(data stored in ACNUC7421 zone)

EMBL: CP001797

ID   CP001797; SV 1; circular; genomic DNA; STD; PRO; 704884 BP.
XX
AC   CP001797;
XX
PR   Project:PRJNA39311;
XX
DT   16-DEC-2010 (Rel. 107, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Pseudoalteromonas sp. SM9913 chromosome II, complete sequence.
XX
KW   .
XX
OS   Pseudoalteromonas sp. SM9913
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Pseudoalteromonadaceae; Pseudoalteromonas.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-704884
RX   PUBMED; 20703316.
RA   Qin Q.L., Li Y., Zhang Y.J., Zhou Z.M., Zhang W.X., Chen X.L., Zhang X.Y.,
RA   Zhou B.C., Wang L., Zhang Y.Z.;
RT   "Comparative genomics reveals a deep-sea sediment-adapted life style of
RT   Pseudoalteromonas sp. SM9913";
RL   ISME J 0:0(2010).
XX
RN   [2]
RP   1-704884
RA   Qin Q., Zhang Y., Chen X.;
RT   ;
RL   Submitted (14-OCT-2009) to the INSDC.
RL   State Key Laboratory for Microbial Technology, Shandong University, 27
RL   Shanda Nanlu, Jinan, ShanDong 250100, China
XX
DR   MD5; 7d6dbcc38f268dc948dac9db33fb14bc.
DR   BioSample; SAMN02603856.
DR   EnsemblGenomes-Gn; EBG00001268494.
DR   EnsemblGenomes-Tr; EBT00001800718.
DR   EuropePMC; PMC3105692; 20703316.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01766; cspA.
XX
CC   Bacteria available from State Key Laboratory for Microbial
CC   Technology, ShanDong University. Contact Email address:
CC   zhangyz@sdu.edu.cn.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..704884
FT                   /organism="Pseudoalteromonas sp. SM9913"
FT                   /chromosome="II"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:234831"
FT   gene            161..1399
FT                   /locus_tag="PSM_B0001"
FT   CDS_pept        161..1399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0001"
FT                   /product="putative ATPase involved in chromosome
FT                   partitioning (parA family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70041"
FT                   /protein_id="ADT70041.1"
FT                   /translation="MSINKNALDTYRLLKATAEVAEKSLEGRIQHYRAHLKSEEKELRT
FT                   YTQKAAADLLGCNNRTLKRRHDNGDFDDLNIKRGANGHYAYTLVNIFAMADIMDIQPDH
FT                   RASTDKLQVIVINSLKGGCGKTTSIVNIAAALATTNIKRYRIGIIDLDPQGSSSSFFPS
FT                   SEPDPITVGDLMRDCIDLDEGETWPEFVSNSFLPTHIPNIRVLPSGMDDFYFEHETATL
FT                   LKDTSNYEQTRHYHKLLERVINPVKDEFDILLIDTAPTLNFMFYNALMASTAMLIPVHP
FT                   EAVDFDANNKYLKRLGEIYHTVAALGHDGWDFMQFLVTNYVKGNHSQRDIVKDVRSAFG
FT                   RQVMSYPINHSSAITASSSSFNTIFDQKASDSLASRESLMRAQENIKDVVDELEMLIRS
FT                   NWQSTQSKLNTPK"
FT   gene            1415..2377
FT                   /locus_tag="PSM_B0002"
FT   CDS_pept        1415..2377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0002"
FT                   /product="putative transcriptional regulator for chromosome
FT                   partitioning (parB family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70042"
FT                   /protein_id="ADT70042.1"
FT                   /translation="MAKKRKNDTRLDPFATAVGSSSLDALLEQANAGDVIRMPAPSDPN
FT                   REITLVCKVIAHNEIENSTQVYGKNRRVQALLNEKSVADILPAIKEDGRNQHPALLWEQ
FT                   GDMSLVLAGSRRRKACILGGADYLVLSSSDFSEQDAKVLAVSSDQYIAPSLWELGQAYQ
FT                   QTRNDLIQQGKKGSYREIAVIEGVSHTAIADAIKAYEQISADVIALYPTANHVGREVAK
FT                   KLINAKERDEEAFNELVVALASNDEINALEADDKRAMLITKYLTAEPKTASKREAVLEN
FT                   DFISVQRNLKSGDVSIKINNKVMTDKRLEQLTKLLSAFN"
FT   gene            complement(2427..2552)
FT                   /locus_tag="PSM_B0003"
FT   CDS_pept        complement(2427..2552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70043"
FT                   /protein_id="ADT70043.1"
FT                   /translation="MKNGIKRRCLVSKNMILDGLSHVFSLFMPLKIRFLPTKKEV"
FT   gene            2774..5950
FT                   /locus_tag="PSM_B0004"
FT   CDS_pept        2774..5950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0004"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70044"
FT                   /protein_id="ADT70044.1"
FT                   /translation="MFLNFNTLSDMSANLSKNDLMAIFEEIKNEQATQFPLSERFIKKL
FT                   FKPAVLAKGKSYYKNGQISWLEHNADFSVVDSTVQGDKGIAFNQRIEISKLPTGYSVDT
FT                   HCTCNVKTKCRHLAAILLKLKIEHSGEYGEDYFINDWFSELSALKNTDQAQPSQVLLFV
FT                   LDIENNKVFLTPKIANYDKNNNYALGRNLTEQQLNSFVTPSDLLESDFRLYSWIRSQNA
FT                   VGNIELKGQWGFNALQQLLATDRLFLQRSRVPIKAQPGLPLNFVWEKQKEVTQLKIHLD
FT                   QIPNWALIKTTPPIYLDLDKYKLGRIRTPLSADEIAHLQTIPALHDTNFDRIYKQLADN
FT                   FGVGVIPHPTNTPSTPVKSLSNAILKVSMSGSVMAISLSFKYKNKNYLAGTAPAKLINS
FT                   AFENTVTNELVNLGFDFCKGGLHSEFIFSQESAIHLHWLVHEVLPSFKQRGWQVSMSKV
FT                   NVADTKSQISLHVNRAANHQMHSKVMLNDTKVATLLNVNNKLYESLNRQSELFYYYPVG
FT                   RQFGVIDKAAFNLLIEFKLRFEFIKTRDEFNIPLSYLPELVQHTAINVELHDPSLERYL
FT                   DELNNDALLSPNTAIHGLHDSVVLREYQQEGVAWLNFLKRNQLGGILADDMGLGKTLQV
FT                   IAYLASSYNTPQAGPTLIVCPTSLVSNWQNEITKFAKSLKVTTIFGAHRNDSLQHLAQA
FT                   QCILTTYPLLKRDIAYYSPLYFENIILDEAQYIKNDTAQVSRLVKRLNADFKLCLSGTP
FT                   IENNLFELKSLLDFAMPSLLGSQAHFKQHFQGPIERESNIERAEQLKALIMPFILRRTK
FT                   AQVAQELPQKTELIKEFEFEPKQKDMYHGITRALEEKLIDLFAEQGVQKSKLAFLEALL
FT                   KLRQICCHPKLIEPETEAASAKLEWLSSHLPLMLSLGRKVIIFSQFTSALDLIAERLNE
FT                   LNINFSMLTGQTRHRDKVIDEFTSGNTSVFLISLKAGGTGLNLTQADTVIHFDPWWNPA
FT                   VEKQATDRAYRIGQTNPVFVYKLIMANSIEQKVFQMQQDKQALVDALFTEKSMSFTQFD
FT                   EQQMLSLIKS"
FT   gene            6555..8024
FT                   /locus_tag="PSM_B0005"
FT   CDS_pept        6555..8024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0005"
FT                   /product="DNA recombination protein rmuC"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70045"
FT                   /protein_id="ADT70045.1"
FT                   /translation="MFTSFLSHLDWLSVGTGAIAGMAIFSVVSVQLSKKIKRQVSEQQQ
FT                   ELLLLQSQYEHTQNQYASLVEEHDLLGLTHQEQRDQAQHFKTRLTEQEKQSQLYNQYWR
FT                   KTEAELTALREQYNLRDVELNNIRTTLEQKQQHFSEQLAHIEQSKETLKKEFENLANQI
FT                   LEEKSQKFKTLNQESIEQLLKPVQGELKGFRDKMESIHVEDLKQRAALKTELLHLQAKS
FT                   QAITEQADKLSNALQGQKKTQGNWGELMLENVLDSAGLRAGTDYKREVSFNTEDGRLRP
FT                   DVVVYLPQGRHLVIDAKTSLNAYTRYVNAETELESQQAIKEHVNAVTSRINELASKSYD
FT                   RLPGINSPEVVIMFVPIESAFVEALKYQSDIYQQAIEKNILVATPTTLLTSLNIVKQLW
FT                   RFEEQTKYSKELANRAERFYSKLNGFLTSMEGVGKQLDKAKETYDKAFSQLYRGKGNLI
FT                   KQASEFKELGVSVQKELPQESVERAHLELDE"
FT   gene            8129..8926
FT                   /locus_tag="PSM_B0006"
FT   CDS_pept        8129..8926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0006"
FT                   /product="LigB family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70046"
FT                   /protein_id="ADT70046.1"
FT                   /translation="MQRPTVFFISHGGGPMPLLGDANHAEMRACLEQVAATIPKPSAIL
FT                   MVSAHWEAQPISITAHSSPPLIYDYYGFPEQAYQLTYPCTGQPQLANLVQQALATHNID
FT                   SKLDPQRGFDHGMFVPLKIMYPEADIPCVQISLHPSLDPLLHVEIGKVLQRIDYDNLLI
FT                   IGSGFTFHNMRAFGVTQSSDVNQQNQAFENWLVSTIADQTLTEQQREQQLLAWQQAPAA
FT                   RFNHPREEHLLPLHVCYGAAMCSSTEVFELNIANKRASMYLWQ"
FT   gene            complement(8999..9895)
FT                   /locus_tag="PSM_B0007"
FT   CDS_pept        complement(8999..9895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70047"
FT                   /protein_id="ADT70047.1"
FT                   /translation="MLALTTNDENTMNLRTLLLSTLLASNIAIADETPLTLDVYNADSN
FT                   SFHVNATLVYGRTDAILIDTGFTKADALRIAAKVIDSGKQLKTIFISQADPDYYFGAEV
FT                   LQQFFPDAKIITTPAVHQKIAAKLKGKLAFWTPKMGENAPKDPVVPKVFNGNSLKIEGH
FT                   TIEIRGTEGEHNHRPYLWIPDNKAILGNVAVYANVHLWMADAQTQAEQDAWAKQLNEMK
FT                   ALKPDVVIPGHMKAGTQLDAANIDFSIQYLKDFAHAKQSSGSSKLLIDKMTNSYPEAVL
FT                   PMALSIGAKVHKGEMKW"
FT   gene            9967..10854
FT                   /locus_tag="PSM_B0008"
FT   CDS_pept        9967..10854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0008"
FT                   /product="putative LysR-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70048"
FT                   /protein_id="ADT70048.1"
FT                   /translation="MDKLTAAQVFVDVAYSGSFTATADRLEMSRPMVTRHIESAEAWLN
FT                   TRLLHRTTRKVTLTTAGEACLPEIEQWLAQANRLVEQTKSQQQLSGKIRVATSMSLGFA
FT                   QLAPIFTRFMKRHPSVQIDIDLEDSTTDLIEQRVDLAIRIAANPDPSLIGKPIAECESI
FT                   LVASASYLADYPPITTPQQLSTHQCLGYKNFDRYIWHLHNGDEFQSVDVKCNLSANEAT
FT                   TLLHAAIAGGGISVQPTYLANQYILDGRLQRVLAPWTLNPMKIYVLYPSRQHLSATVRA
FT                   LIDTLSEEFKNPAW"
FT   gene            10989..13325
FT                   /locus_tag="PSM_B0009"
FT   CDS_pept        10989..13325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0009"
FT                   /product="dipeptidyl-peptidase IV"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70049"
FT                   /protein_id="ADT70049.1"
FT                   /translation="MNLIKTSGLALAIVAGLGLQACSSTNITTNNNAAMSTVNNPLSLA
FT                   QIYKDKEFKTQRSTYFKWLDDGTGYTVLEERESDKKQTDDTQADDEKEHGVKGNDIVFY
FT                   NADGTGRKVLVEFEKLLPEGADEPFAIESYQWSKDGKWLMVFTNSEQVWRSRSRGDFWL
FT                   LNLETNQLQQLGGKDVEPTKLMFAKFSPDSSKVAYVRDNNIYMQSVGSNDVTALTTDGC
FT                   ATIVNGNFDWVYEEEFTIADGFRWSPDNKSIAYWQLDTSDVKFFTMINNTDELYPTLKE
FT                   FPYPKAGETNSAVRVGVVSLSDKQTRWAELEGDNRDRYIPRISWAGTGNELMIQDLNRP
FT                   QSHNKVWLFDWQKQQLTKILEDKDDAFIEWFYKANWSKDGEFFIWHSERDGWRHLYRVS
FT                   RDGKTIIDLTPGDYDIIDMLTINEDKNVMYFIASPNDPGQRYLYSTPLDGSSKPVRVTP
FT                   AEFEGSNSYYMSKDASWAMHTYSKFGTPPTKEIIKVSDHSNVKTLVENTKLKQKLAEQS
FT                   LPKHEFFKVNAQDGTELDGYIMFPENMDKSKKYPIVFYVYGEPWGSTVQDRWEGNSYLY
FT                   KSLLTQKGFIVASVDNRGTRAPKGRDWRKSIYKKIGSITVQDQVDALDAMAKRWDVIDT
FT                   DRVGVWGHSGGGSSTLNLLFRHGDKFKVGIASAPVPDIRLYDTIYQERYAGNPNTDPES
FT                   YDNTSPITFAKNLTGKLLLIHGTGDDNVHYQGSERLIDELVKHNKQFEFFSYPNRSHSL
FT                   REGKGTTLHYHTMMADFFEKHLLNK"
FT   gene            complement(13495..14469)
FT                   /locus_tag="PSM_B0010"
FT   CDS_pept        complement(13495..14469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0010"
FT                   /product="Probable lysophospholipase, alpha/beta hydrolase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70050"
FT                   /protein_id="ADT70050.1"
FT                   /translation="MENFTKLLAITLYIFSLSGCTSIGSYVMSNPGIYLSEAQFIKAKP
FT                   SDIGFEKQKFCSFSTTQCITYLTAEPYQAAEFSQESSVYYNLHATGNNVENTISHRMTP
FT                   DTFNRFEGTALLLHGYGGSKEAMMASAIYFRALGMNVIIPDLFGHGESTEAFVFAAKEH
FT                   GILNELLAESLLNQINNQTVVVGHSMGALTASNLLSSEYVDAAILLAPMMSFDVAAKEY
FT                   LPYKSPLLSHFFHSEIDNIVNQAMFEAGVTIQETNLLPKLTETKKPVLLINSDVDSLSP
FT                   PAYFSSIQNELVKKITFNARSHSSLMVFDRDDAIEIEKWLITW"
FT   gene            complement(14964..15275)
FT                   /locus_tag="PSM_B0011"
FT   CDS_pept        complement(14964..15275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70051"
FT                   /protein_id="ADT70051.1"
FT                   /translation="MKLKLTVKNKIINASEKMSLLKLIKSQLAKHALNIRKVEIQINDL
FT                   SSDRHGTLQQCKINILLPGLPSINVNTKGRSMLQAIKRALKSLQHILVNKYQPSQPSS"
FT   gene            15385..16278
FT                   /locus_tag="PSM_B0012"
FT   CDS_pept        15385..16278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0012"
FT                   /product="regulatory protein, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70052"
FT                   /protein_id="ADT70052.1"
FT                   /translation="MITNINYNHLYYFWQVSKHGSIAAASKILNLTPQTVSSQITNLEQ
FT                   RLGKPLFIRQGRGLQLTEFGHVTQQYTNDMFAIAHEWLETTQGDTTHYSRTLKVGISDV
FT                   LPKSLVSKWLAPLINNDRITNLHCIDGQQDELLAQMAIHKLDLVLADKPLDTTLPFKAF
FT                   CHEIGKSQIALFGNETWHSQLHKQFPQSLNNKPLVLPAKESPVARAIYYWLQEQEIEMT
FT                   IAGHVDDSALMKSLGEQGFGIFPAPILVRAEVERHYGVNYIGTIDNVYQHYYAFTPDRL
FT                   IKDSIYDEFIKHAQMT"
FT   gene            complement(16348..16722)
FT                   /locus_tag="PSM_B0013"
FT   CDS_pept        complement(16348..16722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70053"
FT                   /protein_id="ADT70053.1"
FT                   /translation="MKIVKLRDKVDKTILSVALFFLISPIIGLITGTAHQLGTTGSDYQ
FT                   QASLIDDPEQYWQIIIMQLTITLAIGIQGFITFPALIAARQKILKFRDNNKIVANIIFY
FT                   LLTPIFFIALLIFLIYLFEV"
FT   gene            complement(16788..17597)
FT                   /locus_tag="PSM_B0014"
FT   CDS_pept        complement(16788..17597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70054"
FT                   /protein_id="ADT70054.1"
FT                   /translation="MSDLIVLIIYCAILGSGVGFLAGLLGIGGGLVIVPILSMILLHFN
FT                   ALPPEQVVVVAIATSLASILFTSTSSAIAHHKNGNVPWNIAPWVMVGVAFGALISGFMA
FT                   ALLPEHVVRLVFAVSVVLIALKMIFSGKNDSAIARPLPNKGLLSVYTTITGGLSAMIGI
FT                   GGGAVLVPLLTFFSVDMKKAIGCASASGIVIALFGSLGYISSGSQLFSLKQGFAGFVYL
FT                   PALLGIVCTSWFTAPLGAKATHYLPVSTIKKIFAGLLIVMAINMFTR"
FT   gene            18061..19035
FT                   /locus_tag="PSM_B0015"
FT   CDS_pept        18061..19035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70055"
FT                   /protein_id="ADT70055.1"
FT                   /translation="MSTDLTFTIKSTNLDENYHPSNNTRITTNFANLARGESRQQNLRN
FT                   TLKMINNRFNALASWDNPQGDRYEVELEIISVDLDIAGSGQAFPSIEVLKTNIIDRQTN
FT                   ERIEGMVGNNFSSYVRDYDFSVLLLEHNKSKPQFSIPDNFGDLHGKLFKCFVNSDTYKQ
FT                   HFKKPPVICLSVSDNKTYQQTENLHPILGVEYQPNESSLTEQYFKKMGLQVRYFMPPNS
FT                   VAPLAFYFFGDLLNDYSNLELISTISTMETFQKIYRPEIYNANAAAGSRYKPNLKNDDH
FT                   SLTQIVYDRAERGQLAVEQGKFTEQHFIKPYQSVLQQFSASIA"
FT   gene            19067..20107
FT                   /locus_tag="PSM_B0016"
FT   CDS_pept        19067..20107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0016"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70056"
FT                   /protein_id="ADT70056.1"
FT                   /translation="MKKLLPTSSAGSLPKPSWLAEPETLWSPWKLKGSELIDGKHDALR
FT                   ISLHEQQTAGVDIVSDGEQTRQHFVTTFIEHLNGVDFENRKTVKIRDRYDASVPTVVGP
FT                   VSRTKSVFVEDAKFLRQQTNQPIKWALPGPMTMIDTLYDDHYKSREKLAWEFAKILNQE
FT                   AKELEAAGVDIIQFDEPAFNVFFDEVNDWGIACLERAIEGLKCETAVHICYGYGIKANT
FT                   DWKKTLGTEWRQYEEVFPKLQKSNIDIISLECQNSHVPIELLELVRGKKIMVGAIDVAT
FT                   NTIETPEEVAKTLREALKYVDADKLYPCTNCGMAPLPRDIANGKLNALSKGAELVRNEL
FT                   LAANVA"
FT   gene            complement(20475..21527)
FT                   /locus_tag="PSM_B0017"
FT   CDS_pept        complement(20475..21527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70057"
FT                   /protein_id="ADT70057.1"
FT                   /translation="MEVVMIEDVEGYKSYLRDVRGLVEGTVNSYPTYLSAITNHLHIDI
FT                   TADSVYSSESVKDILRRLKASLKEKNYWGNCQSALKAYLEFLEFKTRAASPLNSNEERL
FT                   LNYLVSHIQSGAIDTNNPMTHLPYSKVLNDLEFPNDGRTPGYSLNKHAMGGLAEWLHNN
FT                   KLPAVTGIIINNKNHPDRALFPSKSYFEFHKKQDMDFAWQRHQIKIACELDWGSELASR
FT                   GVYLLDNFSFAEEVNELLKEGARKTITVNAYERNPEARNLCIKEYGTRCCVCDFSFVEF
FT                   YGKRGEGYIHVHHLTPVSEIKSEYDINPIRDLRPVCPNCHAMLHRKGNISIEELVGEIS
FT                   FNKALKRASR"
FT   gene            complement(21591..21923)
FT                   /locus_tag="PSM_B0018"
FT   CDS_pept        complement(21591..21923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70058"
FT                   /protein_id="ADT70058.1"
FT                   /translation="MEIEEIHRNVGQELIEITEDKLKLLLAEHLSSIESRNTWHTPLAL
FT                   LITIVLVLTTTQFKESLSIAADTWAAIFIISAGLCVFWLGKALWERPKKSTVQELINKI
FT                   KNKQSA"
FT   gene            22638..22826
FT                   /locus_tag="PSM_B0019"
FT   CDS_pept        22638..22826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0019"
FT                   /product="transposase (IS492)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70059"
FT                   /protein_id="ADT70059.1"
FT                   /translation="MNTKNNQNEINVGVDTGKKQLDIYIRPLDIYFTVENNQSGIKHAI
FT                   QILKKHPVTRVTIEATG"
FT   gene            23278..23955
FT                   /locus_tag="PSM_B0020"
FT   CDS_pept        23278..23955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0020"
FT                   /product="L-2-haloalkanoic acid dehalogenase, HAD
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70060"
FT                   /protein_id="ADT70060.1"
FT                   /translation="MATTLAFDVYGTLINTHGVVSLLENMVGDNAHAFSTTWREKQLEY
FT                   SFRRGLMQNYVPFSVCTEQALNYACLLHKVTLSDEQKAQLLARYKTLPAFDDVKAGLES
FT                   LKAQNYRLFAFSNGAASAVNTLLETAGISDYFEGVVSADDIKTFKPNPGVYSHFLHEAH
FT                   STGANTWLISSNPFDVIGALSHGMRAAWIQRSSEAIFDPWELTPTITACDLHDLKTKLA
FT                   SNK"
FT   gene            complement(24030..24479)
FT                   /locus_tag="PSM_B0021"
FT   CDS_pept        complement(24030..24479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70061"
FT                   /protein_id="ADT70061.1"
FT                   /translation="MEVKQLASQTLIGLKVRTCNANEMNAGTANIAELWQKFGEKFANS
FT                   LTENTKVYGVYTNYESDLTGDFDVIACCDNLSIKLPEAKKVTTQAGRYLVFKGEGEMPD
FT                   AVIDLWGEIWQYFSSDDCRYARTYTSDFEYYKSSNEIEIAIAIED"
FT   gene            24862..26400
FT                   /locus_tag="PSM_B0022"
FT   CDS_pept        24862..26400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0022"
FT                   /product="putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70062"
FT                   /protein_id="ADT70062.1"
FT                   /translation="MSQSQVLNINTIEKQAVFEQSGLPPQFNLEQFINYQIASLQGLSA
FT                   VQQAMAKAQKPFSGVSVNALAEVVNDVDLSQPLADFPAVLEELKGVYLDHAVYFHHPRY
FT                   MAHLNCPVTYPAVVAEHIIAAINTSVDTWDQSAGATLIEQKLIDWTCQKAALPSTADGV
FT                   FTSGGTQSNLMAMLVAREVAVSRYAPEHQVKLQGLPAVASRFKIYCSEVAHFSIQKAAA
FT                   LLGLGYNAVVPVATNSKMQMDMQALKTAIATSKAQGDLPIAVVITAGTTDFGSIDPIHN
FT                   IAMLAKEEQLWCHVDGAYGGGLLVSEHHRNALNGIELVDSITIDYHKSFMQPVSCSAFL
FT                   LSDKRHFSHITLYADYLNPLAEAGNGTPNLVDKSLQTTRRFDALKLWLTLRTTGEAPLG
FT                   RAFDKVIGLARQTHIVLNDHPDFEVVNYPELSALVFRFAPDDLKHDLDLLDSLNLHVRQ
FT                   TFLQTGEAMVARTKINGRHYLKFTLLNAQCQLSDVRAVIEQISHIAWQTYREIA"
FT   gene            26400..27719
FT                   /locus_tag="PSM_B0023"
FT   CDS_pept        26400..27719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0023"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /EC_number="1.14.13.59"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70063"
FT                   /protein_id="ADT70063.1"
FT                   /translation="MDNQPYDFIAIGLGPFNLSLACLSEPLEDVKSLFLEQRSEFDWHP
FT                   GMMLEGVTLQTPFMSDLVTMADPTSQYSFLNYAKLNNRLYPFYIRESFFLLRREYNLYC
FT                   QWVCSQLSNVNFEQTVTQVEFCAQSECYTVSCNTPNGTQHYVTRHIVLGTGPAPYIPDC
FT                   AVQSNSNNVMHSSDFCHRLDELKAAKRVTVVGAGQSAAEIYHTLLQQAVPQGLQLDWIA
FT                   RSPRYFPLEYTKLTLEMTSPEYVDYFYNLKTEQRDWLNQNQKNLFKGINGDLINDIFDT
FT                   LYAQSLDGPISTTFKTNSKLTITQKVGKRLLTEFYHQELEQPFSIETDFLICATGFKYQ
FT                   RPAFLNNIAHQLPQDEQGRYLVSREYAVDSEQKRIFVQNAEQHTHGFVTPDLGMACYRN
FT                   SIILREILGYSPYQVEQKIAFQNFDLSDVTLSAQQQSSAA"
FT   gene            27716..28894
FT                   /locus_tag="PSM_B0024"
FT   CDS_pept        27716..28894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70064"
FT                   /protein_id="ADT70064.1"
FT                   /translation="MSLRLALILLTVISVVCDTLLLPFYPQFFASEFAISNATLIGLFV
FT                   ANCCITVMLALPLWAKVAKKYNELALWLVTQVVAAGFGLLCYFATNVWEFWIYYQLMLV
FT                   LKASYLLIYPFALRLEQQTKHLSIIGLFSVLMHFGAIGGALIGGYFFSLAEPRYALLLS
FT                   SAGDLVQVLLCAYLMYSLKTGIYQQAIATEKPRERIPYFIWQFCFLSVVVYFSAFLIRP
FT                   FFTTHWQALNAQSSTLQSAVVYAIPAFAALVMLVFNHYRQHLPLPTLSRTSTLLCALIL
FT                   GALGLYLQAQASVGLVILSRVLYGFALFQVMVLLEVMLFAKSEPAHYGSDFAKVHIAQN
FT                   VGVILASLLVGMSVEHLSTTVVFYFAAIGFASLAFILLWRFKAVARAARSAS"
FT   gene            28919..31267
FT                   /locus_tag="PSM_B0025"
FT   CDS_pept        28919..31267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70065"
FT                   /protein_id="ADT70065.1"
FT                   /translation="MYFSSFVTTLQHTGKVTMRLLQQTDMPTICDWLKQPYAHFWGMQQ
FT                   QTEQQITKVYQAIIDTPHHQAYVIEQNNNLLALVELYSPEHESLMKAAYEVEPNDVGMH
FT                   ILLAPNTAPKRHFSFEMMQCVLQSIFAQNSAARVVVEPDIANSKIHTLNKRLGFVHTQQ
FT                   IQLGEKAAYLGFCNKAAFDRHSQLFTDSLAPLQTDYVIQPHWQWANRHLQAKALTELVH
FT                   ERLLAAETTKRGFKVNVEGGYFIFNGRAMALNHIDIDEPSLCFYNLNEELQPLDVLHFF
FT                   SMQGPALGLTGKRLATYIEELNATLASACFKRENNTLTAAQLANLGLQKIEAAMSEGHP
FT                   AFVANNGRIGFSKADFLRYAPEVGKPFKVLWLAAHKAVCDFAHSEYFADYPSHISDELD
FT                   LTTRDAFNKALKAQNLNPDDYLLIPAHPWQYQHKLSVVFANELANQRLVYLGEGDDLYQ
FT                   AQQSIRTLYNCSHPHKPYLKVALSILNMGFMRGLSRAYMAVTPAINDWVFEKVSQDQQL
FT                   AGANFTALREYATLGYAHHTFEQHALGDTPYRKMFACLWRENPNHNLNSDEQLTTMAAL
FT                   LHLDNNGQSLVGEWIAQSGLSTQQWLHEYFNAYLIPLVHCFYAHKLVFMPHGENLILKL
FT                   KNSVPVGAYMKDIGEEVALLNSTEVLPAGVERIHFSMPKELELLSIFTDVFDCFFRYLV
FT                   AILVREERITEHDFWQCVTQSVKAYQHANPALNERFKEYDFFSDEFAHSCLNRLQLGNN
FT                   EQMVDLTDPAGSLQFAGNLNNPVSAKLYG"
FT   gene            31260..31898
FT                   /locus_tag="PSM_B0026"
FT   CDS_pept        31260..31898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70066"
FT                   /protein_id="ADT70066.1"
FT                   /translation="MAKPITLAQFLYCHQPVQRTFKPSLLLVRALTVRCKAQYPTAPKQ
FT                   FISRHLYLQLCWQAIYAYCYWFACKQSTADPINMPLALNGAYCRGFNLNNGVLVSKTEQ
FT                   IQAFTHFISQVGEWVNTDYALGKKEQARLLLDSLSSATERAHSLALATTLHINNCHRQL
FT                   HTLICEHFNLDALFTENPQRLTCCRYYLAGYSKCQTCPKKDIKTNEPTS"
FT   gene            31882..32961
FT                   /locus_tag="PSM_B0027"
FT   CDS_pept        31882..32961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70067"
FT                   /protein_id="ADT70067.1"
FT                   /translation="MNQRLKTIDLARGASVFIMIIVHTLWMYATTALQSESAFGTVVHI
FT                   LGKGTASFLVAMGLSMALSRRQTPLLLIKRGIQLLLLAYLMNAAKFWLPIEVFNTMPEA
FT                   FINAYGWQSPLSAGQLQFMVLTGDILQLAGVSLLLFGVLNIARWKTIWIAVLAIAIAVM
FT                   SQFVRGQQFTLSPYISDLFFASNYQVYFPVFPWVSAILTGYVLGRLYLSNQQNADYLYK
FT                   VCAQLGAALLVIGGIWLAIDFKGQFGNFFHLNGGGISYLVGLNLCALAAIQYIFADKYN
FT                   GPITRALLYASKHVTALYVIQWVLICWFMGALGYHTLSLWPTLCMMVLMTLLTFAVHKV
FT                   YLKSKQSLTNITQKTKRTA"
FT   gene            complement(32999..33865)
FT                   /locus_tag="PSM_B0028"
FT   CDS_pept        complement(32999..33865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0028"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70068"
FT                   /protein_id="ADT70068.1"
FT                   /translation="MINPTWLNTFCTLVEVNHFTQTAERLYMTQSGVSQHIKKLEQQVD
FT                   CALLERHGKQFTLTVQGQNLYQQGSQLLKEWQFLEQQLKDDSPYSGLVKIQSPGSCGLQ
FT                   FYNQLLALQVEHKELIIDYRFAPNTSVEQAVANHSADIGFLTQAPTLSEVTSHKIGQEP
FT                   LLLVTPAAIKSPTWSALNELGFISHPDAKHHAQLLLSENYSEFEHVDQIKQTGFSNQIS
FT                   LILEPVSLGLGFTVLPAHAVSAFNKPALIKTHHLTKPISENIYVCHHRNRPLAKRMHSV
FT                   INAIKAG"
FT   gene            33970..34470
FT                   /locus_tag="PSM_B0029"
FT   CDS_pept        33970..34470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0029"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70069"
FT                   /protein_id="ADT70069.1"
FT                   /translation="MSHTYPRSFSHIGISVPDVEKAVEFYTKVMGWYTIMEPTVITEDN
FT                   SPIGEMCTDVFGPNWEKFKIAHLSTGDRIGVEIFEFKDQENPKDNFEYWKTGIFHFCVQ
FT                   DPDVEGLADRIVAAGGKKRMPEPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELIYSA
FT                   GAY"
FT   gene            complement(34680..35288)
FT                   /locus_tag="PSM_B0030"
FT   CDS_pept        complement(34680..35288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70070"
FT                   /protein_id="ADT70070.1"
FT                   /translation="MDTSSNNSSLIIFLISACLLLPFLESMHGGALWGLNWHSPRLMDT
FT                   LSHNLLYIKLVLVITGLILLFTKPKKIKSIIKNKIAQWLFYIILTLVGVIQIPFLCLGI
FT                   LVNGSSLSTPDYIHKQNTFTDRTIYIYTADPGAMGKAYHYAYLNCPLAFGRYELKRIAK
FT                   LNWMREYTFYIEKNNLIVIDKNSDGLTHTFDMSDVTCSS"
FT   gene            complement(35548..37623)
FT                   /locus_tag="PSM_B0031"
FT   CDS_pept        complement(35548..37623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0031"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70071"
FT                   /protein_id="ADT70071.1"
FT                   /translation="MKYSLIYLACLSASAQSIAQSQPIEKIAVTYKQAYRGDIPQKQMP
FT                   QSIETLDNAVLDQKGITQLQDALDFSASISRKNNSGALWDSFSIRGLSGNENMPSGYLI
FT                   NGFSGGRGFSGPRDVSNIEYIEVLKGPGSALYGRSEPGGTVNIVTKKPQFEQQGELKLS
FT                   LGSDNFNRVEGDYTNGINDNTAFRINGAWQDSDSYRDEVYTHKKVVTPSIYHQINASTS
FT                   ITYEFEYVDLAQLFDRGVVVLNDNFNTVPSSRYLGNPNDGDTQVYSRGHQVTLNHDINN
FT                   EWSLVVGANYRSSTLTGFSSDAELAPSRQSLFDDGRTLTRQQRYRDYEVDDTSLKFELS
FT                   GHFDTAGITHHLLIGADAYKYDLRTGLYRYRGGNGTYTVDIYQPNYNVARPEVGLLYEN
FT                   NEQQDAYGIYVQDQMDLTDKIKLLVGLRFDSVDQDILETKSGVLSSSSQSQVSPRVGLV
FT                   YELNNAVTLYSSYSEGFLPLSGTDANGDPFGFEYSDSFEVGAKFSYQGITGTLALFDAT
FT                   KSNMLVADPVNVGFSAPIGKANSKGVELDLSTYITDDTKFNLSYAYIDASTANDIINAD
FT                   WGVPIKKGSPLVNVPKNNLNLTLSHQTALLGKELELGASYQYTSERLGDAADLTFNLPS
FT                   YQLVGIFGQVNLTERTKLNISVNNIFDEEYAQSSYNALWVYPGAPTQFKMSLAYQF"
FT   gene            37786..38412
FT                   /locus_tag="PSM_B0032"
FT   CDS_pept        37786..38412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70072"
FT                   /protein_id="ADT70072.1"
FT                   /translation="MLTKTNALIYFLAFSSGFSIMGIELLGGRILAPYFGSSVHIWGSI
FT                   ITVFMLSLSFGYLLGGKLSIRHPSLTKYGLIFLVASIMVVPIALFAEPIMAFIFSHIED
FT                   SRYGSLLASTALFFIPTIILGMISPYSVRLLVTNSERSGQVAGGLYFVSTLGSALGTII
FT                   TSFYMVLAFDVNTIILGFAGVLGTLGLIAISFDKLKVREVVYAQA"
FT   gene            38432..39295
FT                   /locus_tag="PSM_B0033"
FT   CDS_pept        38432..39295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0033"
FT                   /product="putative spermine/spermidine synthase protein"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70073"
FT                   /protein_id="ADT70073.1"
FT                   /translation="MALLFSAHSMSNVVHKERSLYRNLLVEETGDLRCLKFDEKTRQSS
FT                   QSCMYISDPKKLVFNYTKLAFSSLLLIDNPKNVLIIGLGGGTLSNMIHELYPKAHIENV
FT                   EIDPSVIKVARDYFNFIETDNVTTKVQDGRIFIKRAALKSQQFDWIILDAFNGDYIPEH
FT                   LLTKEFFEEIKSVLAEGGIVAANTFSSSKLYEHESATYHAVFGDFINVTANNNSNRIIL
FT                   AGYNKTPTEQQIALRVKQLAPLLAPYDVDIEAISQRMFFTKDGKDWPSDTKVLTDQYSP
FT                   ANLLNF"
FT   gene            39373..40086
FT                   /locus_tag="PSM_B0034"
FT   CDS_pept        39373..40086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0034"
FT                   /product="glutamine amidotransferase"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70074"
FT                   /protein_id="ADT70074.1"
FT                   /translation="MHIHFIIHEHFEAPGAYEAWAKMNGHTLSYTRIYLAEPLPQHTDD
FT                   IDFLIVMGGPQSPATSLAECPYFDSKKEQAFIASAITANKVVLGVCLGSQLIGEALGAT
FT                   YQPSPEKEIGKFAITLTDAGLNHPLFSHFGSEFNVGHWHNDMPGLTATASIIAYSEGCP
FT                   RQIVAYSDLVFGFQCHMELTTEVVTLLIANDDLTNAHNYRFVEQPEKLLSHDYNEMNNK
