHRKMNEFEYLDQTPYLHSSDYLKEL
FT                   YRGADTKEKKQKLFDYIERFEVGSREYKGYYSLYQRIGKELGHIEDDKEEYIQIPKSLI
FT                   AEYARQMMDDEDFVKYNMRGQRK"
FT   gene            634530..634700
FT                   /locus_tag="GYMC61_0649"
FT   CDS_pept        634530..634700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afl:Aflv_0684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77326"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0684"
FT                   /protein_id="ACX77326.1"
FT                   /translation="MIEVIGGGLVLIGIAYAENKGWVDKESVSFILNVGMQAGICGGLL
FT                   YFIHQLSIWFL"
FT   gene            634831..635991
FT                   /locus_tag="GYMC61_0650"
FT   CDS_pept        634831..635991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0650"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: afl:Aflv_0685
FT                   FtsK/SpoIIIE family protein (ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77327"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACX77327.1"
FT                   /translation="MLEFFLLPLAVGATAVVFGRRRQEDYERDIETAFRHLKVGTTVRD
FT                   EHVYPKLVAKEKKDLYTRYVYRVPLGLTKKMLEPVKEVLEATLDRYVEVTFKKWLYIDV
FT                   FHREMPEKVLYKDVPDQNGWVIPLGLNEKGWCFHDFDKTPHCTISGTTRFGKTVMLKNI
FT                   MTYLIEHHPDDASFVILDMKGGLEFGRYKNLKQVVDVASSPVEAFNVLGKVKVFMEQQE
FT                   AEFKKNGWSNVVNTPIQKRLFVIVDEGAQLAPDRFMTKEHKDMLAACQHTLGEIARIGG
FT                   ALGIRLIFCTQYPTSDTLPRQVKQNADLKITFRLPTGYASQVAIDDYGAEELPSDIKGR
FT                   AIIKTHEKMIVQTPLIDDEEMERRLEVYRVEKPAHRTANEDFIRFE"
FT   gene            635939..636535
FT                   /locus_tag="GYMC61_0651"
FT   CDS_pept        635939..636535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0651"
FT                   /product="phage protein"
FT                   /note="KEGG: lsp:Bsph_3730 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77328"
FT                   /inference="similar to AA sequence:KEGG:Bsph_3730"
FT                   /protein_id="ACX77328.1"
FT                   /translation="MKSRLTERQTRILYALNSLQALSRSQIQHMFDLGSKRNANRILQG
FT                   LREYTHTKRIGEDVYYLNKAGAEMVGGEVTVRRNSPLEHIVMRNDIYIFYHYPHDWKAE
FT                   AKTRWKEGGKEYSVVSDARFTYQGKMCFLEVDITQKMVENKRKIERYAYLFRFIQRQQL
FT                   GEPVLLFYTVSQMKKRQIEAITKEYGVHCECLLKA"
FT   gene            complement(636599..637384)
FT                   /locus_tag="GYMC61_0652"
FT   CDS_pept        complement(636599..637384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0652"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /note="KEGG: gka:GK2855
FT                   nitrate/sulfonate/taurine/bicarbonate ABC transporter
FT                   (substrate binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77329"
FT                   /inference="protein motif:COG:COG0715"
FT                   /protein_id="ACX77329.1"
FT                   /translation="MSDCLAVGACRPLAERQLEKALEREERPDRRPFSFDRPFFLGIHT
FT                   FLLRAYDKVKPRFTACEPRGLTNMKKWAVWLCSLLLLLPLSACTNDGGQSEKPLKKVRL
FT                   AEVTHSIFYAPQYVALAKGFFKEEGLDVELTTTWGGDKTMTTLLSGGADIALVGSETSI
FT                   YVYSQGTDDPVINFAHVNLTLTQVYNTLAPLANDTTLAAIEKQKGGSLRLLFFFRCFQT
FT                   ALPHISSSASSKNSNAANMPLTKACSCSSSVSIIAYCSR"
FT   gene            637472..638260
FT                   /locus_tag="GYMC61_0653"
FT   CDS_pept        637472..638260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0653"
FT                   /product="BAAT/Acyl-CoA thioester hydrolase"
FT                   /note="PFAM: BAAT/Acyl-CoA thioester hydrolase; KEGG:
FT                   gka:GK2854 dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77330"
FT                   /inference="protein motif:PFAM:PF08840"
FT                   /protein_id="ACX77330.1"
FT                   /translation="MDGDIIDQYRFPSPHPGIDVFFVTYMSQGLKVKGFLAVPKQNKVY
FT                   DGFLYLRGGIKNVGQVRVPRLVQFASQGFVVFAPLYRGNGGGEGNEDFAGDDRYDALAG
FT                   FHLLRRHPLVHPGRVHMFGFSRGGAMALHAALMAEGVCSVAVWGGVADLELTYWERPDL
FT                   RRMMKRVIGGTPNKCPERYRHRTPLYHLERLKAPVLIIHGGRDENVSIEHAWRLERRLK
FT                   QLGKPVTAWYFPEFTHYFPPQANRETVQRLTEWMKQQPTM"
FT   gene            638353..638595
FT                   /locus_tag="GYMC61_0654"
FT   CDS_pept        638353..638595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0654"
FT                   /product="Protein of unknown function DUF2584"
FT                   /note="PFAM: Protein of unknown function DUF2584; KEGG:
FT                   gka:GK2853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77331"
FT                   /inference="protein motif:PFAM:PF10763"
FT                   /protein_id="ACX77331.1"
FT                   /translation="MGMPMELQTVIVTKGKEQRVQGNVFVLKKEGYRLYPLDVPLEVRR
FT                   TVQSEASGVAVVRKLEWEGSRTTVTYELVSLYSTN"
FT   gene            638875..639777
FT                   /locus_tag="GYMC61_0655"
FT   CDS_pept        638875..639777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77332"
FT                   /inference="similar to AA sequence:KEGG:GK2852"
FT                   /protein_id="ACX77332.1"
FT                   /translation="MAKPRIDHDRLFKELLSTFFEEFLLLFFPNVYEHIDVHRLSFLSE
FT                   ELFTDVTAGEKHRVDLLVETKVKGEDGLVIVHVEHQSYTQRTFPERMFLYFSRLFQKYR
FT                   RRILPIAIFSYDEHHDEPSSLVVQFPFLTVLDFRFLTVELRKLPWRAYIRHDNPVAAAL
FT                   LSKMGYNEEEKVEVKKEFLRMLVRLELDEAKQRLLFGFFETYLRLSEEEEAKLRNEVSQ
FT                   METKEAKRVMELIVSYEQRGMEKGIQQGVKQGMKQGRQKGIEEGKLDVVKRMLAKGYDV
FT                   DTIHELTGLPVEKIERVKG"
FT   repeat_region   639979..641468
FT                   /rpt_unit_range=639980..640010
FT                   /note="CRISPRS"
FT   gene            complement(641533..642411)
FT                   /locus_tag="GYMC61_0656"
FT   CDS_pept        complement(641533..642411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0656"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gwc:GWCH70_3382 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77333"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77333.1"
FT                   /translation="MQEHFHFTTDPAKLQKQYAAIFCFVSAQLSLIQMYLHRRNRHLVK
FT                   QKDEVVMAVHLLGKLLGFSSERAWHRFVTGNLFTNGSFLERSRYNRRCRALGFAVKWIR
FT                   HELAKRGQHHAYAVVDSLPLPLCHPARMQRVKRFRGIADMGYCASKKQWYYGFKLHLQV
FT                   TNQGLAMGYVVTEASCHDVKAAETVMTQIPHPYNFGDKGYISRALREKLYEEHQAAFWT
FT                   PSRHNQKHGPSKAWEEWIRKKRKVIETVFSILVDQYRITDIRANSIAGFEVALDGILVA
FT                   YSLVTLGLVER"
FT   repeat_region   642520..643747
FT                   /rpt_unit_range=642521..642551
FT                   /note="CRISPRS"
FT   gene            complement(644140..645062)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0657"
FT                   /product="hypothetical protein"
FT   gene            complement(645439..647025)
FT                   /locus_tag="GYMC61_0658"
FT   CDS_pept        complement(645439..647025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0658"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="KEGG: gka:GK2850 phosphoenolpyruvate carboxykinase;
FT                   TIGRFAM: phosphoenolpyruvate carboxykinase (ATP); PFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77334"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ACX77334.1"
FT                   /translation="MGIANMTNKLDLLLQKPYVHHQLSVAELVEKVLQRNEGRLTHTGA
FT                   VAVTTGKYTGRSPKDKYIVEEPSTKQTIDWGAVNQPMSPETFDKLYDKVLDYLMKKDEL
FT                   FVFKGFAGADPKYRLPIQVVNEFAWHNLFVHQLFIRPSAEELAAHEPQFTVICAPNFKA
FT                   DPKVDGTRSEAFIIISFERRTVLIGGTEYAGEMKKSIFSVMNYLLPEQGILPMHCSANV
FT                   GQEGDVALFFGLSGTGKTTLSTDPNRRLIGDDEHGWSSRGIFNIEGGCYAKCINLSREK
FT                   EPQIFDAIGFGAVLENVVLDDATRVPNYDDGTLTENTRAAYPLQAIQNIIDPSVAGHPS
FT                   TIVFLTADAFGVLPPISKLTREQAMYHFLSGYTSKLAGTERGVTEPEATFSTCFGAPFL
FT                   PRPAIEYAEMLGQKIAEHNVRVFLVNTGWTGGPYGVGSRMKLAYTRAMVQAAVEGELDN
FT                   AETVQDPIFGLAIPTHVPGVPDEVLQPQNTWADKQAYEQKAKELAQKFRANFQKFAHID
FT                   PSIEKLGGPLV"
FT   gene            647488..648699
FT                   /locus_tag="GYMC61_0659"
FT   CDS_pept        647488..648699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0659"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: gka:GK2849 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77335"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACX77335.1"
FT                   /translation="MSAKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACE
FT                   TSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPD
FT                   IAMGVDRALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPLPISLAHRLARRLA
FT                   EVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVVSAQHHPEITQEQIQRDIKEQVI
FT                   EPVVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKD
FT                   PTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDIL
FT                   IEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAALLKEQALA
FT                   LADK"
FT   gene            complement(648722..649270)
FT                   /locus_tag="GYMC61_0660"
FT   CDS_pept        complement(648722..649270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0660"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: gka:GK2848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77336"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACX77336.1"
FT                   /translation="MIYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGD
FT                   VAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILD
FT                   RAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQ
FT                   YYKALQQQRTSCANKKELP"
FT   gene            649609..650718
FT                   /locus_tag="GYMC61_0661"
FT   CDS_pept        649609..650718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0661"
FT                   /product="Protein of unknown function DUF2600"
FT                   /note="PFAM: Protein of unknown function DUF2600; KEGG:
FT                   gka:GK2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77337"
FT                   /inference="protein motif:PFAM:PF10776"
FT                   /protein_id="ACX77337.1"
FT                   /translation="MVFAPEVSRLNIPKNPIALMKMVYRDVLPLVHRELAYWRRQAERI
FT                   PDPELRRQALASIASKTFHCEGGSILALLAGENMEDCIRFIVAYQTISDYLDNLCDRST
FT                   SLDPLDFRALHDSMPDALTIGAEPSNYYRHRREQEDGGYLPALVRTCQKVLETVRHYET
FT                   IAPFLHELAGYYCDLQVHKHVEASERVPRLEKWFAQYKDALPPMEWYEFSACSGSTLGI
FT                   FCLVAYAFGESLPPEMARQVRDGYFPYIQGLHILLDYLIDQEEDRDGGDLNFCFYYPNE
FT                   TVMLERLCHFIEEADRHVGALPHGEFHRLIHRGLLGLYLSDAKVKKQRGLRRLARRLVR
FT                   AGGAASQFFYWNGKAYRFWQERQKRLSFS"
FT   gene            complement(650776..651363)
FT                   /locus_tag="GYMC61_0662"
FT   CDS_pept        complement(650776..651363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0662"
FT                   /product="putative rRNA methylase"
FT                   /note="PFAM: putative rRNA methylase; Methyltransferase
FT                   type 12; KEGG: gka:GK2846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77338"
FT                   /inference="protein motif:PFAM:PF06962"
FT                   /protein_id="ACX77338.1"
FT                   /translation="MALMNILPFARFLLDQAVNEGDIAVDATVGNGHDTVYLAERVGET
FT                   GHVFGFDIQPEAITAASARLAEHGLCGRATLFERSHSELLEALPADVHGRIAGAVFNLG
FT                   YLPGGNKQIVTQPESTIEAVRQLLSVMKPGGVIVLVVYHGHPEGKRERDALLDYVRSLD
FT                   QRRVHALKYEFINRQNNPPFLIALENRADGGA"
FT   gene            651656..651919
FT                   /locus_tag="GYMC61_0663"
FT   CDS_pept        651656..651919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0663"
FT                   /product="Protein of unknown function DUF2524"
FT                   /note="PFAM: Protein of unknown function DUF2524; KEGG:
FT                   gka:GK2845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77339"
FT                   /inference="protein motif:PFAM:PF10732"
FT                   /protein_id="ACX77339.1"
FT                   /translation="MATRQSVEEFLQRCEDVIRYAKEQYTEAQKQEHYNITEYTNAQQM
FT                   LEQTVIDLAHLARSCNAQQREQLHRMRLQLEQLQNDMILLDR"
FT   gene            651938..652102
FT                   /locus_tag="GYMC61_0664"
FT   CDS_pept        651938..652102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77340"
FT                   /inference="similar to AA sequence:KEGG:GK2844"
FT                   /protein_id="ACX77340.1"
FT                   /translation="MKRRLKQTNPEQKTPSGQNNNDLELGQDFDPVKLAKKQYEETGGQ
FT                   PIRSKQRNG"
FT   gene            652313..653512
FT                   /locus_tag="GYMC61_0665"
FT   CDS_pept        652313..653512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0665"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gka:GK2843 multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77341"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX77341.1"
FT                   /translation="MPRALWWLLVGMALNVTGASFLWPLNTIYLHEQLGQPLAVAGVVL
FT                   MLNSGGSVIGSLAGGFLFDRIGGFRVLLAGAVLTMAALAGLSVWHGWPHYAVFLAFVGV
FT                   GSGVVFPAASAYAGTIWPEGGRRAFNALYVAQNIGVAVGSALGGLVASYSFSLVFFANL
FT                   LLYAAFLFTVVAGLRRVPLPPRRKKEREGRTGDEASRAHIRALVLLCAGYGLCWLSYVQ
FT                   WSTTIAAYTRELGIPVGQYSLLWTINGALIVLAQPLLSAVIRRFMPTLKRQIVIGFLIF
FT                   AVSFAMLLGAHSFAEFAASMIVLTIAEMIVWPAIPAAVNEWAPPGKAGFYQGIVNGTAT
FT                   AGRMIGPVIGGSVADLFGMKLLIMMLALFALLAVLAALLHDRRLSKRTENADEKTAASV
FT                   "
FT   gene            653900..656317
FT                   /locus_tag="GYMC61_0666"
FT   CDS_pept        653900..656317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0666"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: gka:GK2842
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77342"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ACX77342.1"
FT                   /translation="MSFNHREIEQKWQDYWEKNKTFRTPDDDDKPKFYVLDMFPYPSGA
FT                   GLHVGHPEGYTATDILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNI
FT                   DNFRRQIKSLGFSYDWDREINTTDPNYYKWTQWIFLKLYEKGLAYMDEVPVNWCPALGT
FT                   VLANEEVINGRSERGGHPVIRKPMRQWMLKITAYADRLLEDLEELDWPESIKEMQRNWI
FT                   GRSEGAEIEFAVDGHDETFTVFTTRPDTLFGATYTVLAPEHPLVEKITTPEQKPAVDAY
FT                   LKEIQSKSDLERTDLAKEKTGVFTGAYAIHPVTGDRLPIWIADYVLMSYGTGAIMAVPA
FT                   HDERDYEFAKKFHLPMKEVVAGGNIEKEAYTGDGEHINSEFLNGLNKQEAIDKMIAWLE
FT                   EHGKGRKKVSYRLRDWLFSRQRYWGEPIPIIHWEDGTMTPVPEEELPLVLPKTDEIRPS
FT                   GTGESPLANIEEWVNVVDPKTGKKGRRETNTMPQWAGSCWYYLRYIDPHNDKQLADPEK
FT                   LKKWLPVDVYIGGAEHAVLHLLYARFWHKFLYDLGIVPTKEPFQKLFNQGMILGENNEK
FT                   MSKSKGNVVNPDDIIESHGADTLRLYEMFMGPLEASIAWSTKGLDGARRFLDRVWRLFV
FT                   TENGELNPNIVDEPANDTLERVYHQTVKKVTEDYEALRFNTAISQLMVFINEAYKAEQM
FT                   KKEYMEGFVKLLSPVCPHIGEELWQKLGHTDTIAYEPWPTYDETKLVEDVVEIVVQING
FT                   KVRSRLHVPVDLPKEALEERALADEKIKEQLEGKTVRKVIAVPGKLVNIVAN"
FT   gene            656375..656689
FT                   /locus_tag="GYMC61_0667"
FT   CDS_pept        656375..656689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0667"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: gka:GK2841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77343"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACX77343.1"
FT                   /translation="MEEIKEITPAEVKEKLERGEKLNIVDVREDEEVALGMIPGAKHIK
FT                   MGDIPDRLEEFDRNEEYIFVCRSGRRSENVCRYLQELGYRVRNMTGGMLEWEGETVPKR
FT                   "
FT   gene            657035..658309
FT                   /locus_tag="GYMC61_0668"
FT   CDS_pept        657035..658309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0668"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; TPR
FT                   repeat-containing protein; SMART: helix-turn-helix domain
FT                   protein; Tetratricopeptide repeat; KEGG: gka:GK2839
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77344"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACX77344.1"
FT                   /translation="MKLGDRLKFARLMKGLTQEETAEGIISVSYLSKIENNQVIPSQEV
FT                   LEWLFRRLDIRPGGNETMPSWFEWVMSWYKAMTNRDVPAAREMYETVKERCEQSGDAEA
FT                   MIYFQLMRIRYLLLLGDKKGAETAAQSVRDWYGSLSDDMRYYYWKFFGLLYYCQEKYDD
FT                   ALHCYQKAEQLLKGEWKTSGEEADLAYLSALAFSRLWKWFQCLQYAERALALSQAEYDL
FT                   RRSAECHVLLAICHRRCGEIDKAVDHCLLAQKAARMVDDRRLLGIVEHNLGHLKGMKRQ
FT                   YREAVQHYENSLIYKADAPLDARLITLLSLVRVHCDAKHYRKASMAVEEGWKQLAQAPT
FT                   GASEHYEYYLHFSIYRLLLSEEDEPLERLLKQEAIPYFQKKKEYDDASLYAEYLADCYM
FT                   RRRQYKQAAQYYQLSCSLLRTQTGV"
FT   gene            658325..658453
FT                   /locus_tag="GYMC61_0669"
FT   CDS_pept        658325..658453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77345"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77345.1"
FT                   /translation="MKKRVVVIVALAVLGLASAFGQGIGVKEAAKDEHPPPTVIAR"
FT   gene            658832..660472
FT                   /locus_tag="GYMC61_0670"
FT   CDS_pept        658832..660472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0670"
FT                   /product="Thermolysin"
FT                   /EC_number="3.4.24.27"
FT                   /note="PFAM: peptidase M4 thermolysin; Peptidase M4
FT                   thermolysin; Propeptide peptidase M4 and M36; Propeptide
FT                   PepSY amd peptidase M4; KEGG: btk:BT9727_0509 bacillolysin
FT                   (thermolysin-like metalloprotease, peptidase M4)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77346"
FT                   /inference="protein motif:PRIAM:3.4.24.27"
FT                   /protein_id="ACX77346.1"
FT                   /translation="MNKRAMLGAIGLAFGLMAWPLGASAKERSMVWNEQWKTPSFVSGP
FT                   LLKGEDAPEELVYRYLDQEKNTFQLGGQARERLSLIGKQTDELGHTVMRFEQRYHGIPV
FT                   YGAVLVAHVNDGELSSLSGTLIPNLDKRTLKTEAAISVQQAEMIAKQDVADAVTKERPA
FT                   AEEGKPTRLVIYPDGETPRLAYEVNVRFLTPVPGNWIYMIDAADGKVLNKWNQMDEAKP
FT                   GGGQSVAGASTVGVGRGVLGDQKYINTTYSSYYGYYYLQDNTRGSGIFTYDGRNRTVLP
FT                   GSLWADGDNQFFASYDAAAVDAHYYAGVVYDYYKNVHGRLSYDGSNAAIRSTVHYGRGY
FT                   NNAFWNGSQMVYGDGDGQTFLPFSGGIDVVGHELTHAVTDYTAGLVYQNESGAINEAMS
FT                   DIFGTLVEFYANRNPDWEIGEDIYTPGIAGDALRSMSDPAKYGDPDHYSKRYTGTQDNG
FT                   GVHTNSGIINKAAYLLSQGGVHYGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAA
FT                   CVQAAADLYGSTSQEVNSVKQAFNAVGVY"
FT   gene            660588..660767
FT                   /locus_tag="GYMC61_0671"
FT   CDS_pept        660588..660767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0671"
FT                   /product="YteV"
FT                   /note="KEGG: gtn:GTNG_2740 YteV"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77347"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2740"
FT                   /protein_id="ACX77347.1"
FT                   /translation="MYKVKVFDKEHEKDLEAAVNDFLARLKDGQLIDVKYSVAAMESEG
FT                   EQIYCFSAMVIYRT"
FT   gene            complement(660962..662272)
FT                   /locus_tag="GYMC61_0672"
FT   CDS_pept        complement(660962..662272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0672"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; glucose-inhibited
FT                   division protein A; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: gka:GK2836
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77348"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACX77348.1"
FT                   /translation="MGYDVIIIGGGPSGLMAAIGAGEEGAKVLLLEKGTKLGRKLAISG
FT                   GGRCNVTNRLPVDEMVRHIPGNGRFLYSAFSVFNNEDIIRFFERLGVPLKEEDHGRMFP
FT                   KSDSAQSVVDALVRELSRLGVDVRLESPVADVLYEQGKTVGVTLKSGETIHARAVVVAV
FT                   GGKSVPQTGSTGDGYPWAEKAGHTVTELFPTEVPIVSHEPFIQERTLQGLSLRDVALSV
FT                   LKPNGKPIITHRMDMLFTHFGISGPAALRCSQFVVKALKKAAGGAVEMSIDALPDVTQE
FT                   ELFQYFAKLCKEEPKKAMKTIAKTVLPERYAVFLLERAGIDPHASAGTVGHEALRAFVR
FT                   QCKQFTFYVHGTLPLEKAFVTGGGVSVKEIEPKTMASKCMAGLYFCGEILDIHGYTGGY
FT                   NITAALVTGRLAGVNAARYALAEKNGASGSAGQTATN"
FT   gene            662385..664010
FT                   /locus_tag="GYMC61_0673"
FT   CDS_pept        662385..664010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0673"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; multi antimicrobial extrusion
FT                   protein MatE; KEGG: gka:GK2835 transporter involved in the
FT                   export of O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77349"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACX77349.1"
FT                   /translation="MSTSKLLRGTFILTAGVMISRLLGLFYVIPFYHLVGERGGALYGY
FT                   GYVPYQIFLSLATGGLPVAVSKFVSKYNALGEYGVGYRLFRSGLVLMIASGIASWLILY
FT                   ALAPILAPHVIDAKTNVNSVDDVTAVIRAVSFALLIVPVMSLIRGFFQGHESMGPTALS
FT                   QVVEQIARIAFLLGACYVILRLMDGSIVSAVSAATFAAFVGAAAGLLVLLVYWWKRRPH
FT                   LQSLLARDRGEADVSLLAMYKELLLSSIPFVFVGLSMSLYQLVDQFTFNHAMAAAGRGN
FT                   ISEHAYSVFNMWAQKLVIIPVTLATSFSLALIPTITKAYVAQDRKALRQYLNQTFQVLM
FT                   FLTLPAVIGMAVLAGPVYSSFYSYDPLGEQVLRWYAPAAILYALFSVTAAIMQGINEQR
FT                   FTVVSLTAGLLVKLLLNTPLIMKWSAVGAIVATMAGYFVSVAFNLWVIQRRTRYRYRFV
FT                   ARRTAFMAILTAAMSAAVMGVEALASRWIDYRAGTAESVGAVSIGAAVGAAVYLFLSIR
FT                   SGLFSALFGDRFAFWRRKEKKAVS"
FT   gene            complement(664228..664440)
FT                   /locus_tag="GYMC61_0674"
FT   CDS_pept        complement(664228..664440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77350"
FT                   /inference="similar to AA sequence:KEGG:GK2834"
FT                   /protein_id="ACX77350.1"
FT                   /translation="MNEYYYYVPTLDDYRQQPPASQFWPGYPGGPFANWARRIERLERA
FT                   VERLDRRLDRVESRLDRIERRLGLS"
FT   gene            664545..665291
FT                   /locus_tag="GYMC61_0675"
FT   CDS_pept        664545..665291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0675"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein; KEGG:
FT                   gka:GK2833 16S pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77351"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACX77351.1"
FT                   /translation="MELRIDKLLAHMGYGTRKEVKKLLKSGAVKVDGAPVRDAKTKVRP
FT                   DEQIVTVWGETVEYKPFIYLMMNKPSGVVSATEDAVEETVVDLLEEEDRAFCPFPVGRL
FT                   DKDTEGLLLLTNDGQLAHQLLSPKKHVPKTYFAVVGGEVTEADVAAFQRGVVLDDGYET
FT                   KPAKLVVLKSGLRSDVEVTITEGKFHQVKRMFQAVGKRVVYLKRIQMGPLALDPDLAVG
FT                   EYRELTDEEVDMLKQYRPETDEKKGT"
FT   gene            complement(665386..665607)
FT                   /locus_tag="GYMC61_0676"
FT   CDS_pept        complement(665386..665607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0676"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: gka:GK2832 DeoR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77352"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACX77352.1"
FT                   /translation="MKPSTHRMLTRIKSVYMYISEKGTVTTQELVDEFGTTPRTIQRDL
FT                   NVLMYNDLVRSPSKGKWTTTNKKVRISS"
FT   gene            665867..667276
FT                   /locus_tag="GYMC61_0677"
FT   CDS_pept        665867..667276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0677"
FT                   /product="dipeptidase"
FT                   /note="TIGRFAM: dipeptidase; PFAM: peptidase M20; KEGG:
FT                   gka:GK2831 Xaa-His dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77353"
FT                   /inference="protein motif:TFAM:TIGR01887"
FT                   /protein_id="ACX77353.1"
FT                   /translation="MNIDWMNEAKKRKDDLVRDVQALVRIPSVRDDQQAQPGAPFGPKV
FT                   AEALEHMLRRGREEGFRIKNVDGFAGHIEMGHGEKLVGVLGHIDVVPPGDGWTMDPFAA
FT                   EVRDGRLYGRGAIDDKGPTVAAFYAMKIIHDLGLPLGKRVRLIIGGDEESDWRCVEHYF
FT                   RHEEMPDVGFAPDADFPIIHAEKGIIDADLAYRPLESAEAEGFALASFQAGRRYNMVPD
FT                   AAEAVVEGAGRTEELLGLYEQFCRERGVKGSIRQSEGAIVFQLEGVSAHGAEPERGKNA
FT                   GVYLAQFLASLPLDGRSRPFVQFVASAFFGDARGRRLGLAYRDEQSGDLTVNVGVLSYD
FT                   RRHGGTIGLNIRYPVTADGEAIRRTLAGAAAEHGFALSRFSDTKPHYIDPNHELVRTLQ
FT                   RVYEEQTGEPARLLAIGGGTYARALTAGVAFGALFPGRPDVAHQKDEYIEIDDLVKATA
FT                   IYAQAIYELAK"
FT   gene            667345..668529
FT                   /locus_tag="GYMC61_0678"
FT   CDS_pept        667345..668529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0678"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1;
FT                   proton/sugar symporter LacY; KEGG: gka:GK2830 maltose
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77354"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX77354.1"
FT                   /translation="MEAAFKREAAVRKQVFPLFYFLIFFAFGALFPLLSVYLQEEARLS
FT                   GAAIGWIMSLPPIVTMAAQPLWGTAADYTRKPVELLTLALGVTALFGLLYSLAGSYRVF
FT                   VALTVLLSAAQSAIVPLSDSLALRHVHEQGGNYGAIRLWGSIGFAASVLVVGWLSDHVA
FT                   FAVIFYAFSLALLAASVLATRLPRYPMAAPGALTLRDVRRLLSVRSFQLLLVATFLLFG
FT                   PIYANNSYFGLLIHELGGTLTGIGLAFLFAAGSEAPFMKAADRLIGRFGMVRLLLLAAL
FT                   ISAVRWLSYAVDPPLWFVYVTTVVQGCSVGLAIPTALQYARRLAPERVQATAVALYSAV
FT                   GNGLGAWFCALAGGYLLERWQIGAVYLFFGICTIVGVLVLLLLAKRERTAGEEK"
FT   gene            668526..669104
FT                   /locus_tag="GYMC61_0679"
FT   CDS_pept        668526..669104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0679"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: gka:GK2829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77355"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ACX77355.1"
FT                   /translation="MKRSHYFIAVPLTSEAKQAIARFSGDAASSLPFRTWVHEEDYHIT
FT                   LAFLGDVPRGKMAPLCEAMAAVAAKSAPFSLVLAGLGTFGERTAPRVFWQGVETEEALN
FT                   GLRRDVYEACMKLGFSLDRRPFAPHITIARKWQGAEPFRPDRLRSLAAAKAVFSVPEIV
FT                   LYRTNMERTPKYEAIAVFPLLGAPMNGRK"
FT   gene            669116..670054
FT                   /locus_tag="GYMC61_0680"
FT   CDS_pept        669116..670054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0680"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77356"
FT                   /inference="similar to AA sequence:KEGG:GK2828"
FT                   /protein_id="ACX77356.1"
FT                   /translation="MGQLVKLMDCISRYETDVYYYVPEFIRLKQRQWEQAKARWQAERT
FT                   AEASGWLETGETWDVWLDKPSWWERLTKRWRRRAALTEEETFSLAPMARPAATLEELKQ
FT                   QFLDELFELQLKWASSTMMCVSSLDEAVYGDETLKYFLQRFPDTHLCFYRPVAMVGKAP
FT                   VELETMMLTPSALWCIAFVEGRPDNIVMASTGRFWVEQAGTNETRLVNPVVSLRRTEQI
FT                   VSEIFRKHGVDWPIHLVLLNRSGYIDSGGLFPFIRYIDKRNYDEWFSRLRRSALPLRHG
FT                   QLKAAEALLRHCASFYDRRHDGNMSGEEGQQ"
FT   gene            670156..672312
FT                   /locus_tag="GYMC61_0681"
FT   CDS_pept        670156..672312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0681"
FT                   /product="pullulanase, type I"
FT                   /note="KEGG: gka:GK2827 pullulanase; TIGRFAM: pullulanase,
FT                   type I; PFAM: glycoside hydrolase family 13 domain protein;
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77357"
FT                   /inference="protein motif:TFAM:TIGR02104"
FT                   /protein_id="ACX77357.1"
FT                   /translation="MLHISRTFAAYLDEMDQIVVLAPKSLGFDGMAPFTLVAPSGEEIP
FT                   LSVQHVEDVGETVKYECRFASAFEFGATYWVRSCRGEETDVQIGAVVRTPAFDDRFFYD
FT                   GPLGVEYSKEQAVFRVWAPTATAVNVKLVHPHLGEVHCVPLERGERGVWSAAVPGDWER
FT                   ARYTYIACINRVWREAVDPYATAVSINGEFGVVIDWEKTKLAPPSSPLPPLCSPTDAII
FT                   YELSIRDFTSHPDSGAVHKGKYLGLAETNTSGPNGTATGLSYVKELGVTHVQLMPFTDF
FT                   AGVDERDPQAAYNWGYNPLHLYAPEGSYATDPADPYARIIELKQAIRTLHESGLRVVMD
FT                   AVYNHVYDREQSPLERLVPGYYFRYDAYGQPANGTGVGNDIASERRMARRWIVDSVVFW
FT                   AKEYGIDGFRFDLMGVHDIETMKAVRDALDAIDPSILVYGEGWDLPTPLPPEQKATMAN
FT                   AKQLPRFAYFNDRFRDAVKGSTFHLPDRGFALGNPGGREQVKLAIAGSLRALGGLFCHP
FT                   RQSINYVECHDNHTFWDKMEAANHDEPEWLRRKRQKLATAIVLLAQGIPFLHSGQEFYR
FT                   TKGGDGNSYRSPDAVNQLDWERKSRYEDDVCYVQGLIALRRAHGAFRLATEAEVLRHFT
FT                   FLEPLLPSVIAYRLHDVAVYGPWEDIIVVHHNEEKETAIALPDEREWAVVCDGQRCGTT
FT                   PFGQARGMLRLDGVGTWVLVQPAG"
FT   gene            672621..673403
FT                   /locus_tag="GYMC61_0682"
FT   CDS_pept        672621..673403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0682"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   gka:GK2825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77358"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACX77358.1"
FT                   /translation="MEQLLGKEWEITPAGGATGDAYFAEYEGKKLFLKRNSSPFLAVLS
FT                   AEGIVPKLVWTKRLENGDVFTAQQWLNGRELKPWEMGSEQVAALLRKIHRSKELVTMLK