FT                   LYTFLDKLAVHYLSK"
FT   gene            40177..40653
FT                   /locus_tag="PSM_B0035"
FT   CDS_pept        40177..40653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0035"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70075"
FT                   /protein_id="ADT70075.1"
FT                   /translation="MSSTIPFHETLDLTLCGNMGRVHRLCREAVTLAVEPLGLTQSRWT
FT                   AMIHLHHLPLGATQQALATSLGIEMPSLTRTIKQLEQQNLVIRQVDEHDKRSKKLYFTD
FT                   EGIKLLEHLKELTSDIKQRLYAGLSTEQLDGMAHSLVQMEENARRCIASLSGDK"
FT   gene            40656..41720
FT                   /locus_tag="PSM_B0036"
FT   CDS_pept        40656..41720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0036"
FT                   /product="putative efflux pump or secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70076"
FT                   /protein_id="ADT70076.1"
FT                   /translation="MTPDQKFARYVKVSLVGFIVVFFYYIVADVWLPVTPQARVYHPVV
FT                   QISPQINGRVTDVLVSNNQAVKAGDVLFEIDKNTYQLALEQAQLALDDAKLQNKRLDTN
FT                   VKALEAQISAANAKLHEQQLLKKRGETLYKQNSISEQELESIRANFAASQSNLAAFEAQ
FT                   LAEAVLARGDSGQNNLALRHAANQLAQAELNLSYTQVRALSDGVVANLQLLEGSYAVAG
FT                   KPLLAIVAKKADLVADFREKSLSNMQPGSLAKVVFDSRPGEVFDAKIETFEAGVSDGQL
FT                   SANGLLSTTETSNRWVRDAQRQRIHLVLPNNTQLINNMPSGARATVQLLPQSAIGQWLG
FT                   SVQIRFISWLHYIY"
FT   gene            41732..42781
FT                   /locus_tag="PSM_B0037"
FT   CDS_pept        41732..42781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70077"
FT                   /protein_id="ADT70077.1"
FT                   /translation="MTQHVSQAPQLDSNGLRQALRIAGGCTIGFTLCKLMNWPNGIFFT
FT                   VYPMLLLGLVPSINKGVIRQFVASAAYSAFIVLILQGLFSHLPVLMTLIIFASFCILFY
FT                   LMSSGGAFLFGALGAVSLSIQLHFASHVDQGSSIYPLILSNGMAIFITIIIALLMHGLF
FT                   PDVTARPMRAVPHKDKESIRHEVLLCASVATLSFVVFQVLDLQDSISAQAASILILFSL
FT                   CFKAAGTASWQRIIGTLIGCNAALVAQLFLYNHTDVLLFPVAILWILSFIFSRFHILGG
FT                   GPPGVGFGVLTTFGILFGQSLGPGQDLIYSAMYRFSSVAVAVTVSLSAVYVVHRILNRF
FT                   SVTRHHTYD"
FT   gene            complement(42840..43253)
FT                   /locus_tag="PSM_B0038"
FT   CDS_pept        complement(42840..43253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70078"
FT                   /protein_id="ADT70078.1"
FT                   /translation="MLTISNTVTIDEWEVELSAIRSQGAGGQNVNKVASAIHLRFDINR
FT                   SKLPDFYKERLLALKDSRITKEGVLIIKAQSHRTQELNREDALKRLKDLILSATKVNKA
FT                   RRATKPSRNSQRKRMDKKTKHGQTKALRGNIKL"
FT   gene            43417..43746
FT                   /locus_tag="PSM_B0039"
FT   CDS_pept        43417..43746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70079"
FT                   /protein_id="ADT70079.1"
FT                   /translation="MKQISILMFLVCMLAISYAVYAKSSQTFSAGVIAQEQVYPIKVLA
FT                   LGDFQRCFVVAAQKEDALYSACYIKKSAQSIWVAESAGARCEIKCESHLNSDGKTQAQY
FT                   FTTDL"
FT   gene            complement(43733..46909)
FT                   /locus_tag="PSM_B0040"
FT   CDS_pept        complement(43733..46909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70080"
FT                   /protein_id="ADT70080.1"
FT                   /translation="MLLCTLLLIVPKAIIAKQLPTLYQWPIDEESFVIINVRVNGRSVV
FT                   SDLEAYYSKSNKLLLPISGLKSTMGISLNVSQNTLSANVDSSEQVLNAELSSTLAPSEN
FT                   VSLWAVDDYDHYVDLSVINTLLNTDSRFDYSLMQVSFSSNLLTYNNNQVTSGITKKIKS
FT                   KALQYDHFIDDQYQALTYPVSEYSLSASYKSSNNRYKGLLRLNSYFDLFHHRAELRFNK
FT                   NENTANTFLKITKDFNLSEQDHSLARIHYQLGDIQSQSDQLITSSNQGRGFYISNANPH
FT                   SAQNFSTITIEEPALPGWQAELHRNGQFIATTQANDENLVRFTDVETFYGNNIFEIKLF
FT                   GSQGEQITRTQKYTIGQDALSPGKISYQVEFLETDKSFFNQSSNSSTAMSNAFKSNLSY
FT                   GISEFITYDAQITHLQTEQNNSSYLSSGLNTLTDHGSYRFLATKQLDAGYAYFAGFRGL
FT                   LSNKLYNDINVNVEYSALNNFSSALFVAQENSLKNRLSLSLNGRTDFFNSLNWNMRWNN
FT                   EVRKNTNTKNRFSLGINKSYVAGTWSSQLFYDDDTNNLINRLYSSIDIASWKWTNTLDW
FT                   QANNGAELTRLRSSLRWPQTQSTFNQTQLTYQSNSAASTLLNHQYTYRHEIFNIQVSGQ
FT                   VDNQGDWRLSLGLNGTFSFDHLEADFNFDTPRSLNSGQIEVSSFIDWNENEIFDQGDEP
FT                   IQDVNFTGNYLWRDKYTNNDGKVLLPSSYGGQVLDVNLRSLSNPYLQPSLGKIKTLAHR
FT                   GGQTKVNIPLVVYNEVEGTIYLSSNEKSKPIAGLTVVLKEKDGEKHYSTVTEYDGYYYF
FT                   PNVSQGNYMLEIEKNEQLSENITIKNLPEQVITEKSGDTIILQDIIVYTNNADTLTEQA
FT                   TIAAESNQQTPYFVQLGVFKKFQSALTVANKIDKAAYALQLYKHERRDSYYLVAGPYNN
FT                   AAKAQQTINDVYSIPALHGSFMVDARRYASPQWRKIGEWSDMQTKNTETYFCQYGAYTS
FT                   KKSVNKKLLRENPSLFIAERAIKGKAHYLMLSGPHNAKQTACDTQVIKQIKGLTTAIKK
FT                   PWHSIFTINQ"
FT   gene            complement(46955..47800)
FT                   /locus_tag="PSM_B0041"
FT   CDS_pept        complement(46955..47800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70081"
FT                   /protein_id="ADT70081.1"
FT                   /translation="MRNCALKIKCVEQRAPLFIIMLLSCPMILKLFCWAALCLTLLLPE
FT                   ICSANLALSEYRLYFDGRTKNNSLLIRNTSNKNLDFKLVVTHKDMTEEGALIDVTPQQV
FT                   EGRSAKNMLRFSPRRGTIAPKGMQAIRMTVRKKAELAVGEYRAVLKIIASESQNPDIDG
FT                   ISIRPKVAYSVPVIVRHGQLEADSELINPQLITQNGRPTLTFWQTLTGNRSVYGNFELV
FT                   DENNVMIGEIVNVAVYTPLSRRKVYITLQAPVTGPVTLNYKENELYGGKIELAIPINIK
FT                   "
FT   gene            complement(47850..48359)
FT                   /locus_tag="PSM_B0042"
FT   CDS_pept        complement(47850..48359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70082"
FT                   /protein_id="ADT70082.1"
FT                   /translation="MNKKIFAASALLAISSTSLLASNQTFQASVNGWTEPTFAEDSPLH
FT                   FGKIRLSTSSTCTMDNAGAVSGDCDASDANIQLGGITVSGLAPNSAMNITVSGSTGTNL
FT                   TFAPVTTATDGTTSVTTADNVASAFTTDASATDITVSVYGDMTVDSTLTAGAAYTVDYT
FT                   VDVSFQ"
FT   gene            49373..49717
FT                   /locus_tag="PSM_B0043"
FT   CDS_pept        49373..49717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70083"
FT                   /protein_id="ADT70083.1"
FT                   /translation="MQATNRLLDFPKPVFSMLWQFMQRFSYELAVLSRFFIAIVGGYFF
FT                   TAVSVSLLSAVVPVPKVDAVLLSVSASILIYALVFIYSFYIHSLKTVWISILLSIAAQL
FT                   VVLSLLKEWL"
FT   gene            49714..51303
FT                   /locus_tag="PSM_B0044"
FT   CDS_pept        49714..51303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0044"
FT                   /product="putative uncharacterized iron-regulated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70084"
FT                   /protein_id="ADT70084.1"
FT                   /translation="MKGSFFRSMTWLHTWVGLLVCWLLYLIFFAGTISFFRDEVSLWNQ
FT                   PSVHNIEQQADRIGAQKQQIVSGVEYLNAQAPNAPNWRITLPEERIPYLTYGYAKPKEP
FT                   GQRRAQFENTRLNPNTMQPLAPFVDTRGGNFFYRLHFDLHYIDVKTARWIVCFASLFML
FT                   IALISGVVIHKRIFKDMFVFRANKGSRSWLDVHNLSSVFALPFHLMITYTGIITLIFMI
FT                   FPYPAQTVYEDGIRGFFNDVSPSSPATESLQGTAPLVPINTVLDQVYTKWPEADITRVI
FT                   INKPNKAAATIMVLVSPGKTLRDQAPRLIFSGASGELVAHTDDELTGSKALYESLNSMH
FT                   TGRLAEPLLRVLYFLGGIAGCIMIATGCIMWAKRIRERMKKNAQPSWGLKLVEALNLGT
FT                   LMGLPLATSAFFLANRLISTRAMERADKEILAFFLTWLCVLIIAFVKRDKLLWCVMAAI
FT                   NSIACFSVPVVNALTTQGNIISYLRNEQWALFMFDSLFLLFGLLFLLQTEKLRTALQAK
FT                   KPSPINTQEQKV"
FT   gene            51300..51641
FT                   /locus_tag="PSM_B0045"
FT   CDS_pept        51300..51641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70085"
FT                   /protein_id="ADT70085.1"
FT                   /translation="MIALLPFSLCLVAFNCFALAKFNHFKDVFNKRPTDQQRLILLSVA
FT                   WISILLSLLLCVSELHGYGALQFCGFMSLSALIIMIFYSFLVNLTKLFNLLVLLILATS
FT                   TLFFGLNGL"
FT   gene            complement(51848..52381)
FT                   /locus_tag="PSM_B0046"
FT   CDS_pept        complement(51848..52381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0046"
FT                   /product="outer membrane lipoprotein (lipocalin)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70086"
FT                   /protein_id="ADT70086.1"
FT                   /translation="MKLAFKTALFITTVFLLSACTSAPEGITPVKNFDLEKYQGKWYEI
FT                   ARLDHSFEQGMEQVTATYSINDDGTVKVLNKGFISKEQKWDEAEGLAKFVENADTGHFK
FT                   VSFFGPFYGAYIIFELDQPDYQYAFITSYSKNYLWFLSRKPTVSKELKQHFLSQVKALG
FT                   FATDEIIWVNQKSL"
FT   gene            52450..52905
FT                   /locus_tag="PSM_B0047"
FT   CDS_pept        52450..52905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70087"
FT                   /protein_id="ADT70087.1"
FT                   /translation="MKIWVDADACPVVIKEILFRAAERTQTETILVANHAMRIPPSKFI
FT                   SRLQVSSGFDVADDEIVKRIEKGDLVITGDIPLASEVIDNGGQALNPRGELYTTENIRS
FT                   LLNVRDFMDTMRSSGVEMSGGPPPLSQSDRQNFANNLDRILAQNKSS"
FT   gene            52907..53443
FT                   /locus_tag="PSM_B0048"
FT   CDS_pept        52907..53443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70088"
FT                   /protein_id="ADT70088.1"
FT                   /translation="MSSQLIGLGDDSFSVAVYVAKAPPMPYFETLAQLEPLVSGQINSI
FT                   NQHCGNGWRKVFNVYAKVLFALPSEYYSFAKQAVSWQAYRDELLLQQHSGTALLFSAPV
FT                   LTEHKNQLHIIAGRTHAKNLIQQGKLNAQLDWLDDEFAIDKSQNIIVCPYFDYRQLSNI
FT                   KIARLSELVAQLRII"
FT   gene            complement(53458..54102)
FT                   /locus_tag="PSM_B0049"
FT   CDS_pept        complement(53458..54102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0049"
FT                   /product="putative amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70089"
FT                   /protein_id="ADT70089.1"
FT                   /translation="MDINIIFSFWLVSILFVLTPGADWAYTISAGIAGDKIIPAVSGLI
FT                   LGHLMASLIVVIGLGALLASHAIFIKLLTLFGALYIIWIAVSLYRFPPMPAAYNDGQEH
FT                   TSDTPLKWMRKGFIISGLNPKVMLLFLALLPQFVLPTLSFSITEQLLVLSIIHLVGCAL
FT                   VYWLIGVSARKILSNNPALSLKFGRASACILFILGSLMLVDSANTLSVTLT"
FT   gene            54217..54669
FT                   /locus_tag="PSM_B0050"
FT   CDS_pept        54217..54669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0050"
FT                   /product="AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70090"
FT                   /protein_id="ADT70090.1"
FT                   /translation="MDTIDRKILAELQVDGRLTLSELADRVGLSVSPCHRRVKELEKSK
FT                   AIVGYRTEISPEKVGLNFSALVFITIKEGDKASLSKLEQAVDAIPQITNAQRLFGTPDY
FT                   LLHVVTKDLAAFQQLYDDKLSALPGVQRLTSTIVMKDIVRARNLHF"
FT   gene            54958..55167
FT                   /gene="cspX"
FT                   /locus_tag="PSM_B0051"
FT   CDS_pept        54958..55167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspX"
FT                   /locus_tag="PSM_B0051"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70091"
FT                   /protein_id="ADT70091.1"
FT                   /translation="MSNTTTGTVKFFNEAKGFGFIEQESGADVFAHFSAISGDGFKTLA
FT                   EGQRVQFTVTQGQKGPQAENIVCI"
FT   gene            complement(55269..55925)
FT                   /locus_tag="PSM_B0052"
FT   CDS_pept        complement(55269..55925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70092"
FT                   /protein_id="ADT70092.1"
FT                   /translation="MPTFTGEEAQEYDNRITRLVPGYELLHQLTNAQLQTTLSDDAHIL
FT                   VIGAGTGKEVLALAQINPKWQFTAQDTSSDMLDIAKQRFAEQGIDSRVTIECSPVDKVK
FT                   AKADAVLCLLVMHFVEDNGDKKQILKSIKTNLKKGANLYIADLMRPETTFERESQLNTC
FT                   AQLGLTEAGKTQMGHNLEREFYPLDRMRFSELLNECGFGIPKLYFKALGFSGYVV"
FT   gene            complement(55935..59585)
FT                   /locus_tag="PSM_B0053"
FT   CDS_pept        complement(55935..59585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0053"
FT                   /product="exonuclease sbcCD subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70093"
FT                   /protein_id="ADT70093.1"
FT                   /translation="MKITAVRIHNLASIADAEIDFLASPLKDAGLFAITGDTGAGKSTV
FT                   LDAICLALYTKTARLKGDKGNLIDFNGDNIKLNDARNLLRRGKWEGYAEVDFSGQDQQL
FT                   YRARYSIQRTHKKVTGKLKVAEHTLHSLPDETLIADKSGTLKAIENKIGLTFEQFSRAV
FT                   LLAQHEFAAFLKATGDERAQLLECLTGTDKFSRIGQRIFERNKAIKDKFELLTASLASY
FT                   TLLSDDELSEKQQTLADLKQQIEHTKTTLATTEQGVNWYKQAHSLELTLKNAQQNEQQA
FT                   HAALNAVKAQTEQAKQAQSALEIKDNRQRCESLTAQNSQLNTQIKQLNELDHNALITEQ
FT                   ASNVKKQQNELDTAKQQKLTAEPLIAKARELDSQLAIYNQTIKSLTQQSAKEQQQLSDL
FT                   QQQLQQNKISAEQATTQITGHQHWLNEQSQLKPLATDWNYFHHSFKQFFNTQTQLKTTQ
FT                   QQAQAHAEQQTILTAKLSEQNKQLEQAEQTLTTQQQSLNKLNQQHAQFNIEQCDIKLKN
FT                   IDYLKDQRTRYKQFNQELKHTVQQQRDVAEKLSHSEHTKTTLLTHLTSKEQALKHAEQA
FT                   LNQARLRASEHVEHLRAQLVPNESCAVCGATEHPFASNQSQPFTNLITDFENAYNNEKQ
FT                   QHQDAQTQLHQHQTQHAVLVAEHTQHNQAISDAQAKMLEIKNTMQAAKTELNELTVEQL
FT                   DETYKQLSEQKTQYFSAQKQLSNLQETVNQLQSTVKKEQATQQQLNTQHVELSNQQSQL
FT                   NNKCDELATQSEALINELNLHFEYSDFWHALQAGSLPLSDLAQQVEQYQQIQAQLEQSQ
FT                   KQFDSANVQLQQLTPLITKAEQRVNTLNEELTQTQQQHNNTQQQRLALFDNQTISADDY
FT                   QAKLSAQLEHCQNQLSASQQAHDSAVKQRDEHAITLKNLEHRLADNHQELVMLETRYND
FT                   WFKEFNILHGDISHEQVTFLLTISNDDIKTQLKQGEQLSQAVVDASAALKQQQQANEQH
FT                   QQNNQPTQSEAQLIEQQNHLNTQQTQLQNSLLTINTAIEQHNQNAKALEGKQAELSQLK
FT                   QQVDQWHLLNKVLGDATGKTMRNLAQTQTLKILLHYANSHLKTLNKRYELTAIAESLDI
FT                   AIIDRDMADEQRSVNTLSGGESFLVSLALALGLASLSSNKVQINSLFVDEGFGTLDSET
FT                   LSIAMDALDSLQAQGRKVGVISHVSEMSERVATQIHVAKKPGGYSTINVI"
FT   gene            complement(59582..60829)
FT                   /locus_tag="PSM_B0054"
FT   CDS_pept        complement(59582..60829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0054"
FT                   /product="exonuclease sbcCD subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70094"
FT                   /protein_id="ADT70094.1"
FT                   /translation="MKVLHTSDWHLGQQFYEHDRRHEHHAFFSWLLTTLVNQQIDLLLV
FT                   AGDIYHTATPSANAENQLYQFIKNAKAQCPQLHVVIIAGNHDSANRILAAQPLLAQFDT
FT                   HVVGRFDPAKPSDVVITINNDDKRAVVLAMPFLRTSDISTLSQTENGPSYAQGVAKAYE
FT                   LALEHALTLNAENTPLIVMGHLHAKGGNISGDSERNLVIGGEEAISASVFGKQANYVAL
FT                   GHLHKAQLVAKNEQIRYSGTPIPMSFSERKYTHQVNVVEFSEQKNQPLNTAVNPLYIPR
FT                   LAEVIVLPEGECVPLAQLCEQIKALDTEQYDIAPYLRVKLKSSDIDTTFREQIEQALKG
FT                   KQVNFCGIERVRDQQMSNSSETVFEDLSFVEMLNPISLLEQAFNNDKDMAAATVPNELK
FT                   ALLTDVIEELEQEQLL"
FT   gene            complement(60896..61132)
FT                   /locus_tag="PSM_B0055"
FT   CDS_pept        complement(60896..61132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70095"
FT                   /protein_id="ADT70095.1"
FT                   /translation="MDFYVLKKQQKLIAIPADVQNCKQYINSGYLYIDKVAACNETNAL
FT                   QVLQAKKAKALKWPLTIALAALPVIFIAWYTLT"
FT   gene            complement(61496..61660)
FT                   /locus_tag="PSM_B0056"
FT   CDS_pept        complement(61496..61660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70096"
FT                   /protein_id="ADT70096.1"
FT                   /translation="MNKKTKAINTLNKTVKGVYKTHWLLGFVDLSRLNLQQIVWYLGKA
FT                   EPMWCGCSP"
FT   gene            61672..61785
FT                   /locus_tag="PSM_B0057"
FT   CDS_pept        61672..61785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70097"
FT                   /protein_id="ADT70097.1"
FT                   /translation="MSVLFYCIKRYLLYLQKGGEYHPIKAGFYRYFIEAKL"
FT   gene            61827..64271
FT                   /locus_tag="PSM_B0058"
FT   CDS_pept        61827..64271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0058"
FT                   /product="putative Zn-dependent aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70098"
FT                   /protein_id="ADT70098.1"
FT                   /translation="MKKNLFTLSAFVLPLAMASTVLASSVEQTKGSYVDKFRQLDEALP
FT                   TPNVYRSAAGAPAENYWQQRVDYDIDVKLDELKRRLTGSQTIEYKNNSPHTLKYLWLQL
FT                   DQNIFKNDSIAETTQTFKSTLQNEPDAKPAKLSLGDLRRQQFMDDNELGYTISNVKDED
FT                   GKALRVTVVDTLMRIDLNTPLKPGKDVEFSMDFAFNLVEEDAVGARAGYEHFEEDGNDI
FT                   FLVAQWFPRLAAYTDYEAWTNKPFLGSGEFTLEFGDYDVEITVPADHIVSATGKLDNPS
FT                   SVLTSTQRKRLKEAETAKRPVFVVTEEEALENEKAGTDKTKTWHFKAENVRDFAWASSR
FT                   KFMWDAKGYQQGGDEQPLVMAMSFFPKEGGDLWKKYSTEAVVHTMEVYSQYSFDYPYPT
FT                   AQSVNGPVGGMEYPMITFNGPRTDLQDDGTRTYSQAEKRFLIGVVIHEVGHIYFPMIVN
FT                   SDERQWTWMDEGLNSFLDGVAGREWDPTIPWGVEPRDIVAYMKSETQVPIMTQSDSVLR
FT                   LGPNAYTKPAAALNILREVILGRELFDFAFKEYAQRWKYKRPTPADFFRTMEEASGVDL
FT                   DWFWRGWFYTTDHVDISLDKVYQLRLDTKNPDIDFKRLRDIEADKPSSLFVERNRAEGK
FT                   KTWVEQNPDVTDFYDENDRFTVTNKERNTYNKFLKGLKPWERKTLDRALEEDKNYYVME
FT                   FSNLGGLVMPILLELTYEDGTKEERYIPAEIWRRNHKNVQKLIITDKNKPLTSVTVDPG
FT                   WETADVDVENNHYPRRIIPSRIEVYKREKSKAKVSRDIMQDIKTELKKDEPKDEKNNDE
FT                   DQ"
FT   gene            64274..64768
FT                   /locus_tag="PSM_B0059"
FT   CDS_pept        64274..64768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70099"
FT                   /protein_id="ADT70099.1"
FT                   /translation="MRFLLIIVCFLIAAPSMAHQLKSSVTTVLFNQRTHNIELMHRFYL
FT                   HDTEHAVGNLFQGKVDIMSNKRDQKRFAKYVESHVALQTLSGEPLTLNYVGAQVDGKFF
FT                   WVYQEAAIPDEIEGIRMSHGALRDLWPAQVNMVNVEGRGQIKTLNFSQADTWLEAKFEP
FT                   K"
FT   gene            65020..65637
FT                   /locus_tag="PSM_B0060"
FT   CDS_pept        65020..65637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0060"
FT                   /product="putative hydrolase/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70100"
FT                   /protein_id="ADT70100.1"
FT                   /translation="MKTQIEAIKGVIFDLDGTLVSSELNFSLIKAQVGCPAEQDLLDYI
FT                   EQLPSPYMREEAMNIVHQHELLDAQSAKLLPGVVEAVKALQAKNIPMAIVTRNFDKAAT
FT                   LKLQNNPLPIETVLTRTDAPAKPDPSALLTVATQWEMPVDNVIYVGDYLYDIQAAHNAN
FT                   MRACLYAPDVTPGYAEQADFVIHAFDELVSLIDNYAEKVELC"
FT   gene            complement(65651..65803)
FT                   /locus_tag="PSM_B0062"
FT   CDS_pept        complement(65651..65803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70102"
FT                   /protein_id="ADT70102.1"
FT                   /translation="MLCPSCASIEYIWFAIFYQFKPYWASGSICYAVQKQLGINLNNTH
FT                   MSLNK"
FT   gene            65791..66516
FT                   /locus_tag="PSM_B0061"
FT   CDS_pept        65791..66516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70101"
FT                   /protein_id="ADT70101.1"
FT                   /translation="MGRAFEVRKSSMAKTANAKTKVNSKYGKEIYVAAKSGEPDPDVNQ
FT                   TLRRLIEKAKKDQVPAHVIEKAIEKAAGGAGEDYSSARYEGYGPGNCMVIVDCLTDNPN
FT                   RTIKDVRLPFTKTDSKIGTPGCVAHMFDHLAVLGFAGDDDEVVLEALMMADVDVTDVEA
FT                   EDGKVSVFAPHTEYFKAKTALEEAFEGINFEVDEITFVPQVHVEITDEEVIANFDKFIN
FT                   MLEDCDDVQNVYHNATIKN"
FT   gene            complement(67185..69362)
FT                   /gene="glcB"
FT                   /locus_tag="PSM_B0063"
FT   CDS_pept        complement(67185..69362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="PSM_B0063"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70103"
FT                   /protein_id="ADT70103.1"
FT                   /translation="MSHTLTHSGLSVDKQLAEFVKKQLLPGTHLDEHQFWKSFANIVQT
FT                   LTPLNKSLLAKREQLQKQIDDYHLANKNADQAQYQAFLKDIGYLVDEPENFSIETQNVE
FT                   PEIALTAGPQLVVPVSNARFALNAANARWGSLYDALYGTDVLSEDDGAEKGSQYNPVRG
FT                   FKVMAYARQFLDKALPLENGSHIESTNYSIVDGALAITLRDSSHTTLKNPEQLIGYQGE
FT                   AQNPSVILLKNNGLHIELQIDHHHPIGQADKAGLKDVELEAALTTIMDCEDSVAAVDAE
FT                   DKVQVYKNWLGLMQGNLVETFRKGDKMVDRTLQADRQYTGLDGQKLSLKGRSMMFVRNV
FT                   GHLMTNPAITDVSGNDVFEGIMDAMFTATAALHDLNTKNTIKNSTAQSINIVKPKMHGP
FT                   DEVAFANTLFGMVEEALSLPKNTLKMGIMDEERRTSANLKACIHAAKARVVFINTGFLD
FT                   RTGDEIHTSMQAGVVLPKAAIKAQPWISAYEDRNVDIGLACGLSHKAQIGKGMWAMPDK
FT                   MAMMMEQKIAHPQSGANTAWVPSPTAATLHAMHYHDVDVFSLQQSIATRQIASLESLLT
FT                   PPLMPNPETLSKEDIQSELENNAQGILGYVVRWIDQGIGCSKVPDINHIGLMEDRATLR
FT                   ISSQHIANWLHHGVCSKEQVQKVMAKMAKVVDGQNEHDSLYTPMATNEQTLAKSIAYQA
FT                   ALALVFEGVSQPSGYTEPLLHSYRLKYKAQH"
FT   gene            69602..71203
FT                   /gene="aceA"
FT                   /locus_tag="PSM_B0064"
FT   CDS_pept        69602..71203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="PSM_B0064"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70104"
FT                   /protein_id="ADT70104.1"
FT                   /translation="MTTYQGETDTLATLCQSQGSAWKTINPEYATRMRLQNRFRSGVDI
FT                   AQFTADIMREDMAAYDKDTSQYTQSLGCWHGFTAQQMMMAIKRHQKTTKRSYVYLSGWM
FT                   VAALRSEFGPLPDQSMHEKTSVPALIEEIYTFLKQADARELDHLFNELDDAKANGGDVQ
FT                   AVLNKIDNFETHVVPIIADIDAGFGNEEATYLLAKKMIEAGACAIQIENQVSDAKQCGH
FT                   QAGKVTVPHEDFLAKINAVRYAFLELGIDNGIIVARTDSLGASLTQKVPVSKKPGDLAS
FT                   QYNAFLETTPVNSVDDLNEGETAMKLNGQLCKPTRLDNGLYQFREGTEKDRVVLDCVTS
FT                   LQSGADLLWIETEKPHVKQIAELVNRVKEQVPDAKLVYNNSPSFNWTLKFREQVYQEWQ
FT                   EEGRDLSAYPSLDDNKALMAPEMDATELAAAADLLVQNFQRDGAREAGIFHHLITLPTY
FT                   HTAALSTDILSEGYFGDLGMLAYVRDVQRQEIRREQASVKHQDLAGSNIGDTHKEYFSG
FT                   ENALKAGGEANTMNQF"
FT   gene            complement(71899..73917)
FT                   /locus_tag="PSM_B0065"
FT   CDS_pept        complement(71899..73917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0065"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70105"
FT                   /protein_id="ADT70105.1"
FT                   /translation="MKTLLAMSLILGSSQLAVANTDTLQLQDIFNLEYANQIDITEDGK
FT                   TVYFVRNRMDIKTDRKVGNIWSVDYSTGQLQPLTSGVYMDYSPVVSPDGQRLAFISNRN
FT                   GSNQIYIKWLKTGAIAKVSNLTSNPSSLTWTPDSNQLVFSMFVPMAASAPVSLPGKPKG
FT                   ATWAEPAKYIDDVYYRADGGGYTEKGFSQLFTLDANGGNAQQLTNDNFNNGGEVSFSKD
FT                   GKTLYFSANRNENNELKPTNTEVYQLDLDSLAIFPLTERNGPDQQPKVSPDGKYLAYTG
FT                   YDDKRTNYENTQLYIRDLKTGNTQSLTTDFDRSVGQIKWSANSKGLYFSYADEGQTALA
FT                   YQPRSGKRKVITEKIGSVAFGRPYSGGDFDISENGHVAFTLADTQRPADVATIKRGKAQ
FT                   RLTDLNSDALATKQLAKVEELWLKSSHDELPIQGWVAYPPGFDKSKKYPLVLEIHGGPV
FT                   ANYGPHFSAEVQLFAAKGNVVLYMNPRGSDSYGKEFAQTIHHNYPSNDYDDLMTGVDAL
FT                   IAKGFIDESKLFVTGGSGGGVLTAWIVGHTDRFAAAVVAKPVINWISFVLTADFYPFFA
FT                   DYWFPGKPWDHIEHYMKRSPISYVGNVKTPTMLLTGEADYRTPISETEQFYQALKLQGV
FT                   DTAMVRIPNASHGITARPSNLMTKVAYIQWWFDKHSK"
FT   gene            complement(74072..74806)
FT                   /locus_tag="PSM_B0066"
FT   CDS_pept        complement(74072..74806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70106"
FT                   /protein_id="ADT70106.1"
FT                   /translation="MKLNCDLGESFGAWKMGLDDQVMPHIDMANIACGFHAGDPSVMAN
FT                   TLKLAKQHNVMIGAHPSYPDKQGFGRRSMNLSVAELTQCLHYQIAALDGMAKAQGLTLN
FT                   YVKPHGALYNDMMKHQPLLSAVMGAVASYPADLKLMILATADAKHHHTMARHLGLTLVL
FT                   EAFADRLYTAQGHLVARNIAGSVHDKAALLAQVKQLLTSNSVTTQSGKSLKLNADSICV
FT                   HGDNAQGVALIEDIKALCSASV"
FT   gene            complement(74808..76619)
FT                   /locus_tag="PSM_B0067"
FT   CDS_pept        complement(74808..76619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0067"
FT                   /product="beta-hexosaminidase A"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70107"
FT                   /protein_id="ADT70107.1"
FT                   /translation="MPIKSSFADSALSLEQQLGQKLMLDLRYFCHQGSSKRCRTALTEL
FT                   PDTLTKAISRYDIGGVILFSENTQSIEQIISLNQQLQQAASHSKSGLPLFISIDQEGGR
FT                   VARLPRDVATSFTGNMSIGATYPEHGTYFATQTANVLATELSALGINVNYAPTVDVNMN
FT                   PDNPVINVRSFSENPNDVAVLGAAQVSEFEKNGIISALKHFPGHGDTNVDSHTGLPKVM
FT                   HSKEVIYAQDLAPFKHIIEQHSPGMIMTAHIQYPELDSSTLTNVDGKQMIKPATMSRKI
FT                   MTDILRKELNYQGVVVTDALDMAGISHFFSPTQAIINTFAAGVDIALMPIEIRTPDDIK
FT                   KLDALIESLVSAVKSEQLNAQEIAHSAQRITSLKSKFKLNAFPDPIKALANAKHIIGNK
FT                   AHRELEASLALAAITQIKNNNNTLPLKLTAGQHIHIIMPDTRKCIAIQQAIMALSSHAL
FT                   VYSCSSLQGFDPVEAQRNINQADIIIAGNATPNQSAVEIGGMDDLADNPDFALNNAEQP
FT                   KALESLLKMANKQQIPTVFISLRAPYDIAQFGDSADAVLASYAYNIDVDKNEQVSGPAF
FT                   TALAKVLLGQAPAKGSLPVTIKQSKSH"
FT   gene            complement(76759..76893)
FT                   /locus_tag="PSM_B0068"
FT   CDS_pept        complement(76759..76893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70108"
FT                   /protein_id="ADT70108.1"
FT                   /translation="MVIENATYYHPKQIKTTAMYYIYPKYNTEIKLSSLIFVIFGIIK"
FT   gene            76923..78443
FT                   /locus_tag="PSM_B0069"
FT   CDS_pept        76923..78443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0069"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70109"
FT                   /protein_id="ADT70109.1"
FT                   /translation="MLAITATAAILFSGLYISYQVQKERVIEDTLKSNHVFASKLASAT
FT                   DHFLAAAMQQLEFSAKIIAKDITNTELLQAETNRLLNQTHSFNSVAINMQGVVKAASPV
FT                   SLNIINKTVNSPHSKQAFKLQRPLVSRPYVSLANNLIVVLSYPLFDEIGNYYGYIGGSF
FT                   YLEQQSILNALLKQHSYDGGAYFYVVADNKTLLYHPETERIGEQVINNPVIERVLQSED
FT                   GYTRVLNSQGVSMLAGYSPVKLANWGVVAQRSEVATLATLDTFQGLVLKRMLPIVLITF
FT                   VLIGVLAHFIAKPLRLLADSANLSTDQQNVANLKSIKSWYFESQQLKAAMLEGVNILQS
FT                   KMGQLRQDALTDPLTGAHNRRGLYLLLDKLIQEQIPFAVLEIDIDFFKRVNDTFGHDVG
FT                   DEVLKTLTCVIKQVSRKDDIVARTGGEEFLLILPNENSDSAFVIAERLRNEVANTPMAK
FT                   VGCINVSIGIATWPQHSDDIDQVYKCADKALYHAKETGRNKTVIASLN"
FT   gene            78531..79187
FT                   /locus_tag="PSM_B0070"
FT   CDS_pept        78531..79187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0070"
FT                   /product="thermostable hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70110"
FT                   /protein_id="ADT70110.1"
FT                   /translation="MQLAQQQQSASTLFQSFTQFVSARECDEHRQRLEDTVKQGFLAAY
FT                   NASLTSFMPLLCQYKTQQGHCTLGLRNATSPLFIEQYLAAPIEQFLPMGTQRSRVFELG
FT                   NLYSTHRKATLSHFIIVNEALRAIGATNLVFCATKHVRALLRLLGVTCNEIALANSSVV
FT                   EQPKSWGSYYANQPTVCIVNLEQAHLQVLNTPMLLDIKQQNTHGITALINALEAV"
FT   gene            79190..80662
FT                   /locus_tag="PSM_B0071"
FT   CDS_pept        79190..80662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0071"
FT                   /product="putative long-chain-fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70111"
FT                   /protein_id="ADT70111.1"
FT                   /translation="MLNSLNDLAIQPAVVAHFANQTQQFTGTELLQEINKVVEIFANSD
FT                   ADAIAFQLDNTPAWLVLDAATSVANKVAIPIAHFFSQQQTQYVLAQCGAQLFISDMPRL
FT                   SLGAHTLSITLFDHYTLYIYQLNVKESISYFEGTQKITFTSGSTGEPKGVCLSTHSQMQ
FT                   VAQSLCEQIGISKPTHLCLLPLPVLLENIAGIYAPLLSGGCVHLMPLNELGFVGSGLKN
FT                   PEKLISAIDSVKPNTLILVPELLTCLIAFAKQGWQPPKSLQFIAVGGALVSDALIATAR
FT                   ELNLPVYQGYGLSEAASVVSLNTPKNDDLKSAGTVLPHIQTKIEKGQLYIKGELFLGYL
FT                   NQAPHNPNNWYATGDLVTQHGNKLFIKGRLKNLIITSMGRNVSAEWPESLILSQSAIIQ
FT                   AVVFGEGKPFLTAIIYAIPELSEQQLSEHMKFINQQLPDYAQVKKWHRLALPLSVQQGL
FT                   LTTNNRPKRQAISQQFNLIFEQFYRLGEVIHD"
FT   gene            80655..81344
FT                   /locus_tag="PSM_B0072"
FT   CDS_pept        80655..81344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70112"
FT                   /protein_id="ADT70112.1"
FT                   /translation="MTDFFNTLKAQTQNEREYLLAAPIIQRVFKGQASLEEYASFLAQA