FT                   RLGKSPLRAKKMLALLAEQQRRHPAGGSVVCQALDWLEQHVSSLPDGEYVVCHCDINHN
FT                   NWLLADDGTLYLIDWDGAMIADPAIDIGMLLHLYIPRVEWEAWLDRYGWAWSEELGLRL
FT                   KWYTIAHTLHSLFWPKGKDGQKEKEQSLELLKRVMVES"
FT   gene            complement(673513..673782)
FT                   /locus_tag="GYMC61_0683"
FT   CDS_pept        complement(673513..673782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77359"
FT                   /inference="similar to AA sequence:KEGG:GK2824"
FT                   /protein_id="ACX77359.1"
FT                   /translation="MPLDYNHQLTVLRDILSEHQLDCCGTVSECEQIERLAKSLLANDE
FT                   VNSQVKQILPHIYAYGQGGKYSADLNAHISAHQGQLADWVNGLS"
FT   gene            673991..674644
FT                   /locus_tag="GYMC61_0684"
FT   CDS_pept        673991..674644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0684"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: gka:GK2823 hypothetical protein; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77360"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ACX77360.1"
FT                   /translation="MRLRNKPWAKDKIAAYPQYVIPDPETKRGRWRELFGRDRPIHVEI
FT                   GTGKGKFITEMAKLHPDVNFIGIELYPSVLVSALDKLIESGLANVKLLNANAKDLTAFF
FT                   ADGEVSRIYLNFSDPWPKKRHEKRRLTYRDFLALYDRILAEDGDIHLKTDNQSFFEYSL
FT                   VSLSQYGFVLASVQLDLHQSGMTDNVMTEYEEKFSAKENRIYRCEAVRPPRRSS"
FT   gene            674725..675573
FT                   /locus_tag="GYMC61_0685"
FT   CDS_pept        674725..675573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0685"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gka:GK2822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77361"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX77361.1"
FT                   /translation="MEQLRIGQVTLTWLRGGVTHLDGGAMFGVVPKPLWSKKYPPNDNN
FT                   QIELRTDPILVEAYGKRLLIESGIGNGKLTDKQKRNFGVTEESAIDESLAGLGLTRRDI
FT                   DIVIMTHLHFDHACGLTVWEDGRLVPAFPRAAIITSDVEWEEMRNPNIRSRNTYWKENW
FT                   EPIADQVVPFTKETEVVPGIRLIHTGGHSAGHAIVLIESDGEMAIHLGDLLGTHAHQNV
FT                   LWVMAYDDYPMDSIFAKQRWLPYGVKQNAWFTFYHDAYYRAVKWQEDGTMAAAVKRERP
FT                   L"
FT   gene            complement(675568..675867)
FT                   /locus_tag="GYMC61_0686"
FT   CDS_pept        complement(675568..675867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0686"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4; KEGG:
FT                   gka:GK2821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77362"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ACX77362.1"
FT                   /translation="MAWKKWLVGAAVGAAAIYAIRSASKPALLSPEQALAMAKRALGGR
FT                   RAIRGSWIQSAPERYEKNGLAYTVYRGGVCRDDGDDEFFINAYTGAIVDAKPLS"
FT   gene            675980..677059
FT                   /locus_tag="GYMC61_0687"
FT   CDS_pept        675980..677059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0687"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="PFAM: peptidase M42 family protein; KEGG: gka:GK2820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77363"
FT                   /inference="protein motif:PRIAM:3.4.11.7"
FT                   /protein_id="ACX77363.1"
FT                   /translation="MMKEETLRLFQTLTELPGAPGYEHPVRQFMRQELAKYADDIVQDR
FT                   LGSLFGVKRGDEAGPTVMVAGHMDEVGFMVTAITDNGMIRFQPLGGWWDQVLLSQRVQI
FT                   ITDGGPVIGVIGSIPPHLLDEEQRKKPMEMKNMLIDIGAESREDAERVGVRPGQPIVPV
FT                   SPFTLLANGKTVMAKAWDNRFGCGLAIELLKELNGETVPNVLYAGATVQEEVGLRGAQT
FT                   AAAMINPDIFFALEASPANDMSGDKQAFGHIGKGALIRLYDRTMITHRGMREFVLDTAE
FT                   TIGVPYQFFISPGGGTDAGRVHIANRGVPSAVIGICARYIHTHASIIHIDDYAAAKQLI
FT                   VELVKRCDRTTVETIRQNS"
FT   gene            677105..677635
FT                   /locus_tag="GYMC61_0688"
FT   CDS_pept        677105..677635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0688"
FT                   /product="protein of unknown function DUF84"
FT                   /note="PFAM: protein of unknown function DUF84; KEGG:
FT                   gka:GK2819 NTPase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77364"
FT                   /inference="protein motif:PFAM:PF01931"
FT                   /protein_id="ACX77364.1"
FT                   /translation="MKTVAVGTNNEAKIAAVRAVLSEKEYRIVSLEVPSGVSAQPLSDE
FT                   ETRLGAIGRAKRALEAAEADIGIGLEGGVTKIDGQWWLCNWGALADRNGVVVAAAGARL
FT                   ALPPDVGAGIEAGRELGDVMEAYTGRRNVRRKEGAVGVLTNGRVDRSAMFSHIVELLAG
FT                   QYEWLCQNGSFHV"
FT   gene            677676..677867
FT                   /locus_tag="GYMC61_0689"
FT   CDS_pept        677676..677867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77365"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77365.1"
FT                   /translation="MSGPRSTKELDRAAGKARGGAKRWKTPRGHGQALSTPDAPLAKPR
FT                   PKGGNGRHGRRQNKEEHE"
FT   gene            677864..678661
FT                   /locus_tag="GYMC61_0690"
FT   CDS_pept        677864..678661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0690"
FT                   /product="protein of unknown function DUF1444"
FT                   /note="PFAM: protein of unknown function DUF1444; KEGG:
FT                   gka:GK2818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77366"
FT                   /inference="protein motif:PFAM:PF07285"
FT                   /protein_id="ACX77366.1"
FT                   /translation="MNSRQMYEKIKERLVAHPHWTFRFDAKQDAMRVEDRRTKKGVTIS
FT                   LPGVIAKWHEQKDEAVREVVYYVEQTLKTMEEDAALSGNERNIYPVIRSASFPTETKEG
FT                   VPLLFDDHTAETRIYYALDLGKTYRLIDERMLEKDNWSRERVKEIARFNVRSLPTPVKE
FT                   DRVADNVFYFVNTNDGYDASRILNESFLADMRARVEGTMAVAVPHQDVLVIADVRNDIG
FT                   YDVLAQMTMSFFAGGRVPITALSFLYENGELEPIFILGKKRRT"
FT   gene            678682..679287
FT                   /locus_tag="GYMC61_0691"
FT   CDS_pept        678682..679287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0691"
FT                   /product="t-RNA-binding domain protein"
FT                   /note="PFAM: t-RNA-binding domain protein; KEGG: gka:GK2817
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77367"
FT                   /inference="protein motif:PFAM:PF01588"
FT                   /protein_id="ACX77367.1"
FT                   /translation="MNVFYNREGVGDVLLVSLKPAADEERTFVRQGDVVRIMSERTGET
FT                   VGYNIFSASSYYPFSGNGPLEVNEELVGVINDILAKNGFDEPIEADLSPKFVVGYVKEK
FT                   TKHPNADKLSVCQVDVGDEVLQIVCGAPNVAEGQKVVVAKIGAVMPNGLVIQESELRGV
FT                   RSSGMICSARELGLPNAPQEKGILVLSDEYEVGQPFVF"
FT   gene            679394..681748
FT                   /locus_tag="GYMC61_0692"
FT   CDS_pept        679394..681748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0692"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; DNA translocase
FT                   ftsK gamma; KEGG: gka:GK2816 DNA translocase (stage III
FT                   sporulation protein E)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77368"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACX77368.1"
FT                   /translation="MKFWKRWLRFLTSDEEEEGNEQRTNSRLSAGMPERGAVNVIYQYP
FT                   QGRFRFPLIPDDQPGENRERPGRAKSEASRPLPSRRPSAGVSREIAEKRPFRPSDVPSP
FT                   VFGYDRNRGKQRQRADEPELTGAGDIENRSDEAVREEALRGEATRRDAREGTESRAAEP
FT                   PKEEAPLAKGAEEWNEDASGAMPAAVMETEGKHELAPAAGQEERDAEADEKKGQELDER
FT                   GNERAPHATDGGLESEGRGVPSQMRNGDGGRASSTEQREKTPDREIRHSAAPVCREEAS
FT                   RPERTRIPYNVIMLKQDWRKLEEKAANRSNGCVLPPLALLEPPEKAAERDEQWLRDQCQ
FT                   RLDRTFASFHIGAKVVGATQGPTVTRFEVQPDLGVKVSKITSLIDDIKLSLAAKDIRIE
FT                   APIPGKRTIGIEVPNRTSRPVRLREILESEAFRKSPSPLTVALGLDISGAPVVTDIRKM
FT                   PHGLIAGATGSGKSVCMNAMLISMLYKAAPHEVKWLLIDPKMVELAPYNGLPHLLSPVI
FT                   TEAKAAAGALKWAVGEMERRYEQFVHAGVRDIEKYNAHLRERGSSEPPLPYIVIVIDEL
FT                   ADLMMAAPADVEESICRLAQKARACGIHLLIATQRPSVDVLTGLIKANIPTRIAFSVSS
FT                   QVDSRTILDVNGAERLLGRGDMLFLENGSAKPVRLQGCFISDEEIERVAAHVKEKQGPS
FT                   YLFDPDDFRQTASMGGEDDELFEEACRFVIAQGGASTSSLQRHFRIGYNRAARLIEMME
FT                   ERGLISEARGSKPRDVLMSEDEWERWREQNS"
FT   gene            681907..683211
FT                   /locus_tag="GYMC61_0693"
FT   CDS_pept        681907..683211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0693"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: gka:GK2815
FT                   UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77369"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACX77369.1"
FT                   /translation="MTAYHFVGIKGTGMSALAQVLHDLGYTVQGSDVEKWFFTQKALEE
FT                   RGIPVLPFSKDNIRPGYTVIAGNAFPDTHEEIEAARQLGVPVIRYHRFLGQLAGKFTSI
FT                   AVTGSHGKTTTTGLLAHVMQGAHPTSYLIGDGTGKGEPGSKYFVFEACEYRRHFLSYFP
FT                   DYAIMTNIDFDHPDYFANVDDVFSAFQQMANQVKKAIVACGDDPYLPNIQAKVPILFYG
FT                   FGEENDFQARNIVKTTEGMAFDVFVRNTFFASFAIPRFGTHNVLNALAVIALCHYEGVD
FT                   AGTIAKRLQTFQGVKRRFSEKTVGRQVLIDDYAHHPREITATLEAARQKYPGREVVAIF
FT                   QPHTYTRTQTFLREFAESLLQADHVYLCDIFGSAREHEGKLTIRDLQAQIPRSQLLEEQ
FT                   NVAVLKQHQDAVLVFMGAGDIQKFQQAYERAVLSA"
FT   gene            683357..683770
FT                   /locus_tag="GYMC61_0694"
FT   CDS_pept        683357..683770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0694"
FT                   /product="protein of unknown function DUF948"
FT                   /note="PFAM: protein of unknown function DUF948; KEGG:
FT                   gka:GK2814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77370"
FT                   /inference="protein motif:PFAM:PF06103"
FT                   /protein_id="ACX77370.1"