FT                   YHHVKHTVPLMMSLGARLTDEQEWLREAVAEYIEEEIGHQEWVLNDIAACGFDKESVRH
FT                   SKPQFATEMMVSYAYDSIARKNPLSFFGMVHVLEGTSIALADGAASNIADAVGLPKKAF
FT                   SYLTSHGALDIEHVKFFENLMNKITNEADQQAILHGAKCFYRLYGDIFRALDDEPFFKA
FT                   LAQEQHA"
FT   gene            81341..82111
FT                   /locus_tag="PSM_B0073"
FT   CDS_pept        81341..82111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0073"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70113"
FT                   /protein_id="ADT70113.1"
FT                   /translation="MNTGLCVLTGATGGIGQAIAKTLHAQGWQLLLVGRNGDALNALSS
FT                   QCPGSMTFVGDLTVAENMLALAIKAKKLGGAKLLINNAGINVMQSLSSCSSEQIDNLLS
FT                   TNLAVPMKLCQLFLEQLQANRGTIVNVGSSFGSIGYPYQTLYCASKFGLRGFSEALSRE
FT                   LSDTGVRVTYLAPRATDTDINDAQTRAMNKALGNQMDSPQLVADELVALLNSNKTRRFI
FT                   GFPEKLFARINGVFPRIVDNAIAKQLPKIKSFLG"
FT   gene            82406..83053
FT                   /locus_tag="PSM_B0074"
FT   CDS_pept        82406..83053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0074"
FT                   /product="TPR repeats containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70114"
FT                   /protein_id="ADT70114.1"
FT                   /translation="MKKFTLAAYLSIVSVFSSPVFADEQSDLLAIQQQWAVANYELKDD
FT                   AQIKAFTQLSEQSAQFIENYPNSANSYTWNGIVLASFAGAKGGLGALGYAKDAKASLEQ
FT                   ALKIDDSALGGSAYASLATLYSKVPGWPIGFGDDDTADKFFKQALAFNQKGIDTNYLYG
FT                   EFLYDEREYKQAKAHLLVAQAAGIRDTRAKADKYRQQAISQLLAKVDKKLKR"
FT   gene            83065..83724
FT                   /locus_tag="PSM_B0075"
FT   CDS_pept        83065..83724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0075"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70115"
FT                   /protein_id="ADT70115.1"
FT                   /translation="MHLLLVEDDHLVAQGLCRSLRQEGYSVEHSATVKHALQCLGSGEI
FT                   ELVILDLGLPDGDGSQILKHIKAQKKVIPVVILTARSSIDDKVQGLDMGADDYLAKPFE
FT                   PAELFARLRVASRRVNQAQSSLLQCGDVTMDTSAHSVTLNDELLSLPRKEYMLLKALLE
FT                   NQGRVQSKQQLENKLYQWGEEVGSNTIEVHIHHLRKKFPSDFIKTLRGIGYVVGKR"
FT   gene            83787..84971
FT                   /locus_tag="PSM_B0076"
FT   CDS_pept        83787..84971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0076"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70116"
FT                   /protein_id="ADT70116.1"
FT                   /translation="MSIRKRLTLILLSMMVLTCFLALVKGYQKSMSHGEQLLDSELKVV
FT                   AGVLMQQPLSINAMAPKMQESAQLLYQIWQSGELLSGSDELNLDLSQYQAGFQTLNIAG
FT                   QRMRVFVFATSLRTVIVAEPIAKRFELAEAVILSAMLPMLWAVPLLALFISFFVKYALA
FT                   PLTRLSKQLALRQANDFTAINWQVTDEEIKPVISRLNDLFKRVETAYLRERFFASDAAH
FT                   ELRTPLSSLKINVHNLAAQQGDNQELQAMTQGINRLTNIVEQMLILGRTQPEQWQKQFK
FT                   EQSLLAITQEVVSQLYEKIEAKNHTISLEGDDFTINGDEFTLVTLISNLLSNAIKYAPA
FT                   NGQIKITLKQMHRQRIWQIEDSGPGMTDDQKQRIFNRFIALAVTNILRVNKVRA"
FT   gene            84974..85087
FT                   /locus_tag="PSM_B0077"
FT   CDS_pept        84974..85087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0077"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70117"
FT                   /protein_id="ADT70117.1"
FT                   /translation="MAIVQHIIAIYSAEINLTDSDLGGLKVQVVFAGAKCD"
FT   gene            85080..85433
FT                   /locus_tag="PSM_B0078"
FT   CDS_pept        85080..85433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70118"
FT                   /protein_id="ADT70118.1"
FT                   /translation="MIKRLIHPYLYCCVFLSFNAASKDYLIVLKDHLFYPAEIVVPANK
FT                   KVRLLIENQDSTPEEFDSFDLNREKVLYPNRKSVIYIGPLTPGRYEFFGEFSPNTARGV
FT                   VIATEKEGSDANN"
FT   gene            85420..86160
FT                   /locus_tag="PSM_B0079"
FT   CDS_pept        85420..86160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70119"
FT                   /protein_id="ADT70119.1"
FT                   /translation="MLITSLVMSLNQLLPVAILLILLQVIAKQSLVKVLGMLVLGVGLS
FT                   FLFVKSAPLISPLFDYQGLEYTQIALCILVFISALYYAIKQATPAFMIAIISVMTLYLS
FT                   HYIIYLIGFWQNNEAAQSLFIGTFLGLGICSSFSVLLYFLLSAIKQRFGLIPLLVLLAL
FT                   NSAAKLVVALDLASQIDLIATTATVWDLRAILTENSEFGRVLRALIGYEATPNLTSVLS
FT                   YVLSSVLFLSVCYFIPKSITKEQS"
FT   gene            86157..86870
FT                   /locus_tag="PSM_B0080"
FT   CDS_pept        86157..86870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70120"
FT                   /protein_id="ADT70120.1"
FT                   /translation="MKAINLFAATVLIGFCLLIPKLAYADGIVVDKVYHPYVLPFEREL
FT                   EWRLVSHQTDNGNILAQRVGLGGAINDTMALEGYLVGERDDNGDFGLQAYELELRWQLI
FT                   EQGRLWADWGALFEFEKQHDADAYEATTGFVIEKEFGRASLTMNAFLVYEWGQDIQNEW
FT                   ESEFRAQYRYRYLSAFQPAVEVYLGEDFVGIGPGFIGLHRFDGQKQLKWEAGFITEISQ
FT                   SEKNHSFRMALEFEF"
FT   gene            87131..87340
FT                   /gene="cspX"
FT                   /locus_tag="PSM_B0081"
FT   CDS_pept        87131..87340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspX"
FT                   /locus_tag="PSM_B0081"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70121"
FT                   /protein_id="ADT70121.1"
FT                   /translation="MSNIVSGTVKWFNESKGFGFIEQENGPDVFAHFSAIKSEGFKTLA
FT                   EGQRVEFTLSQGQKGPQADNITAL"
FT   gene            87706..88464
FT                   /locus_tag="PSM_B0082"
FT   CDS_pept        87706..88464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0082"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70122"
FT                   /protein_id="ADT70122.1"
FT                   /translation="MFIFKFTLLALGLLFSHNIQANAPKLVIYTESFAPYNFQNEAGQL
FT                   AGINHDIVKDACARAALECEFMMLPWKRAYQLVQNNPHSAIISLAKTQERIPLFEWVGP
FT                   LVSSQTYFFKLKTSDHIVMNDISQAKNYSLGIVRGDIYEMLVRRLGFVTDKNLLLFSEA
FT                   DSFMRLFFKKRIDLIIGSDFTIDHQTEPFGYSRDDLVKLKQIHVDELKGNYIGFNKATS
FT                   PVVVKRFNQALEQLKAESGYEAYIKRYVKN"
FT   gene            complement(88711..88824)
FT                   /locus_tag="PSM_B0083"
FT   CDS_pept        complement(88711..88824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70123"
FT                   /protein_id="ADT70123.1"
FT                   /translation="MHLYQSAIILNHFAGLNVSLPVLKNSHLEQLNSEFFA"
FT   gene            complement(89037..90260)
FT                   /gene="nupX"
FT                   /locus_tag="PSM_B0084"
FT   CDS_pept        complement(89037..90260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupX"
FT                   /locus_tag="PSM_B0084"
FT                   /product="putative Na+ dependent nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70124"
FT                   /protein_id="ADT70124.1"
FT                   /translation="MTTFMSLVGMLVLLGIAFAASTDRKAIKLRTVGIAFLMQVIIGGF
FT                   VLFFEAGKNVLASMSRAVSSVIGYANDGIGFLFGPLASQDTLGFIFAIQVLPVIVFFSA
FT                   LVAVLYHLGIMDWIIKILGGGLQKLLKTSRTESLSATANIFVGQTEAPLIVKPFIATMT
FT                   KSELFAVMVGGLATVAGSVMAGYVIIGVDLKYLIAASFMAAPGGFLMAKMIVPETETPK
FT                   DDLADIDLGDDKPVNVIDAAASGAANGMHLALNVGAMLLAFVALIALLNGLLGGIGGLF
FT                   DYPTLTLQEILGYLFAPVAWLLGVPWNEAILAGSFIGQKLVVNEFVAYLDFINYRDTLS
FT                   AHTQAIVTFALCGFANLSSIAILLGGLGGMAPSRRKDIARLGLRAVLAGSMANLMSAAI
FT                   AGFFLSLA"
FT   gene            complement(90278..90907)
FT                   /gene="udk"
FT                   /locus_tag="PSM_B0085"
FT   CDS_pept        complement(90278..90907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="PSM_B0085"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70125"
FT                   /protein_id="ADT70125.1"
FT                   /translation="MTRTIIAIAGASASGKSLFSQTIYNELVNELEPGAIAIIEEDAYY
FT                   KDQSHLPMAHRTQTNYDHPDAFEHELLLEHLTQLRNGHSVEVPTYDYAQHTRSDKTRRV
FT                   ASAKILIVEGILLLSDKALNKEFDIKVFIDTPLDICLMRRMQRDMEQRGRTLQSVVEQY
FT                   QATVRPMFYQFIEPSKHNADLVVTRGGMNRVAIDIIKSKIKYILQE"
FT   gene            91100..92317
FT                   /gene="deoB"
FT                   /locus_tag="PSM_B0086"
FT   CDS_pept        91100..92317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="PSM_B0086"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70126"
FT                   /protein_id="ADT70126.1"
FT                   /translation="MARAIILMADSLGIGAAPDADKFGDVGANTFAHLLKAYYDETGSK
FT                   LSLPNLSKLGLVDACEAAGKEPCLVAERHEPQGAWGYAKELSSGKDTPSGHWEMAGVPV
FT                   LFDWGYFPKTQPSFPQEFVDEFIARTGIPGILGNCHASGTTILEQLGEEHVKTGKPICY
FT                   TSADSVFQIAAHEESFGLEKLYQVCEIARALLDEMNIGRVIARPFLGSNNQDFARTGNR
FT                   RDYSVLPPSPTLLDVLAKDGGEVISIGKISDIYAHQGITQKHKAPGLINLLEKTSEVVA
FT                   TAPDHSLIFTNLVDFDEKFGHRRNPVGYAKALKEFDDYLPTILAQLKPDDLLMITADHG
FT                   CDPTFPGSEHTREYVPVIAYQTGMKNTPLGERNSFADIGQTLAQWFNLKALEYGDGFID
FT                   KLNTVK"
FT   gene            92383..93084
FT                   /gene="deoD"
FT                   /locus_tag="PSM_B0087"
FT   CDS_pept        92383..93084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="PSM_B0087"
FT                   /product="purine nucleoside phosphorylase (inosine
FT                   phosphorylase) (PNP)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70127"
FT                   /protein_id="ADT70127.1"
FT                   /translation="MSTPHISANVGDFAETVLMPGDPLRAQYIAENFLDDAVQVTGVRN
FT                   MYGFTGTYKGKPVSIMGSGMGIPSMSIYARELIVSFGVKNIIRIGTCGGIGSDIKIRDV
FT                   IFAQGASTDSNVNRARVRGTDFAAIANFDLLLNGVNAAKDLGIDAKVGNVFTTDTFYQA
FT                   DDTFYKDLDKLGVLAVDMETAGLYGVAAEYGAKAMALFTVSDHVITGEATPADERQTTF
FT                   NEMVKIALESI"
FT   gene            complement(93895..94113)
FT                   /locus_tag="PSM_B0089"
FT   CDS_pept        complement(93895..94113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70129"
FT                   /protein_id="ADT70129.1"
FT                   /translation="MASIQLDIITPECKTCFSYQLSAISYQLSAISYQLSAISYQLSAI
FT                   SYQLSAISYQLSAKTLKWFILKASFIT"
FT   gene            94091..94834
FT                   /gene="fpr"
FT                   /locus_tag="PSM_B0088"
FT   CDS_pept        94091..94834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="PSM_B0088"
FT                   /product="ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70128"
FT                   /protein_id="ADT70128.1"
FT                   /translation="MSNWIDATVKSVKWWNESLFSLTVNADVEPFKAGQFTKLSVMDGE
FT                   KRIARAYSYVNAPDDPNLEFYLINVVDGQLSSHLAQLTPGDTVLIERRASGFFTLDEVP
FT                   ASEQLWMLSTGTAIGPFLSILQQSEVWQKYKHINLVHGVRLNSDLSYQELINKLLKAHP
FT                   GQLNYVPVVSREEPLQGLAGRITTVIENNALSEHVGLCATPNNAQFMLCGNPQMVKDTS
FT                   ELLVAQNYKRNRRKEPGHITVEQYW"
FT   gene            94925..95626
FT                   /locus_tag="PSM_B0090"
FT   CDS_pept        94925..95626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70130"
FT                   /protein_id="ADT70130.1"
FT                   /translation="MKPSFIIYACLFAAFTLNCHAIEQSASSNNAELTQPEKVQPQQDA
FT                   LDTLTQEVNIPKQPDVKKVTADDSKVLGSESTKPVEQPKSKVDKAQAVVEAEQAVTQAK
FT                   EALTARQQAKAKQSRESLAVIEQLVKAYNARNIEEFIRMYDEDVEFYIFPNELLFKGKE
FT                   KLIARYGIMFKKLKCLHSSPIKRIVHGDIVIDHELSETCSNDPNVIDKRSELISSYQIK
FT                   DGKVVRVLFFR"
FT   gene            95636..95956
FT                   /locus_tag="PSM_B0091"
FT   CDS_pept        95636..95956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70131"
FT                   /protein_id="ADT70131.1"
FT                   /translation="MQLSDEKKIRVMYRVEPGCLGPEGADHIEDFCRFANKHIKSPYYA
FT                   QLLFLPRYDKQKDERQYSVKNRNLSQVQAKAYLNHFEINIEDFEEQLDELLTKSIDLFF
FT                   KR"
FT   gene            complement(96156..97040)
FT                   /locus_tag="PSM_B0092"
FT   CDS_pept        complement(96156..97040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0092"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70132"
FT                   /protein_id="ADT70132.1"
FT                   /translation="MRFYFLLFIVFIGVFSSAVQAADKNTAALNEQQQRELAQLEAPLY
FT                   KPLLERYILDELKSVRQDQQKLREDVTKQVTHAQLDTADRALTYTTDTINNVFFIITAT
FT                   ASILVLVGWNSLRDVKNKVEDIVNTRVSVITDEYEDRLKILEEKLRVRSEEILSNQERI
FT                   SITNEVHSLWMRANLESDIANKIEIFDEILKRKPEDVEAIAYKADALLELNETEQAIEL
FT                   CNQAIDIDSDYGYAYWQRACAYALTHEHADALADIKMSLEYSPNLRNELLHESAFASLH
FT                   DNDSFNAIVSNEA"
FT   gene            97961..100141
FT                   /locus_tag="PSM_B0093"
FT   CDS_pept        97961..100141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0093"
FT                   /product="catalase hpi"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70133"
FT                   /protein_id="ADT70133.1"
FT                   /translation="MDNHKAGKCPVMHGSNTTTENTNTDWWPNSLNLDILHQHDSKTSP
FT                   YDSDFNYADAFNSLDLEALKTDLKDLMTQSQPWWPADWGHYGGLMIRMAWHSAGSYRLA
FT                   DGRGGGGTGNQRFAPLNSWPDNANLDKARRLLWPIKKKYGNKLSWADLIILAGNMAYES
FT                   MGLKTFGFAGGREDIWHPEKDVYWGAEKEWLAPSDERYTHVDKPDTMENPLAAVQMGLI
FT                   YVNPEGVNGKPDPLKTAEQVRETFARMAMNDEETAALTVGGHTVGKTHGNGKEENLGPE
FT                   PEAADVHEQGLGWNNHKTRGIGRDTMTSGIEGAWTTYPTKWDNGYCKLLLNYEWELTKS
FT                   PAGAHQWEPVNIKEEDKPVDVEDPSIRLNPIMTDADMAMKLDPAYRKIIERFNDDFEYF
FT                   TDVFARAWFKLTHRDLGPKSRYLGADVPSEDLIWQDPIPAVDYTLSDAEITDLKAKLLN
FT                   CGLSETDLINTAWDSARTYRGSDHRGGANGARIRLAPQNSWQGNEPARLAKVLSALETL
FT                   QASLTKPVSMADLIVLGGTAAVEQAAKKAGVDITVPFAPGRGDASDDMTDAESFEPLEP
FT                   IHDGFRNWLKKDYAVSAEELLLERSQLMGLTAPEMSVLLGGMRVLGTNYGNSEHGVFTD
FT                   KVGVLSNDFFVNLTDMNNRWEPAAKGEYNIVDRASGKTKYTATRVDLVFGSNSILRALA
FT                   EFYAQDDNKTRFVHDFVAAWVKVMNADRFDIK"
FT   gene            complement(100144..100317)
FT                   /locus_tag="PSM_B0094"
FT   CDS_pept        complement(100144..100317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70134"
FT                   /protein_id="ADT70134.1"
FT                   /translation="MRRCAFRGNKKSQLLSCSSFFIDTAFYPRLAARSPQLVTFNLNNI
FT                   KKEHCCSFLNFT"
FT   gene            complement(100600..100719)
FT                   /locus_tag="PSM_B0095"
FT   CDS_pept        complement(100600..100719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70135"
FT                   /protein_id="ADT70135.1"
FT                   /translation="MLGINSNAIGNLFNKKGKEKLYFYLLICLSFFALCANRF"
FT   gene            complement(100910..102487)
FT                   /locus_tag="PSM_B0096"
FT   CDS_pept        complement(100910..102487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0096"
FT                   /product="putative ATP-binding cassette (ABC) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70136"
FT                   /protein_id="ADT70136.1"
FT                   /translation="MQFGAEPLFENISAKFGNGNRYGLIGANGCGKSTFMKILSGALTP
FT                   SAGNVSITPGLKLGNLSQDQFAFEQYSVVDAVIMGDVELWKVKQERDRIYSLPEMSEED
FT                   GMKVAELESIFAEMDGYTAESRAEEILLDAGIDKEFHYGLMANVAPGWKLRVLLAQALF
FT                   ANPDILLLDEPTNNLDIHTITWLANELNQRKCTMIIISHDRHFLNSVCTHMADIDYGEL
FT                   RIYPGNYEKYLEASGLQREQLLAENAKKSAEIDELQDFVNRFGANASKAKQASSRAKKM
FT                   DKIKLDEVKSSSRMSPSLNFDEGKKMYRQALELTKLGHGFDGETLFTGGDLLLEAGAKL
FT                   AVIGENGVGKTTFLRCLVNELKSNEGEVKWSENATFGYCPQDSTKDFDNDLTLFDWMSQ
FT                   WRTAKHNDLMVRGMLGRLLFTADDSNKKARNCSGGEKNRLLFGKLMMQDVNVLIMDEPT
FT                   NHMDMEAIEALNNALKDFKGTLIFVSHDREFVSSLATRIVDIKDKQVIDFQGTFDEYLA
FT                   SCEENKVA"
FT   gene            complement(102654..103385)
FT                   /locus_tag="PSM_B0097"
FT   CDS_pept        complement(102654..103385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0097"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70137"
FT                   /protein_id="ADT70137.1"
FT                   /translation="MLKIAFVVLLLSSCNVFACFKTLKVGTNENNWPPYVIAVNGNLTG
FT                   VEIDVLNTIFNGSSFCLKFMLLPTSSRAFEELKEGRIDVIFAASKTLARADFAYFSDAY
FT                   RDEVVRLYKYTESPDLNNISDIFYKDLTLAVNRGSYYGVAFELFKQNHPANVIMMPTAE
FT                   KRFAMLNKNRVDYAIEDELAAQYFINQYPAIEAVTNMAAINKSSIHLMLSKKTISQIEL
FT                   QAINELIKQNKSAIQAIYPHY"
FT   gene            complement(103599..105110)
FT                   /locus_tag="PSM_B0098"
FT   CDS_pept        complement(103599..105110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0098"
FT                   /product="putative ABC transporter solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70138"
FT                   /protein_id="ADT70138.1"
FT                   /translation="MRVVFALVISLMLAFQCVAQITLPHSKIESQPSTPQQATTQLNVL
FT                   TVDLGTLISKPLIQRGLEFEQQTGIKVNVTKVPFGQLYNEINKDLSSPTSQYDIIAYAS
FT                   LWMVDFAENNYLARLDNYIASDPLIEWNDVSRFFRDFSSKYNGQIYSIPLDGDIHLLYY
FT                   RLDILEKYGLAPPRTWDDYLAIAKQLNGVDMNGDGEGDFGSCISKKANEQSYWSLLSIA
FT                   GSFLQSKGTSQGIFFNTRTMAPLVNNDAFKKALKIYKKTTEFGSADELNFDTNDVRYAF
FT                   ISGRCALAIEWGDIGTMAVLPESKVKNKTGVSILPGATEVLNRKTGQLERCNANLCPFA
FT                   IGDINYAPYAAFGGWVGSINNASSKHKKNLAYNYLSYVTQPLQSNEDVTIGATGMNPYR
FT                   TSQLVNHKNWLKQGMSKSTLHFYLGSISKTVNNANIILDLRIFENNRYFRDILDTEVAK
FT                   YLRHTQSVEQTVINIEQGWNKLTDEIGRDKQLKAYRASLGLVPTP"
FT   gene            complement(105146..105928)
FT                   /locus_tag="PSM_B0099"
FT   CDS_pept        complement(105146..105928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70139"
FT                   /protein_id="ADT70139.1"
FT                   /translation="MNVRFRWLLAVLLALCLGVPSSGWASSDIKKIILATDTIDGLVEK
FT                   DGSGLYVDILSKIFAAQSIELNIMIVPQSRAYLWTANGNADAMLSARQNEVEGLYFPVW
FT                   HYDITFVSAMFKKDRFKDWQGEYSLQNRSVGTLRGANYNNYLYVPIDLQQVTQRIEGVK
FT                   MLKLDRLDFFLDNRKALQQTLIANATKLSKMNFDPQQYQIENIVPVKQYIAFTDNAKGR
FT                   ELAQIFDAGFAKLLASGELEALFIAYNYLPFPFPQNID"
FT   gene            complement(106108..106227)
FT                   /locus_tag="PSM_B0100"
FT   CDS_pept        complement(106108..106227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70140"
FT                   /protein_id="ADT70140.1"
FT                   /translation="MLFTLLPNSSTPLKMFRLYKKHPQLFKSLSLVKLYEHLL"
FT   gene            106381..106980
FT                   /locus_tag="PSM_B0101"
FT   CDS_pept        106381..106980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0101"
FT                   /product="tellurite resistance protein-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70141"
FT                   /protein_id="ADT70141.1"
FT                   /translation="MLTKTLSYYNQNAQSFSDSTLNVDMSALYVDFLPLIPKHGHILDA
FT                   GCGSARDAMYFKQQGFTVSAFDASPELAKLASNYLQQAVEVKTFQQLNCTNKYDGIWCC
FT                   ASLLHVPKVELPQVFLKLQNALKPNGVLYVSFKYGTQERVHNGREFTDLNEDGLTALIA
FT                   HHTELKILKQWQTVDQRAERESEVWLNALIKAVPVL"
FT   gene            106977..108515
FT                   /locus_tag="PSM_B0102"
FT   CDS_pept        106977..108515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70142"
FT                   /protein_id="ADT70142.1"
FT                   /translation="MMSTMQQQLDFIAYIQRMLVEGDFSATYKFALLHALADVCVEQPL
FT                   QSEQSELVIELPTLADKLITLYWHHAMPFPSEHTGESALLLQNTGAQSKVISVLFECQQ
FT                   NNIRNLRQLKQSGFYKPTFNAAMATLKSGPLWRLQILAKQEECFLYPHTKNPKYITLNA
FT                   GIASCFRRFYDLVTYLAKNAWLQKIQSIKHNQTLIGPQSQLHDFLFGFDRNALTKAKPV
FT                   LVELQSNSCFYCQKPMKNDVEVDHFIPFARYANDLGHNFVAAHRTCNNNKRDFLAAQQH
FT                   RERWQKQNLVVNSQIISNELSAYFHCDADKSLAVSNWAYQVAQANNAKLWLGNKDHFEQ
FT                   AKPTAELFTFPNAPQPELDQVAEPEVNLKSIDDALKLPYFPNIKIACGHFKTGDESDME
FT                   LMDAPLGAGKLDPQVHFFAHASGNSMNGGKHPILDGDLLLLELITSDKAGSLRGQIVAI
FT                   ERDDIGGEGQYLLRKVNKLPNGQYELIAQNPDYEVMIADESMRTFARFKQVVAG"
FT   gene            109105..110277
FT                   /locus_tag="PSM_B0103"
FT   CDS_pept        109105..110277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70143"
FT                   /protein_id="ADT70143.1"
FT                   /translation="MLEKKKPREQSGRHSFAAYRAQVRSAAMASLSILENDGIDRVYCD
FT                   LHDDFVIRKKDDDGFSYVFYQVKTNGKQNHNWTLNELFGLKARTKDQKKQCTEKIKNSF
FT                   IGKLLLHTVVFDNYCNSVVFQTNINNGDDVEKVIEDIEAGTFQNKFSEVLIDRFNKCFP
FT                   EEVSNELSEDEIKLRLSKLKFETDVQHLKSGDDNFEPIAKNAIYKFSEVDLGHTETREI
FT                   LMKLLELVENKSSGVIAELTQESIEQYAGIAIEDLLSILSISKDAYNNLLESGDSKVIK
FT                   SASIIQRTLSSAGASIEEVEYISRCKTNWDLWHRKNRHVLLEFDLQSINSMVRELLNSS
FT                   IRSDGSLHLASLRSPIKDLVSKLESEGLMYDLNPELILGGIFAELVKGKS"
FT   gene            110274..110753
FT                   /locus_tag="PSM_B0104"
FT   CDS_pept        110274..110753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70144"
FT                   /protein_id="ADT70144.1"
FT                   /translation="MNFDTFFEKIAQSGTEIRVDSSSYNKPNLLNNEALFQLPLISLIV
FT                   LLMAKDKRKPKVSEIGQLVGESLETSMPGFKGSAQHVGWSANLRVRTVKAVSFLEYSNL
FT                   IEIPNNKGRIKITTLGKKVIDKAFNEEDILACNLAEIAKAYRNLCVSKQLDMELE"
FT   gene            110750..112525
FT                   /locus_tag="PSM_B0105"
FT   CDS_pept        110750..112525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70145"
FT                   /protein_id="ADT70145.1"
FT                   /translation="MKLISIQIFSNGLSGWQSDLLKFGDNITQLFGKNGCGKTPIVQSI
FT                   AFCLGYPSVFRNDIYERCNHAILEVSSPIGNLQLKRIYSKGIDIQVTEPNGEKQRFYDE
FT                   KEYSAYLFETLGLTVDNLVTNNNKSTSPYLASMLPIYYLDQDDGYNKFYSPPSNFIKDQ
FT                   FSEMMRMIFDLPVKHSFDQKKEKFKAKERLDYLDKQVELHSRHAEIAKQEAALISKSSE
FT                   ELEDEISTLESEIEQLKSSGANHDDSINVLDRLISKHKASIRDLTLEIAEINKRTSGIA
FT                   QIVDEINTEVETLNLNEEARRVFLSFNEICGSSNCHLFSSSSDAYSKNLLYLKDQIKDL
FT                   ERNADIDKIKIEQIMKQRESLEGLIQTIIDERNQSLEKSEISALVDAISALKNQIFELQ
FT                   SQKSDIEKVELLENKHFQTIAERNKALEKYQSFGTDKNSIPALVKLKADLREFFLNWLE
FT                   VLNTNNISRNITFKDDFTPYLGTETISQLKGSTRTRAVLAYHAALIELMALHNSFCFKF
FT                   LILDTPKQHEIHNDDLNQYIKALKVLCAQHSVQVVFSTTEYHYQGDNQDIEWNPKYQGE
FT                   KQLMFLKMNDNDRII"
FT   gene            complement(112594..115746)
FT                   /locus_tag="PSM_B0106"
FT   CDS_pept        complement(112594..115746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0106"
FT                   /product="helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70146"
FT                   /protein_id="ADT70146.1"
FT                   /translation="MQQIGIYEQLITQVIKQNLNRDQFYVGERQLESAEAATWLSRFLG
FT                   RLVEHAIDAIPNSSERLHEQINLANSLVLWLKDHIRDDELINENLIDSQGRILTALFNT
FT                   QNPIAANLKDYSHDIFPLTGLTQSELFSGANAGISLETELKREIKSSDTIYWLVSFIKW
FT                   TGLRIFKNELEAFTKSGNKLKVITTSYMGATDAKAVEFLASLPNTEVKLSYNNQQERLH
FT                   AKSYLFMRNTGFHTGYIGSSNLSHSALTSGLEWNLKITAQEIPHIIAKTKSTFETYWQS
FT                   PDFELFTGKAECKEKLINSLNEQRGIGQASSQFYFDITPKTHQLAILEKLSVERSVHNR
FT                   FKNLVVAATGTGKTIISAFDFKTVYDKNPNAHFLFVAHREEILKQAQSAYRGVLKNNDF
FT                   GELWVGNYKPQHYNQLFASIQTLNSQIESLNLTHDYYDYIVIDEVHHVSAASYRAILNH
FT                   FTPTILIGLTATPERQDGANILDDFCGVIATEIRLPEAINQRHLCPFQYFGLDDDTDLS
FT                   QITWRGGRYDISELSNLYTGENNRANKIISSLVNIATNVQTIKALAFCVSQKHAEFMAS
FT                   KFNLAGISADVLTSKNTNERAAKQQALRQGEIQILCVVDIFNEGVDIPEVDTLLFLRPT
FT                   ESLTLFLQQLGRGLRLPDNSQKQCCTVLDFVGNSRPEYDFASKFRALIGKSNQPIKTEI
FT                   ENNFPHLPLGCRIELQKRTQQTILKNIQQAINSKRRLQQLINSYPQHTNDALTLSNFLR
FT                   INPQVTLEDIYKPKDKKLGGWHWLKGDEIPAEQADIYAAYYRAINTQLLGCNSLSYLCF
FT                   LRDLCNNDFNFTPTPQNQQYALMAHYNFWDNTGTSLGFKTLDQSLQALKHKELQQELAQ
FT                   VIALLINRIHQQESDLACLPNHAIKLHSRYTRQQILAAFGAHSFDKKSTAREGVLEFKN
FT                   QNLELLFVTLNKCEKTYSPTTLYHDYAISPTLFHWQTQNSARPEHGRGLSYIQHQQTGK
FT                   TILLFVREQGKDENGRTMGFVNYGEVKYQSHNGSQPMNITWELTNPMPSEMWHEAGKLA
FT                   VG"
FT   gene            116206..117081
FT                   /locus_tag="PSM_B0107"
FT   CDS_pept        116206..117081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70147"
FT                   /protein_id="ADT70147.1"
FT                   /translation="MDDLLNQGLSLLVIVGSVYSLLGVLFFRIWSHQRSAKLPIERHKL
FT                   KRVAAQTLQEQVNDKIVDVIGLIFLAALIVIMPFAIKGIAEMFASGNFNYFLIVLIILG
FT                   LAYVARKLWVKSNYLIKLKLGRDAELAVASELIELQSHGYQVFHDIQADGFNIDHLVVG
FT                   ANGIFAIETKGRHKRIKDDTNYKVKFENNHLAFPSWFESKPLEQAQKQANWVNKWLQEA
FT                   TGFNTQVFPVLCFPGWFVELKQRPLFPIVSHKQLVKTILSMRQVNLNQEQQRAICYQVV
FT                   QRSLHESKAI"
FT   gene            117475..117774
FT                   /locus_tag="PSM_B0108"
FT   CDS_pept        117475..117774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70148"
FT                   /protein_id="ADT70148.1"
FT                   /translation="MRSEQALKLARRLGDLIRQHRTLLYTQSTFAKMIGVSRSTVQKLE
FT                   QGEVVKSDILFEALVVLQLQGSLLDEINELAADVGGYNARQRKSNKTQVINDDF"
FT   gene            117764..118969
FT                   /locus_tag="PSM_B0109"
FT   CDS_pept        117764..118969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0109"
FT                   /product="Amidophosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70149"
FT                   /protein_id="ADT70149.1"
FT                   /translation="MTSEAYVFIDGLEDSPVICGFFKLNTQTGRGEFNYGKSYLARSDA
FT                   FALDPLHLPLQPGIVSYSANKGVFGVLSDAGADSWGRKLILSLHNTKPKNELEFLLAGS
FT                   GYGVGALVFSLSRSASKHKANKNTLADLALLDQAKDDLLANKTISQEAKKAFEFGQSMG
FT                   GARPKTSVKIDQKLYLAKFNRQDDLFNLARAEHGAMCMANELGIRTANTRIHETENGDV
FT                   LLVERFDVSDDLPTHHFLSANSLLQKPKVAISDLATYYSYGELAEFIRHHTGEFAADAT
FT                   ELYKRMVFNVFIGNTDDHSRNHAFLYHFAGQTWRMSPAYDITPINNSKQHGIGLGDDGR
FT                   YASIDNLLSQAKRFGLNKAQATKIITEVESYTRQWPTHFKRFANISDIDIKRLESVIPS
FT                   IS"
FT   gene            complement(119212..120060)
FT                   /locus_tag="PSM_B0110"
FT   CDS_pept        complement(119212..120060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0110"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70150"
FT                   /protein_id="ADT70150.1"
FT                   /translation="MHVMLSAKLRYRIYIASFLLMAFTSHYTHAIEAIQPSSKAPNHHA
FT                   TLNISTGEWPPFLSESLPHKGVVAHLITDIFAQANIKVNFTFLPWPRAYHDTINDKYAA
FT                   TAVWMFEQQRTEDYFYSEPVLNERFVFFYHKQRPFDWQNLNDLKGLLLGGGLAYSYGKD
FT                   FDKAADEGLFDMSRVSTTEQNFKRLAMGRIDAFAEEQSVGYFTLASKLPDLFSAINHHP
FT                   KALLVNQSFMMFPKNNPRSEQRLEIFNQQLLKFKQNGRYQAYFDALDNGAYQPTNSALA
FT                   D"
FT   gene            complement(120223..121704)
FT                   /locus_tag="PSM_B0111"
FT   CDS_pept        complement(120223..121704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70151"
FT                   /protein_id="ADT70151.1"
FT                   /translation="MKPLLSCLLFCFALFYSASSAAYNEAMCILIKQEMQQHSNNKASR
FT                   KYRNAARDFEKNCSDPQAARTLPVPKPKPQPVIEQSTPEVVKPQQTEPTLQPTLPDAAT
FT                   EQSATGPQNNVIEKSATQTIEQAKNNAPVASTTTAPNESQVNVTAAAEQSGASEKNAQP
FT                   SKIPASELSNTEENTQPEVKKATVEPAQTAVPITIKASEQTAVIASSMPKGANIISLVL
FT                   PSVALLLIVVITVVVLMRLRNIKQNKQVADTGIPLQMPASHDNDQTHSVVTEPMVTGSD
FT                   LQNPAVESKGKEPDSSRVNTVKIKPEPNTAEFEAAAKATLERIKNATEFAEPQVRDFDP
FT                   EAKQTKIQRNPINQPIKKVQQEAPIKPSHSAPEPIVPHQPQADFHPAKTQRSSLSSTTE
FT                   HDFKEPEVRTFDPDAPLPTKKIKVMPEQVKVVPEEPSKPDNSPQSSNPFANLSLDESWD
FT                   PNSPQKPKIEEKKRAPKSQALIDAEERAKNMQTKE"
FT   gene            complement(122050..123513)
FT                   /gene="dgt"
FT                   /locus_tag="PSM_B0112"
FT   CDS_pept        complement(122050..123513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="PSM_B0112"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70152"
FT                   /protein_id="ADT70152.1"
FT                   /translation="MINFSSKVTPARMQRTTANLQMALESDRGRIINSAAIRRLQQKTQ
FT                   VFPLERNAAVRSRLTHSLEVQQVGRFIVQRIFANLNYQQQKEYGLSGLERPLETLVEMA
FT                   CLMHDIGNPPFGHFGEAAINNWFNANLASITPERCQTTNSSIGVIFKHLAQDICSFEGN
FT                   AQGIRIIHSLLSLNLTYSQTAAILKYTCPASLAKQDIPQNKNYIMKKVGYYYSEKSFVE
FT                   ALQTELKMEPYCRHPASYIMEAADDISYCLADIEDAVEKDIITTQLLCEQLKKQYQKAL
FT                   INLALNDTQHQSFVDDAINYAIERAQAQPFNFNSEFFIYLRVSLLHPLVNHAAKRFIEN
FT                   IEPIYHGDFNHALLEDRSYLHAATQALKQVALEHVFSHKEVEKLELQGYRIINGLLDCY
FT                   KPLLLLSSDDFKRALHGDNRLLIESRLVKKLSKKHLSSYQHAINAMQEEPDHFAAYEFY
FT                   YRCRLIQDYISGMTDQFAYDEYRSLMVID"
FT   gene            123664..124884
FT                   /locus_tag="PSM_B0113"
FT   CDS_pept        123664..124884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0113"
FT                   /product="putative type I phosphodiesterase/nucleotide
FT                   pyrophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70153"
FT                   /protein_id="ADT70153.1"
FT                   /translation="MKLWITKVMCFCLLLGVNSAFAAKEQTVVMISIDGLRWDYIEKHG
FT                   APNLKAMGEQGVRAQKMQPVYPTKTFPNHISVITGLLPVNHGIVDNKFCDKARNNECYS
FT                   MGKGQKDSTWVRGTPLWNLVKMHGLKSAVYFWPESDARFNGMTPDYYFHYSKQGDYQDR
FT                   IDQIIQWLSLPKAQRPRFVASYFSLVDSMGHEYGPDAVQTRDAVKQLDALMGQLKTRLS
FT                   KLEQEVNLVIVSDHGMAQVEPEQSIVVSSLPKDDNFMVVNTGPRLLIYTKSDAKNADVE
FT                   AYKARLQHAAKGRYTVLTEEQLAGYHYNKGTRVGDIVVQTTAPAVFSNSAKVPYLGTHG
FT                   YAYTDDMAATFIATGPAFKKGVSIERVNNLDIYPVLAKVMGLKLMSKVDSDGETLLPAI
FT                   KQKMINH"
FT   gene            complement(125004..125747)
FT                   /locus_tag="PSM_B0114"
FT   CDS_pept        complement(125004..125747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70154"
FT                   /protein_id="ADT70154.1"
FT                   /translation="MKKVISTAAIATALCAASTVSAETIDIGILYTDQSAAATSNINTK
FT                   INQLIAFSNQVYSQNGVDITLRLAGTQNLGDYAVTPSEDWLNAVTNSSYVDGLRNDWKA
FT                   DMVAVLGTGQSAGNGLISCGLAWVGQGTNGNLYSSMSSRMYSITAIDCGATTFVHELGH
FT                   NQGLAHSRKQGDTAGGVYVDGMGHGVQNEFASIMAYPFVFGSATQYDYFSNPNWSVNGI
FT                   PFGVTNQSYAIRTVTDTKTSIANFK"
FT   gene            complement(125820..126533)
FT                   /locus_tag="PSM_B0115"
FT   CDS_pept        complement(125820..126533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70155"
FT                   /protein_id="ADT70155.1"
FT                   /translation="MKRYIVLTIAIPLSVFALYTLLNDQKKTDEVEAPIAIDIVPVDSE
FT                   FAKKTHNPSPIDMSKDPIAAKPANIESNVPSNSFDAINKPSAKAKEILKAAKVLPTDLQ
FT                   NEAYIEFDLAALKTLKTGDNFDLAIPQTAETYSAEITNVTHASNGDKSIVGQVIGANGA
FT                   MHTTILTVGNDAVYGQFTAPSGNYVFESKGQYGWIAAKRDLYKTHIEHQVGEPAPKNAD
FT                   DTDPFAPRAENTPSF"
FT   gene            126903..128060
FT                   /locus_tag="PSM_B0116"
FT   CDS_pept        126903..128060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0116"
FT                   /product="putative benzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70156"
FT                   /protein_id="ADT70156.1"
FT                   /translation="MAGTDQLLSRIMAGLVAVIIGFSSSIALIYQVVITLGGTPELVAS
FT                   WILMLGLVMGGTSIVLSFYYKVPILIAWSTTGAALLISSAQGYSLHEAIGAFMLSALLV
FT                   LVSGITGWFEKIMNRIPSELACAMLAGVLVTFGIDVFNFMNDLPLVIGLMVVVYFIGKR
FT                   FFARFAMLSVLLAGIFLAWYMGNIDTSTVQWQASSFAYIAPSFSLQAFISISIPLYIVT
FT                   MTSQNLPGFAILKAHNYKAPISSSLTVTGLINLVTAPFGTYSINLAAITAAICMSEEAD
FT                   KNPDKRYWASIAGGMFYIIMALCAAMLVAIVASLPQALVLALAGIALFGTIANSLQQSL
FT                   HSPEYTEAAIITFLVTASDLTLWSVGSACWGIIAGALTLMVTRKS"
FT   gene            complement(128218..129237)
FT                   /locus_tag="PSM_B0117"
FT   CDS_pept        complement(128218..129237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0117"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70157"
FT                   /protein_id="ADT70157.1"
FT                   /translation="MSRFSAVTDNPHDGRFNQKTGILLTNLGSPDAPTASALRIYLREF
FT                   LSDPRIVEIPRIVWMLILHGIILRIRPKRSAKLYKSIWTENGSPLTHITRQQSIKLNAL
FT                   LKQHGYTNTEVVMAMRYGNPSIEAGLEELRDKGLTRIIVLPLYPQYSSPTTGSTFDAVA
FT                   NVLKKWRWVPELHFVNGYHKNPTYLESLANSISEDLEKHGMPQKMVFSYHGMPKQFLDN
FT                   GDPYHCLCQQTTRLVVEKLGLDKNKVITTFQSRFGKAEWLKPYTDATLESLPGEGIKDV
FT                   AIISPAFSADCLETLEELEGENREIFEEAGGEKYRYIAALNDRDDHIDAMFDVLKPML"
FT   gene            complement(129316..130653)
FT                   /locus_tag="PSM_B0118"
FT   CDS_pept        complement(129316..130653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0118"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70158"
FT                   /protein_id="ADT70158.1"
FT                   /translation="MTDIDVLEQLNEQPPSILCLDDEANVLKSLVRLLRQYKFDVSVST
FT                   SGHDALEKMQKKQFDVVISDMRMPLMSGAEFLAKARKVAPDSQRILLTGFSDLESTISA
FT                   VNEGGIHAYVQKPWQNDHLISVIQSGVEKFRLKKQNEILQRHVNQQNEQLKELNTNLEQ
FT                   LVEKRTKQIRSVLKKLEVANESEKREHQSTVELLYNFINANPYLDGKRAENIAGTCTQI
FT                   ARYLNVSQKSIELAPIAGYLAQIGLLAMDPELYNKPINELNEVQRKTFYTHPSISQLML
FT                   MPATHLSDVSDAIYHQFERYNGQGIPKGLAKNDIPIGAMVLSVARDYWEGYEQSEPLLT
FT                   TKQRHQFALNSIKSNSGSLYHPRIVDALEASHAKLIASDSSIGSIKVMSAQELEENMIL
FT                   ANSLHSHTGIMLLPKGHIFNTKSIVKLQQLEAKKPTPFRIMVKMAK"
FT   gene            complement(130900..132309)
FT                   /locus_tag="PSM_B0119"
FT   CDS_pept        complement(130900..132309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0119"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70159"
FT                   /protein_id="ADT70159.1"
FT                   /translation="MSSNEILLEKLHLLQVHNLALEENRAFNSLILNGLDAILKNDKTE
FT                   TLLTEFFDILQQAIAFSAAILIKINPSNETTTLITASHPQSDEIITQLKALNKPNRDIK
FT                   NVFNLHQLPDWQVTDPFWHSQHAMLTTPVSTSTESYQLYIFSETIGAFNQHDITLMQRF
FT                   VSFAGNTISQFEKRNLLVKQKEMEEKQSNIEQVLINSEKMASLGQMAAGVAHEINNPLS
FT                   YIVSNIQNLAYNLEQFSHLINALKAEKAIAQQPLADTLQHYQFDELETDSSDIIAEMTE
FT                   GADRVKEIVQGLRQFAHPDQTQIGDIDITELIDNTLRVAWNEIKYNANVEKHYDTEPVI
FT                   ITGRSTQLSQVFLNLFFNAAQAICDKVGVISITTKADKKNAYITIADNGSGIDEDKLNK
FT                   IFDPFYTTKPIGQGTGLGLAISKAIIEQHSGQIRVESQLNQGTAFYITLPKKPTLTDDV
FT                   LTILHANKQIE"
FT   gene            complement(132306..133490)
FT                   /locus_tag="PSM_B0120"
FT   CDS_pept        complement(132306..133490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70160"
FT                   /protein_id="ADT70160.1"
FT                   /translation="MFAIDTFHTHGSDIDKFIQPVSQFTNNSPDLLLGFATTDTIKYLF
FT                   NNQPRSLKNTHNCLIISSCLGSSTDQTLSLNEQSISLFSIKDSNGHYGVASCNATDNLR
FT                   ENAAQTVLKAIANAGQAGLAPKMVWCFQVPGNEELVLQGIQDAIGQRIPVFGGSCADND
FT                   ISAKWCFSDTENVYQQGFIIAVLYPSVETFGFYSSGYDKTDQQGTVTDVDGRLLKTIDN
FT                   QPAFDVYNQWRKNIGLNALTSGNILAQSTMTPLASALSLNDEIPRLLLSHPAVAENGTL
FT                   ELFSNLSVGDTIYLASGSPEQLIKRGDVVVTSLTKLAELHAIKNITGAIIIFCGGCMLS
FT                   IKDAMQEVKESIAAQLPNTPFIMGFTFGELGTFSDSTSKHGNLMISCEIFGGPE"
FT   gene            133699..134277
FT                   /locus_tag="PSM_B0121"
FT   CDS_pept        133699..134277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0121"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70161"
FT                   /protein_id="ADT70161.1"
FT                   /translation="MLKTLKPSEIARYCDVHQRTVSRWINAGDLKGHKLTGRGNYRVQV
FT                   IDFIDFLVRHKMPVPQSLSHKPQVLIIDDEANVRSVIKRVLKRSGFDVVEAAGGFEAGT
FT                   LMHQRKPELITVDLSMPGLSGIEVIRFIRSCEEFKDIKVLVISGMPETQLIDAVNAGAD
FT                   GYICKPFSNDTLINSVNILFGKNRTLLGV"
FT   gene            134281..136290
FT                   /locus_tag="PSM_B0122"
FT   CDS_pept        134281..136290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0122"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70162"
FT                   /protein_id="ADT70162.1"
FT                   /translation="MALRILLVDDELNVLKSLKRVLVRSGYDVMTASSGFEALEILAAN
FT                   QVEIIITDFRMPEMNGADLLRQVKINWPDCVNLVLSGYADFKSVVELLNQGLVFRFLEK
FT                   PWVDSELLENISEAKVKYEQRRAKRVRDQLLMGSMSALIEIDNDGIINRFNAPAAEIIS
FT                   DIHLYENKHLANLDTAQNKAVSQSFVDKQSSTLFINYTCTSDLAKSEEVMIERCLHDGF
FT                   CQLLKLSINSNSMSNIFQLTRTPSVVTNESDFYHHLALCEANKECYALVYIGIAQFQLI
FT                   NDLLGAEDGSHLIKLVLEVLKGVSKQPVKVLHKSADRFVLFVPEIKSDSEILTDLNKAM
FT                   NDLKKLLPSKYNDAHVQLYGVYGLFPEDSLEGKELVNQMQLTMNYQVSEQQRICSRFDP
FT                   QLVADYKKNFELSRLLLTAVSNDELSLRFQPKVDTKTGQILIAETLIRWYEPSKHGWVP
FT                   PAHFIPIAECDGQIISIGRWVISQSCKTLKYWTENNTGVRVLAINLSARQLKDDPDWID
FT                   FMLECLSRNNLESSQLVFELTETYLIEDFAICEQQLIRLRTLGFKLLIDDFGVGYSSLG
FT                   YLSKLPVDGVKLDRALIADIESSLAMQSMIRNITRMSHDLNLKVVAEGVETAYQCELIK
FT                   KLGCDYIQGYYYSEPLEQDDFCNYLSHFNSQGAQ"
FT   gene            136287..137444
FT                   /locus_tag="PSM_B0123"
FT   CDS_pept        136287..137444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0123"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70163"
FT                   /protein_id="ADT70163.1"
FT                   /translation="MSSIAVVILDDDAFLLKVLQRTIHRAFPEVDIMTTSDIDEFWQLL
FT                   NTKQDLDLVLSDYLMPQMNGLDVLEQCSSQNPYPVRALLTGDMTLSTMMRQPNVVHAYL
FT                   AKPFNEADITALFNNVAALKSLPFAFNVRRQLGAMISFPVYPLILKELRELVQSDEFDL
FT                   HDIAHVVSQEPIITAKLLQLANSSYLGFVRPTSSIDEAVSRLGTTILMAITTSLLVAKN
FT                   FESSIPSAIHEKQLDIAANYASCVKRFAKQAGFNLHDQELLFSVALLSFVGKIILLSQG
FT                   ESEASFEHEKAVSEEYASSNFISAYVLKLWGYDTKMCSLLMSCHDLAATDDNELIPLNH
FT                   TLFIVRQILFDKHSPMQLRAYCDSKGVDPILCHLISEFDWHSYTS"
FT   gene            complement(137744..138538)
FT                   /locus_tag="PSM_B0124"
FT   CDS_pept        complement(137744..138538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0124"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70164"
FT                   /protein_id="ADT70164.1"
FT                   /translation="MSVSKAGYYKWLKQSLSQRASENDSLLEFLKKVSSDEHCIPGYRK
FT                   LWKAAIDNGYECSKGRVQRLLQSMGYRSAAGKRRYTGSGKKQGHITAENLLGREFSVDE
FT                   PNTVWVSDITQVRCREGWQYLCVILDLYSRKVVGWATSRVNSADLVIRALKKTWDARKP
FT                   DGSRLLFHSDQGSQYRAKETISWLNNRQVTISMSRKGNCWDNACSESFFAQYKKEWMNN
FT                   LNELSRSEMTVQSRFYIENYYNSVRMHGTLGNVSPMQYELMN"
FT   gene            complement(138601..138768)
FT                   /locus_tag="PSM_B0125"
FT   CDS_pept        complement(138601..138768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70165"
FT                   /protein_id="ADT70165.1"
FT                   /translation="MTSKSTSNPIKNQGPDKSYKDLERQVRKLEKQLEDAQLENDVLKK
FT                   AKAYLDSRKE"
FT   gene            139135..141663
FT                   /locus_tag="PSM_B0126"
FT   CDS_pept        139135..141663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0126"
FT                   /product="putative TonB-dependent receptor for Fe"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70166"
FT                   /protein_id="ADT70166.1"
FT                   /translation="MSTYRLNTLAVAVAFAFSAPSMVNAQEAPAKAEKNIEQISVLGSR
FT                   VSNRTATESSSPIDLIDADDLNKGGFTELGQSLQATAPSFNFSRTQVSDGSDLFRPATL
FT                   RGLQPDQTLVLVNGKRRHNQSIFGLTSTVGGGSAGTDMNAIPLIALKGVEVLRDGAAAQ
FT                   YGSDAIAGVINLSLNNSTDLTTGYVQYGETAEGDGETISAGLNRGFELGNEGGFINLSL
FT                   EYRDADKTNRAERDTGGSLNVAPGTLSDEVRWGQGNAESEFTSVFYNMALPMSEGELYS
FT                   FGGYSERTALGNGFYRNFNEASKNVIQVYSDGFLPQIDNEAQDISVSIGFRGDINSDWN
FT                   YDVSAVYGENQYDFTSRNTLNASYAAEYLFNNPGASDADIAANAGPIEGYSGGFRFDQT
FT                   TFNADVNGIVDIGRSEPVYVSIGAEYRKENYEIVPGEEASYACGTANTDTSYPSVNDPN
FT                   QFAQCGFQAYNGLRPEASNKSDRDSYAVYIDAETMVTDAWNVSGALRYEDFSNAGDDII
FT                   GKVATRYEFNDDFAVRGALSTGFRAPSLQQSGYTAFTTNLGSDGTLSQSFTATTGSAFP
FT                   AALGVDNLKLETSTNYSAGFVYDVTSDLSLTVDFYRVEIEDRITLGSLLSADDVAFSPD
FT                   AVAALQATGAVQANYFSNSVNSTTQGVDIIASYRTDLYEGNFSATFAGNLNETKIDSVN
FT                   AAPGIPENVALDDIQSSFLTDGQPGERATLTFDYERDAYSSMIRFNYFGETDVKYFGND
FT                   HIELATDGSFKATSTVESAVLVDLNVSYQINDMFALSVGADNVFDETPDELGDDEVLNA
FT                   ISNGAFKYPLRAVPYGFDGRTYYAKVSFSF"
FT   gene            141837..142037
FT                   /locus_tag="PSM_B0127"
FT   CDS_pept        141837..142037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70167"
FT                   /protein_id="ADT70167.1"
FT                   /translation="MAKKSKAKAVNKSAVDTGRGVIKHNALAALVTSKVFKPQVVKAKK
FT                   GKGSFKRSNKHAGQESYLIAA"
FT   gene            complement(142588..143313)
FT                   /locus_tag="PSM_B0128"
FT   CDS_pept        complement(142588..143313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70168"
FT                   /protein_id="ADT70168.1"
FT                   /translation="MAKSAQLYRMATDEHICPFGLKSKDLLERQGFEVNDHLLTSRAQT
FT                   DAFKQQHDVETTPQTFIDDKRIGGYDELRSFFNKSPAGQQGTTYTPVIAIFAVTLLLSL
FT                   AFSLSGAGLSMYTLELFVALTMAVLAIQKLQDLNSFSNSFITYDLLAMKVIPYAYVYPF
FT                   LEAFVGVAMIAALPVYLVAPISLLIGSVGAISVIKAVYIDKRELKCACVGGDSNVPLGF
FT                   ISLTENLFMIAAGIWMLVK"
FT   gene            143496..143672
FT                   /locus_tag="PSM_B0129"
FT   CDS_pept        143496..143672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70169"
FT                   /protein_id="ADT70169.1"
FT                   /translation="MERLTELYNLERSTGPKCKIYNMCRFIVNKLSGTGYTFKNQAAFN
FT                   ALSAEGGLAARAS"
FT   gene            complement(143677..144699)
FT                   /locus_tag="PSM_B0130"
FT   CDS_pept        complement(143677..144699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0130"
FT                   /product="transcriptional regulator, LacI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70170"
FT                   /protein_id="ADT70170.1"
FT                   /translation="MRTTINDVAKDAGVSIKTVSRVINNETSVRDNTREKVMASVKKLN
FT                   FQPNLAARSLAGTKAYSIAYIYDNPNAYYIIDMQNGILDTCKKQGFELLIHPCDAKEAH
FT                   IIDEITSMIKRTRIAGILLTPPFSEMPHFVEKLTQLDLKVVRILSGHDAPDTLTPCIMI
FT                   DDNLASKSITEHLINNGHTRIGFLAGGSEHNSTKERLEGYKAALKQYDITIDPSLIIDG
FT                   EYSFESGVEGAKTLINQQNRPTAIVSCNDEIAAGALFAARLMNIDIPSELSITGFEDSP
FT                   FSRQTWPKLTTAHQPNNKIAEDAASLLIAQIRNGNDRDIIKLYTPELVVRDSTAPPIAL
FT                   "
FT   gene            145209..147899
FT                   /locus_tag="PSM_B0131"
FT   CDS_pept        145209..147899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0131"
FT                   /product="beta-hexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70171"
FT                   /protein_id="ADT70171.1"
FT                   /translation="MKIKSLLTACCLALGLSACQGNVDEQNTVSVQLSPANDSAVELLA
FT                   KTLQIKYQQVDNRPSAQCDPDIENGHCFKAYLHLTANSAINFDQWKIYFSQITPIQTAV
FT                   SDEFTIKRVNGDIHVIELKDGFTGFKAGETKTITFYAHFWSLSQSDAIPNYIVVNNNDT
FT                   AKVIESTKPKIDPETGLEVLPHVMPYTDYERQFKRTANDKTQWLSAERLFERNEKYDFS
FT                   AYLTSQNQVSNVIAQQIIPSPRFSEFSQTQTLDISQGLNINYSGIDKTHLSAATQRLAL
FT                   LGINISDDAAAIKVTLNTVTKNDEFEGSYKLAIKADEIVINAADEAGIFYALQSLASLY
FT                   QVNSNMLPVGEVIDAPHYQFRGVLVDVARNFRDKGFILKLLDQMAAYKLNKLHLHLSDD
FT                   EGWRIEIPSLPELTDIGAKRCFDQSEQQCLMPQLGAGLDTSSAANGYYSVADYQEILKA
FT                   ASARHIQVIPSLDMPGHSRAAIKAMQARYNKYIKQGDKQKAEQFLLYDPLDTTVYSSVQ
FT                   HYNDNTINVCLDSSYAFIREVMEQVKGIHSDAQHPLTRYHIGADETAGAWVDSPACADF
FT                   IKQNKLEITEASQLGSYFIERIANMLADMNIETAAWSDGLSHTNPENMPEVVQGNSWDL
FT                   LMWNGHQRAHEFANRNWQVVLSSPDVLYFDFPYEADPQEHGYYWASRHINTEKIFQFMP
FT                   DNLPIHAEFWLDREDKPYVADDTLKHDEQGKVVSAPLAKDKRFIGIQGQLWSENTRTNN
FT                   MAEYKLFPRLLSLAQRAWHKADWAVPYDHNGFVYSQQTNRFSSALKQQRDQQWQTFAAT
FT                   MGLKEFPKLEMADVHYRLANAGAKIENGMLYANIAYPGLVIEYKQGSGQWQTYKQPVKV
FT                   TQDVWIRSKTPSASRVSRKLKVTHR"
FT   gene            148063..148974
FT                   /locus_tag="PSM_B0132"
FT   CDS_pept        148063..148974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0132"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70172"
FT                   /protein_id="ADT70172.1"
FT                   /translation="MITNNINNNQLFVGIDGGGTKCKAIIVNSCNEIVGTGVAGPGNPL
FT                   HGFSQATHSIEQSARLALQDAGLKETPLSALIAGVGLAGVNLPSLHNQMTQWQHPFKTM
FT                   HLTTDLLIACMGAHQGSDGAVMIAGTGSCGFSYVNGQSFMIGGHGFPHGDKGSGAWIGF
FT                   TACQQVLLSLDKLIPSGALTNLIMKYLEVRDAMQLVEVIANKPAAFFAQLAGCVFQSAQ
FT                   ANDAIAIAILKEGGAYLSDIARQLLDKNPPRLSFIGGLLAVMTTWLDPDIQAILSAPLS
FT                   SPEMGSVLYAKQQHVNYSSQEL"
FT   gene            148974..149972
FT                   /locus_tag="PSM_B0133"
FT   CDS_pept        148974..149972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0133"
FT                   /product="SIS domain protein"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70173"
FT                   /protein_id="ADT70173.1"
FT                   /translation="MFNTLMEKEAAQTPNVIEKQIIANQPLVEKIGHKLRDMAPKVVMM
FT                   IGRGSSDHAGVFGKYLIEIEAGVPVSSAAPSVASVYGKTLKLEGAVVIVISQSGRSPDI
FT                   LAQAKMAKEAGAYCIALVNDEASPLQDIVDDFVPLKAGDEISVAATKSYLATLSALVHI
FT                   VANWTQNESLLQGLKELPSALDAMIDSPTQLQPSEFANIKNMVVLARGLGFSISKEMAL
FT                   KLKEVCAIHAESFSSAEFLHGPVTLVEQGLVILDCSVDDETKESHQQQIAEVKKRGAHV
FT                   ISLNQNGINVHPRLAPFLVLQRFYLDVAKVALSRGFNPDEPKGLKKVTRTL"
FT   gene            149973..151100
FT                   /locus_tag="PSM_B0134"
FT   CDS_pept        149973..151100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0134"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70174"
FT                   /protein_id="ADT70174.1"
FT                   /translation="MSVKRIHVAEFFDGEQFVNDKVLSIDAGIITAIDDNVQQADEHLT
FT                   GLVAPGFIDLQVNGGGGVLFNRTSSVAGVKQMLLAHAKYGTTAMLPTLITDTVEVMHQA
FT                   ADVIADAIALQTPGIIGIHFEGPHLSVAKKGAHSADYIRPISEQEWQVLSRQDLGKVVV
FT                   TVAPENVLPSDIAKMREVGIHVCLGHTNASFAQAQRAVDAGATGFTHLYNAMSPLQGRE
FT                   PGVVGCALLNDDTYCGLIVDGHHVDYAACQLALKAKPMGRVFLVTDAMPPVGTNDTEFA
FT                   FFDRTVTLDNGKLTSTTGELAGSALDMATAVRNTVTHLKQPLAQALNMASLYPAQYLQL
FT                   PATHGRLIPGSPADFVQLNTQQQVISTWIGGAQVC"
FT   gene            151133..152428
FT                   /locus_tag="PSM_B0135"
FT   CDS_pept        151133..152428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0135"
FT                   /product="glucose/galactose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70175"
FT                   /protein_id="ADT70175.1"
FT                   /translation="MTTNVMDTSKNSSVVPMAIVAVLFFILGFATWLNGSLMPYLSQIL
FT                   QLTPFQGSLILFSFYIAVTFTALPSAVLIKKVGYKNGMALGMGCMMLAGLLFIPAAMSQ
FT                   FFPLFLLAQLVMGAGQTLLQTAVNPYVVRLGPEESAAVRISIMGILNKGAGVISPMVFT
FT                   ALILSNFTGTVGTELSQEQVDDMANGLILPYLGMAIFIGLLAFAVKKSPLPELINDEVD
FT                   AINDKGEIRETLSHPNLVLGAIAIFLYVAVEVIAGDTIGTFALSLGVEKYGVMTSYTMM
FT                   FMVFGYILGILLIPKFISQQSALTASSVLGIVITLCILLLDAQSFVIANALLVPLGGAN
FT                   LPDVLLLIAFLGLANAIVWPAVFPLALSGLGKLTSTGSALLIMGIAGGAFGPVLWGLLS
FT                   GFTSLQTGYSVLLPCYLFILFYAVKGHKMKKQ"
FT   gene            complement(152484..153983)
FT                   /locus_tag="PSM_B0136"
FT   CDS_pept        complement(152484..153983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70176"
FT                   /protein_id="ADT70176.1"
FT                   /translation="MSDKTLIFNFDGTGSEPRDADQFSTEHFKEDASISNILKLHLLLG
FT                   GKLDDSPTTPFSKQLSFYYQGIGTKGSRLKRILNQALAPRSDDVASILNQAINDFKQHY
FT                   QSGDTLLLTGFSRGAALARRFAKCLEPLIHEKVYLCVFDTVASIGMSKVSKATWGAEHV
FT                   IFENHTIASNVFEALHCVALDEKRRAFEPTLMNQQANITELWFAGAHSDVGGGYYRDGL
FT                   ADICLRYALEWLIAQPLSVSLLTSHDIDYENLLPESNLVAQDDVTVIPDPLALSHQQNY
FT                   FWLNPFFKLVDRQCCVLIDDEISHVAPLIHHSVAQRINKLTSYRPESLKNLHYKMIYSD
FT                   DSTLNFMGLSAHIMLANQNMSLLSINQSQDVMAYASEAYNATGLMLAQGATYRFTPYPN
FT                   QYWYDDGIKCSPSGWHRDNVQLGVKEIPMALLEPFRRLATAQWFSLIGTIGQSDEHAFE
FT                   IAEGVEITIKKSGEFCPFANDLSRFYGANAGRIKLKVTRLS"
FT   gene            complement(154078..155382)
FT                   /gene="ndh"
FT                   /locus_tag="PSM_B0137"
FT   CDS_pept        complement(154078..155382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="PSM_B0137"
FT                   /product="respiratory NADH dehydrogenase II"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70177"
FT                   /protein_id="ADT70177.1"
FT                   /translation="MDITIPKIVIIGGGAGGLELATQLGHKLGKKQHANILLIDKNRTH
FT                   IWKPLLHEVATGSIDADLDGVVYSAHAAKHHYNFQLGTFCNLDNNNKTITLSPLYDELG
FT                   HQILPKRTVHYDHLVIAIGSVSNDFNTPGIKEHCFYLDSNQQAERFQHALLDNFTRLHQ
FT                   DDDPLHSLNIAIVGGGATGVELSAELYHVSDLLKIYGLTNMSAKRLHIHLIEAGPRILP
FT                   ALSERIASSAKRELLRLGVTVRENTQVKQATEHGFITNDDEQINADIMVWAAGVKAPDF
FT                   IKELGIFELTRNNQIKVNEYLQSNLDPQIYVLGDCCAFTQDDGTQVPPRAQSAHQMAQC
FT                   VEKNLIATLREQPLKKFEYNDHGSLVNLSRYSTVGSLMGNLTSNSFFIEGKIARFMYIS
FT                   LYRMHQRAIHGSAKTFALWISEKVLRVVRPKMKLH"
FT   gene            155617..157557
FT                   /locus_tag="PSM_B0138"
FT   CDS_pept        155617..157557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0138"
FT                   /product="putative helicase (recQ-like)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70178"
FT                   /protein_id="ADT70178.1"
FT                   /translation="MSTSLVQSLEQHFGFNQFRTGQQQTIEQLLNGQSSLAIFPTGSGK
FT                   SLCYQLTALHLPHLTLVVSPLLALMKDQISFLNSKGIYAASLDSSQDQMQSSTVMNDVR
FT                   SGKVKVLMVSVERFKNERFREFISQVALSMLVVDEAHCISEWGHNFRPDYLKLPRYREE
FT                   LNIPLVLLLTATATKKVKRDMAERFAIEPQCIVQTGFYRANLDLNVLSVKTADKNNELT
FT                   KIVRAQTGPGIVYVTLQQSAEQVANMLSAQGLHAVAYHAGLEDTLRGQIQDDFMAGKIN
FT                   VVVATIAFGMGVDKSDIRFVIHYDLPKSIENYSQEIGRAGRDGNPSNCYTLANLDGLNT
FT                   VENFIYGDTPELSGIEYVINDIRQAQQQWEMQEYSLSSESNIRQLALKTLLVQLEMQGA
FT                   ITPQYAYYADFKYKFLVDKNELLSQFDEQRQAFLKQIFSHTDFKKIWGTLNFDSLTQAA
FT                   QVDRKRVVAALDYLAEKNLITLETKRITHVYKVHSEVINNPALAQQLHDYFTDKEQAEI
FT                   KRIAALVRFFELQSCLSYNLARYFDDANAPQQCGHCSVCRGHSVKLEYSIPPATIDTAL
FT                   IYQKVDEFLAHMATKGVHNVGIETQCRFLAGMSVPLFARNKVRQLSGFALCEQQRYSEI
FT                   KGTLLSRSMAK"
FT   gene            157665..158738
FT                   /locus_tag="PSM_B0139"
FT   CDS_pept        157665..158738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70179"
FT                   /protein_id="ADT70179.1"
FT                   /translation="MKLQKIILLGAFISASSYAEINISGFASINAGKVLSGTGVPQYGV
FT                   EPTFLADYPNVSAYTEDLSFSPESLIGLQVSGDLGEGLSVTGQLVARGVNDFEANFEWA
FT                   YISYDINDNWTIQAGKKRLPLFYYSDFFDVGYAYVWMRAPADNYTWQVFNYEGVNLLYS
FT                   GSIGDWGVSANIYTGKEDDDDNKLLSDFFFQEPTREIWEDMLGGVLLLNRDWLELRVTH
FT                   MQYTNKRFRAGEPVLWDGKDSRDGKFYGLAANLDFGDFFVLSELNRLDLDGNLDTYMIS
FT                   AGYRFDSITPYVMFSDFEQEGEGDTEQHNTFAVGVRWDFHPSAAFKVQYDRVKDDSFDL
FT                   AVAGDSKAITLGVDVVF"
FT   gene            158750..159157
FT                   /locus_tag="PSM_B0140"
FT   CDS_pept        158750..159157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70180"
FT                   /protein_id="ADT70180.1"
FT                   /translation="MKKLILSVIFLFTNFAYADFAIIVHPSNESSFDESVISRIYTGKE
FT                   KSFSNGNKIIPISQEPSSAATEQFNSKLLNKTSSQLKAYWSKLIFTGKGTPPKELENDS
FT                   EVIKMVAANPDTIGFVSSSAVSDNVKVVFNF"
FT   gene            159307..159609
FT                   /locus_tag="PSM_B0141"
FT   CDS_pept        159307..159609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70181"
FT                   /protein_id="ADT70181.1"
FT                   /translation="MPNSIIAVENINTQPVTCANCQACCCQLEVRIVTDTGVPFRYIDY
FT                   DKWGSEVMKRGDDGWCEALDRNTLMCTIYENRPLTCREFEMASGECITERELAGI"
FT   gene            complement(159642..161006)
FT                   /locus_tag="PSM_B0142"
FT   CDS_pept        complement(159642..161006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0142"
FT                   /product="Trk family potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70182"
FT                   /protein_id="ADT70182.1"
FT                   /translation="MVLWHPLKTPIERKVSGHKKINAAPPLILCCSFLILITLGALALK
FT                   LPFATYEPISWIQSAFTATSAVTVTGLVVVDTGSVFTPFGQGVIALLIQLGGLGLMTFA
FT                   VVTLMALGNKVGFIQKTVTKAAFNQTDTSTLVNTAKSVLLFALIVESIGVVILTLYWLP
FT                   EMGLQKSFFHALFYTISAFNNAGFALSPNSLMQYVEDPVVNLTITGLFIIGGLGFTVLM
FT                   DLYKSKRWAKLSPYSKLMLISTVIINVIALLLIYAIEYDNPKTLQPLSEVGKWLAAWFQ
FT                   AVTPRTAGFNTIAIEELKNASTALTMMLMFIGGGSLSTASGIKVVTFIVLILATYSYLR
FT                   RDKGVTVLRREIDKESVYKALALTIISAGVTWLAIFTLLVVEDAPFLDVAFEAVSALGT
FT                   VGLSRGLTSSLSPLGEFIIMFLMFMGRIGPLTIAYFLASPRTKKLRYPSAQLSIG"
FT   gene            complement(161009..161662)
FT                   /locus_tag="PSM_B0143"
FT   CDS_pept        complement(161009..161662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0143"
FT                   /product="TrkA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70183"
FT                   /protein_id="ADT70183.1"
FT                   /translation="MAHFTVIGLGRFGIAASLELIHLGHTVTGVDSNPKLAEKYVEHLS
FT                   ETIVCDSTDEAALKELDLASSQAVLVAIGEDMQSSILCTLALKNLAVEQIWVKASTKAH
FT                   HTIISKLGVTRIIHPEEEMGVRVAQALNYPIVNDYISLGNGLYVVEVSIKAHLHKTKLG
FT                   HLLREIKGTVDPLLVKRAKQTFVKLDDDFELHTHDTLLLSGSRVELNYLAPRLL"
FT   gene            complement(161674..163128)
FT                   /locus_tag="PSM_B0144"
FT   CDS_pept        complement(161674..163128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0144"
FT                   /product="Trk-type K+ transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70184"
FT                   /protein_id="ADT70184.1"
FT                   /translation="MINWKITLRLLAFPIIWMGVVQLAFAALSLFIFKDRVISAFLISG
FT                   ATMISVALVLLINLRKTDYTGATFRDALIYATVTWIIAGVLGAIPILVITGVNFSDAVF
FT                   ESISALTTTGATVLSGLDNMPASFLLYRQFLQWMGGLGIVIFVVAILPMLNIGGMKLLK
FT                   AETPGPIKDEKLTPRVASTAHYLWGVYFAITVLCILAYYAGGMSLYDAIAHAFTTVSTG
FT                   GFSTHDASMWYYRSHLLLWIANVFMLAGAINFALHFKVAHKRAITSYYHDEETRYFIYI
FT                   VVFLSVLLTTMLLLKDSYSNVLEAFSFSTFHIISFITSTGYGAAGFTDWPAEAGFLLVI
FT                   AGYLGGCAGSTAGGNKIIRNIIVGRMINNNIKQLLHPRAIFTLKYQGSPVKEDVRHAIM
FT                   AFMTFAVGTSLLFTMLLMATGLDFWSAFTAVAACVNVLGPGFGEVGANFQPVSDTGIWI
FT                   LSVAMIVGRLEYFTVFALFTHSFWKK"
FT   gene            complement(163263..163397)
FT                   /locus_tag="PSM_B0146"
FT   CDS_pept        complement(163263..163397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70186"
FT                   /protein_id="ADT70186.1"
FT                   /translation="MALLTPKKMLYTTLVWPRPDSLIIPLTFEHLGYCLFDIASIKFL"
FT   gene            163391..164659
FT                   /locus_tag="PSM_B0145"
FT   CDS_pept        163391..164659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70185"
FT                   /protein_id="ADT70185.1"
FT                   /translation="MPLIVVMAIFPVRNWFTTTDIVMLQLLWVTWVAVRSNRRLAILTT
FT                   LVSVACTDWFFVAPNFTFHIENIEYLVTFIVMLIVGFVISQLAGELSTKVRDVQLHASN
FT                   SRTLYELAKDLNSLDTLDEQKKYFVQRIGKHLNASCTFMPAAPRGNSEFILLSEANPSR
FT                   GGFNFTKRLTQGQKAFADTAISLLYQVHEKTLLRQQSAAISVQAELERAKNALLRSLSH