FT                   /translation="MEWLLYGSVALIALAFLLLVVYIAKTLIVLQETLRRLTAAIDHAD
FT                   EQVQTVAKEVRELLHTANGIASDVQKKAETLNGAIEAVGEIGGTIRSLNRALRQAAAGL
FT                   SARAGLGQGKWVKALRWTNVLLDLREKWRKNNR"
FT   gene            683786..684181
FT                   /locus_tag="GYMC61_0695"
FT   CDS_pept        683786..684181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77371"
FT                   /inference="similar to AA sequence:KEGG:GK2813"
FT                   /protein_id="ACX77371.1"
FT                   /translation="MAKNNGGFLLGALVGGIAGAATALFLTSEKGRKWLEEWNHAGRWE
FT                   PVKDTAAEWIETAKEKTKEIASFIPLKSSPAPAGGENDGEEAKEATIPIPPSAGPADRE
FT                   TLQKLLEEAEAALDDAEQNITSRKEAE"
FT   gene            684187..684516
FT                   /locus_tag="GYMC61_0696"
FT   CDS_pept        684187..684516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0696"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77372"
FT                   /inference="similar to AA sequence:KEGG:GK2812"
FT                   /protein_id="ACX77372.1"
FT                   /translation="MGMEKLETIEQFDRVMKETERFLFVKHSLTCPISQAAFGECEKFA
FT                   ADHPELPIYCLYVQEARPLSNYIAETTGVKHESPQVLLFENGRVVWHASHWAITYGALS
FT                   EHVGA"
FT   gene            684728..685810
FT                   /locus_tag="GYMC61_0697"
FT   CDS_pept        684728..685810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0697"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; chorismate mutase; PFAM: DAHP synthetase I/KDSA;
FT                   Chorismate mutase; KEGG: gka:GK2811 bifunctional
FT                   3-deoxy-7-phosphoheptulonate synthase/chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77373"
FT                   /inference="protein motif:TFAM:TIGR01361"
FT                   /protein_id="ACX77373.1"
FT                   /translation="MSNERLDELRARVDEINLQLLKLINERGRLVQEIGKIKEAQGTHR
FT                   YDPVRERKMLDLISEHNDGPFETSTLQHIFKEIFKAALELQEDDHRKALLVSRKKHPEN
FT                   TIVEVKGERIGDGNQYFVMGPCAVESYEQVAAVAEAVKKQGIKLLRGGAYKPRTSPYDF
FT                   QGLGVEGLKILKRIADEFDLAVISEIVTPADIEIALDYIDVIQIGARNMQNFELLKAAG
FT                   QVNKPILLKRGLAATIEEFINAAEYIMSQGNGQIILCERGIRTYERATRNTLDISAVPI
FT                   LKKETHLPVFVDVTHSTGRRDLLIPCAKAALAIGADGVMAEVHPDPAVALSDSAQQMDI
FT                   AQFNEFMEEVRAFQRQFVRA"
FT   gene            686115..687107
FT                   /locus_tag="GYMC61_0698"
FT   CDS_pept        686115..687107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0698"
FT                   /product="global transcriptional regulator, catabolite
FT                   control protein A"
FT                   /note="KEGG: gka:GK2810 transcriptional regulator involved
FT                   in carbon catabolite control; TIGRFAM: catabolite control
FT                   protein A; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77374"
FT                   /inference="protein motif:TFAM:TIGR01481"
FT                   /protein_id="ACX77374.1"
FT                   /translation="MTVTIYDVAREANVSMATVSRVVNGNPNVKPSTRKKVLEAIERLG
FT                   YRPNAVARGLASKKTTTVGVIIPDISSIFFAELARGIEDIATMYKYNIILSNSDQNKEK
FT                   ELHLLNTMLAKQVDGLLFMGGTITEEHVAEFQKSSVPIVLAATIGPNEIPSVNIDYEQA
FT                   AFEAVTYLLEKGNRRIVYVTGPTDDPINQRKLAGYRRALEEHGAPYEEELVIEGDNSYD
FT                   SGLEAYEKITELAERPTAVFAGTDEMALGIIHSAQDHGVRVPDELEVVGFDNTRLATMV
FT                   RPRLTTVVQPMYDIGAVAMRLLTKYMNKEPVDHHIVVLPHRLEVRESTR"
FT   gene            687307..687866
FT                   /pseudo
FT                   /locus_tag="GYMC61_0699"
FT                   /product="hypothetical protein"
FT   gene            687877..688344
FT                   /pseudo
FT                   /locus_tag="GYMC61_0700"
FT                   /product="hypothetical protein"
FT   gene            688402..689673
FT                   /locus_tag="GYMC61_0701"
FT   CDS_pept        688402..689673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0701"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpu:BPUM_1066 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77375"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX77375.1"
FT                   /translation="MFSILKNASYRKLWLSQVISELGDGITSLLILYLASKTSDSPLVF
FT                   SYVLIARYLPNVILGTFVGPIIDKFPKKRVMILADIYRFVILIGMIFAQSSLVLLILFT
FT                   LLLGVGTVFFEPAKSATIPRIMDNESIPNAVSLSQSTTMAISIIAPSIGGVLLLTKHYS
FT                   FMLILDSLTFLLSALILFFIRIPTDICSKEGERQKQSYKEALKEGVKTISSSTVLIGLF
FT                   SLLIVGIFVFSFINTNIYPLLLNDFKVGELHFGTLQTVFGFTAVVGSLLVPKIMEKIKS
FT                   SSLVIFTFIFIGIMCFLVIPTYKAHLLLPLVPVYIWLAIIGFTNTFINVPVNSLLLQSV
FT                   PKEILGRVTGILITVINLSSLIGLYSGGFIANHIGSIWAIVIGGACLLVFSLVFPLTKY
FT                   YKSLHIKNEKSSIEEMKGVSVEES"
FT   gene            complement(689707..690261)
FT                   /locus_tag="GYMC61_0702"
FT   CDS_pept        complement(689707..690261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0702"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpj:JDM1_1744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77376"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX77376.1"
FT                   /translation="MIKNSLDVAKLLFDPRIDKILKCFKYTPKTVKEAAEELNEKPSRL
FT                   YYHINKLVDLELLKVTEQKMVNNFMEKYYSSAHLYKSDSYMSFEGEFAVKNKDFLINQI
FT                   LFNINQGINVFKSDLENQSETPQSNAMYSQFEVNLTMEEWQHIHNEIRKLVKQRDKTPS
FT                   SETNEYSFILLSYNKNHQSKS"
FT   gene            complement(690319..691197)
FT                   /locus_tag="GYMC61_0703"
FT   CDS_pept        complement(690319..691197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0703"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gwc:GWCH70_3382 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77377"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77377.1"
FT                   /translation="MQEHFHFTTDPAKLQKQYAAIFCFVSAQLSLIQMYLHRRNRHLVK
FT                   QKDEVVMAVHLLGKLLGFSSERAWHRFVTGNLFTNGSFLERSRYNRRCRALGFAVKWIR
FT                   HELAKRGQHHAYAVVDSLPLPLCHPARMQRVKRFRGIADMGYCASKKQWYYGFKLHLQV
FT                   TNQGLAMGYVVTEASCHDVKAAETVMTQIPHPYNFGDKGYISRALREKLYEEHQAAFWT
FT                   PSRHNQKHGPSKAWEEWIRKKRKVIETVFSILVDQYRITDIRANSIAGFEVALDGILVA
FT                   YSLVTLGLVER"
FT   gene            691342..691734
FT                   /pseudo
FT                   /locus_tag="GYMC61_0704"
FT                   /product="hypothetical protein"
FT   gene            complement(691844..693031)
FT                   /locus_tag="GYMC61_0705"
FT   CDS_pept        complement(691844..693031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0705"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   gka:GK2942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77378"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX77378.1"
FT                   /translation="MNRLAHHQGIYKFFFTLGLTLQLSKPVLKHLVHLVDALTTKGFSG
FT                   TLTDVHHWSFHPNHRTTLSHFFTKSPWNEERLLGKLQEWILSQVERLAKRKNQPLFVSI
FT                   DDTICQKTKPSSRAAHAIQGCDWHYSHKDHQSVWGHSLVWLMVHTFTQAFPFAFRLYDK
FT                   KAGRSKINLAMEMLSSIKVKLTQPVYVLMDSWYPSKTLIEACLKKGFHVIAMLKTNRIL
FT                   YPKGIAIQAKQFARYVEPQDTRLVTVGKERCRVYRYEGAIHGLDDAVVLLAWKADQPMT
FT                   PEHLHCVLSTDRGLGDEDILRYYAQRWTIECFFRQAKDQLKLDGYRVRHVRAVKRYWAV
FT                   VLLASVYSIAESRQTLSAGLELLRSRKDHSVVEFIYDAAKQGIPIDVIKKQLRIA"
FT   gene            complement(693494..694028)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0706"
FT                   /product="hypothetical protein"
FT   gene            complement(694128..694454)
FT                   /pseudo
FT                   /locus_tag="GYMC61_0707"
FT                   /product="hypothetical protein"
FT   gene            complement(694819..695988)
FT                   /locus_tag="GYMC61_0708"
FT   CDS_pept        complement(694819..695988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0708"
FT                   /product="Histone deacetylase"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   gka:GK2809 acetoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77379"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ACX77379.1"
FT                   /translation="MSRNCAFVYSEQFLQYKFHDDHPFNQLRVKMTYDLLCTLGALEDR
FT                   QIVAPRMATDDELALIHDRSYIEAVKAAGRGELSEAAAQNYGLGTEDTPIFPNMHEASA
FT                   LLVGSTLTAVDAVLSGAAEHALNLGGGLHHGFRGKASGFCVYNDSAVAIQYIREKYGLR
FT                   VLYVDTDAHHGDGVQWAFYDDPNVCTFSIHETGRYLFPGTGNVNERGLGAGYGYSFNIP
FT                   VDAFTEDESWIAAYTTALREIADFFRPDVIVTQNGVDAHYYDPLTHLSVTMKTYRAIPK
FT                   LAHEIAHEYCGGRWIAVGGGGYDIWRVVPRAWALLWLEMTGQADVSGPLPDEWRERWQP
FT                   LSPVALPLEWDDPDDLYPPIPRKAEISEKNAQTVEKALYFIRSQKSRQP"
FT   gene            complement(695985..696629)
FT                   /locus_tag="GYMC61_0709"
FT   CDS_pept        complement(695985..696629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0709"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; amino
FT                   acid-binding ACT domain protein; SMART: CBS domain
FT                   containing protein; KEGG: gka:GK2808 acetoin utilization
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77380"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACX77380.1"
FT                   /translation="MLVEQIMKAPVVTLCPTNTIAEALQLLRHHRIRHLPVVDGEGRLL
FT                   GLVTSQDLRDASPSIFHLHEHLEDLQKPVSTIMKTDLIVGHPLDFVEEVAALFYEHRIG
FT                   CLPIVNHGKLVGIITQTDLLRTFIELTGVHQPGSQIEIKVPNETGMLSKAAAIISERHV
FT                   NIASVLVYPAPDPNEKILVFRVQTMNPLPLIRDLQNAGYHVLWPNLPGVTS"
FT   gene            complement(696722..697354)
FT                   /locus_tag="GYMC61_0710"
FT   CDS_pept        complement(696722..697354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0710"
FT                   /product="acetoin utilization protein"
FT                   /note="KEGG: gka:GK2807 acetoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77381"
FT                   /inference="similar to AA sequence:KEGG:GK2807"
FT                   /protein_id="ACX77381.1"
FT                   /translation="MEHKKTYNAKELKTPKGTLLIEGPVTPEALASYEFHHDLTSFRPP
FT                   AKQHKALIEIAKLPEGRIIIARRGEVIVGYVTFLYPDPLERWSEGNMENLLELGAIEVI
FT                   PEFRGFGVGKNLLIVSMMDDAMEDYIIITTEYYWHWDLKGTGLNVWEYRKVMEKMMNAG
FT                   GLVWYATDDPEICSHPANCLMVRIGKRVDAESIQRFDRLRFMNRYMY"
FT   gene            697529..699244
FT                   /locus_tag="GYMC61_0711"
FT   CDS_pept        697529..699244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0711"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gka:GK2806 acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77382"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX77382.1"
FT                   /translation="MNTERLPVIQGDYNLKNYEETYKQFQWSEVEKEFSWHETGRVNMA
FT                   YEAIDRHAESFRKNKVALYYRDAVRNEKYTFKEMKEMSNKVANVLKQAADIQKGDRVFV
FT                   FMPRSPELYFAVLGIIKTGAIVGPLFEAFMEGAVRDRLEDSGAKAIVTTPELLPRVPVG
FT                   DLPELKYVFLVGDGIVEEGPYIDLKKRMNEASKHFDIEWVDRQDGLILHYTSGSTGKPK
FT                   GVLHVHNAMIQHYQTAKWVLDLKEDDIYWCTADPGWVTGTSYGIFGPWLCGASSVIVGG
FT                   RFSPDAWYQTIQDFGVTVWYSAPTAFRMLMGAGDEVVKKYDLSSLRHILSVGEPLNPEV
FT                   IRWGMKVFGRRIHDTWWMTETGGHLICNYPCMEIKPGSMGKPIPGVEAAIIDDQGNVLP
FT                   PYRMGNLAIKKGWPSMMKTIWNNPQKYESYFIGDWYVSGDSAYMDEDGYFWFQGRVDDV
FT                   INTSGERVGPFEVESKLVEHPAVAEAGVIGKPDPVRGEIIKAFIALREGYEPSEELKED
FT                   IRQFVKKGLAAHAAPREIEFRDKLPKTRSGKIMRRVLKAWELNLPTGDLSTMED"
FT   gene            complement(699598..702348)
FT                   /locus_tag="GYMC61_0712"
FT   CDS_pept        complement(699598..702348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0712"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG: gka:GK2805
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77383"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACX77383.1"
FT                   /translation="MKRNQLSISLEKAWHYFSLTYDVVWNVILILLIAALCLICFSIGA
FT                   GAGYFAFLVKDMPVPSPDEMKKEIYSYGETSHMYFDGGVYLGRFRSDLDREAVRLSDVS
FT                   PYVVQAIIATEDEHFYEHHGVVPKAVIRAVFQELTNSPVKSGGSTLTQQLVKNQMLTNE
FT                   VSFERKAKEMLLSLRLEKFFSKEDILEAYLNVVPFGRNSSGRNIAGIQAAAQGVFGVNA
FT                   KELNLAQAAFLAGLPQNPFVYTPFAADGSVKPDLSAGLKRMKTVLYRMKRAGYISEKQY
FT                   KEALSYDVAKHLAAPKPSPFEQYPFLTMEIERRAKEVLAETFAKRDGYKPEEVQRDPAR
FT                   FRRYLGEAEKELRQGGYRIYTTIDKKIYEQMQRIAARYPYYGSDNVYYTKDKKTGKTIP
FT                   HRQPVEVGAMLIENKTGKIISFVGGRDYGREQLNHATQAHRSNGSTMKPLLVYAPAMEM
FT                   GVIQPATIIPDLPLSIGSYTPKNADGKTHGLVTARYALQQSFNIPAVRTYRKIQSRHPI
FT                   DYLHKMGITSVSKQEEANPALAIGGTHIGVTVEENVNAYATFANYGSFVDAYMIEKIVD
FT                   KNGKIVYKHQSKPVPVFSPQTSYLMIDMMRDVLHGGTASSVPRYLTFSADWAGKTGTSQ
FT                   DKRDSWFIAVNPNVTFGVWIGYDRPAPLESRYKGLSYSQRTQLLWARLINAAYQENPKL
FT                   IAPPKRFLMPGGIVRRAYCAASGFSPSAACEKAGLVRYDLYNTKFAPREGSGEEVMESR
FT                   VVVIGGRRYVALETTPEEFVTREVIVNPKLLADWGINGEGQAGDASLVSTLKENGRPPA
FT                   PPAARLAGGKLVWNRHNEPDVIGYRVYLVNETGERRLAAAVKADEAASFSPLQPGAAYC
FT                   VTAVDIAGQESAPSNPVSLPSASPPNSGHQKSGEPSSPPPSGDVE"
FT   gene            702513..702773
FT                   /locus_tag="GYMC61_0713"
FT   CDS_pept        702513..702773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0713"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77384"
FT                   /inference="similar to AA sequence:KEGG:GK2804"
FT                   /protein_id="ACX77384.1"
FT                   /translation="MMGISSGCLPGAESWRTVRASPQAGVNYLPEQRWRTVLAPSSHPP
FT                   AGAVTQMSEKAPCFLSRVVPRRTLAPSSRAGVFFFMTFIER"
FT   gene            702779..704038
FT                   /locus_tag="GYMC61_0714"
FT   CDS_pept        702779..704038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0714"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: gka:GK2803 tyrosyl-tRNA synthetase; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ib; RNA-binding S4 domain protein; SMART: RNA-binding
FT                   S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77385"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ACX77385.1"
FT                   /translation="MDLLAELQWRGLVNQTTDEDGLRELLKEERVTLYCGFDPTADSLH
FT                   IGNLAAILTLRRFQQAGHQPIALVGGATGLIGDPSGKKSERTLNAKETVEAWSARIQEQ
FT                   LSRFLDFEADGNPAKIKNNYDWIGPLDVITFLRDVGKHFSVNYMMAKESVQSRIETGIS
FT                   FTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGLELIRKTKGEARAFGLTIPL
FT                   VTKADGTKFGKTESGTIWLDKEKTSPYEFYQFWINTDDRDVIRYLKYFTFLSKEEIEAL
FT                   EQELREAPEKRAAQKALAEEVTKLVHGEEALRQAVRISEALFSGDIGNLTAAEIEQGFK
FT                   DVPSFVHEGGDVPLVELLVSAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAEHRL
FT                   EGRFTVIRRGKKKYYLIRYA"
FT   gene            complement(704085..704687)
FT                   /locus_tag="GYMC61_0715"
FT   CDS_pept        complement(704085..704687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0715"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: gka:GK2802 30S ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77386"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACX77386.1"
FT                   /translation="MARYTGPMWKVSRRLGISLSGTGKELQKRPYPPGQHGPGQRRKLS
FT                   EYGLQLQEKQKLRHMYGVNERQFRKTFEEAGKMPGKHGENFMILLESRLDNLVYRLGLA
FT                   RTRRQARQLVTHGHILVDGSRVNIPSYRVKPGQTIAVREKSRNLQVIKEALEANNYIPD
FT                   YLTFNPEKMEGTYTRLPERSELPAEINEALIVEFYSR"
FT   gene            704999..706858
FT                   /locus_tag="GYMC61_0716"
FT   CDS_pept        704999..706858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0716"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: gka:GK2801 two-component sensor histidine
FT                   kinase; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77387"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX77387.1"
FT                   /translation="MLVWVEKAMNKDEMKRYESFKQKFFHWFLAFQDDGPFSAAAGELL
FT                   ALLKEELALEQAVFYSYDPVRAAFYPEAAAVGTPDVGLIAAEGEREVVVVDAGGPHMAA
FT                   RLFFMLSDEAPAMVELMYRKDGGFDERLLWEIRTDLARLFRKLSAVLQGEGEEKRYGQL
FT                   HRFAAKIHSSMHIDVVLEEIIRTLQNVYPSFTYHLLLSHDNHLRGNLPIKTLVLDEREK
FT                   QTAALRAFLTGQVQCEEMEAPPRSVLYAPIKGVQAVYGVIEIIAPYAAPFPKREIHFIS
FT                   LLASTAGSALENAKLYEQSRRLVADLQLINDTMRQLNARPRLHEAIEYMISQIQQSFGA
FT                   EEVGFFLFANGKRELLPGSTPFFFDYRSEPYIEWVEKRRQSGNDILFAGDVCVSAFGSF
FT                   RSIMAAPMQQNKETKGLCIALASEPYRFTFEMFKLLESLVQHSTLAFMNAMLREELEKL
FT                   VVTDYLTKLHTRRYLDERIQQSMGTDASGAFILLDIDNFKQINDVYGHQTGDEVLVQVA
FT                   ETMRANIRDGDVAARWGGEELAVYLPNVPLSYAVAVARRIMEKVREQTIPAVTVSCGIS
FT                   WWGHGGFQDAEQLFKRADAALYMAKEMGKNCIFVHDDGHVYKV"
FT   gene            complement(706913..707389)
FT                   /locus_tag="GYMC61_0717"
FT   CDS_pept        complement(706913..707389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0717"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; SMART: GAF domain protein;
FT                   KEGG: gka:GK2800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77388"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACX77388.1"
FT                   /translation="MFHPIAYRGTREENYQLVIEQLKALIAGEPNFIANLANAAALLNQ
FT                   FFTDINWVGFYLAEGQELVLGPFQGLPACVRIPFGKGVCGTAAAERRTVVVPDVHQFPG
FT                   HIACDAASQSEIVVPLIKDGRVIGVLDIDSPVKNRFDDIDRRYLEQFASVLMSA"
FT   gene            complement(707476..708279)
FT                   /locus_tag="GYMC61_0718"
FT   CDS_pept        complement(707476..708279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0718"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /note="KEGG: gka:GK2799 histidinol-phosphatase; TIGRFAM:
FT                   histidinol phosphate phosphatase HisJ family; PFAM: PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77389"
FT                   /inference="protein motif:TFAM:TIGR01856"
FT                   /protein_id="ACX77389.1"
FT                   /translation="MRDGHIHTPFCPHGSQDPLEAYVERAIELGYTDISFTEHAPLPER
FT                   FIDPTPNQDCSMKLSQLERYLHAVAEVKARYRNDIAIRVGLEVDFIPGFEEETTRLLDE
FT                   VGPLLDDSILSVHFLAHEGQYVCLDYSEDMFADIVRLFGSVERVHRAYYETVRQSIRTE
FT                   LGRYKPRRIGHMTLVRKFQRRFPCLEPMDEWIVAILDDIKQFGYELDYNGAGAAKPLCL
FT                   EPYPPGGVIAEARRRGIPIVYGSDAHRAADLHQGREEMERTALSD"
FT   gene            708475..710178
FT                   /locus_tag="GYMC61_0719"
FT   CDS_pept        708475..710178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0719"
FT                   /product="Septation ring formation regulator EzrA"
FT                   /note="PFAM: Septation ring formation regulator EzrA; KEGG:
FT                   gka:GK2798 septation ring formation regulator EzrA"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77390"
FT                   /inference="protein motif:PFAM:PF06160"
FT                   /protein_id="ACX77390.1"
FT                   /translation="MGMAWIVLLLGAGAIIYNHVYRKRMYREIDRLEEWKINLMNRPVP
FT                   DELAKVKQLNMTGETEQLFERWRQQWDDIVAVKLPNVEEQLFDAERLLDKYRYRQARRL
FT                   LGQIADGLRRLEEEVHEIIHEVNELIGSEEQSRAEIEELRAAHREAKKALLAYRYTFGS
FT                   AADLLDVRLTEAEKQFQRFAELTEAGNYLAARDVVLTLKEELGRLTSMMEEIPKLLGEC