FT                   DLRTPLATIMGASSMLADDEITLSDSVIKEQASNIYEQSKILNQHFDKVMELSRVNKMG
FT                   ENLCWQTINLQALLSEAKARRQQQLTHFVIDTNIDAQSKCIGDVTLLEIALANMLENAW
FT                   RYGDGKVSVEFTQSSNQQKVCYQLLLTNNVITKAQTSSDEGVGLGSIICDVVAKFHQGT
FT                   FTLTINNETQMAYAKLIWEKDND"
FT   gene            164670..165320
FT                   /locus_tag="PSM_B0147"
FT   CDS_pept        164670..165320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0147"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70187"
FT                   /protein_id="ADT70187.1"
FT                   /translation="MEDSPPLQSFLKTLLQASGYELSICDKGLDGFARLSEQSYDLVLL
FT                   DLGLLDMDGQDWLIEFRQWSALPVLVLSARDGEVEKVTALDNGANDYITKPFSANELLA
FT                   RIRVLLRTQSQPSVAFTCGNIKIDPQKHIVTTSGNEIKLTKKEYAILLLLFQNKDKVLT
FT                   HNAILSHIWGAQYIDRPEYVRVHVAQLRQKLEANPASPKYILTEPAVGYRLVD"
FT   gene            165601..167679
FT                   /locus_tag="PSM_B0148"
FT   CDS_pept        165601..167679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0148"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70188"
FT                   /protein_id="ADT70188.1"
FT                   /translation="MLLYLALPVMLIIASILSYWYSTSLNQAVIQAKLNLSQTADTIAA
FT                   KVNEETQLAVRTTEIMALAQQNGLFGDREASINFVRAVLKMTPSFVGASFGYEPNADNQ
FT                   DQAYINAPPLKEGVYVDQTGRFLPYWHRDFNDSERLLLEPLVDMESSLYYEGVRQQFLR
FT                   DGNTETMITEPYVYEGRMLVEQSSPIIINGEFVGMASVDRALADITEFLQTIKQQLKID
FT                   VLLLSQRDNVIATTLNHSGLKTKAILDTDYASIAKQLKSQGQAREILSANDPFDSGIFY
FT                   FDKAKVATGHWTVIVRRSETDIIGPIQAQFSPLLAAAFASVLLVFLLFWYFINRTTKRI
FT                   NIAIKSVEQLANGDLSIHVQKYMTQKDELGTMFRSFERLIKASKDIDQVCSAIAAGDFS
FT                   QTVSKRSPYDSLSDSINLMSSKRHEAEQALLEQTIELRRTQQELVEAEKMSSLGSLVSG
FT                   VAHEVNTPLGVCVTATSHLREMLIETKNKVASGTLSKTQFSEFISEVDLSCDILLKNMQ
FT                   RAADLISSFKRVAVDQTTEELRNLYVSSYFNEVLKSLYHTLKATPVDITISATEPEPEV
FT                   YSDPGALAQIFTNLVMNSIIHGFQNGSKKGQISVHIEYSDSVCIHYQDSGQGMTDEVQK
FT                   KVFDPFYTTNRAGGGSGLGMNIVYNLVVHRLKGQIAVKQKESTGVYFFIQFPVTPPN"
FT   gene            167699..169234
FT                   /locus_tag="PSM_B0149"
FT   CDS_pept        167699..169234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0149"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70189"
FT                   /protein_id="ADT70189.1"
FT                   /translation="MEWLQDDVVSDKAVANSNAKPWKILIVDDDDSVHQVTQLAMKRFE
FT                   FEQRPVELHSVYSASEAKEKLQSSERYALILLDVVMETEHAGLDLARFIRQDLQNGYSR
FT                   IILRTGQPGVAPERSVIRDYDIDGYKAKSQLQSQDLELIFYTSLRAYRDICMLQTHRYN
FT                   LKRLIKAISTITQIGDLVEFTSVVMEELKLVLNMSSANLYIDAPKVFGICQLDEKLQMI
FT                   EGEVSGIHLFTGSGIDSIPKKHQEYFLRAKQTKQNFIAEDHYVYFHHSQKGLDSILAFQ
FT                   SLQPVKKEAQQLVDLFLGNVVLTFESLLLANSIEETQQLAISLMGGAMESRSKETGSHV
FT                   IRVGLYAKLLAQLHNQNQAYCDKISLAAQLHDVGKVGVPDLILNKPAKLDADEWEIMKQ
FT                   HTTKGWEILKGTTNPVINMAANIAIDHHERWDGAGYPHAKKQQEISLEGRITAIADVFD
FT                   ALCCRRCYKEPWSMDDAKAEIIKGAGNHFDPNLVALFEAHFNDFKQIYLDRPE"
FT   gene            complement(169286..169903)
FT                   /locus_tag="PSM_B0150"
FT   CDS_pept        complement(169286..169903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0150"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70190"
FT                   /protein_id="ADT70190.1"
FT                   /translation="MIKLHHLNKSRSKRIIWLLEELEVDYEIVAYQRNTETFLAPDELK
FT                   NVHPLGKSPVIEDDGLVIAESGAITDYLITKYGKGKFAPKAGTPDYVDYQQWLHFAESS
FT                   AILPLLLKMFVQKDGAKTQFLEGYADAETAKVISYFNSRLEGKHYLVGETLTGADFMMS
FT                   FIVEIVKNAGQLEHFKNLVKYDEQLQSHEKFHTANELEAKYD"
FT   gene            complement(169952..170980)
FT                   /locus_tag="PSM_B0151"
FT   CDS_pept        complement(169952..170980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0151"
FT                   /product="putative Zinc-binding NADPH:quinone
FT                   reductase/dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70191"
FT                   /protein_id="ADT70191.1"
FT                   /translation="MSTTSRQFTLASRPHGAPTNDNFEFKSKELPSLKEGEVLLRTIYL
FT                   SLDPYMRGRMSDAKSYADPVEIGDVMVGATVCQVETSKNDKFSEGEWVLAYTGWQTYAI
FT                   SNGEGLMSLGKEPTNPSYALGIMGMPGFTAYMGLLDIGAPKAGETVVVAAATGPVGATV
FT                   GQIAKIKGCKVVGVAGGSEKCAHAVEKLGFDACIDHKADDFAEQLEKACDQGIDVYYEN
FT                   VGGKVFDAVLPLLNTSARVPICGLVSQYNATSLPEGPDRMGMLMGQLLTKRIKMQGFII
FT                   FDDYGHRYDEFAQDMQKWLQDGKIQYREHLVEGIENTISAFNDMISGKNFGKTVVKINS
FT                   PL"
FT   gene            complement(171153..171329)
FT                   /locus_tag="PSM_B0152"
FT   CDS_pept        complement(171153..171329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0152"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70192"
FT                   /protein_id="ADT70192.1"
FT                   /translation="MFKSTNLNRIYAAVFAGNAGSIKALLKSGFNTEAILKQAIYKNGH
FT                   YFDSHIFSMLKTE"
FT   gene            complement(171590..171973)
FT                   /locus_tag="PSM_B0153"
FT   CDS_pept        complement(171590..171973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0153"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70193"
FT                   /protein_id="ADT70193.1"
FT                   /translation="MFKRLKLARLLVDNNKLIYHMMILREFKQHDTFQIVTILNNQQVA
FT                   RYLSSKIPFPYTQADANWWINEGAKCGIIKAIEVDGLCVGCIGVIPGEFEYSRSGEIGY
FT                   WLSQQYWGQGIITQAIGLIIRVC"
FT   gene            172067..173272
FT                   /locus_tag="PSM_B0154"
FT   CDS_pept        172067..173272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0154"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70194"
FT                   /protein_id="ADT70194.1"
FT                   /translation="MHPHIAALYNSAKKPSRLIIGLMSGTSLDGLDVALCKITGAGLHT
FT                   QIEVLKFTTVEYNDEYKTKIKQVFAKRECDLEVLTLLHPWVGKLHGAMVNQCLALWQVN
FT                   PADIDVIASHGQTIYHCPQSQHNHHDFKNGTLQIGDSDQIAVTTGITTIGDFRQKHIAA
FT                   GGEGAPLAVYGDYLFFASPNENRILLNMGGIANLTFLPKNGDTGAVFSSDIGPGNTIMD
FT                   AYVQHYFKGLHYDEGAKLAKAGKVNTKLLAALTDNAFFKLPLPKTTGPEVFNLAYLRAA
FT                   QMHSTTQRLNHEDVLATLNALSATTIAKALNDCAQHTQDCVVYASGGGIHNPLLMEQLL
FT                   MHCPNIKAFKNTENLGVNPDAKEAVLFAILANECLAGQRQGLNNNNQGILDITMGKVSF
FT                   AD"
FT   gene            complement(173309..173794)
FT                   /locus_tag="PSM_B0155"
FT   CDS_pept        complement(173309..173794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70195"
FT                   /protein_id="ADT70195.1"
FT                   /translation="MSESIVQLTFALPSFEDPMSAAMSHSMEFETLSQDANSQHQITLQ
FT                   CVLPEAAHESDIISLSATEPNARAAQYYTEKTLNLSDLEQGRVNLTLSQIAHSHDFVMQ
FT                   MILHGKHGTLKNSLQFDMHINQFGSGYTAPATYIAPPRPHRVRQYFANMGTALLSLF"
FT   gene            174224..176479
FT                   /locus_tag="PSM_B0156"
FT   CDS_pept        174224..176479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0156"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70196"
FT                   /protein_id="ADT70196.1"
FT                   /translation="MALIKNNLWKLFCFLLLGGLILLSVLLVYEWKNIKKDYRTSSQNR
FT                   VEFSAQALKSTLRNKELMLDLIGRDILSNNNLHEKTSTIKLLDNILLENPVLLGFGLFN
FT                   PQGEIIYYSSNLNASTMINLKENKNTRQSFAQTLVSDKMVLGQTYFNESLQEWVIPIRK
FT                   ALRDKSGTVIAVMTAGMAVSRGTKYLNILQSNRDDYIMLAREIDGFIQYSSVRDADIAS
FT                   YIKTQTKEALGLSGNALIEQTGKTKQTLKSSEEVFSIETTVKGKPYITSAKFDNRYQLW
FT                   TLSQMAMQPIKNLYYWKVGLYVLVYVFICMVLFFGFRLIARAEKKRIDELFHLSRHDDL
FT                   TKLPNRKALRDSFEEKKETSFSLAIINITNLRSMNNRFGMEFGDKAIKTFAGFLKTTFL
FT                   SPYLVFRNSGNEFCIIAPHTFDEQNRRAFEHILESAIQQYETNNSERLLNISVGIACYP
FT                   EHGITKSKLVRSAHLANQWAKDTGQWLCHYHADIKQAYLRRLKVEERLNMALNEQSLSM
FT                   AYQCQVNEQGKIHAMEALIRWQDGELGMVSPAEFIAIAEQSDLIFKIGDFVLARSIGEF
FT                   AKMQQHSDTPLELAINISVMQFQSSVFIPTLLHSLETHNVTAQSIILEITESLFMDNLE
FT                   HVIDTIKSLKSRGIRFSMDDFGTGYSSLSLLRRLPIDELKIDKSFVDDILVDSKSNSMV
FT                   QSIIAIANSHNLSVIAEGVEEQAQFDMLVDIGCKRFQGYYFYKPVAAATVIEYLTVN"
FT   gene            complement(176481..177488)
FT                   /locus_tag="PSM_B0157"
FT   CDS_pept        complement(176481..177488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0157"
FT                   /product="putative translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70197"
FT                   /protein_id="ADT70197.1"
FT                   /translation="MTSLQPTQLLNTEERINQAVALLKAGECVALPTETVYGLAADASN
FT                   SDAVAKIFAAKGRPTNHPLIVHIPELSHVHHWAKNVNKAAITLAEAFWPGPLTLILNAK
FT                   DNLNSPVTGGLNSIGLRVPAHPQFLAVLKQLNTGLAAPSANRYKQLSPINTAHVMRDLN
FT                   GRISAVLEGGQCDVGIESTIVDATTEQLRILRPGPISAADILQKTGLNVTTPLSHNEAV
FT                   PGNVKAHYQPHAPAILINSADFPSVLSNTPHLQTHYLIYSTKAEQQLLANHISPQYITK
FT                   LSACPVEYAKNMYKTLHHIDETTPMNIYIEKPPVSSKWGAVNDRLSRATTVFAG"
FT   gene            complement(177497..178294)
FT                   /locus_tag="PSM_B0158"
FT   CDS_pept        complement(177497..178294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70198"
FT                   /protein_id="ADT70198.1"
FT                   /translation="MPKIVIATKHKKAPLVAPALEPLGFEVFTTDLFDTDTLGMFSHEV
FT                   QRHCSANTAALTKAQRACELTGEQFGLGSEGSFGGGPYPGLMNWDEEVICFYDKHNNNA
FT                   IYGYAGGPFSPSSLSISSETSAESITTACQRYENQHWILDDTQTLHKGLSIEALIALYT
FT                   EKTPSTGTITPDLRAMYSPQRQVIISRAAEDLARRLSSTCPQCQNPNFVAKQVTKGLPC
FT                   ELCNMPTEQMKSTTSVCDSCGFSHIETNKKRVADATYCQFCNP"
FT   gene            complement(178298..180724)
FT                   /locus_tag="PSM_B0159"
FT   CDS_pept        complement(178298..180724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70199"
FT                   /protein_id="ADT70199.1"
FT                   /translation="MSNQTHSNHTALSLSDTENNILNKVCGYIAPNWPLDQMIAVNPFW
FT                   EMRHLPIEDVSARIDTLCNANMLMPKDFYQHKYDNGIITDNHLADAAKLLNSDFTHEQL
FT                   IKTLHIDVPLVDWHNIADLLDQQRNKHKMAWHDEITHQLSQFCAAHYQQLGPMLHGDDT
FT                   SSQSPLYRHWLTVIQADKGISIVMDEKHLNGYFKRLPTCADELIALTLSTLNIDNDSLE
FT                   LYAHSLLLDINGWASWLAYLRFQGQLYAKPKDDMKQLLAMRMAWDLVIWQYLADHDSAS
FT                   FKQLQSQWQQEKSLVIERLHAHKLAQKPLWVWAKALELSYQYPLNHALQNATKTPVNNA
FT                   QLQAVFCIDVRSEVIRRALESQSKNIETFGFAGFFGLPLEYQENGSAITRPQLPGLLKP
FT                   AIHATQTHKDAALEASRQNSATWQSWSKSAPSSFSMVESAGWLYAFKLIKNTFLPKGKA
FT                   KKCATTDWQLTQNQQKLTLKDKTDLAQKVLNTLGIKEFAPHVMLVGHASHTTNNLHSAG
FT                   LECGACGGQSGEVNVRVLANLLNDTQVRQALKERGLTLAQSTQFIAAIHNTTTDVITAY
FT                   DTELNDNLKKWLTVATQTAQQERLVNIDPQLVNKTADEINHAYQQRARDWSQVRPEWGL
FT                   ANNAAFIVAPRAWTRSVNLQGRCFLHDYEWENDNEFAVLELIMTAPMIVTHWINSQYNA
FT                   SVTDNHKYGSGNKILHNAVGGNIGLFEGNGGDLRIGLAMQSLHNGEKWMHEPIRLNVYI
FT                   AAPQSAIAAIYNKHVMVKELIDNHWLTLIRWGDDNTLEQFENGHFSTISASNEPI"
FT   gene            complement(180721..182289)
FT                   /locus_tag="PSM_B0160"
FT   CDS_pept        complement(180721..182289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0160"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70200"
FT                   /protein_id="ADT70200.1"
FT                   /translation="MSEYIISLLLLMMPLSTFLAAWLIGRQPCASNGNVLFKVMLFNSV
FT                   AFISAVALYRIYAFDLLSFLSLSVTRAIMLGLILFITLILIRFCKHYMQGEPRVNYFWR
FT                   WLLLTVTAVMIVVMSNHLALFWLGWVAISLALHKLLMFYPERPRAVLAAHKKFIVARVA
FT                   ESLLLVAFIILSVTHNSLYISDITTFYHTTTLPLSLAEQLAAFLIAFAALIKCAQLPMH
FT                   GWLIKVVEVPTPVSALLHAGVINLGGFLLILFAPLFIQAAAAQWLILIIAGLTTVISAL
FT                   IMTTRISVKVRLAWSTSAQMGLMLIECALGLFELALLHLVTHSTYKAFAFLNSGNGVNE
FT                   DLIRRHIPKQSPTCFAWLTGALVSITLVSAAWTISGYQGAVSVWLLLASALTILLANQH
FT                   GASSVQTHSKKLLVALLVVISYVVAKNIFTLALELEQWREAAFSLADSWVIALILTLMI
FT                   ASYFLRYQSWRPQVKSLSTLLFAGLYLDEWFTRLTLKIWPINLPNNGHTDLKNHAAGIT
FT                   VEESK"
FT   gene            182386..183264
FT                   /locus_tag="PSM_B0161"
FT   CDS_pept        182386..183264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0161"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70201"
FT                   /protein_id="ADT70201.1"
FT                   /translation="MSRLNYHHLYYFWSVARIGNLTQAAKELHLSQSALSTQIKQLEHT
FT                   INIQLFERKGRTLALTDMGKRVQMYANDIFTKGEELSSFIHKGMISQTQHLSIGVLNTL
FT                   SRNFIEEFINPLMSNDEVRFSLTAGRMDGLLNGLAEHELDLVLTNKPIGLEHYDQLWQS
FT                   QLVSRQPLAIVGPADKKTRGQFPTGYTDAQWVLPSKTSAIRDSFNALCARWQYQPKIKA
FT                   EADDMAMLRLLARDSGALSVLPSVVVKDEIEQGLLVEYQRLPDAFEHFYAITAQRKFVP
FT                   DILKSLLAKTC"
FT   gene            183383..185338
FT                   /locus_tag="PSM_B0162"
FT   CDS_pept        183383..185338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70202"
FT                   /protein_id="ADT70202.1"
FT                   /translation="MVNKLQGNYANLNALLAQSVNNSNQTSMPTGLQSRAHLAPSTAII
FT                   TDEMLSQFSDEQVDEILNQQLSSLLTISSAPSGSNYKLSSEEVALRTVISSQQEGLLKN
FT                   ERSDQLIERLNSSVKNIQGAYANTSDILSNLGQLGFNQKTFLASSQQRVERSLDPFMES
FT                   FNRERYEDDDNYGFELSVKTKEGDVIKITFHSAQGYDEETGETTDEFSVSYEVDGDLFE
FT                   AEHQALTQVFSGVGEMADEFFKAKQSAYSRYVPANQTDLDLSFLSNFDNKQLSGFDLYF
FT                   STSEGNTADADGALLGKDNELNLSYTLDEDSEQQILEFESVNGQNNIDFSLDMSTIGAQ
FT                   DKSQMQQYIKALDKSLEDSQLNSSEKSTRSAFGQKSDEVMKQGLAVFKSAFSSMSSAAE
FT                   RYSQIESVATQQFTNGRELVADLVDNMITRDPRYQGLGSSNKNSLGDGISKLADFDAKF
FT                   SFAMDQGDYIATSTTKLSQNTEYQKSAGLTGVTQDKAASTRFNYEEGNRSDIPPDYYDK
FT                   QENYTVGTAVKNNELVALDQAHEVDVDKKVYQFNPEISQYELKKELKETTTSESNIRLI
FT                   NDIWLEKNEDSHRMDERKRLSGVGATNEFRTTSSYSHTQLVTLIGDLEKLEQNKEAKRE
FT                   YLAVLSQVDDFMDKSK"
FT   gene            185313..185858
FT                   /locus_tag="PSM_B0163"
FT   CDS_pept        185313..185858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0163"
FT                   /product="putative thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70203"
FT                   /protein_id="ADT70203.1"
FT                   /translation="MILWIKVSKCIHLSSIVGIVAKTLFKYKVMLKQLILLFILTLPLA
FT                   ANATFKPHSDAVTAKRLLSEHDKFAKQYQTFSPTPQDVVLMQKLAGKELLVLLGSWCHD
FT                   SAREVPRLIKLLDESKVELSKITFVTVGYDKRDEAGIALAHDLQYTPTFIIKHNGVEVN
FT                   RVVEKPSGTLAQDLTLGL"
FT   gene            complement(185885..187195)
FT                   /locus_tag="PSM_B0164"
FT   CDS_pept        complement(185885..187195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0164"
FT                   /product="Deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70204"
FT                   /protein_id="ADT70204.1"
FT                   /translation="MKKRILYWLQNDLRIDDNPILNDLSQQQCELDIVFVINPAWFKSN
FT                   NYQQKPYGVHKQRFLMQSLYELQESVLGLGQTLHILEGDPVRVLTQRINELGIDEVVYS
FT                   EQIGVYEQRQITALKSKCATVVFKSVMQDTLYQQQQLPFELADLPTGFTPFRKKIEATG
FT                   ISLSSVPFSAKRLPPPIILCAKQPISEPPTGNPLLQGGHKAGLAHCLQYFSSALPSSYK
FT                   ITRNELGGFDNSTKFSSWLAFGCISAKQIFCAVDAYEAQHGENESTYWIKFELLWREYF
FT                   KWHAINVKHQLFTFKGKKQSSPLTTFSPNRFAKWCQGSTPFPLVNAIMKELNATGFITN
FT                   RSRQIAASCLVNELQLDWRYGAAYFEQQLIDYDVAANWGNWQYIAGVGVDPRGGRHFNL
FT                   AKQTQQYDPHGEYIAKWQGNEHCDAQLDDLDAADWPV"
FT   gene            complement(187327..189054)
FT                   /locus_tag="PSM_B0165"
FT   CDS_pept        complement(187327..189054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0165"
FT                   /product="periplasmic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70205"
FT                   /protein_id="ADT70205.1"
FT                   /translation="MLKKTILAIALAATSLPSLADSNSDLKTIIDNHWQNAKAEKIFFR
FT                   TDPDGWKPNGTLPNWSEQAIAKRQAYNNSVLKSLASIDPKTLNSEQLMNYRLFKYERET
FT                   EQQSYLYQDKYFPVNFLSGWHTYFAEAPANMAFLTAEDYDAFLVSLGDYPRFNQQNINL
FT                   LKQGIQTGFTHYCETFKNYGQSISAHIVKQPENSALYEPFTRIPNTFSAAQKETYQNKA
FT                   KALIASKVVPAYEHFYDFFENEYMSHCRAQPGIASIKGGLDYYKYTVNYYTTTNATPKQ
FT                   IHELGLKEVARIKAQMQSIIDEVGFDGSYSEFLEFLATDEQFYATDPQDLLEKTAFITQ
FT                   KMYGKLPTYFGHLPRNTFTIKGSASRGAFYMPPPDNRSPGTYFLASTPKLQPLYNLEAL
FT                   SLHEAIPGHHLQNAIAMELDVPEFRRTLSHSAFGEGWALYTERLGKEAGFYQSPYSDFG
FT                   RLGYEMWRAVRLVVDTGIHAFGWSRQKAIDYLADHTALPQSAVEDQIDRYISWPGQALS
FT                   YKMGEIKIRELRAKAEKQLGAQFDIRSFHDTVIGQGSLPMAVLEDVINDWIAQQKSAI"
FT   gene            189273..189428
FT                   /locus_tag="PSM_B0166"
FT   CDS_pept        189273..189428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70206"
FT                   /protein_id="ADT70206.1"
FT                   /translation="MLSFAGSKSDYDEEKWIGITRCTWKKMSDNAHEFVLAGHTPLIGL
FT                   IHKALE"
FT   gene            189470..189976
FT                   /locus_tag="PSM_B0167"
FT   CDS_pept        189470..189976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0167"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70207"
FT                   /protein_id="ADT70207.1"
FT                   /translation="MLCPRTNTPLEPILVGGITVYTSSLGGVFFDNSQIFKFSSPELKH
FT                   GQVLLKYLSNYAEGEGEVAMRVNCPKCPSIVMMRRYFSPLKAVEIDECPSCAGIWLDSG
FT                   ELSKIHENHLTPKERKLLAHEMATNHGFITIKPPKSKYYPKAPKNVQGTTVERLVQLAL
FT                   LNFES"
FT   gene            complement(190031..191500)
FT                   /gene="engA"
FT                   /locus_tag="PSM_B0169"
FT   CDS_pept        complement(190031..191500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="PSM_B0169"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70209"
FT                   /protein_id="ADT70209.1"
FT                   /translation="MLPVIALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGQA
FT                   NYDGFEFIVVDTGGIDGSEEGIETEMADQSLLAIEEADIVLFLVDARVGMTVADQAIAN
FT                   HLRKQEKKCFVVANKTDGIDADSNCAEFYQLSLGEVHHIAAAHGRGITLLLEQTLQPVI
FT                   AELAALDEDVADDDEELIDLYQEGEEDDTDHQAFADKPVKLAIIGRPNVGKSTLTNRIL
FT                   GEDRVIVYDMPGTTRDSIYIPMTRNDKEYILIDTAGVRKRKKVSDVVEKFSVIKTLQAI
FT                   EDCNVVLLVVDARDGISDQDLSLLGFALNSGRSLVIAVNKWDGLDNYVKDRIKTELDRR
FT                   LGFIDFARLHFISALHGTGVGHLFESVDEAYESATKRISTAMLRRIMDMAQADHQPPLV
FT                   RGRRVKLKYAHAGGYNPPRIVIHGNQVHDLPDSYKRYLMNYYRKALKIMGTPIKIEFRE
FT                   GDNPFAGRTNKVTLSQKRKIRAFSKENRNKS"
FT   gene            191451..191570
FT                   /locus_tag="PSM_B0168"
FT   CDS_pept        191451..191570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70208"
FT                   /protein_id="ADT70208.1"
FT                   /translation="MDLPTLGRPTRAITGSINYLFKKQQKASQCEALQKIINY"
FT   gene            complement(191594..192772)
FT                   /gene="yfgL"
FT                   /locus_tag="PSM_B0170"
FT   CDS_pept        complement(191594..192772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgL"
FT                   /locus_tag="PSM_B0170"
FT                   /product="outer membrane protein assembly complex subunit
FT                   YfgL"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70210"
FT                   /protein_id="ADT70210.1"
FT                   /translation="MRKITTATLALCIATLMGCSSSDDDEELVLPEIANQFETEVVWQE
FT                   SIGSGVEHYFSRLSPAVYKDTVYVASREGQVEALSLANGDTLWETDVRHDLSFWPWSDN
FT                   DSAKLSGGILQAYGKIYLGSEHGYVIALDRETGKEVWRKKVPGESLSKPAAGDGLVFVN
FT                   LASGKLLALHPDTGEERWSFEQEVPALTLRGQSSPTVANGGVLVGLETGKLSVLISESG
FT                   YSAWSAEIAVAKGASEFERLVDVDTQPLISGPFAYAIAYNGNLSAVDIRSGNVVWKREY
FT                   SSYREIAMDLQTIYVVDSNGVVYALDKDSGIERWSQPALRGWYLTGPAVAGNYLALGDQ
FT                   EGNLHWLNKDTGELVSREDFDSSGFFVEPVVADDKLILYTRDGEVSAVKIPN"
FT   gene            complement(192783..193403)
FT                   /gene="yfgM"
FT                   /locus_tag="PSM_B0171"
FT   CDS_pept        complement(192783..193403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgM"
FT                   /locus_tag="PSM_B0171"
FT                   /product="TPR-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70211"
FT                   /protein_id="ADT70211.1"
FT                   /translation="MEIYSTEEQQAEAIKRFFRENGLSLALGVIVGLGGLYGWKAYNQN
FT                   QITTAEQASDAYTKLVESDDVLASADAFISENKDTQYATLAAFVAAKEAVDAQKLDVAN
FT                   EKLSWIVSNVDNAQLKAIATTRLARVQIAQQQYDDALTTLNSPLPEAFNANIAELKGDI
FT                   YTQQGNKEQARVAYQAAVDAGGLTSNPLLQIKLDDLAVTSPAA"
FT   gene            complement(193449..194729)
FT                   /gene="hisS"
FT                   /locus_tag="PSM_B0172"
FT   CDS_pept        complement(193449..194729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="PSM_B0172"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70212"
FT                   /protein_id="ADT70212.1"
FT                   /translation="MAKQIQAVRGMNDCLPGDTQVWQKVEHILRETVSSFGYQEIRFPI
FT                   VESTDLFKRSIGEVTDIVEKEMYTFADRNGDNLTLRPEGTAVCVRAGNENGLLYNQEQR
FT                   LWYMGPMFRHERPQKGRYRQFHQFGLETFGIASADIDAEVILLTAQLWEAFGISDHVRL
FT                   ELNSLGSNEARAQYRDALIAFLEQHTDVLDEDSKRRMYSNPLRVLDTKNPDIQAILVDA
FT                   PKLSEHLDTESKEHFENLCERLDAAGVKYTVNEKLVRGLDYYNRTVFEWVTDSLGAQGT
FT                   VCAGGRYDGLVEQLGGKSTPAVGFAMGLERLVLLLQALECVGDIRRSTDVYLAAMGDKA
FT                   SIQAPIIASTLRRDVPGLRVMVHAGGGNFKKQLKRADKSDALVAVIIGEDELEQGVVTI
FT                   KYLRERKEQVTLELEQAKALLAELINS"
FT   gene            complement(194916..196034)
FT                   /gene="ispG"
FT                   /locus_tag="PSM_B0173"
FT   CDS_pept        complement(194916..196034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="PSM_B0173"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70213"
FT                   /protein_id="ADT70213.1"
FT                   /translation="MFSESPIKRRKSTRINVGNVPIGDGAPIAVQSMTNTDTMDVDATV
FT                   AQIQAIQDAGADIVRVSVPTMDAAEAFKSIKEQVSIPLVADIHFDYRIALKVAKYGVDC
FT                   LRINPGNIGSEERIRAVVDSAREHNIPIRIGVNGGSLERDLQEKYGEPTPEALLESAMR
FT                   HVDILRRLDFDQFKISVKASDVFLAVGAYRLLAKEIDQPLHLGITEAGGMRSGSVKSAV
FT                   GLGMLLAEGIGDTLRVSLAADPVQEIKVGFDILKSLRIRSRGINFIACPSCSRQEFDVV
FT                   STMNQLEERLEDIIEPVSVSVIGCVVNGPGEALVSDIGLAGANRRSGLYINGERQKARI
FT                   DNNNIVDQLEGYVRDFIEQKQQQTPIDIKIVE"
FT   gene            complement(196040..196909)
FT                   /locus_tag="PSM_B0174"
FT   CDS_pept        complement(196040..196909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0174"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70214"
FT                   /protein_id="ADT70214.1"
FT                   /translation="MNEDNTQPQSDEPSVGQILKSHRENANISIAEIASLLKLTESQVE
FT                   HIESDEYHLLGAKTFVKGYIKNYCRTLNIDSTAILAMLPAFSTSDKPVDMQSFSRRTEK
FT                   EAHDSRLMTVSYLILAIVIGSSAVWWWQNAMPIDEQTKTINANNSLITQQQENTKLLAE
FT                   AADEALLNDIESTEEVDSALQNEQQTIQAAPVNNAQSTSEPKNSDLSTIFMMFNDESWV
FT                   EIHDANDEKIAFGVKKAGYEMTLTGVAPFSVVLGKHDVVRITLNGEPVDISAFPKNRLA
FT                   KFKLPLAE"
FT   gene            197016..197129
FT                   /locus_tag="PSM_B0175"
FT   CDS_pept        197016..197129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70215"
FT                   /protein_id="ADT70215.1"
FT                   /translation="MHAFKGYHQLRFYKNVSIALLKFLLFLFLKPFNAPNI"
FT   gene            complement(197266..198150)
FT                   /locus_tag="PSM_B0176"
FT   CDS_pept        complement(197266..198150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0176"
FT                   /product="putative lytic cell-wall binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70216"
FT                   /protein_id="ADT70216.1"
FT                   /translation="MTENSYNGSDKPVVENKINNAGAARTRIALALQYLNTGNNSQAKY
FT                   NLERASEYAPNLPEVHYSLAYYYQQVGENALADKAYQKALAIKPDDPNTLNNYGTFLCS
FT                   IDEYDRATDQFLKAIEIPSYIRVAQSYENLALCAIEFNDFTNAESYFQQALNHSSQRAS
FT                   TLISLAALYYAKSDLYKASTLIKRYDDTAQVSSRALLLSYLVKQRMGRIEDAEKIAATI
FT                   LQTYPNSVQANAIRDNQLRQTEFEVLREKYRQAQLDELQESSNNNQIIVEPKIKIIRKK
FT                   SPTSAVNSDDSVK"
FT   gene            complement(198312..199442)
FT                   /locus_tag="PSM_B0177"
FT   CDS_pept        complement(198312..199442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70217"
FT                   /protein_id="ADT70217.1"
FT                   /translation="MTEQKKINLLDLNRDAMRELFVSFGEKPFRGDQVMKWIYHFGVDN
FT                   FDEMSNVNKKLKEKLKNECEIVAPEISVRQQASDGTIKYALVLEGGQEVEAVWIPEKDR
FT                   ATLCVSSQVGCALECTFCSTAQQGFNRNLKVSEIIGQVWRVAKDIGLDGNSEKRPVTNV
FT                   VMMGMGEPLLNVKNVVPAMELMMDDWGFGLSKRRVTLSTSGVVPALDLLKEKIDVALAI
FT                   SLHAPDNALRDILVPINKKYPIEEFLAACRRYIDGSKANKDVTIEYVMLNGVNDSTDQA
FT                   HELVKTLKGTPSKVNLIPFNPFPGNEYTRSSNSRIDRFSKVLQAAGITCIVRRTRGDDI
FT                   DAACGQLAGDVVDRTKRMAKKKMRDDNAIAVNIHQA"
FT   gene            complement(199626..200057)
FT                   /gene="ndk"
FT                   /locus_tag="PSM_B0178"
FT   CDS_pept        complement(199626..200057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="PSM_B0178"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70218"
FT                   /protein_id="ADT70218.1"
FT                   /translation="MALERTFSIVKPDAVAKNHIGAIYNRFETAGLKIVAAKMVHLSQE
FT                   KAEGFYAEHSERPFFGALVSFMTSGPVMVTVLEGENAVLKNREIMGATNPAEALAGTLR
FT                   ADYADSIDENAVHGSDAVESAAREIAYFFADEELCPRTR"
FT   gene            200327..201652
FT                   /locus_tag="PSM_B0179"
FT   CDS_pept        200327..201652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0179"
FT                   /product="methyl-accepting chemotaxis transducer/sensory
FT                   box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70219"
FT                   /protein_id="ADT70219.1"
FT                   /translation="MFFNQSLKNQIADLQSKLSVREQVKQSLDSEMLVLELDKQGAILR
FT                   QNKNFEREFNYSNNKIINKNILDFIPENARNNADFHAFQKALSKVEHFAGAIQVSHPNG
FT                   QRDWLRCILHPIKNEQGQLEYLTLHCTVLTQIIESSRENEDLIKALHRSTAVIEFDTQG
FT                   MVLRVNDNFLKSMSYSRQDVVGKHHGMFCDEQEASSKEYQAFWQRLRNGEFIASRFKRI
FT                   DKHGHVVWLEASYNPIFNEVNELYKVVKFATVITDQVERELATEQAASIAHGTSIETDN
FT                   NADKGAEVVQKTVQVMNELSVQMEQAAQEISALDKQSQLIASIVQSISSIADQTNLLAL
FT                   NAAIEAARAGEQGRGFAVVADEVRLLASRTSKATEEIVDVVQQNQNLTQSTVAVIEQGK
FT                   NKAQQGLALSKESGDVMSDIKKGAQQVVDAVSQFSNQLSSKK"
FT   gene            201808..203196
FT                   /gene="yegQ"
FT                   /locus_tag="PSM_B0180"
FT   CDS_pept        201808..203196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yegQ"
FT                   /locus_tag="PSM_B0180"
FT                   /product="putative peptidase YegQ"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70220"
FT                   /protein_id="ADT70220.1"
FT                   /translation="MSAVSSSTLFVPELLCPAGSLKNMRYAFAYGADAVYAGQPRYSLR
FT                   VRNNEFDLDTLQIGINEAHALNKKFYVVSNIAPHNAKVKSYLRDIEPVIAMKPDALIMS
FT                   DPGLIMLVREKWPDMPIHLSVQANAVNYASVQFWAKQGIERVILSRELSLEEISEIRAL
FT                   CPETELEVFVHGALCMAYSGRCLLSGYINKRDPNQGTCTNACRWEYDVKPGTENETGEM
FT                   VHKIDPKTVIPTLGEGAPSNDVFMLEEQGRPGEYMPAFEDEHGTYIMNSKDLRAVQYVE
FT                   QLTKMGVHSLKIEGRTKSFYYVARTAQVYRKAIDDAVAGKPFDADLFKTLENLAHRGYT
FT                   EGFLKRHAHQDYQNYEYGHSVSTKQQFVGEVLGRNANGLVEIDVKNKFCVGHSLELMTP
FT                   KGNISFPLESMENKKGESITDAKGSGHIVKIPLPDNIDLEHAILMRNLDENQDTRNPFK
FT                   QAVS"
FT   gene            203286..203456
FT                   /locus_tag="PSM_B0181"
FT   CDS_pept        203286..203456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0181"