FT                   QTSLPAQLAELADGYREMEERGYILDHLHMERTLQEKREKIKQCLAMIHGLRIEEAKQI
FT                   VAELKEEIDALYDLLENEVLAHQYVQTEMPRLSGMLQELAAEAKETEAEALFVQQSYHL
FT                   APSDLEKYRSIEKQLHQLQKRFFLIQDRVAEAKTAYSLLKEELEQLVSQIDLMKEEHEQ
FT                   FRTMLQTLRKDELIAREKLDGMRKTLAEALRLVQKSRLPGLPEPYALELAEARRSLQAV
FT                   AARLEEKPLDMPAVDQALEEAKAAVERLYERTVEMIEQATLAERTIQYGNRYRRRYPAV
FT                   RKGLEEAEFLFRHYDYEEALRQAVAAVEEVEPGAFDRVQKLWQEDNSREQ"
FT   gene            710556..711701
FT                   /locus_tag="GYMC61_0720"
FT   CDS_pept        710556..711701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0720"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG: gka:GK2796
FT                   cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77391"
FT                   /inference="protein motif:PRIAM:2.8.1.7"
FT                   /protein_id="ACX77391.1"
FT                   /translation="MIYLDNSATTKPFPEVVDSFVAVATNYFANPSSLHGLGMKAERLL
FT                   AQAREQIAAMLRVKPNEIVFTSGGTEANNFAIKGVAWQYQRRGRHIITTKIEHPSVAEP
FT                   CRQLEELGFEVTYLPVDREGRVSVEQVERALRDDTILVSVMHVNNEVGTVQPIEEIGAL
FT                   LSRYPKTLFHVDRVQGISKVPLDLKQAGVDLCTISAHKFHGLRGAGLLYVREGVRLAPL
FT                   IAGGGQERQLRSGTENVAAIVAMAKALRLAMERYERDIGRLQALKDEWLEALSAIPDIE
FT                   INTPRDGAAPHIINFSLKSGIKPEVFVHELEKSGIYVSTTSACSSKKKAPSKTLLAMGL
FT                   GEDRAERGIRISLSFDNSREEIAPAVAAIKQAIKTLSEVTE"
FT   gene            711703..712911
FT                   /locus_tag="GYMC61_0721"
FT   CDS_pept        711703..712911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0721"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="TIGRFAM: thiamine biosynthesis/tRNA modification
FT                   protein ThiI; PFAM: Thiamine biosynthesis protein-like;
FT                   THUMP domain protein; Queuosine synthesis-like; KEGG:
FT                   gka:GK2795 thiamine biosynthesis protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77392"
FT                   /inference="protein motif:TFAM:TIGR00342"
FT                   /protein_id="ACX77392.1"
FT                   /translation="MMNYDRILIRYGEMTTKGKNRNIFVRRLKSNIARKLQAFERIQIE
FT                   YMRDRMYILLNGEPHEPIIEKLKTVFGIHSFSLAMKCENDLDAIKETALAAVRQLPYKG
FT                   KTFKVSARRVDKQFPYRSDELNYEVGAHILRQTDGLRVNVREPDIDVRIEVRQDGTYIT
FT                   CRDIFGAGGLPVGTSGKAMLMLSGGIDSPVAGYLSMKRGLEIEAVHFFSPPFTSERAKQ
FT                   KVIDLVRKLTTYGGRIKLHIVPFTEVQQAIYQGVPNEYSLISTRRAMLRITDALRRRQR
FT                   ALAIVTGESLGQVASQTLESMYVINEVTNTPILRPLVSMDKLEIIELAKQIGTHDISIL
FT                   PYEDCCTIFTPRAPKTKPKKEKVLHYESQLDLAPLLEKAVNDTETLVIDEETGQGDEFA
FT                   ELF"
FT   gene            712993..713196
FT                   /locus_tag="GYMC61_0722"
FT   CDS_pept        712993..713196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0722"
FT                   /product="small acid-soluble spore protein alpha/beta type"
FT                   /note="PFAM: small acid-soluble spore protein alpha/beta
FT                   type; KEGG: gka:GK2794 small acid-soluble spore protein
FT                   (major alpha-type SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77393"
FT                   /inference="protein motif:PFAM:PF00269"
FT                   /protein_id="ACX77393.1"
FT                   /translation="MARNNSNQLLVPGAQQALEQMKYEIAQEFGVNLGADTTSRANGSV
FT                   GGEITKRLVAMAQQQLGGARQF"
FT   gene            713334..714926
FT                   /locus_tag="GYMC61_0723"
FT   CDS_pept        713334..714926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0723"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gka:GK2793 acetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77394"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX77394.1"
FT                   /translation="MRREDLIAPERYNLTSEMERHAAAGPDRIALKWESEQGETKEITY
FT                   GRLMARANQIGNAFLSHGLEKGDKVLVMMPRLIETYEVYIGALKAGLVVIPSSEMLRTK
FT                   DLQYRLVHSEAKAVVAYAPYTDEFAPIDGIERLTKFVIGEPRDGWIPLEDAMAKESETL
FT                   EAADTSRDDMAFLSYTSGTTGNPKGVVHCHGWAYAHLRTAAKNWLCIEEGDLVWATAGP
FT                   GWQKWIWSPFLSVLGSGATGFVYYGRFEPEKYLQLLEKYNINVLCCTPTEYRLMAKVPD
FT                   IGRYHLSHLHSAVSAGEPLNREVIDTFAKHFGVEVRDGYGQTENTLLVGVMKGMPIKPG
FT                   SMGKPTPGNRVEIIDENGEPCPPGQVGDIAVHIETPALFKYYYKDPERTAMQFRGDYYI
FT                   TGDKARKDEDGYFWFEGRGDDIIISAGYTIGPFEVEDALVKHPAVKECAVVASPDEVRG
FT                   HVVKAFVVLRDGVDKDDPSLIPALQEHVKQLTAPYKYPRKIEFVDDLPKTASGKIRRVE
FT                   LREREARLAGRSS"
FT   gene            complement(715090..715893)
FT                   /locus_tag="GYMC61_0724"
FT   CDS_pept        complement(715090..715893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0724"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: gka:GK2792
FT                   inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77395"
FT                   /inference="protein motif:PRIAM:2.7.1.23"
FT                   /protein_id="ACX77395.1"
FT                   /translation="MDMERNRLYFFYKRDDKLIERVKPLIELAERGPFVVVGDYREANI
FT                   IVSIGDDGAFLQAVRQTGFLPDRLYVGVSVLPARGFYCDFHIDDIDHMVEAAKNWKLEV
FT                   RRYPIIEVTIDGAASFFCLNECSIRSQIIKTMAIDVFIDDLHFETFRGDGIIVSTPTGS
FT                   TGYNKSVHGAVVDPLLPCFQVSELASLNSNRYRTLGSPFILSGSRTLTLKMSEETSHFP
FT                   IIGLDNEALSIQHIERIDIRLSDRVVKTVRLKDNSFWDKVKRVFL"
FT   gene            716001..717008
FT                   /locus_tag="GYMC61_0725"
FT   CDS_pept        716001..717008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0725"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; peptidase S14 ClpP; KEGG: gka:GK2791
FT                   protease IV (signal peptide peptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77396"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACX77396.1"
FT                   /translation="MNRKRWTALAIAAALFVISVLVQAVGVLLSDKAGGWSESWLALME
FT                   SPFSEEVIAEGDPLKKIAVLEVNGVIQDAGEAESFLSSSQYNHQTFLQMIKQAKEDQDV
FT                   KAIILRINSPGGGVAESAEIYDQLMKLKKKTNKPIYVSMGAMAASGGYYIAAAGDKIFA
FT                   SPETITGSIGVIMQSVNYEGLAKKYGVELVTIKSGPYKDIMNPARKMTEAEREILQRLI
FT                   NDSYDAFVDVVAKGRKLPEDTVRKLADGRIYDGRQAKELRLVDEFGYLDDAIAALKKEH
FT                   HLTGAQVVKYVNDAPWSSLFEMVSNRMKPDSEAAGLIRLLSRPSSPRLMYLYAE"
FT   gene            717021..717491
FT                   /locus_tag="GYMC61_0726"
FT   CDS_pept        717021..717491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0726"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   gka:GK2790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77397"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ACX77397.1"
FT                   /translation="MTDMQITATLADHLPPAERPLCYGGFWLRFWAYCLDVIVVSSLNR
FT                   LIVWPLFRLFDWPLAQDGLFAPAAVAAAVVFYAYFVLMTKAFGQTLGKMVFGLKVVDER
FT                   GEPLTWLTVLFREVVGKFIAKKLLFIGFLFVAFSEKKKGMHDQFADTIVVRE"
FT   gene            717601..718290
FT                   /locus_tag="GYMC61_0727"
FT   CDS_pept        717601..718290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0727"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77398"
FT                   /inference="similar to AA sequence:KEGG:GK2789"
FT                   /protein_id="ACX77398.1"
FT                   /translation="MKAVIAVIATVVLLLLLVAWMKVSVTVVFRHMKDDDECKIVVRTL
FT                   FGLLRYTVRIPLIKLDMDPDAPGVAFLHKKGVEGTRGKEEKKGKLTLKKIADLFRQLKR
FT                   FLEQVVDLHEIMKQFYRHVTITKWEWKTRIGTGDAASTGLLVGLGWSLKYMIIGAASRY
FT                   MNIKTTPAVAIVPAYDRAASETVFLCMIQFRIGHAMVAGLRVVKHWRGRRLPKRNPLAA
FT                   KQANEGY"
FT   gene            718302..718748
FT                   /locus_tag="GYMC61_0728"
FT   CDS_pept        718302..718748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0728"
FT                   /product="sporulation protein YtfJ"
FT                   /note="TIGRFAM: sporulation protein YtfJ; PFAM: Sporulation
FT                   protein YtfJ; KEGG: gka:GK2788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77399"
FT                   /inference="protein motif:TFAM:TIGR02874"
FT                   /protein_id="ACX77399.1"
FT                   /translation="MTNHPIQGLMTTAMENLKQMIDVNTIIGDPVETPDGSVILTVSKV
FT                   GFGFAAGGSEFMLDGQQNGHQGAQADGNGHPFGGGSGGGVSITPIAFLVVNSSGVKLLH
FT                   LDESTHLYEKILDVAPQAFEKIQAMLKKNKKDGAAGQKADDFDI"
FT   gene            718873..719373
FT                   /locus_tag="GYMC61_0729"
FT   CDS_pept        718873..719373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0729"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   gka:GK2787 thiol peroxidase (superoxide-inducible protein
FT                   8)"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77400"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACX77400.1"
FT                   /translation="MAYVTFKGQPVTLVGNEVKVGDKAPDFTVLDQNLQEVTLADTKGH
FT                   IRLISVVPSLDTGVCDAQTRRFNEEAAKLDNVKVLTISVDLPFAQKRWCGAAGIENVQV
FT                   LSDHRDVSFGQAYGVLIKELRLLARAVFVIDSNDTVTYVEYVPEVTNHPNYEAAIEAAK
FT                   AAK"
FT   gene            719493..720482
FT                   /locus_tag="GYMC61_0730"
FT   CDS_pept        719493..720482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0730"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: gka:GK2786
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77401"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACX77401.1"
FT                   /translation="MMTPVERLFTVFDETAQLLQEELQCTYLEAVAETGENLFHGDVLQ
FT                   DEVSELNAKRLKKQYRELMLERFQNEEIRKAFQLAVLKGMRKHVQPHHQMTPDAVSLFL
FT                   AYLVREFTRSHLALKILDPAVGTANLLTAVLNGLRGKQAASYGSDVDDLLVKLAYVNAN
FT                   LQKHPVQLFNQDSLRPLFVEPVDVVVCDLPVGYYPDDDNAARFALKAKEGRSYAHHLFI
FT                   EQSLRYTKEGGYLFFLIPNTLFSSPQAGQLNEFLKEAAIVQGVLQLPLSMFKNDQAAKS
FT                   VLILQKKGPNVKKPKHVLLVELPRFSNKSAMQAMMAKIDAWITAEKEQ"
FT   gene            720861..722051
FT                   /locus_tag="GYMC61_0731"
FT   CDS_pept        720861..722051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0731"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: gka:GK2785 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77402"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ACX77402.1"
FT                   /translation="MAKVLAINAGSSSLKFQLFEIPAETVLTKGVVERIGFDDAIFTIV
FT                   VNGEKHQEVTAIPDHAAAVKMLLDKLIRYGIIRSFDEIDGIGHRVVHGGEKFSDSVLIT
FT                   EDVIKQIEEVSELAPLHNPANLVGIRAFQEVLPDVPAVAVFDTAFHQTMPEQSFLYSLP
FT                   YEYYTKFGIRKYGFHGTSHKYVTQRAAELLGRPIEQLRLISCHLGNGASIAAVEGGKSI
FT                   DTSMGFTPLAGVAMGTRSGNIDPALIPYIMEKTGMTADEVIDVLNKKSGMLGISGISSD
FT                   LRDLEKAAAEGNERAELALEVFANRIHKYIGSYAARMCGVDAIIFTAGIGENSEVVRAK
FT                   VLRGLEFMGVYWDPILNKVRGKEAFISYPHSPVKVLVIPTNEELMIARDVMRLANL"
FT   gene            722284..722796
FT                   /locus_tag="GYMC61_0732"
FT   CDS_pept        722284..722796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0732"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77403"
FT                   /inference="similar to AA sequence:KEGG:GK2784"
FT                   /protein_id="ACX77403.1"
FT                   /translation="MALFRDDAHVYRVIGEFMQIPSRPRTEMELRSWWGQHPAYQEYGD
FT                   EVEQINRIGEQIRRSRAAFVFYLTDPGAVISIDARRTETGENYAIYFGQAIDAPDVAIK
FT                   TTGDIAHQFWGGNINVPLALMTGKMKAKGSKAKALQLLPRIVPTFPLYRRYLELIDERA
FT                   LLHALKA"
FT   gene            722933..723283
FT                   /locus_tag="GYMC61_0733"
FT   CDS_pept        722933..723283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0733"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   gka:GK2783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77404"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ACX77404.1"
FT                   /translation="MTTVRDIFQLIDSQLREDPSRADGVVAVYQFNLSGSDAGVYQVVL
FT                   RPDAGFVIEGEQETPDCTLSLDSEDFKKMVDGELNGTEAFMSGRLRIDGDMGLALRLQE
FT                   VLSAYNSANQNQ"
FT   gene            723419..724954
FT                   /locus_tag="GYMC61_0734"
FT   CDS_pept        723419..724954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0734"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gka:GK2782 long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77405"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX77405.1"
FT                   /translation="MDLRTVWTKNIERFGPYPALIFEGNEYTNVDCDARSSQLAHALIE
FT                   LGVKPGDRVVVTMPNSPEVVVAFSGVLKAGAVVVPVLPLLQTQELHYIFQDCEPKVVLT
FT                   AEMLWAKAKEAANGLPAPPMMFTIDDPHSPRSLRTRMEQAPASMPLAAVTENAPAALLY
FT                   TSGTTGQPKGVVLTHRNLYANAEAAAEMAKRLPTEYDRVGLGVLPISHAFGFTMMNVAL
FT                   LLGDKIVLLPYFEPKKVLETIERHRVTHTAMVPAMFHALCYCPEADRYDTSSLVACVSG
FT                   SASLPRPLAEQFQRKFNCLILEGYGLSEAAPIVTATDPTQTIKPGSVGLPLPGVQVAVV
FT                   DEHGNRLPPNEVGELIVSGPNIFQGYYGKDEETRQALRDGWLYTGDMARIDEDGYVFIV
FT                   DRKKDVIIRGGFNIYPRDIEELLMSHPDVLEAGVVGVPSPKMGEEVAAYVVVRRGAQVT
FT                   EEELIEFCQKRVAKYKSPRFLKKVGYLPKNIIGKIDKKKLREWASEFIPAVQS"
FT   gene            724975..726117
FT                   /locus_tag="GYMC61_0735"
FT   CDS_pept        724975..726117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0735"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: gka:GK2781
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77406"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACX77406.1"
FT                   /translation="MISFQPTEEEQAFFQVARSLAVEKIRPAARECEKRRTVSVDLSDR
FT                   VDELGLSALELPESWGGLELPLLSQAIIWQGLSYGDLGVIQGLPGAGEASSLFRLSSEH
FT                   RVWHRYREMAKGGWPTVAWIDEAEQKEPLKEAIRVRRRGSGYIVDGVSSPVRLASKADW
FT                   AVIAARDEEEETVLLALDERVWEIEEGDIRLGLLAAGIARLRFAEVYAGPEQLVACGSE
FT                   ADALLNRVRARNQVIEAAKEVGLMEAALDYTIEYTAGRKAFGQEIAKFQGVSFTIAEMA
FT                   FACRGAKWLVWQAAFAVDRGDEQANGFAWRSLARAHRSLRYVTDQAVQMLGGHGYVQEY
FT                   PAEKWMRDAQAQVMLYGRERDWLIRRGEQLLGKRKERVAP"
FT   gene            726114..727328
FT                   /locus_tag="GYMC61_0736"
FT   CDS_pept        726114..727328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0736"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: gka:GK2780
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77407"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACX77407.1"
FT                   /translation="MISFEFSPQQKQIKELVHWFAKHEVRPIALEADRLGRVPDEWLQK
FT                   VNKMGIQLNASSFGGGRPPSHAEGKKEKKEREGNRVAVIAAEELAWGCPGIALSLPGPG
FT                   LGGPPIQSSGTPEQKQRFLSIFTKEEPRWGAYALTEPEAGSDASGIRTTAKKVDGGYVL
FT                   NGQKIFITNGARASWVVVFATVDPKLGRAGHRAFVVEKGTPGFVATRTVHKMGLRANET
FT                   AELLFEDCFVPDENLLGGEELYSANANKPSGFQVAMKTFDSTRPIVAAMAVGIARAAYE
FT                   YTLDIVRSEYPKQGRLYYEAAALLAEAEQEIDAARLLTWEAAWKADIGEPNAMEAAVCK
FT                   AVAGKMALHVCAMCLELLGPVGLDGHLVEKLYRDVKVFDIFEGTQQIQRLVTARRLYAP
FT                   YGVHV"
FT   gene            727425..728216
FT                   /locus_tag="GYMC61_0737"
FT   CDS_pept        727425..728216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0737"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   gka:GK2779 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77408"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACX77408.1"
FT                   /translation="MPYETLRIERRNKGVAWVMIDNPPANAISERLMEELEKAADELEA
FT                   DRGVRVVVIASAHPKTFLAGADLKDMIQRGTQFAGNEAGIAEQSARMQRCFDRFATMPK
FT                   PVIAAINGYALGGGCELALACDFRIMGGGKIGLTEVSLGLIPGAGGTQRLTRLVGRAKA
FT                   TELIFLARRLNPQEALELGLIHRITPPERLEEEAAAFAEQLSEGAVRAMGLAKRAIYAA
FT                   EGLPEDGFGIEAASFAATFKTGEPAIGLAAFFQKKQPQFLR"
FT   gene            728232..729074
FT                   /locus_tag="GYMC61_0738"
FT   CDS_pept        728232..729074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0738"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: gka:GK2778 3-ketoacyl-[acyl carrier
FT                   protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77409"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX77409.1"
FT                   /translation="MSSWAELLKGKVAVVTGASRGLGRADALALAEAGADVVITDILLE
FT                   SDEESKQTAQKYGPLSQVMQSTKVVYAEKTAEDIRAMGRRALALKMDVTDREQVKEVFA
FT                   RVKEEFGSIDILVNNAGTLDHVSQIEKQNDEFWERDLRVNLTGTYNCTKAVWPYMKEQG
FT                   WGRIINMSSVAGTLGGFGQASYSATKGAVLSFTKSMALEGARYGITVNAIVPGIINTEA
FT                   FRMGNPKMNERMIQRTAFRRPGEPEDVANAIVFLCSDKAKYITGIGLNVSGGIELFTF"
FT   gene            729189..730331
FT                   /locus_tag="GYMC61_0739"
FT   CDS_pept        729189..730331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0739"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: gka:GK2777 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77410"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACX77410.1"
FT                   /translation="MREVVIVDAVRTAIGKKKGALSSVHPVDLLVPVLRALVDRNGIDA
FT                   SLVEDVVVGCVTMTGEQGGNIARQAVLAAGFPVGVPAFSLNRMCGSSQQAIHSAAQAIL
FT                   AGDIDIAIAAGVESMTRVPMGSDMGRFSRQLTSRYNIVPQGISAEMIAKKWGLSREELD
FT                   EFSLASHEKAAAATDRGMFEREIIPLDVPGEDGAVRFARDEGIRRDTSLEKLAALTPSF
FT                   QPKGGVITAGNSSQVSDGAAGVLLMSAEKARQLGLRPRARIVARAVVGEDPVMMLTGII
FT                   PATRSVLQKAGLRLDQMDAIEVNEAFASVVKAWERELEPDMTKVNPRGGAIALGHPLGA
FT                   SGARLMTTLLHELEDMDGTYGLQVMCIGFGMATATIIERL"
FT   gene            730352..732097
FT                   /locus_tag="GYMC61_0740"
FT   CDS_pept        730352..732097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0740"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; RIO-like kinase; KEGG:
FT                   gka:GK2776 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77411"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ACX77411.1"
FT                   /translation="MHASLETAKPKPARDFAAIGAAIEEELAAITAGKRRRKIIAVLVK
FT                   NGLGMVLGDAIARKLRGNEEDKQYLRHIGRRLRLAFEELGPTFIKLGQVLVTRQDLLPE
FT                   PITLELEKLLDRVPPIEFAKIEYILERELPDGLATFDWIEEEPLGSASLAQVYKAKLKD
FT                   GPVVAVKVVRPTVEKLFQTDIAIIKKMAARLQKRLPPELQAALDLGGLVQDYYSSAMDE
FT                   LDMTEEARKMQEMKQKYERRAEHVKVPHVYEATKSVLIMEYIDGWLIKDFPVDFLTFEE
FT                   RVNIMIDLVHHYVQTMLDGHYHADAHGSNIMIDKRTKKAVIIDWGMTGRMDSVMAQILM
FT                   RVILHIQLNQAEDAAEVFMELMSPTIYTDVVKLKDELRTLTLNYVSAHQGSSRYNYGRL
FT                   VLEATAIGLRNYCKVPNGLALWAKGFSATEGTARWICPEISYGEVVEAYEIPILKSILG
FT                   KRFNFRANASLVAETAEMIATFPRRFNKVLETMAENKWRMTVQVQTDPVTRNTLNQIAN
FT                   RLALSIIAFAIIMATGFIVASIPGGTFLGMEKTTIANIGLAASVILVVFLGWRLFRTRK
FT                   QRPRF"
FT   gene            732114..732440
FT                   /locus_tag="GYMC61_0741"
FT   CDS_pept        732114..732440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GYMC61_0741"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GYMC61_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACX77412"
FT                   /inference="similar to AA sequence:KEGG:GK2775"
FT                   /protein_id="ACX77412.1"
FT                   /translation="MREEQEDLTMSKRIEAFYRQSGGPGSPTIRRLLDKHLLYGKDHGL
FT                   PGKKEEFEDVIRDVFLQDHSTRPLVIGLFKLKETLKQEWDAYLDALRGRGIREEEADMA
FT                   GKRA"
FT   gene            732468..733574
FT                   /locus_tag="G