FT                   /product="putative 4Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70221"
FT                   /protein_id="ADT70221.1"
FT                   /translation="MGAKIYQIDSDKCTECVGHYDKPTCVSVCPIDCIKPDPNHRETID
FT                   ELAEKYVRLMG"
FT   gene            203736..204455
FT                   /locus_tag="PSM_B0182"
FT   CDS_pept        203736..204455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0182"
FT                   /product="putative sirtuin"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70222"
FT                   /protein_id="ADT70222.1"
FT                   /translation="MNTLYITGAGVSAASGIPTFRGEDGFWTIGSKNYTPMEMATRAMY
FT                   ENNPSEFLAWYYHRFATYRHHGPNEVHHWLSDKNLITQNIDGLDGKAGNKNYIAIHGRL
FT                   DQMTVFHHQGDKVTPQATLWSNVDESNLHRSLLALFNIENHQPKLNHSLKPFVLLFDEY
FT                   YTELYRITEAQQRMIDADKMVFMGTSFSVNITQMALEIARSYSIPIEIVDPDPTHVLHS
FT                   NVSYKKMTALEYIQQQG"
FT   gene            204611..205426
FT                   /locus_tag="PSM_B0183"
FT   CDS_pept        204611..205426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0183"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70223"
FT                   /protein_id="ADT70223.1"
FT                   /translation="MLSISLGPLVISISQLIIFLGLGIFWGLTYLLTRQHPLQKAILDT
FT                   VFKAIVVGFLVSRLAFVFTMWDAYQGNWWQLFNISDGGFIGYYGWLSGIVVLAFYARGK
FT                   KAVMKNYAIAGFVGFCSMIIPNFALSIYQTGVQLPQSVVHNIQGQQVNLQNFKGKPVVI
FT                   NFWASWCPPCRKEMPVLQAAQKNNPNITVAFVNQGEDLHTVKAFLDEQQLDLNHVFFDQ
FT                   SSNVSRESGAAGLPTTLFYNSQGELVTSHMGELSHASLGYYIQAISDKK"
FT   gene            205683..208610
FT                   /locus_tag="PSM_B0184"
FT   CDS_pept        205683..208610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0184"
FT                   /product="putative TonB-dependent receptor; outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70224"
FT                   /protein_id="ADT70224.1"
FT                   /translation="MTAHRITHAAHHSLPLFIKSTLCVSILSVVNHAYADEAEDKTLKS
FT                   KDMEVIEVRGIRSSMAANLDIKRLSSSVVDAITAEDIGKFPDKNVADSLQRVPGVVIDR
FT                   DGGEGSSVSIRGLSSELTFSQLNGNFIASSPGEPSRSFDYALLPSAMIESVEVYKSPEA
FT                   RLDEGGVGGTVLMHSRKPLSMEANSGVINIESTYADVTEESEPQLTALYSWKNEADTFG
FT                   MLFGYTSQKRTNRTLSGGTDANVWRFAGDNPVDTNGELVDNNNQWDSISDAQGNNYNDV
FT                   WFPQVVRGSIVNELREREGVQFSTQWRPTSRVEIGFNYFGFSLDKNRTESVIDIPEWSL
FT                   NPDFLTDVSLDESGTIINGMQFDAAASGAENDMQLPWMRGRYVREESTSDTFDFNLTYE
FT                   GDYFKARFVAGNTRSEGGPKESWEAAYKSSNAGENESRIENASQTAGWQINENDISLNI
FT                   DPNTLANLLNGVGGGRDPGSSNSSFVRSELEEDYYQADFDIYTDWGILRTIKTGVKYRE
FT                   ATLHRETGNTFFLDPNFDIAAGEASEGGITRFDSYQWNNGMPLAQDVFINEGNIAGGFN
FT                   INQMPGIDWQKYRDIVTSHYVPYTRKEDNFIYDIEEQIAAFYLQGDFEFNSVRGNLGVR
FT                   VVRTKTMTSSTDLYTYLLDHTDDDSGEPVTGDDRFVEDYQLITQESTDTQILPSFNIAW
FT                   DISDDVVVRGAVAKVMSRPDYADLGAQQRITFVSDEWADDRAEFNEIPGFSGSGGNKNL
FT                   KPFESVQADLSIEYYYSEGSAIGLALFHKTVDNFVVPLVIDVQQDFAGKEGIVEAGNIT
FT                   VSPYSTVGNGTDAVSKGAEVFIQHAFDSGFGFYANYTYNKTNKADVEVDGKEFGKSPLI
FT                   GSAKYQYNTSIYYEGDAFNIRASYNKRGETVLGLNSGLNVYQDPYEQVDVNASINLLED
FT                   LSLTAAVINLTKSESVKRLGNDTESRLLNSSYSGRRYYAGINYRF"
FT   gene            208731..209528
FT                   /locus_tag="PSM_B0185"
FT   CDS_pept        208731..209528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0185"
FT                   /product="response regulator receiver domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70225"
FT                   /protein_id="ADT70225.1"
FT                   /translation="MSDLTAIANLSILLVEPSEVQQKLIKKSLAQCGVTQIETASTQEN
FT                   ALAALSNYHPDLVISSMYFSDGTADSLLQAIRSNSNTEQQAFMLVSSERNKRHLEQLRQ
FT                   SGVLAILPKPFSADEITRALKATLDIISEQEVELEHFDVTLLRVLVVDDSRFARKHIIR
FT                   VLAGMGIPAPVEAEDGKQAIEMLNSQSFDLIVTDYNMPEMDGKELTETVRQSNAYSHIP
FT                   ILMVSSEANDTHLANIAQAGVDAICDKPFEPATVRDLLFKIMS"
FT   gene            complement(209555..211642)
FT                   /locus_tag="PSM_B0186"
FT   CDS_pept        complement(209555..211642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0186"
FT                   /product="sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70226"
FT                   /protein_id="ADT70226.1"
FT                   /translation="MAPNKTNNMPAHQYVTNDPLHQLFDAVDSISVQGYDEQRRVIYWN
FT                   KGSELLYGYTHQEAIGKKLEDLIIPAPMREPVIKAHSNWIKYDIEIPASELILSHKNGN
FT                   DVAVFSSHVMFTNQYNTKQMYCIDIDLSEVHKAQAEAVFNATMLKTLFEAIPDLFFVLE
FT                   QNGTITDYHANNENDLYISPNQFIGKKMVDVLPEKVAQKFQVHIEKTITQDSMVSFEYE
FT                   LSMPEGVIYYEARLRLLPKKNQIMVIIRDISEPHRSAELIRHQAHFDSLTDLPNRFLSL
FT                   DRLSQILLEVQKSHEKAAVFFLDLDDFKKVNDSLGHEVGDELLIAAAARLQQTLKKSDT
FT                   IGRLGGDEFIVLISNLNDENDALAIAERLLQAFRKPFKLVGRDLILTLSIGIAISPKDG
FT                   TCASVLLRNADTAMYQAKTMGRNTSSFFTPQMNVAMRRRFEIEEQMHGALERNEFELYY
FT                   QPQIDVKTNTIVGAEALLRWHNIVLGEITPDEFIPIAEQTGLITPIGVFVLQQALRFLN
FT                   EWQSINKQNYTMAVNLSPRQFRDPELVNIIKHTLHKNSINNECLELEITEGVLMNSQAS
FT                   IHDALLQIDELGIKLSMDDFGTGYSSLSYLREYPFDVLKIDRSFITGITDNKADCNLVK
FT                   AAIAMSHSLEIKVVAEGVETKEQLDLLNELNCDIAQGFYLSKPLPAAKLLNFSLRYLKA
FT                   L"
FT   gene            complement(211825..212505)
FT                   /locus_tag="PSM_B0187"
FT   CDS_pept        complement(211825..212505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0187"
FT                   /product="oxidoreductase NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70227"
FT                   /protein_id="ADT70227.1"
FT                   /translation="MATQKVILITGASSGIGEATAKTLVNNGHKVILTARSEDKLNKLV
FT                   DELGHENAFSVSADATEFNELENVVSKGVEKFGRLDAAFANAGMGVSSPGTENGDPKEW
FT                   SAMVDLNIKALLWTAKLTLPHLRENQGHFILTSSAAGRRPIDGSIYGATKWFAHGFGQN
FT                   LAEEMKPWHGRCTTIAPGMVNTPFFDEAKPDKLDPQDVADAVLFAIEANQRNSVREIYL
FT                   MPTN"
FT   gene            complement(212764..214110)
FT                   /gene="astB"
FT                   /locus_tag="PSM_B0188"
FT   CDS_pept        complement(212764..214110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astB"
FT                   /locus_tag="PSM_B0188"
FT                   /product="succinylarginine dihydrolase"
FT                   /EC_number="3.5.3.23"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70228"
FT                   /protein_id="ADT70228.1"
FT                   /translation="MHALEVNFDGLVGPTHNYAGLSYGNVASLNNAASFSNPQEAVLQG
FT                   LAKMKAMRDKGLTQGVFAPHARPDLNVLRRLGFTGNDAQVINKAFKADPILLRACYSAS
FT                   AMWTANAATVSPSPDTNDGKVHFTAANLNNKFHRSLEPNTTTRLLKAMFNNEQYFAHHS
FT                   HLPEQGFFGDEGAANHTRLCDSHGETGLELFVFGASAFNSQLVKSVKFPARQTLEASEA
FT                   ICRLHNIKDTSQILLQQNPDVIDQGVFHNDVIAVGNANVLLCHQQAFLNQTQALDDIRE
FT                   AYVGNKQLYIIEVPTSKVSIQDAVSSYLFNSQLVSLSDDKMLLVAPQECQRNPAVKAYI
FT                   EEMIIDDNPINQVQFFDLRQSMQNGGGPACLRLRVALNSQELAAVNPEVILDEQKYTQL
FT                   CDWATRHYRDKLGANDFADPALLTESYQALDELTQLLSLGSVYPFQLEA"
FT   gene            complement(214192..214311)
FT                   /locus_tag="PSM_B0189"
FT   CDS_pept        complement(214192..214311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70229"
FT                   /protein_id="ADT70229.1"
FT                   /translation="MSNLYNTLYFLWRLDITVWQVNEPTNTHTTSEKERIYSR"
FT   gene            214335..214487
FT                   /locus_tag="PSM_B0190"
FT   CDS_pept        214335..214487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70230"
FT                   /protein_id="ADT70230.1"
FT                   /translation="MTIKYKEEVCQLFIEYFMNINQIFTIISLIPSLVEAPNWGSDYKI
FT                   CTFLV"
FT   gene            complement(214540..215634)
FT                   /locus_tag="PSM_B0191"
FT   CDS_pept        complement(214540..215634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70231"
FT                   /protein_id="ADT70231.1"
FT                   /translation="MTHLKKRLIAITYSITLLVSNGALANNSELTTVATFDAQHPPGNI
FT                   AITPSGRKFLSIHGFYGQNQKIMELLSDGTTKPYPNEQWAYAYNKGKGFYGVLGVNVSS
FT                   DGILWMLDTSGPDHAGRLVGWDTNQEQLHKIIYLAKPTITDTSFLNDLVIDNKHGVIYI
FT                   ADTAQGSQAAIIIVNLKTGEARRVLQDSQYTTAENIDMVINGRTMRLGGQPARLGVNPI
FT                   TLDPNEDWLYFGSMSGTSVYRIATSAINNEQLSAKALEAKVMRYGTKPISDGITVDGGG
FT                   NVYVTDITNGAIGVVKPNGDYEVLFKDDRLSWPDGFSYGADHKIYFTVNDLHNSPVLSN
FT                   DKTQNPNKFKVMSFTPLVKGKVGR"
FT   gene            complement(215682..216158)
FT                   /gene="ohrR"
FT                   /locus_tag="PSM_B0192"
FT   CDS_pept        complement(215682..216158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="PSM_B0192"
FT                   /product="OhrR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70232"
FT                   /protein_id="ADT70232.1"
FT                   /translation="MQTKILCIEMKDKAMSFEQLKLKNQLCHRLYMASNSIARAYREPL
FT                   AELNLTYPQYVVMMALWEQDEVTIAELIDKTAIDGGALTQILKKMTDKSLLNVIKDEHD
FT                   KRKRLVQLTHTGHSLKLEAADIPKRIFCKFDSIDTTQAQQLMQLLDLVVNDLTD"
FT   gene            216246..216674
FT                   /locus_tag="PSM_B0193"
FT   CDS_pept        216246..216674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0193"
FT                   /product="putative organic hydroperoxide resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70233"
FT                   /protein_id="ADT70233.1"
FT                   /translation="MNVLQNVAYTAKATATGGREGVAKSDDGRLNVNLSTPKGLGGDDG
FT                   QGTNPEQLFAAGYAACFIGALKFVAGSEKIALPSDTYINSEVSIGAIDAGFGIAVKLAV
FT                   SLGDMDKAAAQALVEKAHQVCPYSNATRGNIEVELSVI"
FT   gene            216876..217232
FT                   /locus_tag="PSM_B0194"
FT   CDS_pept        216876..217232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0194"
FT                   /product="putative arsenic resistance operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70234"
FT                   /protein_id="ADT70234.1"
FT                   /translation="MNQLNPLHFFKCIADDTRLKTILLIAHEDELCVCELVAALDVSQP
FT                   KISRHLAVLRQCGLLADRKQNQWVFYSLNKSLPDWAKDVITKTLHATPTFYEHQLQRLN
FT                   VMGKRPERILKCCD"
FT   gene            217249..218262
FT                   /gene="gapB"
FT                   /locus_tag="PSM_B0195"
FT   CDS_pept        217249..218262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapB"
FT                   /locus_tag="PSM_B0195"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70235"
FT                   /protein_id="ADT70235.1"
FT                   /translation="MTIKVGINGFGRIGRLTLRAAIDWPEVEFVHVNDVAADAKTHAHL
FT                   LEFDSVHGRLKYEVQADDNSFSVAKHTVKVTNNKSIAETDWSQCDVVIEASGKMKTTEL
FT                   LNAYLAQGVKRVVVTAPVKEESVLNVVIGVNDHLYNPQLHKIVTAASCTTNCLAPVVKV
FT                   LQEKVGIKHGSITTIHDITNTQTIIDAPHKDLRRARSCGTSLIPTTTGSATAITQIFPE
FT                   LKGKLNGHAVRVPLTNASITDCVFELERGVTEQEVNGWFKQAANNELKGILGYEEKPLV
FT                   SIDYKTDPRSTIIDALSTMVINHTQLKLYAWYDNEWGYANRTAELMLKVGQSDLVN"
FT   gene            218278..219498
FT                   /locus_tag="PSM_B0196"
FT   CDS_pept        218278..219498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0196"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70236"
FT                   /protein_id="ADT70236.1"
FT                   /translation="MFSQIANLPSALKQYGIITGNYWAFTLTDGALRMLVVLYFHQLGY
FT                   GALAIAMLFVFYELFGVITNLIGGWLGAHLGLNKTMNIGLGLQVVALAMLCAPSDWLSV
FT                   SYVMLAQALSGVAKDLNKMSAKSAIKYLVPEGDNQQSQLYKWIAILTGSKNALKGVGFF
FT                   LGGLLLTLLGFVGALVALIMLLTIAWIISLVYLEGDIGKAKNKPKFKALLSKSRAINLL
FT                   SAARFCLFAARDVWFVVALPVYLASQFNWPHWWVSGFMALWVIAYGVVQSQAPKITGKS
FT                   LVSNDAIKKAFYWGGVLACVTLLLACLMQFNIAVNTTLIVGLFIFGAAFAINSSLHSYL
FT                   IVSLAKSDGVSLDVGFYYMANAAGRLVGTVLSGFMYKVYGLQACLWVSASLLLLVCLIT
FT                   QRLTKQS"
FT   gene            219612..221729
FT                   /locus_tag="PSM_B0197"
FT   CDS_pept        219612..221729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0197"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70237"
FT                   /protein_id="ADT70237.1"
FT                   /translation="MREIALAKKLLWISVGSILLTVVLFSGILWSKLSSSNAQTSSEAE
FT                   TLIVSEVDGRLTANAAAYGEKIAAFINEAYRIPYSLGSILEDADKTSINRESVALLNRS
FT                   ILESNDVISSIYSQFEKNGFDGKDSDFTQGYDHSVAGAGTLEVYLTRNSNGVVEQQVVE
FT                   DASEKYVDKINEFGLREAEWYLCAKDKLKPCIMEPYLYEITPGYSEMMTSLVVPIIKSG
FT                   KFVGVTGADITLPVFQKLTEELSKALYDGKAKVTLLSHLGLIVGTSHYKEKLGRPLKEA
FT                   VSAKSYESYKALKGTKGTNKQGAEIMVSYPIEIKLADVKWMLLIEVPAELAFEGPIQLT
FT                   AGMSEAAKELGVIILITGTVIAVLAFIVMKLVVGSVVAPLKQIQERVDNLASSEGDLTQ
FT                   TLHVDTHAELIALAGGFNKFLSKLRELISELKAVSDQTKHQGEVTSNIAVETKHNVQAQ
FT                   FKEIESVVTAMNEMSATALEVAKASEQSAQQADEINTLVVSSESSLSSAMTQVKTMSEE
FT                   IKEANQAVEKVASRSNDITQILDVIRTISEQTNLLALNAAIEAARAGEHGRGFAVVADE
FT                   VRALASKTRSSTDDISSLIDSLLSEVGNASTVIEKGVVRAENAVDETSTAFDALHSVVV
FT                   KVDEITNQITHIATAAEEQSLVTEEINRNLTIISDAASQLSDLSAQAGDSSQELNKLVA
FT                   QQDAELNKLKT"
FT   gene            complement(221855..222442)
FT                   /locus_tag="PSM_B0198"
FT   CDS_pept        complement(221855..222442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0198"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70238"
FT                   /protein_id="ADT70238.1"
FT                   /translation="MANKIKFEREHVVRVASQLFWEKGFHATSTRDLQEAINMRPGSIY
FT                   SAFGSKEGLYSESLKDYTVQMKSQIEGFIANSDSILGGLRAFVENVIIKTKDCSPSAIC
FT                   MLVKANTEFAEKDTALSELSAGLLTKFESYLTTLFTRAIENGELSGDLTATAYAQFFQV
FT                   QFTGLRGYFNRPAVEHLAMPMINQMFVLIKKL"
FT   gene            222557..223099
FT                   /locus_tag="PSM_B0199"
FT   CDS_pept        222557..223099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70239"
FT                   /protein_id="ADT70239.1"
FT                   /translation="MAEFTLYTQENVSAEAKPLLADSVAAFGMLPNLHAVMAEAPTLLK
FT                   GYQVLHELFQKTSFNAQELTVVWQSINVEHECHYCVPAHSGIAAAMKVDENIVDALVNK
FT                   TPLADPKLETLRETTLEMTRERGVLSQSQQEKFFAAGYTKQQLLEIVLGLAQKVMSNYT
FT                   NHLADTPVDNAFKKFIK"
FT   gene            complement(223204..223734)
FT                   /locus_tag="PSM_B0200"
FT   CDS_pept        complement(223204..223734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0200"
FT                   /product="hypothetical protein"
FT                   /note="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70240"
FT                   /protein_id="ADT70240.1"
FT                   /translation="MTYLKASMLLFSLCIFSIQANNKTDLLEPELAVFTPYLGTWQADF
FT                   HIDKNPLPTQDVTKWERTLNGKAIRTTHSINEGEYGGESMIFYDRKKQSLVFYYFTTAG
FT                   FYTKGVMKVLSPTQFVAYEDVTGSQEGITKVKSTSEFKDEQFVVSTSYLKKGEWTKPQI
FT                   RTYHRSNKEVKFK"
FT   gene            223786..224151
FT                   /locus_tag="PSM_B0201"
FT   CDS_pept        223786..224151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70241"
FT                   /protein_id="ADT70241.1"
FT                   /translation="MIKSSLIIFSSLFIALFWLAYLNNEVEMYLPIYVSLISCITYIYY
FT                   AWDKRKAVQSNHKKVSRIPERHLHLLALFGGWPGALIAQQSLRHKSQKRVFIAVLWVCI
FT                   VVNISVISYAWFAYYRI"
FT   gene            complement(224199..224543)
FT                   /locus_tag="PSM_B0202"
FT   CDS_pept        complement(224199..224543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70242"
FT                   /protein_id="ADT70242.1"
FT                   /translation="MKNLSLLAAAVILTGCSTTSSVNKPEEVVIEPTSQVSEENAPISL
FT                   TVITNPADSRVRIMNIVPVYQDAIELDAGKYDIEVSKAGYVTYRKWVTVDKKTILTIEL
FT                   DEKQLSQSAQ"
FT   gene            complement(224720..226693)
FT                   /locus_tag="PSM_B0203"
FT   CDS_pept        complement(224720..226693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0203"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70243"
FT                   /protein_id="ADT70243.1"
FT                   /translation="MSNINDNNDKTQIASLDSSTKKTSSIHKQNLLGKKISDRYLIEEL
FT                   IGQGGMCYIYRARDTFLENSGRSEASVAIKVLQEEFSNSEEAISLLKDETAKTQQLAHP
FT                   SIVKVYSADSDGDLYYVTMELIEGETLEQIIKRNKPSGLAFKKAKIILEQLTDALIYAH
FT                   SRGVIHNDLKPSNIIFDSNGNLKVLDFGIAKHKSLDDQYAVKNESEFATIGGYTPTYAS
FT                   PEQLKGGEASIKDDVFSFACIAYELLSSKHPFNRIAADKVPKNTTVKKPSNCPLLLWKN
FT                   LHKALSLSASQRLDSLEQISKTLKVNLKPAIFASVASVAIIALITQNYFSSSDNTKQLQ
FT                   AQLDNAKAINQQVEAWMSWQGPTILNKLEQIPPQYEVLKQGLLRSNQQSILDSFNDEAS
FT                   QFNNIAGRKFKDFDKIIAVYSNALNYYPDSEKLSMQLESVLRERQSIIFDITARIDLLL
FT                   EQSRYNEDQPNSIAHLVKDLKEVDKTYRYQPTDLHLDNFTVALNTAIESDDVISQKVLL
FT                   NVGKIVFSNNKKAEELLANLMKRESAINALTAYQQKINLGEQAEFPRADAVIFYGPKFQ
FT                   RFSAQLETIEDHKALMEFEEFIKSESTALPNDFSLLVSLRKELSRRYISTANDLMKKRM
FT                   YKAAERLVEKSEAITQSLDNML"
FT   gene            227087..228358
FT                   /locus_tag="PSM_B0204"
FT   CDS_pept        227087..228358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0204"
FT                   /product="FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70244"
FT                   /protein_id="ADT70244.1"
FT                   /translation="MELILNITSYHRLSPEIEATKTVKDSLTFGRSEGCDWHLPDPEKI
FT                   ISSKHGRIEKEGDSFYIYDNSTNGLFINFAVAPLGQGNKQRLSDSDVLTIGDFQVDVSL
FT                   ADEPHADISNPITSNSSQQVSTFASHSSQTAESAPLFNDSIMNESMPAVSVISQQATAD
FT                   NHIPEDWDELTRLMNTDEFDLGNDEVNSSAPVDTPAPIKESAPTKRYNAEQQAVKQTAP
FT                   VKSFAQNDKVFCDAFLNGLGIKDELKSALDNEKLWFEMGQGLSLLLTELMESLRQRAIV
FT                   KNKLRLNHTMFQTEQNNPLKFSANIDDVIQNLFIKNSASFLSSNESIKESFVDTRKHEQ
FT                   ALLAGADGVLKGMLSQVSPVQINQQANDNSNVLKIIPGQIESKCWKLYQSLYDDISQEV
FT                   NAKGAMAMSDDFLKAYNDRIKETL"
FT   gene            228374..228838
FT                   /locus_tag="PSM_B0205"
FT   CDS_pept        228374..228838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70245"
FT                   /protein_id="ADT70245.1"
FT                   /translation="MHKVKLYLMSFSLLFLVLGCTTMNKIVPPSTDLIINVSKNVNPDT
FT                   SERPSPVVMKIFELSSRTIFDTQDFFSLYDTPEKILGPDLLKKDELELQPDSVQQYKMS
FT                   LNRNTRYVGVVVAYRNIDQARWRAVIEVDPTGYDDINVNVEAIATYMREQ"
FT   gene            228854..230182
FT                   /locus_tag="PSM_B0206"
FT   CDS_pept        228854..230182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70246"
FT                   /protein_id="ADT70246.1"
FT                   /translation="MGDNTRVAWTEGMFLRPQHFQQSDKYISNVIKQVCSGNLADPWGI
FT                   IDISIDNELLNSGQFAVDSLTAITPDLLPIDMPQSTSLPEPLVVNKDVFDEIVYLAIPA
FT                   LKNSGVNISSTDDNMVTRYKLNDLAVSDDLLGAQSQEIIQVAKVYSKLMLSSDDHSGYI
FT                   VLPLARIVDVSSEGQIKLDAKYIPPSLKVGQCKPLSGLVREIGSMIKQRAESIAARLCQ
FT                   GYAGSTSVADFIMLQTLNKYDAIFNNLLSVNSLHPNVFYSRLIELAGELSTFSTANKRV
FT                   PKLPNYDHTNLGQVFSEVVNFLYQSLSHVIEQTATEIKLEQSKFGISFGALKDKSILNS
FT                   AQFVLAIKASVPHEELRKILPSQIKIGSVETIRDLVNNQIPGITISNLPTAPRQIPYHA
FT                   GFHYFELNRHGEHWEKLRSSGGIAIHLSGSYPELQLSLWAIRT"
FT   gene            230205..231485
FT                   /locus_tag="PSM_B0207"
FT   CDS_pept        230205..231485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70247"
FT                   /protein_id="ADT70247.1"
FT                   /translation="MDETIIKPRPGRLGRNTPSSGAAQNDADKTVMSVEPPSAKPMSNN
FT                   KVSIFKNPLLEAATDCFSLVISINQSLEMSNLAALKHRCVEAIKRFEVEVRNQHLSKEV
FT                   INNSRYCLCAILDESVLNSKWSSMEWADESLLSTFHKETFGGEYFYTLLDAGLGQPEKN
FT                   KQFLELQYHCLNLGFKGKYRLDAGGDTKVEEYRSQLYHLLNQLDGPINNKLSPNWQQRV
FT                   AAGVELRNQVPLWVIFSVLGLILLMIYLSINMKLNNDVFAINEKLAGIHPLAVNQTVDK
FT                   KDQQLRVLEQLLQTEIKMGIVAVAKNSDGIRITINSENLFKQGDSQLLPSFQPILEKLA
FT                   LSLEGTKGRVLITGHTDDLPISTDKYPSNWHLSLARATQVANLMAKSTNLSGRLWPEGK
FT                   GAAEPIASNSDSASRSLNRRIEIDLLF"
FT   gene            231615..235004
FT                   /locus_tag="PSM_B0208"
FT   CDS_pept        231615..235004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0208"
FT                   /product="ImcF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70248"
FT                   /protein_id="ADT70248.1"
FT                   /translation="MADYVPLAGVASRLLTILLVLLVFSVTKIYRLMQQNKRDEKMADE
FT                   LIDNNDANSSEVNEEITTLKTRMNEAIDLLKDVKLFKGKNIYQLPWYIMIGPPGAGKTT
FT                   VIHNSGLDYPLKDKLGVDLVHGVGGTRNCDWWFTNKAVLIDTAGRYTTQSSHAKHDSRA
FT                   WEGFLGLLRKHRPLRPINGVMISMGISELMSQTKTERNLHARAIKQRLQELQNQLGMTF
FT                   PVYVIFSKVDLIEGFREFFAELTEEECEQVWGITFELDLDKDTQVDAFNKEFHALISKL
FT                   TEMLNRRLINERNEAIRAKIFEFPRQLRVLQGVGDDFLKEIFTPNAYEELPMFRGVYLT
FT                   SATQEGTPSSFLNDASAGKTDYINQSKSFFIKNVLESVIFPEQNLASTNKHHDKQNKWL
FT                   RVASISAACVALLGFSVSWYFSFAWNSNLIDATDEAITTYQELDASSFDRNNLLVLNDR
FT                   LNALRNLPATNSELINPEDASSVGFNKLTEIKESSTNAYKRSLQTYLEPFVANTLIKEM
FT                   EAHPEHLSYLYETLKCYLMLFKPEYFESEDIVVWFSAYLDRNLPGDMNMQTRGELMNHI
FT                   SALLNEGITQTEIDNQAVRVARAELTKLPIAERAYQRLQADFLDSSIPPFRLTDIISFE
FT                   SAQKFTFRNNGDLTRSIPGLYTFNGFHGIFNIEKGKMLGNLMASSWVYGQEASGTYDIS
FT                   KAEIEKKLEQRYFQDYIYYWQSFLDDLSLNQYSSPAEGVNITDVLAGSEAPIKNIINAV
FT                   KKNVQLTKLPVSENQKVAGDVAANAAKVAMQTKANRIKRFLPDEAPKFEIDLPGYQVEE
FT                   AFEDIIDIDVQQLDNIQKNLRELNIYLTKLDRGDQLKYSIKDQISGKSKPSFIRQLEYQ
FT                   SSDLPYPFNSWLLDISRDTSNITKNSANRHLNEIWKSKVLREYNAAIVGRYPFAPQAEK
FT                   EVSIKDFTRFFGPNGTIDNFFNSYVAPSVDMSSTPWKFEKDIGISNNTLKMFEHAYKIQ
FT                   TAFFDRGSNTPRIEFGLRTFKLDKTVSSFMIEIDGQSMIYRHGPLKVTNFVWPGASGQS
FT                   KTRVVFTPPNGGRSINTTYQGEWSLYRMLDELSEKRSKTREDLELHFSLMGNNAKVELL
FT                   PSSIRHPFWNSSVEKFSCPTRL"
FT   gene            234986..235714
FT                   /locus_tag="PSM_B0209"
FT   CDS_pept        234986..235714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70249"
FT                   /protein_id="ADT70249.1"
FT                   /translation="MSDPIVDIGYLGKVPCLGDFVQDNVTKEFSEHWEQWLQAAIAVSK
FT                   EQLGDVWQENYLTGPVWHFALSPNIVGDTGVMGTLLPSMDAVGRHYPLTVTRTTHIAPV
FT                   DVLHSGVFSLEYEDAVLKVLDGSVDLFSWRKELANTLSEITSTKKQVSFANSLDKNKQA
FT                   TALEFSGTELSDHILQDTMHAILYKKYGDYSVWWTHGSCNIKPMVLITSALPPVNQVAA
FT                   MLDGRWKHWEWNFTQVKNSD"
FT   gene            235707..236504
FT                   /locus_tag="PSM_B0210"
FT   CDS_pept        235707..236504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0210"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70250"
FT                   /protein_id="ADT70250.1"
FT                   /translation="MINNLSSSYAITHRGAVRQLNEDAHVEINSHNLWVVADGMGGHEA
FT                   GEVASQLVVDVIRTHVEKFKLEDLNVSDIVKAIEDANKQLTEYSAQYLSNKTAGSTVTA
FT                   LFVKNERYYILWVGDSRAYLLRNSKLTQVSRDHSQVNDLIDEGMISVEEAKNHPLSNVI
FT                   TRAVGVMDEVKVDIVEGDINTGDIFLLCSDGLTGELSDEEICLSLEPSSIIDSGMALMH
FT                   SSLVRGAKDNVTCILVKYDDVDANQSIQSCNLQDEATIPLFTK"
FT   gene            236708..237823
FT                   /locus_tag="PSM_B0211"
FT   CDS_pept        236708..237823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0211"
FT                   /product="ImpA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70251"
FT                   /protein_id="ADT70251.1"
FT                   /translation="MFLFEEYISPISDAEFAGIDPRSDVSPTSTYYALKDLRNQLRAAE
FT                   RNALVDEEGIASLSRDWLPLLEQCSEAVKSESKDIEYLAWLIEGLCRVHGFKGIAFGFS
FT                   VAKHLLEHHFESLYPTLDDGDEISDKVSALVGLNGTAGEGTLIIPIKSIYMTDSVSMDP
FT                   FSFWEYQQGYDISRLNDEKREKKIAQGAVDFEQLEKSAAETSTEFFVSLKNDIEDAIEQ
FT                   FAALSEVMDEVTGEPQPTSNIKQALEVSLAAVKHVAADKLEAAQTALDKANAEPEEELV
FT                   EDAIQADSEQPKKLSSDEINSRENAIKKLQEIATFFRKTEPHSPMSYTIEQVIRWSELS
FT                   LPELLNELITDSDARTGYFKLSGIKISETET"
FT   gene            237839..238342
FT                   /locus_tag="PSM_B0212"
FT   CDS_pept        237839..238342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70252"
FT                   /protein_id="ADT70252.1"
FT                   /translation="MSIHDKLKRVRKPRVHITYDVETEGAAVKKELPFVVGVMGDFSGD
FT                   NTEALKPLKDRRFIQIDRDNFNDVLKRMSPSLRLKVDNTLTDDGSQFEVNLNFKSIDDF
FT                   EPAAVVNQVEPLRKLMETRNKLRDLMTKIDRSEELENVLEEVLSNTASLDSMAKELNLE
FT                   ETDK"
FT   gene            238339..239829
FT                   /locus_tag="PSM_B0213"
FT   CDS_pept        238339..239829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70253"
FT                   /protein_id="ADT70253.1"
FT                   /translation="MSTEQLATESESVAEVSSSLLEQAIGATKQTESSRAEELLKTLTE
FT                   EALKGTVQWNKNMTVTFNEAIQLIDQKISKQLSVVMHTDEFQKLEGSWRGLHHLVMNSE
FT                   TSSTLKIRVLNMKKKELHKDLSKAVEFDQSQTFKKIYESEFGTPGGEPYGTIVGDFEFT
FT                   NHPEDVETLSLMSNVAAAGFCPFIAASSPSLFGFDNWEELTKPRDLEKVFESLEYTKWR
FT                   SFRDSDDSRFVSLTMPRFLSRLPYGAASKPVEEFNYEEFEVEAKDGRSVSTDNSDYCWS
FT                   NAAYAMATNMTAAFSQYGFCTAIRGAEGGGKVEGLPTHIFTSDDGDPDLKCPTEIGITD
FT                   RREAELSQLGFLPLCHYKNTDYAVFFGGQSCQKPKIYSTPDATANAAISARLPYLMATS
FT                   RFAHYLKVMARDKIGSFMEAEDVESWLNRWILSYVNATEGGGQDIRARYPLADAKVSVK
FT                   EIPGQPGAYNAVAWLKPWLQMEELTSSLRLVAKIPEIG"
FT   gene            239867..241393
FT                   /locus_tag="PSM_B0214"
FT   CDS_pept        239867..241393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70254"
FT                   /protein_id="ADT70254.1"
FT                   /translation="MNHEEFSFINQDFTFQQKSQSRISDNDALLDRFLNEKNLDKALLL
FT                   WLEGSSDSPLSWNKESLSPYLQRVIIELDQLISSQLNHIIHAKSFQNLEASWRNLWWLL
FT                   LQTEQQDKEKKVKVKLLNCDWPTLSKDVNKAIDFDQSTFFQLLYQNEFDSAGGEPFGIV
FT                   IGDYEISNGCSAGTIYNDIDTIKEVSRTAAAAFSPFICSASANLFGADSFSDLGYYSDL
FT                   FNHFEQPEYIKWQSFRKMEEARFMGFTLPHVLVRPPYANDGKRHQEFYFKEQIINPETD
FT                   MLWGNAAYQFVSTIIRAYCDSGWFGHIRGIEPGKVSKGLVTGLARDSFANDTYQKEAKP
FT                   PLDLLVTSKFEKQFSELGFIPASSVTNTEHIVFYSNASVQKTKNYDSSAANINARLSSM
FT                   LQYILCVSRFAHYLKLLARDRVGSYSTAQACERDLQAWINNYTTASDSASEHIRSKYPL
FT                   SNAKIKVSENKANPGHYFSVLQLQPHFQLDQMVSSIKLITELSPHHKIKE"
FT   gene            241396..242175
FT                   /locus_tag="PSM_B0215"
FT   CDS_pept        241396..242175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0215"
FT                   /product="virulence protein, SciE type"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70255"
FT                   /protein_id="ADT70255.1"
FT                   /translation="MKKIHSLIREGKLADALLCCATELQDEPLNFDIRSLYSELLCING
FT                   ELEKADKQLDFMVQKNPEFAVGAVNLRHLIRAQQSRVDFYQGKGIPKLFHEANELDTLF
FT                   LKMHVALLEGETSEAATLAKQMEALRLESVDDEHSAIRDLDDSLSPYLEVLGTNGEFYL
FT                   ANFNEIEALKVEPVTSLLESIWLRVEITIKDGPSGTAHLPLVYANSNTELEKLGQVSDW
FT                   DELQDEFIVGKGMKMLFVNDEAITIPSLKINAVETAE"
FT   gene            242191..242676
FT                   /locus_tag="PSM_B0216"
FT   CDS_pept        242191..242676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70256"
FT                   /protein_id="ADT70256.1"
FT                   /translation="MIEHKQQLQASILDRLIDDEPDFQDAPSRTEGISISELRKNVRRD
FT                   IEALLNARIQWHTWPSQYAELSTSCLSYGLPDFSSMSVSSHEGRALLCETVRNTILKFE
FT                   PRFIEVEVFTDDEVPVNRVLNLRINALLYADPEPEFISFDSEVEPVNLGMKIIEASL"
FT   gene            242673..244499
FT                   /locus_tag="PSM_B0217"
FT   CDS_pept        242673..244499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70257"
FT                   /protein_id="ADT70257.1"
FT                   /translation="MNDELLKYYNRELAFVRHMGKDFSEKYPKVAGRLKLSDDHIEDPH
FT                   VSRLIESFAFLTANIRQKLDDSFPELTDALLGQMLPDYQAPIPSMSVVKLEAENLSTTG
FT                   VVIPRGSEVETNVESMKQCKFQTCYETYLWPVEITSAQFDNSPFVAPKPRWHEKAKSIF
FT                   KLELTGEYPGVSLAETGLEKLRLFINGQWHHTLKVYELLFKHAIGIAFDNGEEGIKYLS
FT                   KNQLKAVGFDANEAVVPYSQRSSAGYRLLVENFTFPEKFRFVELENIRSSLPKKSNKCS
FT                   VYIYLDSESTELEKQVDKNMFLMGCTPIINMFEQELEPIRPELSEYEYQLTPRYMDSEI
FT                   SEVIGISEVIAFDHKGNKQIVCPFYGQTHPRYQGHDDLFWHIRRETASWAGGYVESGTE
FT                   SFLSLVDARFENSAMDYAEGNTVLTVRANCSNRNLPASMPFGDDELGLLMPERGDVIKK
FT                   IRCLIPFTHAVRPILADATRWQLVNHLTLDAFSGDDACNKLKEVLRLYDFRASPQTKGL
FT                   IDNIYRVIVEPATARVVQKGRVSFATGSEIEITFANDDFSGSGMFFFASILDHFFAQFA
FT                   AINSFTRVSLRLKEQEQVYYQWPARVGESPLI"
FT   gene            244463..245485
FT                   /locus_tag="PSM_B0218"
FT   CDS_pept        244463..245485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70258"
FT                   /protein_id="ADT70258.1"
FT                   /translation="MACSSWGKPVNMIQHIISQASQVDFYKAVFIIENQLKKHGLEYRY
FT                   VGYDSSPKQELIKFTATQKFGYPGNAITKLEQASFEDGLHKVNMQISFMGLTGCSGALP
FT                   QFYSELVMQRLRYKDTTMRDFYDMFNHRLVSLYYRAWKKYKPSLNHVNKDKNKDPYTQI
FT                   LGLLSGGYNDHQLHFSGLYSRKIRNAFDLKSVLSSYLGCDVVIKQMVGKWHDLKPQEQT
FT                   CLASERLYEGQHARLGVDTVIGKKIWDISSNIEIHISTTDIDKAKSLLPKGKLFELATK
FT                   IVKDYAGNAISFRLIIESDFQQLDAVQLSKRECQLGANSFLMASKNTPKFNPIKLSFKG
FT                   "
FT   gene            245509..248127
FT                   /locus_tag="PSM_B0219"
FT   CDS_pept        245509..248127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0219"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70259"
FT                   /protein_id="ADT70259.1"
FT                   /translation="MSTMTLNKLVEKLSPDCRKSLEAAVAICNSRSHFTVELEHWLLAM
FT                   IEQQLDDVRLIFGSFDIDIDQVKQDLNQSLESFKTGSDSSPSLSVHVTTLLRQSWLSTS
FT                   IEFTDEQIRSAYVIYTLTKDDTLSSLVTRCSKLFNNIEPGQLLHAWPEIVAQSQERNTA
FT                   NVTAATPANGSSKTPSLDQFTVDLTAQAKAGKIDPILGRDFEIRQMVDILTRRRQNNPI
FT                   LTGEAGVGKTAVVEGLALRIAQKDVPAVLQNVKLHSLDLALLQAGAGMKGEFENRLKSL
FT                   INEVKNAVDPVILFIDEAHTMIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKK
FT                   FFEKDAALTRRFQVVKVEEPTPEKAVAMLRGLVPVMEKHHKVFISEQALESAVHLSHRY
FT                   ITARQLPDKAVALLDTACARVAMSQASTPNAIEQLMNRLSEIEAQVLMLNREQKTGLDH
FT                   SEQLSALKSELVEIEQQLEPLNEQFNVEKGIVAELNQALESINTNDADSSAEVLEQLKE
FT                   SKLKLASYEHNMVHWQVDEELIAQVISDWTGIPVGKMHEDEIHGILNLAAQMKQRVVGQ
FT                   DHALELMAKVVQTSRAQLADESRPNGIFMLAGPSGVGKTETALSLAQEVYGSEDNVTVI
FT                   NMSEFKEEHKVSLLLGSPPGYVGYGEGGILTEAVRRKPYSVVLLDEMEKAHPGVQDIFY
FT                   QVFDKGTIKDGEGRDIDFKNTIIIMTSNVGTDTTMSLFEDEESKPSIKGLLKALQDDLL
FT                   GAFKPAFLGRINVIPYIPLSDEILTQIAALQISKIIKRVKKHYDAQLTYNDDVIEHIIA
FT                   NCQNAGSGARNIHTILQNKVLPLLSEILLSSMVEGEKVTSISLLIKDNEFDVELTKVNS
FT                   K"
FT   gene            248348..248827
FT                   /locus_tag="PSM_B0220"
FT   CDS_pept        248348..248827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70260"
FT                   /protein_id="ADT70260.1"
FT                   /translation="MQANTYLKYGSIKGETTAESFKDLITVLSLDWNVSREISAATGTA
FT                   MDRESSSTRLGDVTITKLQDKASPDLFKEATIGKGLPAVFHITKQGDKVEEIMKIELTD
FT                   AMISSYSVSVQNDRPIETITISYTEMMMTVTPTDDQNNITAPLVYGYSGVKGQQM"
FT   gene            248901..250754
FT                   /locus_tag="PSM_B0221"
FT   CDS_pept        248901..250754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0221"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70261"
FT                   /protein_id="ADT70261.1"
FT                   /translation="MQKATQDKNVIQISTPVGKDALYLTRFVAQEAMSDLFVMSVNMYT
FT                   IGQQIAHEDLVGKPVSIKVKNAEGGGERFYHGIVSQLVSNGSRTADVDEQKNYIDYQAT
FT                   IVPFAASMRNRKNSRIFQKKTIKDIFADLFGQHNVAFSDKTSKTYPKYEYCVQYQESDF
FT                   DFIQRLLQSEGIFYFFEHTKSNHTLVLADDITAYEMCGEAKVVHSTGHLSESHVSRWQG
FT                   GLSLAPGSFKRLGYDFKQPSRYPDAEQANAELPTQSVSEIFEYTAEAECHPRAANLASV
FT                   QLESLQRDMKLSSGRSDCRSFSVGKLFSFKKHEDPRLEGKTFAITSMMTSIVVPNQSGA
FT                   AQASSEEVYSNHFECVPKDIPYRAQVSKKKPVINGVQTAIVTGDSADEIMIDQYGRVKV
FT                   QFDWDREGKKDSKSSCWIRVAQNWAGKKWGAFFFPRVGQEVLVDFINGDPDQPIISGAV
FT                   YNADLMPPYALPGEKTQSGIKTRSTKEGGADNFNELRFEDKKGSELVYMQAEKDKQLYV
FT                   KNDQNEKIDNDRNVEILNNDNLKVTANRVAEMGENDTLKVGKTLNIEAGDEIVIKTGSA
FT                   QIKMSSSGNITIEGTNIDIKGSNVKVDGSAITLSAGVIKLN"
FT   gene            250757..251113
FT                   /locus_tag="PSM_B0222"
FT   CDS_pept        250757..251113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70262"
FT                   /protein_id="ADT70262.1"
FT                   /translation="MEIVNNFQSGFRNGIANNGHVVYCRYGLPHLVCLPINRPDDPLLS
FT                   PALSHLKAMNGYYAQQFFIHLSDALNSENVISNLYQYATQSAVALSDHSKDELIEEISL
FT                   LVTSNKLLVIPLYE"
FT   gene            251152..251442
FT                   /locus_tag="PSM_B0223"
FT   CDS_pept        251152..251442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70263"
FT                   /protein_id="ADT70263.1"
FT                   /translation="MGKPAATIGHMHVCPKVTAKVPHVGGPIVAGSGNVLIGGMPAARK
FT                   GDMIVCVGPPDSVKTGSGSVQINGKPAARMGDDSGHGGKIVVGNPTVLIGG"
FT   gene            251445..252470
FT                   /locus_tag="PSM_B0224"
FT   CDS_pept        251445..252470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70264"
FT                   /protein_id="ADT70264.1"
FT                   /translation="MLATYLSDHQAQLLQISNAQLCPFTCVGHVRYLRKTLLESCWLTA
FT                   KNNNQKNNFELPTTEQLVEIITNTKNDELVAQACIEVMANLPQNKNIIFINELLNEPAL
FT                   SAFFKIIINKVVIQQHSFNLIRLLNLNTLFFAYSAEEEIAPQTLVTINQITSLAQHHDR
FT                   QILTAIFDALSEQAHLSPLMSLFLLSLNFEQVNSLSNHASNTLSVDHTLHILLQSGFVK
FT                   LIVLANSLLQQVEQPALIIALIRRMLGDKLDQLVEYDIQRLAWQGDESALIDFQQQLKH
FT                   NWPKYETAMSSLRLIAGHPLDEVPNAIYLSAMDSYSQGVFNLYRYYQHLAANKTQDEVA
FT                   P"
FT   gene            252467..253312
FT                   /locus_tag="PSM_B0225"
FT   CDS_pept        252467..253312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70265"
FT                   /protein_id="ADT70265.1"
FT                   /translation="MSAFSIEMTCFSVPNISSVDTLLFDDNSAVFNELQWQSWDACVYD
FT                   CIIKSKELMAEVTDSTLPMIWLLPALSFQDELKQLLAQSLQQLYPDHSNELIFHGTTGA
FT                   HSAIALAGEKKWQKFNVIALDATFKANKQQQFVYQGVGGALAVVEMVPCGWSQVSHEIA
FT                   ASIDFSKHNQLAGMLTRLAEQTENKIDLIFAPGNGVDDDSWLNNLQLLTSLIDEHTYYE
FT                   LPNYKLGKIGALEGLVNLYQLTTSPAIVEHFSYALMLSQEQAKHQGAASYLWISEEVDS
FT                   "
FT   gene            253312..258009
FT                   /locus_tag="PSM_B0226"
FT   CDS_pept        253312..258009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0226"
FT                   /product="YD repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70266"
FT                   /protein_id="ADT70266.1"
FT                   /translation="MQSNTVVLQGISYPICLVAGKGSAPSGFVAVAANTPESAKNQIAQ
FT                   IGSALTSDAAKRLDVINLLNLAGVSCSRGASARETASVLTQALVADKISCYHQKAKSAI
FT                   QVSDNTNSGAAGKKPSSKSSSTASGKSASQAPAKNSGGASNNTPSEEPITKQECRSDPV
FT                   SMLSGEEILPLIDFTLAGSKQLIWRRLYRSSHADVCSVMGNGWRHDFMVQLTEHYLPPP
FT                   KVGPKQKGTYWLEYQDEHGAKHRFEKVKPGQSSYQLSSNLALHYQTNGKQVLVTPDDQH
FT                   LTFKAGENSWLLEKVINEKGQSIGFYYDAKERLHRVEVNKARGCILKYNPQGLLANISA
FT                   YRTGDNNKPVLLTPLLAQYDYDENKNLVRATNQQGETEHYGYNAANLLTKRTRASGFSH
FT                   HFEWDSYSSSAKCIKQWGDNNTYTYQFEYNLDAGETTCIDSRGHKEHFVHNAQGKLVKH
FT                   TDPNGNVWHYRYNAQGQKITEIKPDSSEIKYSYTPYGQLESITQPDGSVTKFAYNQLGQ
FT                   RVLTTLPDGQTITRKYSVAGLLQSETFGDGRTVLYSYDKFGQLTQHINKDGQVTKFVWN
FT                   EQGELLAKHHNDELIRYSYDSLGRVNATINNAGLLTQYKYNEHGQLAQTIAFDEKDPEN
FT                   KQHQHFSYDDAGRLISSQNSKGDTTEQHFEGLSQPHCVIQPDGSALHLTYDKERNLTAI
FT                   ERSDGHVYRISYDANENPTQVTGFDGTLQQYKYDACNRLTSVTQSDKRHVKIERDKLGR
FT                   VIAQHASLATDTHIVNNANYYSYNLQGKITRAHNAQSTLKQQFDKGGRLVRAEQVHNQQ
FT                   QAHTLKYSYDDYGRRQSLTLPDSSKLNYSYNKFGQLSGIHLQQANSTAVELAALSYDSQ
FT                   GNIQTQKFGNDITLTQQFDVFNRLTQQQLTHPAQALFDTCTYIYDSVNQLIARKEEGVS
FT                   SHNINFEYNSLGQLIQQNLVSSENTKTTQYQWDSFGNPVSQSTVKNDELAEQQTPQHND
FT                   DSDASNKVESNQSESTPNVINSEYNDSNAATFASDLSDNDDVITGTTDADRLTHFGDSD
FT                   FHYDEFGNQIRETGKGIKTRREYNAFNQLSCFNNNGTLTQYDYDPLGRRIAKHTEQGKI
FT                   DYIWDNDQLIGEYQQGEYTWYINLPNQFHPVALIKKGEVYYYHLDQLNTPRFVTNNKTE
FT                   VVWENQADVYGYEESEANTTNSFTQPIRFQGQYLDIESGLHYNRYRYYSPKQQRFINQD
FT                   PIGLVGGINHYQYAPNPVNWVDPFGLSCKEGDAKRVVFAGHGIIDETKSAIVPVGSTLT
FT                   VYAFNGATITDDLGQLIESGGSLNSNVYKKVYVAGDVIPGYVLLDNPGDIELLDSSVQV
FT                   SKPTDISELLAENVGDCHWAACASIFGHENENVIHHTEGIFKKESNKFYQLQDDDSWSE
FT                   LLEDNASEDTRSITKPYGIEQSALEKALINDINPDKVINGRKIINSDLAGTIVKTKGGD
FT                   VAFDTDGFPDFTPYSQKTVSVEGLTGDMLNDVPLAMEKAGIEVYDKTKYVWHHHQDAKT
FT                   MMLIPKSVHSVRNGGVAHTGGRAVIKHNKDNPNNVLNYKSPKELV"
FT   gene            258020..258397
FT                   /locus_tag="PSM_B0227"
FT   CDS_pept        258020..258397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70267"
FT                   /protein_id="ADT70267.1"
FT                   /translation="MTEIKSIKHIIKRVWREPECTLLLSSQVDTTLYSELSKEIPDKYL
FT                   VIEEVFCDEELDDIWESFKGYLSEYEVFPFLGLFGGAVICVGYGENNIGKIFYFDFDFG
FT                   CLQFDRDDLNQFISKLKCVDA"
FT   gene            258838..259140
FT                   /locus_tag="PSM_B0228"
FT   CDS_pept        258838..259140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70268"
FT                   /protein_id="ADT70268.1"
FT                   /translation="MACINIKNLTLQDVASFTLKNNPSKQFKEKWGDEYFSRAMSLWRG
FT                   VKECYSKSKECNFTTQELLFAMNYEYAVAPYSSENNNAIEFYRWCFENLNKIKDR"
FT   gene            259140..259913
FT                   /locus_tag="PSM_B0229"
FT   CDS_pept        259140..259913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70269"
FT                   /protein_id="ADT70269.1"
FT                   /translation="MNKINTDVNYRTMAGNARLVMLGESSHSAAGYKYEAIKAIRQLKA
FT                   AGFTHFAIEMLPSSMQEKIELYQRTGKGFNIIQQYFDKYWTHGDFTPQAYGELVKAARN
FT                   AGMKIVALDVSVETMEVMDSVCPSTKAVTGECFDAHTFRNDLWAYNLATILKRAKQNKI
FT                   VAFMSRWHAVKNLKYQIGIDSLIKEHGIQNVRFIDFIGGLSCYSDRPCKGMSSQQETLK
FT                   GQYFYKEGFPYESTVKSFQVHLPEKRINNDGSFQW"
FT   gene            259907..260494
FT                   /locus_tag="PSM_B0230"
FT   CDS_pept        259907..260494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70270"
FT                   /protein_id="ADT70270.1"
FT                   /translation="MVKAPVTLVLAIVFFIFTDAKASMFANIDINDPNLTVEIAAKQCE
FT                   KSYMHAPNKLEEWCEKAYEMGHLESLYYIGMYTGNGSRYLNELNIRIEQGEANAINTLA
FT                   WLYQSGRLVKKDLSKAARLYQLYLAQENNQAITLKTSTHFELATIYRKLGMWDKVITHT
FT                   QYVIDKAKREGRRELAQRWRDEAETYLKESNL"
FT   gene            260491..261108
FT                   /locus_tag="PSM_B0231"
FT   CDS_pept        260491..261108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70271"
FT                   /protein_id="ADT70271.1"
FT                   /translation="MSFSRVYSFSLGSHVTKYLLISALFTFSLISNAAGPRWDNSIDIN
FT                   APDLTVLAAAEQCHKSLINAPEYLEEWCEKAYGMGYWKALVTLSLHNGDGTRLLEEAKK
FT                   RVAAKEPKAYSTLAWLYGSGMFVEQDINYAIALYKEFLALDAELPNSLVAAAHFKLANL
FT                   YESQQDWLAVNEHAQYVIDHSPLAYDKERAVDLIKLAKKIFD"
FT   gene            261181..261447
FT                   /locus_tag="PSM_B0232"
FT   CDS_pept        261181..261447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70272"
FT                   /protein_id="ADT70272.1"
FT                   /translation="MEQQNQHTLTNLVYDIYEDPTKIEEHQELIQPLLSDLVATAPAGF
FT                   EGIATMINTHISNGFKFKNPKIQKFELESGLLKLKTYFQKINL"
FT   gene            261508..262293
FT                   /locus_tag="PSM_B0233"
FT   CDS_pept        261508..262293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70273"
FT                   /protein_id="ADT70273.1"
FT                   /translation="MTLINTCILMLFLQPLFVYLALFKQSKYSVEPKSSLDNEDSMFLF
FT                   IAPGLSVFYLDQFWVALLYLGSVCLLGVLLAKIVESKANKRLTRDDSIGFMVASFIFFG
FT                   MIKLIIVAVAYFFTDDASSAITEDLSPAKEPSLTISQMFSVDYLYSQFKPTVYFLALMV
FT                   VTLVLKIIEYKFSLKEALSGILIMLSALLVGISPLFGEAYILGLIANFFIFFIVCSTCI
FT                   EIDKIGDASGGAIAILYGYILMMGLGFSIICKLVYEVFF"
FT   gene            262471..262983
FT                   /locus_tag="PSM_B0234"
FT   CDS_pept        262471..262983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70274"
FT                   /protein_id="ADT70274.1"
FT                   /translation="MLSRFKAYFLVVVSITIIFTTTQACADMFGFFNKQDFVLSAPMKG
FT                   QLLDKGQPVANTKVVRALTYGDEYKDEAITDENGFFTFTEKSIKTSKPANMFDNESLVQ
FT                   HVYLENGTPEGVVLWYTTVSMHEGSDTLKNLLANLECDIAEEPQTYDIPIEEAPEHFFT
FT                   IYGACKM"
FT   gene            263014..264180
FT                   /locus_tag="PSM_B0235"
FT   CDS_pept        263014..264180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0235"
FT                   /product="predicted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70275"
FT                   /protein_id="ADT70275.1"
FT                   /translation="MNTLTPTQAVQVALLAYKAKSIKSTTLLNNSLHPSLRGSFNFGVS
FT                   PEAVQGISGGFFSHLFGLSTGFGLLGHGQGLYQGDSVITIRGTASLRDGLTDAHFGLSG
FT                   GSNGSMVHAGFNKTFYSMKPALQEFVAANIRDKITGCVHIVGHSLGGALATLSADWIKA
FT                   EYSLPVKLYTFGSPRVGLDNFSRAATSRIDKIYRCTHGADPVTKVPLWPFSHAPYNGQE
FT                   IRLDNGQGLKGAAHKLSGTPGYVNTANSNDWGNLTVKANHFLSTPVRLKFEDRNQASFS
FT                   SHWADKLGAALVTLLKDSGYYSAVAAQAAIGTGLTFYDMLARTLDKIAKASASFATQTL
FT                   GLLGHMLVFAGKVISKAVELTYSFIKSVFDSTLGALYRAAREGLNGLD"
FT   gene            complement(264194..264652)
FT                   /locus_tag="PSM_B0236"
FT   CDS_pept        complement(264194..264652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0236"
FT                   /product="Transcriptional Regulator, MerR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70276"
FT                   /protein_id="ADT70276.1"
FT                   /translation="MAVQKKLTEANLTVGFVAKRSGVKVSTLHFYETKGLIRSWRNSGN
FT                   QRRFKPDVLRRVAVIKAAQAMGITLEEIKQTLATLPEQRTPTQKDWSALSKQWQAQLDE
FT                   RIAYMQRLRERVDGCIGCGCLSMSKCPIYNKDDHLGETQSGAILLERD"
FT   gene            264751..265215
FT                   /locus_tag="PSM_B0237"
FT   CDS_pept        264751..265215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0237"
FT                   /product="FMN reductase, NADPH-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70277"
FT                   /protein_id="ADT70277.1"
FT                   /translation="MQEESAHHIAIIYSSGRKNGNTTAQVNAYSKQQSGIVFCLDDYVI
FT                   SPYRYDKQYHNDDFYNLFEVLLRYEHWVFSSPVYWYNTTPQMKAFMDRITDYMDDEALK
FT                   PKLRTLRQKQFSLLSNAASPSAPDAFIDMFKHTFNYLGMTFKSHSHIQAS"
FT   gene            265263..265787
FT                   /locus_tag="PSM_B0238"
FT   CDS_pept        265263..265787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70278"
FT                   /protein_id="ADT70278.1"
FT                   /translation="MKTLLIGSSLLLASFSTLAAEPAPVIKDYGYFYNVPENVSDLSQA
FT                   QFKIAFDVGKGAEKGAQNNHINSLARFINMHVAHGVKPENIQLALVVHGGASVDVLQNS
FT                   DYKARFEKDNKTESLIKQLLANNTQVYVCGQSAMHMKVAADQLIPGVKMALSAMTAHAQ
FT                   LQQQGYTLNPF"
FT   gene            265787..266404
FT                   /locus_tag="PSM_B0239"
FT   CDS_pept        265787..266404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70279"
FT                   /protein_id="ADT70279.1"
FT                   /translation="MNILCFGDSNTFGISPVDGKRLSEIERWPTLLKQQLGTGFEVIEA
FT                   GEPNRTLVNNPPFMGDKSGIKYLKPYLEAHTVDVVIIQLGTNDLKARFALFAIDIGKAL
FT                   EELILAIKAFYHCKTISKIIIISPPKVREVGSYKSIYAGAGKKAEQLSIEFKAASDRHT
FT                   CEFLDCYPLIKPCKKEGIHLPVSAHRELANRLTPIIKKAAVY"
FT   gene            complement(266440..268689)
FT                   /locus_tag="PSM_B0240"
FT   CDS_pept        complement(266440..268689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0240"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70280"
FT                   /protein_id="ADT70280.1"
FT                   /translation="MKFNKTKSMLACAITLALSTHAALAAEQAKEKKVERIVVSGTPAG
FT                   VGIRKIDASYAVTNIDSSQIIKLSPKSTADLFKAVPGVWVESSGGESGANVFVRGFPGG
FT                   GDAPFLTLSIEGSPVYPAPTLSFLENSSLFRIDETIETMEALRGGPNPVLSNGQPGLTT
FT                   NFRLKRGSEDTQGLFKYTTSDYDLQRVDAVVSGEITDDLYFMVGGYVKSSPGIRDAGFT
FT                   SEKGSQFTINITKELDNGELNFYTRQTDDHGAWYLPTPLNVNGIDAEYTQLGTLNRQAT
FT                   IFTGPNAQPHDIDLGDGRGWDGHVSGGSIKLEFDNGWQFIDRFNITKGDANTFGLVPNG
FT                   SATTVGEVADNGQTAFGAVTNTEYASDTAIQQLGRWVVLKEISSFTNDLAFSKQFGDLS
FT                   ATFGYYTASTSASDWWSLGNTAYHVLEAGGELLNGIECNQNTDGCGFNYDISSTGDART
FT                   NALYFTSQYKFADAFTLDLGVRKENHDVQYSVDEDLDGIITKTVDYDESKTSWTTGLNY
FT                   SINDDMGVFARVNRGYKMPYFDDFRDNFGAYQGGEKLIKEVTQGELGYKLISDSTDFYA
FT                   TFFVNEVKGDTFVSRPGVPAEILTNEAYGVELDYNFNHESGFSVNLNTTLQQTEITESP
FT                   ENKGNEAQRQPKWQVRVTPSYDFEVDGMYATLYGTISAVDDRFGNNENTVTLDGYEKVD
FT                   LGLIIEPMEGIKLQLAIDNLTDEQGITEGDPRNADAPNGRYIMPRTTRLSVSYAF"
FT   gene            268970..269977
FT                   /locus_tag="PSM_B0241"
FT   CDS_pept        268970..269977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0241"
FT                   /product="transcription regulator, LacI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70281"
FT                   /protein_id="ADT70281.1"
FT                   /translation="MNNKKIKLADLAKLAGVSTSTVSRALNNNPLIKQETRDKLQQLAK
FT                   KHNFSLNTAASRLRTQKTNVVAVIINLDEQTEQSISDPFLLKVVSEINLALNQQGLELL
FT                   LSNSIMAQDDWANYFINGRRADGIIVVGQGKNQTNIEAAADAGIPLVVWGDPKTQSNYP
FT                   IVGSDNYLGGMQATAHLIEHGAKNILFLGDPEHGEISERHRGYAAALSTHKLEQHVISI
FT                   DLTSRSAYQAINQLLREKGLYFDAIMACSDMVALGAMKALKERYVSIPNDVALVGFDDI
FT                   AMADISHPSLSTIKQNTQFAATLLVKKLIQQFSGEKVESQVIDIELITRQSSKR"
FT   gene            270147..271385
FT                   /locus_tag="PSM_B0242"
FT   CDS_pept        270147..271385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70282"
FT                   /protein_id="ADT70282.1"
FT                   /translation="MSKIKITLAIAASYFIFAILLNSVGTVILQAINTLGVSKTEASVL
FT                   EGFKDLSIAIMSFVVASFIPRLGYKLAMLLALIVVAIACLSTAVISDFYMFKVLFAAVG
FT                   CGFAVVKVSVYSIIGQVTEDANSHSSLLNTIEGIFMVGVLSGYWVFTAFIDPVDSNAWL
FT                   NVYYVLAALTLLVIISVVIAPIKPAIKGQKSNSGWSDFIAMLKLTYQPLVLIFIISAFL
FT                   YVLIEQGVGTWLPTFNNQVLQLPVAISIQLASIFAAALALGRLVAGQVLKHIHWFVVLS
FT                   CCLVAMAALIIITLPLTENLPKSEVNSLFDAPLAAFVLPLIGFFMAPIYPVLNSVMLSA
FT                   LQKHQHAAMTGLIVVFSALGGTTGSVITGYVFEHFSGQHAFYLSLVPISLIFISVIIFK
FT                   KRTHAISQHAVNS"
FT   gene            271401..272897
FT                   /locus_tag="PSM_B0243"
FT   CDS_pept        271401..272897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0243"
FT                   /product="trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70283"
FT                   /protein_id="ADT70283.1"
FT                   /translation="MSFFNSQLFKDVQTQHIFSDCKTFADATARVDWQSACKQYEQIAP
FT                   LDKTQLRDFVDAHFITTPLLTMKGAANTTSVKGYINSLWSGLRREADTPKANSLLALKH
FT                   SYIVPGGRFQEIYYWDSYFTALGLIDADKSDVVEDMLQNFIDLINDYGCIPNGNRSYYL
FT                   SRSQPPILALMVDLLWQHTHSKTHNLAWLKLCVEALTKEHAFWMQGADTLSDTQTSVKR
FT                   VVTMPCGGVLNRYWDDEAAPRAESLREDLALASGFSDDKKTEFYRNIRAACESGWDFSS
FT                   RWLAESNLLSSIQTTDIVPIDLNCLLYNLENQLSECFKLLGNEQQSQTYSDYAVKRKSL
FT                   INQYLWSNEQRFFVDYNHKLSKPSAILSAAASTPLFVNLASQQQAELVANVLSEQFLKV
FT                   GGIVTTVVDTPQQWDSPNGWAPLQWFAVKGLRNYGIDQLATRIMKNWLTMVEQDFIENK
FT                   CLLEKYNVCTPQQKASGGEYQVQQGFGWTNGVTSRFYTLL"
FT   gene            273001..273690
FT                   /locus_tag="PSM_B0244"
FT   CDS_pept        273001..273690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0244"
FT                   /product="putative csg operon transcription regulator (LuxR
FT                   family) protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70284"
FT                   /protein_id="ADT70284.1"
FT                   /translation="MLQKSSAFIKTTLQSSFHSQNYTVILRTLQAIFGDIKMDSTIPHI
FT                   DQRGAYDIFLIDGSQNDWQDLIPADLICLAKQYKVVLFNVELEQVCEKNLLLNHFNGVF
FT                   YKSAAAEDIFKGLVRISTGELWFTRKVISKAFNDILSVASSFSSLSEDITLNEADYKHL
FT                   TKREKSVIHLIAQGASNNKIADKLNISDHTVKTHLYSAFKKTNSRNRVELANWAQRYIS
FT                   VLLPVES"
FT   gene            complement(273743..274462)
FT                   /gene="csgG"
FT                   /locus_tag="PSM_B0245"
FT   CDS_pept        complement(273743..274462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgG"
FT                   /locus_tag="PSM_B0245"
FT                   /product="putative assembly or transport protein for curli
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70285"
FT                   /protein_id="ADT70285.1"
FT                   /translation="MGNLIPPSKQSAVTLEPTDVFSDLKSLPKPAGSIPVSVYSFRDQT
FT                   GQYKPQTNVSSFSTAVTQGANSILVQALHESDWFTPVEREGLQNILTERKIIRAAQATN
FT                   PNQGELPPLTTAKIILEGGIISYDTNVKTGGLGMEYFGIGASELYREDAISIYLRAVDV
FT                   RTGQVLLSVATSKKVLSQEMRAGFFRYVSYKRLAEAEAGFSDNEPMSICVTQAIEKALT
FT                   DLITKGIDKGLWAKQAT"
FT   gene            complement(274516..274929)
FT                   /gene="csgF"
FT                   /locus_tag="PSM_B0246"
FT   CDS_pept        complement(274516..274929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgF"
FT                   /locus_tag="PSM_B0246"
FT                   /product="putative curli production assembly/transport
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70286"
FT                   /protein_id="ADT70286.1"
FT                   /translation="MKKIALTIITTLSFSVSATEIIYTPINPSFGGNPLNANMLLSKAQ
FT                   AQNKHKAPVVEKGYAEQFQDSLERTYLNRMVREITDMAFGENIEDSVFNQDSIFMSGDY
FT                   QIEVITSTTDTITVRITNVIDDSVVVIEVPRFG"
FT   gene            complement(274932..275324)
FT                   /locus_tag="PSM_B0247"
FT   CDS_pept        complement(274932..275324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0247"
FT                   /product="curli production assembly/transport component"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70287"
FT                   /protein_id="ADT70287.1"
FT                   /translation="MKNKQYIYLFILLTFFTPLSNASAELEIDGLLLNKSISRFGYQFY
FT                   SEFSNYWRELPSTAGFNVEIKETVIPRAGTKLVLIMNHKIIYATHLGRKLEPLDERVEQ
FT                   AVHSVMDAMARSNMQTASPDMALNGW"
FT   gene            complement(275366..276874)
FT                   /locus_tag="PSM_B0249"
FT   CDS_pept        complement(275366..276874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0249"
FT                   /product="putative secreted major subunit of curlin, may
FT                   bind calcium"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70289"
FT                   /protein_id="ADT70289.1"
FT                   /translation="MKLNKSLLSCAIAIAMGASFTANANTETKAGSTSELAAKVSVSSI
FT                   ENAVTVKQSFSDNTALVSQDGDGNTALATEIGNNNDVKIAQLQNGNYAEVETTGDNNQQ
FT                   TYAQDGVANGFITRITGDNNGVYVSQFGQGLFQNNEAINIITGSDNNIDVEQGNGGHWF
FT                   YNMDMRGNGNEIISSQSGMWQEFEVLSLSGDENIIEIEQTDTWNEFKIGSLRGNENEID
FT                   VSQDGSRNIITFTDIAGDDNEIAIEQSSGDNNTITFAAVTGNDNEIKLDQEGSNNAIES
FT                   GLFDGSFNEVTVNQIGDENLATTELMGDNNELTAMQVGNTNEAYMGVIGSNNEFTVTQV
FT                   SDFNSVHLANFNGSGNDVDLSQSGGDENAILVQSSYPDVSLTSNDNDIDVNQVGNQNEA
FT                   IVTLAGILDSNANQIDIAQNGDINVIDLMVEGSNHSIDIAQQGEGNWVGGTGDSAFLLG
FT                   GENVSFSVTQTGNYNTVEGNVIGFNSTFSVTQLGDGNTATITQM"
FT   gene            276841..276966
FT                   /locus_tag="PSM_B0248"
FT   CDS_pept        276841..276966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70288"
FT                   /protein_id="ADT70288.1"
FT                   /translation="MHSLKVIYSISLLFSLKDKIKYLDYLLSFKKVFSLQHAVLP"
FT   gene            complement(277241..277390)
FT                   /locus_tag="PSM_B0250"
FT   CDS_pept        complement(277241..277390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70290"
FT                   /protein_id="ADT70290.1"
FT                   /translation="MNLSNHVASVKKTGNQSLTQVKKAKSGTKPLFLTRNTVKKTLIAA
FT                   ILMN"
FT   gene            277445..279952
FT                   /locus_tag="PSM_B0251"
FT   CDS_pept        277445..279952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0251"
FT                   /product="deseasin MCP-01"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70291"
FT                   /protein_id="ADT70291.1"
FT                   /translation="MKTKLSIITLALLPCLAAAKLPDVNSTTQKVTASSDSIIVKYKKN
FT                   ASPKMRKQARSLVKAKISDLNNDEIDDNFTSLFSGRLAKFKISGMSAKEAIERLKSHQA
FT                   IEYVEPDYRVSIASATNDPRFDDLWGLNNEGQTGGTADADIDAPEAWSISTGSRDVVVG
FT                   VIDTGVDYSHPDLAANAWVNSGEIAGDGIDNDGNGYIDDVHGINAITDVGDPMDDEGHG
FT                   THVSGTIGASGNNGVGVVGVNHDVSIVGCKFLAADGTGSTSGAIKCIDYMVGLKNAGVN
FT                   LRVLNNSWGGGGFSQALADAITASEQADILFVAAAGNDAVDNDQNPHYPSNYENDNVLS
FT                   IASTDSRDNMSSFSQWGLTSVDMGAPGSGILSTVPGNSYATYSGTSMATPHVAGAAALV
FT                   LSVNPDLTTLELKELLMSSGDANAALNGKTVAGTRLNVNQALIDADPTPGFKLSVSPVS
FT                   QQATVGDTVTYTFTIGSIAQWEGDVSLALASDLTDASLSATTARPGDEVVLTVATNSDT
FT                   QWGNYDFTVTATTEEQVKEQTVSLMLQPAGLNDFTYSSDENIAIPDNSPEGASSVITVA
FT                   DDLTIFGTTADVDITHTWSGDLVLTLISAQGTEVTLQSNEGGSADDIVKSFTSSVFNSE
FT                   VATGDWTLHVEDTAGADTGNINGWSLTFSAIGEVSPQPPQAGFSVSAQGLTATFVDTSR
FT                   DVNDDISQWSWNFGDGSTSTNPNPTHVYAQSGSYEVELTVTDSENNSDTFTQTVVVSDV
FT                   EIELSLKRANKSRLDTMRVELNWAEVGAESLSLYRNGELVDTVSDNGRYRDYVRNATLP
FT                   AYDYQLCVSENVCSNIITVSFSE"
FT   gene            280182..283352
FT                   /locus_tag="PSM_B0252"
FT   CDS_pept        280182..283352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0252"
FT                   /product="chitinase A"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70292"
FT                   /protein_id="ADT70292.1"
FT                   /translation="MSSRKIITNAFNLSALSLSFLSLNVHASIDCSALEQWQTGQTHVA
FT                   GDQVQAQSTAYEASWWTQANPVENAGDYKDWKILGVCDNAVIDNEIPVITELMPADGFQ
FT                   LTDKDSVVISAQAIDNDGVVTTVEFFVDGIFLAADTSSPYSVDWQAVAGSHQISAIATD
FT                   DQGAQSLQIINTLTVADDVTNPVNQVPVASISLSTLPEQLIVGSQVVFELSGSDSDGEI
FT                   TALNFAINGDDTHQATSATSQYTWQATALGQASFTLTVTDNEGATAQTTKTLNVVDSAA
FT                   PGSGVTDCQPQGLYQTPGVNTPYCTVYDADGREVMGADHPRRVIGYFTSWRNGANDQPS
FT                   YLVNDIPWDKITHINYAFAHVDANNKVSIGDPNSANNPATNMEWPGVIGAEMDPEFAYK
FT                   GHFNLLNKYKKQHPHVKTLVSVGGWAETGGYFDETGRVESGGFYTMTTHADGSVNYEGI
FT                   NAFAKSTVEFIEKYGFDGVDIDYEYPSSMNDSGHPDDFPISNARRAGLNASYQVLMKKV
FT                   REELDRAGEAAGKHYLLTIASPSSGYLLRGMETFQAVKYLDYVNIMSYDLHGAWNSHVG
FT                   HNAALFDTGLDSELTQWNVYGTKEFEGIGYLNTDWAVRYFRGAMAAGRINIGIPYYTRG
FT                   FKDVSGGTNGLWGQSALPNQADCATGTGVGEKNKCGNGALGIDNLWHDKNDAGQEMPAG
FT                   SNPLWHAKNLENGIVGSYLEVYGLTPDTDADDRLTGSYTRYYDSVAVAPWLWNADKKVF
FT                   LSIEDEESMASKVDYVINNGLGGIMFWELAGDFDYDSAKGEYFMGSTLTSLAYDKFNQS
FT                   GVAYDVHGGNPNFTVPAEAVDITFEAKDFPVGDDNYPISPTFAFTNNSSLDLSGAKISF
FT                   DVPVSTSAIFKSNWNAQEKLGMAVEVNGSNAAGNNIGGFENEFHRFSITLNNEWGGQPK
FT                   DFSAGATVNAQVMYYMPITGPSNFTIEKDGKTYAFKAEYPMLPGATPGDGTGNPDNGGG
FT                   DPVGTCEGVDIATIPVYPNFPQTDWAGNPSHAAGGDLMVHNNAVYKAKWWTSSEPGATA
FT                   DWTLSCSL"
FT   gene            283419..285014
FT                   /locus_tag="PSM_B0253"
FT   CDS_pept        283419..285014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0253"
FT                   /product="chitinase B"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70293"
FT                   /protein_id="ADT70293.1"
FT                   /translation="MASIKLNTITLSAIAGGLLLSMLAPQVQAHGYMDSPKARQAFCQD
FT                   DGGYWWPEDGTNIPNLACRSAYLESGTVQFVQAIEFSVNTPDYLNQTAVEASIPNGTLC
FT                   AGGDTAKRGMDLPSPHWQRSDVVPNANGEIQVRYLASTPHNPSFWQFYLTKPTFNAATD
FT                   VLTWQDLELVQEHQNVDVIKDTDGERYYQMSVAIPQGRNGDAILYSRWQRNDVVGEGFY
FT                   NCSDINIVNDAAPTNPNAWASLGYFVRQGQNAIAGDTVWARLFDESGQEVINQQLKINA
FT                   DNQVNWQQVLASQLNLDYAHLVQIGVQNQVGDVVFNSADVLTNQVYGSNPNYTYTLSVQ
FT                   GTPDNTAPIVSKPENLVVDENTTTAVHLHAFDDEQNALIYTWSVPAPLSFTGSDANINL
FT                   ISPEVSTPTDYTVVVSVSDGQLTTQTEFVVTVNDSVINDPAIAPWSTTEVYQATDKVSF
FT                   QERVYLAKWWNQGQHPDSSSAWELVEEGTNPAAWSINKAYQAGAEIIYQGQRYRANWWT
FT                   QGDTPGQADVWKTL"
FT   gene            285088..287718
FT                   /locus_tag="PSM_B0254"
FT   CDS_pept        285088..287718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0254"
FT                   /product="chitinase C"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70294"
FT                   /protein_id="ADT70294.1"
FT                   /translation="MNIKQLTAAMGVALFAGSVSAAPSTPSINWEPQQYSFVEVDLEGN
FT                   GSYKQLVTRVEQVNINIEWSAWSGDGGDSYKVYFDDMLVNEGTLADGSKSGTISFPYDK
FT                   AGRHTMYVELCEGGTTCARSAGKPIVIADTDGGHLAPLPMDVDPNNRDIGVKQDLVTGA
FT                   YFVEWGIYGRDYDVTNMPAQNLSHILYGFIPICGENASLTGGPKRALETACAGSADYEV
FT                   VIHDPWAAVQKALPGVDAKDPIRGTYSQLMALKQRYPDIKILPSVGGWTLSDPFGGFTN
FT                   KANRDTFVASMEEFLRTWKFYDGVDIDWEFPGGDGPNPDIGDPINDGPAYVALMQELRA
FT                   MLDKLEAETGRTYELTSAIGAGYDKIEDVDYQAASQYMDYIFAMTYDFYGAWSNVTGHQ
FT                   TALYCGEHMSVGQCNGTGLDENGEPRKGPAYTTDNAVQLLLAQNVPSKKIVVGTAMYGR
FT                   GWEGVYPQNAAVDGNPMTASGNGPLKGSTAQGVWEDGVIDYKGVKANMIGAAGTGINGF
FT                   EVGYDEQAQAAYVWNRSTGKLITYDSRKSVLAKGAYVNQHNLGGLFAWEIDADNGDILN
FT                   AMHDGLGGVVAPPSNKKPVVSVSSSVSVNSGESITVTASATDADNDPLSFSWSADSALV
FT                   VSGQNTSSLVINAPTVTTDTQYVATVAVSDGQATVNRDVVVNVIAPTSGGENTAPSVNA
FT                   IANVSVEEGASASVAVVANDAQNDALTYTWTVPAGLTLVGSGANVSIEAGAVDTDTNFT
FT                   VSVAVSDGALTTTQSFSVTVTNGDTTTPPTGDWDASVAYVGGDVVTYNGVEYKAKWWTQ
FT                   GERPDLGGAWEATTQPTDGTGVEVWQPTAIYNSGDEVSYQGNKYQAKWWTQGNEPGSTD
FT                   VWLAL"
FT   gene            complement(287797..288279)
FT                   /locus_tag="PSM_B0255"
FT   CDS_pept        complement(287797..288279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0255"
FT                   /product="ribonuclease activity regulator protein RraA"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70295"
FT                   /protein_id="ADT70295.1"
FT                   /translation="MTQFTTPDLYDEHRDHVQVADSGLQHFGNKTLFYGQVVTVTCPDD
FT                   NSFAGNILHENGEGKVLVVDGFASKRFAFIGDMIAERALKNGWQGIIINGCCRDIEILA
FT                   TLDLPVMALGATPRCTTKRGLGAKDHPVNMLNTTINTGDWVYADVNGLIISNKALF"
FT   gene            288619..290082
FT                   /gene="cstA"
FT                   /locus_tag="PSM_B0256"
FT   CDS_pept        288619..290082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="PSM_B0256"
FT                   /product="cold-shock regulated carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70296"
FT                   /protein_id="ADT70296.1"
FT                   /translation="MIIFFICLTILILGYKFYSPFVEKQAGMDSTVDTPQKRFSEGVDY
FT                   VAIHPVRAFLIQFLNIAGVGPIFGPILGALYGPVALVWIVLGNVLGGAVHDFFSGVMSI
FT                   KEDGKSLPEIAGHYYNVVFKGFMLIFTAMLLFFVGVVFIMSPAGLLSNLDIFKDTIFAN
FT                   NTFWVLAILAYYFLATLLPIDKIITKFYPIFGLLMIVMTVAIAVSLLINAPHLPVAGDF
FT                   LAYFEADHAHDFLAPNPDGLPTWPLLFITITCGAISGFHSTQAPIIARCLTNEKYVRPV
FT                   YYGAMMCEGIVGCVWALAGIAAFPEGYAGLKAMLDLGGPGLVVNHIANSYLGVFGGIMA
FT                   IIAVAVFPITSGDTAFRSLRLTVVDAFSIPQSLRNRLLLAIPILTIAYFMTKLDFSVIW
FT                   RYFAFSNMLLSTSVLWLATKYLFDRGTFHWITSIPAVIATAVTLSYIMTAAIGLNLSSD
FT                   LGKPIGAAVAVIGFIVLAVVHSKHKVRTA"
FT   gene            complement(290155..290673)
FT                   /locus_tag="PSM_B0257"
FT   CDS_pept        complement(290155..290673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0257"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70297"
FT                   /protein_id="ADT70297.1"
FT                   /translation="MTKKAALLKAAENKVRLGGYSNFSFRELANEIGIKSASVHYHFPT
FT                   KADLGAELAHQYTDAFIAVLGEPEAHKANGKNPIDIYTQLFRNALVIDKKMCLCGLLGA
FT                   ESDSLPDKVRVEVQRFFNKNLAWLTQAHAANGEKNPARAAIQTVSLLEGAMMISKTLDD
FT                   ISYFEQATF"
FT   gene            290852..291472
FT                   /locus_tag="PSM_B0258"
FT   CDS_pept        290852..291472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0258"
FT                   /product="glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70298"
FT                   /protein_id="ADT70298.1"
FT                   /translation="MKIYDVENFPNPLRVRIALAEKKATDKVEFVAVDLLNGEHRTEAF
FT                   LAKNPLAGVPVLELDDGTFIAECTAITEYIDTAFAGPSLTGVEAKERAVINMMQKRAES
FT                   MVLDAVATYFHHATDGLGPALETYQNVAWGEKQGEKARQGFVYFNTVLANSAYVAGENF
FT                   SVADITLYAGLVFAGFAKIAIPSELSHLIAWQEKVAQRPSIAA"
FT   gene            291487..292179
FT                   /locus_tag="PSM_B0259"
FT   CDS_pept        291487..292179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70299"
FT                   /protein_id="ADT70299.1"
FT                   /translation="MKIAADFSERVVVHSESLEWIASPMAGVDRRPLDRVGNEVARATS
FT                   IVRYAPNSHFSAHTHTGGEEFIVLEGVFQDEHGDFPKGSYIRNPPESKHTPSSENGCVI
FT                   FVKLWQFQPEDREHVRLQTNTMCSVPHPEFSNVNVVSLYKDAFEEVSILAFSPNSEISL
FT                   NALGGGELLVLEGSLEEQGDTLVQHSWLRVPPNSEIKATAGSEGARVWLKIGHLTDVEN
FT                   QIARLKNA"
FT   gene            292300..292701
FT                   /locus_tag="PSM_B0260"
FT   CDS_pept        292300..292701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70300"
FT                   /protein_id="ADT70300.1"
FT                   /translation="MVNLTHGLSIGIERSGCEFFLTLKAIGTLTHKDYEVITPMIDSAL
FT                   GEVKHPIVNVLIDGTELDGWELRAAWDDLKLGLKHNKEFKKIAIYGNKDWQSTIAKLGS
FT                   WFVSGEIQYFENATAALEWLKSNDEEADA"
FT   gene            complement(292900..293844)
FT                   /locus_tag="PSM_B0261"
FT   CDS_pept        complement(292900..293844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0261"
FT                   /product="carbohydrate kinase, PfkB family protein"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70301"
FT                   /protein_id="ADT70301.1"
FT                   /translation="MTKLLSLGELLIDMLPQDSQNSAYLPIAGGAPANVAVGYAKLGGK
FT                   AAFCGGMGDDYFAKQLSKSLEQYKVSTEYLFTIKDSQTAVVIVSLDETGERSFNFYRHN
FT                   TADLLLTSDHLCHIKWDELSTLHFCSNTLTNPAIANTTVCALKLAKNNHKLVSFDVNLR
FT                   YSLWQNSNDIEHNVHACYAYCDIVKLSRDELNFLAEQTQHAPDDYLQSILNIGVKLVFL
FT                   TDGPAPATVYHKGFILNESAPIINAVDTTSAGDAFIAGVLYYLNHTDENSPLIEKINNE
FT                   HLVKHALSFGLRCGSKACLAKGAFPALPTLQEV"
FT   gene            complement(293970..296363)
FT                   /locus_tag="PSM_B0262"
FT   CDS_pept        complement(293970..296363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0262"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70302"
FT                   /protein_id="ADT70302.1"
FT                   /translation="MTTHNTPLYLMSALALAVSQGVYAQQEEQNTQAQANKGLETIVVT
FT                   GVPRRTTIMASSSSVSSLSLAQVEVSTPRSTAEAFRIIPGVRSESTGGEGNANIAVRGL
FT                   PVASGGAKFLQLQEDGLPVMQYGDIAFGNADIFMRLDNTVQTIESIRGGSASTAASNAP
FT                   GGIINFISKNGENESGSVSTTLGLDYDTIRTDFEYGTYLSDSVRFHVGGFVRQGEGPRE
FT                   TGYTSNKGGQIKANLTKDFENGYVRLYYKHLDDKSVGYLPMPMYANGDSIPGFDAQSDT
FT                   PHSALFTKTVRLNGENQISSGDIRDGMNPQVDSVGFEAVFDLDNDWRIENRFRKSSVSG
FT                   NFNSLIPAEVGSATAIAQSIGGAGATLSNANTGAAFNDDLAMRIHTFDVTMNDFDSIVN
FT                   DFKLTKSLSDDTSVTFGYYASTQNIAMSWLWNSYLMELKGDNAALLNVTAADGTAFSEN
FT                   GLYAYGTPFWGNCCQRDYDTEYDTRAPYVSFSTKVGDVSIDASARYDSGEARGNYAGAV
FT                   TSTVDMNRDGVISVPEQNVAGIDTANASPVNYDWDYASYSIGANYQIDSSLATFARLSK
FT                   GGRANADRLLFGKVRADGSVADEDAVDEVNQYEFGVKKRFDSLSVFATAFYAETEEQNF
FT                   EATSQTFFDREYEAKGIEIESTYFIDAWDFRGNLTWTDAEIAKDALTPEVVGNTPRRQA
FT                   DLIYSLMARYSFDKGAAGVNFIGTTDAYAQDNNDLKFDGYTQVNGFVSYDLSENLNIAL
FT                   NVNNLFDTVGITEAEEGSIPDNNIIRARTINGRTTSITLKYAFN"
FT   gene            complement(296531..297760)
FT                   /locus_tag="PSM_B0263"
FT   CDS_pept        complement(296531..297760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0263"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70303"
FT                   /protein_id="ADT70303.1"
FT                   /translation="MTKSHTHVSSDPLQQIRWLTYMMFFMFAMTSDAVGMIIPELITEF
FT                   GLSMTQASAFHYAPMALIAFSGLFLGFLADSLGRKKTIMLGLLIFSASCFLFAISSSFI
FT                   FFVFLLCCIGLAIGLFKTGALALLGDISHSNAEHTKTMNKVEGFFGIGAIVGPALVGVL
FT                   LVQNVSWTYLYIIAGIMCLILAFLAWRAEYPSVVKSTEKPASLATTMKMIKNPYALGFS
FT                   LAIALYVATEVAIYVWMPTLLKDYTGSWPLLATYALTIFFILRAAGRFIAVWLLNRYSW
FT                   QGVMAYLSLGIALCYVGTLVGGVDWAVGLLPLSGLFMSMVYPTLNSKGISCFPVQQHGA
FT                   VAGVILFFTALSAALAPLFMGMISDYFGHVRYGFYLATGFAIILFLAMLFNYFRDPSAS
FT                   ALQESNLITE"
FT   gene            297936..299408
FT                   /locus_tag="PSM_B0264"
FT   CDS_pept        297936..299408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0264"
FT                   /product="sucrose phosphorylase"
FT                   /EC_number="2.4.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70304"
FT                   /protein_id="ADT70304.1"
FT                   /translation="MMKNKVQLITYADRITGRDINALTTLLHGPLEGVFGGVHLLPFYN
FT                   PIDGSDAGFDPIDHSEVDSRIGTWDDIKALGKDHDLMADLIVNHVSAQSFQFQDVLAKG
FT                   KASAFWDLFLTKEDVFPNGMSEAEQQAIYRPRPGSCFTPMKCGDGQTYDFWTTFTDNQI
FT                   DINVKVEAGIAYLNNVLTKFSANNVNIIRLDAAGYAIKQAGTNCFMLDETFGYLDNLSK
FT                   QANDLGMETIAEIHSHYQTQVDVAKRVNMVYDFALPPLILHSLFNNNADALLKWLKISP
FT                   RNCLTVLDTHDGIGIIDAGPMGEKPGLLNAEQIDNLVETMHANSNNQSRQATGAAASNV
FT                   DLYQVNCTYYNALGANDFDYLLSRAIQFFAPGVPQVYYGGLFACENDMELLAKTNVGRD
FT                   INRPYLNAAKIEQALNKPVVKGLIELIKMRNEHPAFAGEFSAQGGASVCCLMWKFEQQS
FT                   ISLRIDFASRIALISQVNGTQESTLNLQSLLA"
FT   gene            complement(299482..300513)
FT                   /locus_tag="PSM_B0265"
FT   CDS_pept        complement(299482..300513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0265"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70305"
FT                   /protein_id="ADT70305.1"
FT                   /translation="MSKPTRWTLKSIAKELGVSNATVSNAFNRPDQLSAKRREAILKAC
FT                   KELGYYGPNKAAQSLRSGTFNIVALVLPDSVEYMVSDPVASSFMRGVTSVLEKNNINVL
FT                   LFSGNSDNLNSVVDFVDGFICYGRPRNKALVEQLKTVSKHVVTVDFDIARNASINVNNE
FT                   QASYEIAKHVLHNQNDKVAILGLRLLDENVLCRVYEHHEFETGQSISHQRLRGYQRALS
FT                   EANITVADDRIWNIPESSERFANIAAKEVLTASPRPNVIICMSDLIALATMREAIKQGI
FT                   KIGSELRIVGFDGIEEAARFVPRLTTIHQNSQEKGVMAANLFISKEEKQYEVGYALDIG
FT                   ASS"
FT   gene            complement(300595..301488)
FT                   /locus_tag="PSM_B0266"
FT   CDS_pept        complement(300595..301488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0266"
FT                   /product="AraC/XylS family transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70306"
FT                   /protein_id="ADT70306.1"
FT                   /translation="MHTSQLNKKRQQLDVLIENKVTFAADNSELSIYDTYKSAQKVALH
FT                   SNELLFCAMLSGKKIMHVESSQYHKAFLPHESFVLAPEQSVLIDFPHASMNAPTTCLAI
FT                   EISTDKITNVANALNMQQNFANDALFEYNPNLVHTQHNTQTQQLLERMVHLFSEQGAER
FT                   HYLIDLSLNELITRLLQQQSRDLLLANCDKLRLKSNVSDALHYIEEHLSENLDINTLCK
FT                   ITCMSRSKFYQQFKLAFGTSPALWQQQLRLKKARTLLLEGHAISKVCYDLGFNSASHFS
FT                   RLFKQTFGIAPKACRH"
FT   gene            301684..303204
FT                   /gene="aldB"
FT                   /locus_tag="PSM_B0267"
FT   CDS_pept        301684..303204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldB"
FT                   /locus_tag="PSM_B0267"
FT                   /product="aldehyde dehydrogenase B (wide specificity)"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70307"
FT                   /protein_id="ADT70307.1"
FT                   /translation="MIYANPGTADALVTFKQQYGNYIGGEWVAPVNGQYFDNISPVNGK
FT                   VFCKVPRSDKDDINLALDKAHAVKTQWGTTSVAERSNILLKIADRIEQNLELLAVAETW
FT                   DNGKAIRETLAADIPLAADHFRYFAGCLRAQEGSIGEIDETTVAYHFHEPLGVVGQIIP
FT                   WNFPLLMAAWKLAPALAAGNCVILKPAEQTPASILVLMEIIGDLLPGGVLNVVNGFGKE
FT                   AGEALATSTRIAKIAFTGSTPVGSHILKCAAENIIPSTVELGGKSPNIFFSDVMEKDDS
FT                   YLDKAIEGAILAYFNQGEVCTCPSRLFIQEDIYEQFIERILKRTKQIKRGNPLDSETMV
FT                   GAQASKAQFDKILSYIEIGKEEGAEVLTGGHVEQLSDELNGGYYIQPTLLKGRNDMRVF
FT                   QEEIFGPVISMSTFKDEAEALELANSSEFGLGAGVWSRNMNRAYHFGRKIEAGRVWTNC
FT                   YHMYPAHAAFGGYKKSGIGRETHKLALDHYQQTKNLLVSYSEDPLGFF"
FT   gene            complement(303155..303298)
FT                   /locus_tag="PSM_B0268"
FT   CDS_pept        complement(303155..303298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70308"
FT                   /protein_id="ADT70308.1"
FT                   /translation="MLSVLVLKKTKRYKNVALSLLIGCLFKLKRVIKKSQADLRCNLLA
FT                   SF"
FT   gene            303508..304113
FT                   /locus_tag="PSM_B0269"
FT   CDS_pept        303508..304113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0269"
FT                   /product="CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70309"
FT                   /protein_id="ADT70309.1"
FT                   /translation="MFETIAIYSGLIATLWIFIGVYVASRFYEGYSHSKQFCSELGATG
FT                   SPTEKLSPLINNYPLGFLFCFFGWYLAQLANVSILVNIVGWLVIVHGIGTWVAGYFPMD
FT                   ADPFTKHPTFSCKVQSWAGFIMLLSLVVAPILIAISPTTEITPLYFRVFSIVSVIATVY
FT                   YLFAMAKAIKLQSNPGSYQRISYGIQLSWLSVFSIVLM"
FT   gene            304218..304436
FT                   /locus_tag="PSM_B0270"
FT   CDS_pept        304218..304436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70310"
FT                   /protein_id="ADT70310.1"
FT                   /translation="MNINHTKFRFILLKGVLGWGIPTAILFQLIMYFTGEQDFFDGIIS
FT                   SLIIFPLVGILFGYFLWHSKYKKERNN"
FT   gene            304498..305025
FT                   /locus_tag="PSM_B0271"
FT   CDS_pept        304498..305025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0271"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70311"
FT                   /protein_id="ADT70311.1"
FT                   /translation="MNICETQRLLIRQFSIDDVPALSEILSDDEVMKYSIRGVCDEAAT
FT                   REFIKWCLQCYGSYGLGPWALIDKNSNLLIGFCGVSPQSVAGNEEPNLGYRLAGDFWNK
FT                   GLACEAAKGVLKYVFTQTTHQSVVVIIEPEHIASLKVAKKIGFTDYSTHEFHGRTVQLY
FT                   RLTKAQWSNSLV"
FT   gene            305106..305237
FT                   /locus_tag="PSM_B0272"
FT   CDS_pept        305106..305237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70312"
FT                   /protein_id="ADT70312.1"
FT                   /translation="MDIDSHIVQLEKNNRKLFSASHYLGLTIAMAVIVLLLMFYSAH"
FT   gene            305541..307013
FT                   /locus_tag="PSM_B0273"
FT   CDS_pept        305541..307013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70313"
FT                   /protein_id="ADT70313.1"
FT                   /translation="MNIKTKIVSRTLLSALLITPTLSMAELAVTPQTPEQWRSVTDRDI
FT                   EAAYSISAKNHPGMFDVNNPVFPELLKQAKAEALALSAKASGPQVHVAAIARFSTVLQD
FT                   GHAGVFSSVERPARRWPGFSAVWRGDALKVYYSETDNINKGDVISGCDRQSTETLMRQR
FT                   VFKFHGQVTQPGHWWQQGWRLLIDEGNPFLTPLKECQFVKANGQAYSKTLDWSVRPKSV
FT                   SKHLTHAYNGDELTTDLTWPAQNIAWIAMPSFANNDKQTHDYNNLYKKVTDQRSKLLSA
FT                   KTVVLDLRHNQGGSSYWSLKLAKALWGEQVVEQKMDNYSKNSRVWWRASKDNTSHVKSL
FT                   IEVLKDQPKAQKEFKEIAAGMAQSLENNKLFYIEEPQSKPNQSDSTVPESDFKTQVFVI
FT                   VPPQCASACLDAIDVFKQFSNTQLFGAPSSADSLYMDVRLAELPSGLGKVIVPNKVYVN
FT                   RARGKGDYYKPDIAYNDIDWTTDKLLEKIKQL"
FT   gene            complement(307087..310080)
FT                   /locus_tag="PSM_B0274"
FT   CDS_pept        complement(307087..310080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0274"
FT                   /product="Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70314"
FT                   /protein_id="ADT70314.1"
FT                   /translation="MNTNKFKKSPLAASVSLIIAASTFNFAYAAQENTAEPELEVIEVK
FT                   GIRGSLIRSMDVKRDASGVVDAISAEEMGKFPDTNLAESLQRITGVSVSRSNGEGSQIT
FT                   VRGFGPSFNLVTLNGRQMAGTGFTRSFNFENLSSEGVSSLEVMKTARADTPTGGLGATV
FT                   NIVTAKPLQKPGQRFSLMAKGIHDTSVEEGDEVTPEIAGIYSNTFADEMFGFSANFSYH
FT                   RRDFQRQAANVRSWLVNPNLSVDAENIIDNRPMDADGNPAKQFFDPNAGDNGEFVSAAF
FT                   FPQEVSFSKDDIQRERLNAQATFQFAPTDNLTFTLDHTISNATTGNNSLSWGIWNGSFG
FT                   GNGNAYELDENGTAIYYNSAGDDASFTAFRETAEVDSKATGINVEWLATENLSFNFDAH
FT                   TSKTTTDNGKDPGLNSNARIILGSAELSTKEYFFREGDVPGFNINWNNGTQEVSPNQIG
FT                   SNFSIFTRTPGESEVSQVQLDGKLFTYTDIGLETVKFGAAYTKQTLSGWGGSNNANAPG
FT                   FNNGTFAEIFPDAMFERIDLSGFLDEFSFGPNGVAPGYAYTYDLDEAFARQSAYLTEDV
FT                   IGSDYYRIGSFDNFPTNEVEEETISVYLSSNWVFNVSDYDVFVNLGLRYEETDIVSPAK
FT                   SRVAEQVYWAGGSEWLTQFAAGGELVEVDYEGQYDLLLPMIDIKVDLTDDLVTRASWGQ
FT                   TITRPTLGNMLGNLALTPSPKLNSRSGSRGNPNLEPFKSTNLDLSLEYYYSEGSYAAVG
FT                   LFWKDVDNWIDNTQVKTTFEGLHDVYLGERWNNAVAAIEGRGDQATDTAIYNEIVANGV
FT                   GIGENNRILPDPATDPLIEWTINSPENVGSRKVNGFEFAVQHLFGDSGFGAGFNATVVD
FT                   GDVEYDNYYLASQAVLAGLSDSANIQGFYEKDGLSVKITGAWRDEYLIAQGLPDSGATA
FT                   PPQYAEEYLQWDISVNYEVNESTTVFFEGVNLTNETERSFSRFESQFLSAAQYGPRYAF
FT                   GVRYSMGN"
FT   gene            complement(310155..312812)
FT                   /locus_tag="PSM_B0275"
FT   CDS_pept        complement(310155..312812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0275"
FT                   /product="glycosyl hydrolase, family 16"
FT                   /EC_number="3.2.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70315"
FT                   /protein_id="ADT70315.1"
FT                   /translation="MNIETTRITRLLAAISLASLAGCGGDAATTTTDIEKVNPTEPVSD
FT                   WRMVWNDEFDSTSIDTNKWNFELNCAGGGNNEKQCYTDSEENAFIKDGVLNIVALPAEE
FT                   GAEKPYTSARLNTRYNADFTYGRFEMRAKLPSGQGSWPAFWMMPTDEEYGTWPRSGEID
FT                   ILEAVNLKTVAEDGTVEANIHGTLHYGREWPNNSSSGKAYTFPEGMNPADDFHTYAIEW
FT                   QEGEIRWYVDGYLYATQRRSEVRYNSKDEPVGLKHKGWFAEYFEQGSGELTTHWDNAPF
FT                   DKDFYLILNNAVGGDWPENVNNLGVDAAAFAEGQSFEIDYVRVYECASNPTTGKGCETV
FT                   RPGYDSLEDALVEGKAPVPTPPSDGVAKNLDIFDGSLNANWIAWDCCGGTTPETITDAD
FT                   KGEVIKFNINDNNGTVLGFSTRGGHFSDDFTGTSSPFDASPLLDLNGRLTFDMKVVTPP
FT                   TSSTTWLLKAEAGDGGPNTGDVALSDSNEGVTPVTGQWQTYTFPLSLLQERGLDLSAID
FT                   VLMVFPAWQTGAGAEYLITNVAIEGDLPGSPEVDLFTDGQNLDWPMWDCCGGSTPIEVV
FT                   DDEEHGLTAEFSIGEAPTVMGFNTRTSAGGSGKPFDATSILENGVLQFDVKVMSNPNDP
FT                   AAVWTMKIESNEGDTAVELPLTDAGDAPVAGEWKTYTFTFADLAGAGLDVSAIDVVMIF
FT                   PAWGTGEGAVYRVDNAKMYDPSASAGDEITIFQDTAADMWSIWDCCGGSTPTEETDDAE
FT                   HGTVAEFVIGATPTVMGFLADEGVSFDASAILANGVVQFEMKMVTPPNDPDSVWTFKIE
FT                   STGAATAVELPLAQSVEGEVPVIGQWQTYTFTVQSLFDAGLDISDINVLMVFPAWGTGE
FT                   GAVYRIDNVVIANP"
FT   gene            complement(313084..313872)
FT                   /locus_tag="PSM_B0276"
FT   CDS_pept        complement(313084..313872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0276"
FT                   /product="putative C-5 sterol desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70316"
FT                   /protein_id="ADT70316.1"
FT                   /translation="MDNELWWRLGCFVSILVIMMLLEWQAPARQSPIKATKRWVANFGL
FT                   VFTSSVIARLAVPLGLTAAALYNQEHSIGVFNQLTMPLSVAIILSLLLLDILIYWQHRL
FT                   FHKIPILWRLHRVHHADAHVDTSTGLRFHPIEIGLSILIKLAAITALGVPAIAVLIFEI
FT                   TLNGLALFNHANIRLPSAIEKPLRLILITQALHRIHHSQNPEETNSNFGFSVTWWDRLF
FT                   GSYKSQASQPDKRIALGLSQYPNPEQNSSLWQLLIMPFKK"
FT   gene            complement(313865..314515)
FT                   /locus_tag="PSM_B0277"
FT   CDS_pept        complement(313865..314515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0277"
FT                   /product="putative CDP-alcohol phosphatidyltransferase or
FT                   phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70317"
FT                   /protein_id="ADT70317.1"
FT                   /translation="MLDKFVTPIIKPLLTPVVMLINKSGITANQLTVFGFLVGMFAVPL
FT                   LAFEMWYGALIAIALNRILDGLDGALARYANQSSSAGGFLDITLDFLFYAAIPLGFILA
FT                   NPAQNAIAGAILLATFIGTGSSFLAFAIAAEKFKLDKPQFKYKSFYYLNGLTEGTETIA
FT                   LFVAFCIWPQHFAIMASLFAAACAITIFTRIYGGYHTLKQLEANISKTEAING"
FT   gene            complement(314544..315182)
FT                   /locus_tag="PSM_B0278"
FT   CDS_pept        complement(314544..315182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0278"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70318"
FT                   /protein_id="ADT70318.1"
FT                   /translation="MQSSLHIKDCQLYRQGELLLSLNEQVNGGEILTIMGPSGSGKSSL
FT                   LNWLTGCLPKDFRAQGEVWLNDQNIDNTPPHLRHIGVLYQDALLFSHLTVAGNIAFAMP
FT                   KGNKKQRLEKIDHALEQVGLTGLAARHPDSLSGGQQARVALLRMLLSEPKAILLDEPFS
FT                   KLDTQLRVDTRELVFSQIREHKLPAIMVTHDHSDAEATAGKVITLGTDA"
FT   gene            complement(315207..316922)
FT                   /locus_tag="PSM_B0279"
FT   CDS_pept        complement(315207..316922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0279"
FT                   /product="putative ABC-type transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70319"
FT                   /protein_id="ADT70319.1"
FT                   /translation="MNKVPASNSLFTFLVKLSPYCLVALLTLPVLGGVIGVLLPAFGWA
FT                   PALNETNIGLAGFNALWQTPGLTHMVELSIRTGLISTLIAFVLMIIMLGAFFNSVWLKR
FT                   IEYILSPILVIPHAAAAIAVSFLIAPSGLFTRLFSPWLTGWQLAPEGALPYDAFGWSII
FT                   IGLVLKELPFLLLIALSVLAQPELGKKLRKQHQIAVNLGYYPMVAFFKVVLPSLYPLLR
FT                   LPIFAVLAYASASVEMPLILGPNTPPTLAVAIMHWFNDVDLNLRIKASAGALLQLAVTV
FT                   GLLLTWLLLEKIIALVFKQSLINGRRQYAHQLICTFTHVFTSLILIFIVAALIGLVMWS
FT                   IAGYWRFPDTVPSSVVFLHFQHAFTQIHTPLFNTLIIGVISTLFAITMVLLCLEAEQLN
FT                   TKPMSKWTQLIIYLPLLVPSIAFLFGIVWLQQLLNSQHAFFNVIFVHVLFVLPYVFLSI
FT                   ADSYRRLDPRLARVAASLGTSPCKVFLQVKLPQLFAPILIAIALGLAISFGQYLSTLLA
FT                   SGGRISTITTEAVTLANGASRRTSAVYAILQMALPLIGFGVAWVLPKYFFKARA"
FT   gene            complement(316919..318196)
FT                   /locus_tag="PSM_B0280"
FT   CDS_pept        complement(316919..318196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70320"
FT                   /protein_id="ADT70320.1"
FT                   /translation="MHVVKPIQILSRYCFLSIALCIVLVASFKTMATSPSDTRWQTIQS
FT                   QGKNQPVYFYAWGGDPQINAYIQWVAEQVKAQYDIELVHVKLSDTSEAVSRVLAEKSAN
FT                   NHAQGSVDLIWINGANFAAMSKHDLLLKDWAQTLPNFALTDPNNNPAVNFDFGLPTNGM
FT                   EAPWGQASLTFYYDSLAIDGSTTNQLPTTLHQLLTWSAQNPGRFSYPKPPDFLGMSFLK
FT                   YALVVLHNNNDDELKAQLNQPATDKNTTEVLNPLWVFLNKLHPTLWRSGKHFMQSGAQM
FT                   RRLIDDTELSIGFTFSAPEVPAAVQRFDLPTSTRSYAMHDGSLSNTHFVAIPYNASHAQ
FT                   GAQLVANFLLSPQAQAHKQKPTIWGDKTVLIQSMLNTQQQALFKTTQPHPSALPFNSIK
FT                   RTLSEPHPSWVNAIMQGWQTRYGVSQ"
FT   gene            complement(318183..319007)
FT                   /locus_tag="PSM_B0281"
FT   CDS_pept        complement(318183..319007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70321"
FT                   /protein_id="ADT70321.1"
FT                   /translation="MHGAEVKPLYTLLKFLVLSALLVTAFKSSAQNLHDSWNTLLTKHV
FT                   VAINHGHSTEVDYAAIKHEHTQLKAYLNTLTAITPGEFNTWGKHKQLAFLINAYNAFTV
FT                   ELILTQYPNIESIKELGSFFSSPWSKEFISLLGKTRSLDDIEHELIRGSGKYNDPRIHF
FT                   AVNCASIGCPALREEAYSADKLEEQLHQQTVRFLSDNTRNMATGNTLNVSSIFKWYGGD
FT                   FEQGFKGANTLHPFLAQYADALKLLPAQQKALQNNDMKIKFLDYNWNLNARR"
FT   gene            complement(318988..321093)
FT                   /locus_tag="PSM_B0282"
FT   CDS_pept        complement(318988..321093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0282"
FT                   /product="mercuric reductase (Hg(II) reductase)"
FT                   /EC_number="1.16.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70322"
FT                   /protein_id="ADT70322.1"
FT                   /translation="MFFHFNLHQLLTLDGLKGSMDQFNQYKAQSPLLVIGGFFLLYVVV
FT                   TALSLPGAAILTLAAGALFGLVEGLLVASFASTIGATLAFLVSRYLLRDTIKKRFPERL
FT                   AAIDKGVDKEGAFYLFTLRLVPVFPFFLINLLMGLTAIKSWTFYWVSQIGMLAGTFVFV
FT                   NAGTQLAQIERLSGILSLDLILSFALLGVFPLIAKAILNVFKKQRVYKNYTKPKKFDRN
FT                   MIVIGAGAGGLVTSYIAAAVKAKVTLIEAGEMGGDCLNTGCVPSKAIIKSAKIAQQMRH
FT                   GENYGLENTTPQFSFKKVMARVHQVIADIAPHDSIERYTNLGVEVLKGYGKLIDPWTVE
FT                   IKLNDGSTQTLTARTLVIATGARPFIPPLPGIEETGYVTSDTLWSKFAELDEAPKKLVV
FT                   LGGGPIGCELAQSFARLGSSVTQVEMTQRVMIKEDVEVSAFAHQSLADSGVNILTSHQA
FT                   LRCEAREGKKYLVVKHNDTEIDIEYDELLCAVGRSAHLKGYGLEELGIETNRTIVTNDY
FT                   LETLYPNIFAAGDIVGPYQFTHVAAHQGWYAAVNGLFGHFKKFKVDYRVIPWTTFIDPE
FT                   VARVGLNEQEAIDKGIDYEITRFEFEELDRAITESANNGFIKVITPKGKDKILGVTVVS
FT                   EHAGDLIAEFVLAMKHGLGLNKILGTIHSYPTWAEGNKYAAGEWKRNHAPQTVLNMLEK
FT                   YHAWRRG"
FT   gene            complement(321156..323510)
FT                   /locus_tag="PSM_B0283"
FT   CDS_pept        complement(321156..323510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0283"
FT                   /product="putative TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70323"
FT                   /protein_id="ADT70323.1"
FT                   /translation="MKYSSLAVSIAALLNTPAIAFATTKPVTENAIERIEVAGQSLNSQ
FT                   GLSVKDATINGPFGDNLALQDIARSVTPISKELIEQLNITTLQDVLAVSPNTYAASGFG
FT                   APSLPTIRGQLGELFQDGTRRQAGNNGFGVPLSFNAVEQIDVVKGAPPVLFGSSQRNGG
FT                   FVNLHSKQASTEEHKGKAKLSAGRWDQYTAQLDYTAPIVKDKIGFRVSYEHLDHGSYYD
FT                   YSGTKSDSLFAALRVLPDDKSSWDINFELYQVEFTDNAGINRPTQALIDHGLYITGQGV
FT                   QANGSTVPAAGSIVSPTGLVNIDRSTVLTDPDNQNEATTYLLHSIYKRELSDKASLKNI
FT                   SYFQHLKRDEVAQNSFVEIIDGADTAQNRTELTYQWNNEQQTILAFDVRYNKVLGYSQF
FT                   TTEADTPIDLTGPLSNRRIPLTDAQKARLVELRPGVFVSPGGQYDINGDGSGDFNLSDT
FT                   TDSRSWQTGFAIQQDSQWTNKLRTSVGYRLDYYDVEAHDPIAPQGQTAASDSINDTLQS
FT                   GQISFNYKLNTDFTSYGAASYNEATSNSMAGGNTLGGDNTISAQNFATENTLVEFGLKY
FT                   APTNSDWYADGALFSQRRSLRNRDGSNTGIRTSGFEGQVFYDAYPYWLSAGYSYIDARY
FT                   DNSATGQDSAQIADAFDNSRPDIIAGNGIGAPSYTAFAPSNSQVQGIPEQSLSVNGSYS
FT                   INEKWQAGFSALYTKSYPLDFLQTVKIRDQYTLNVNTSYAFTPSTKLRLDVNNVTNQDN
FT                   WRPVFEGGYFGATLAFPELPINAKLTLTHNF"
FT   gene            323528..323674
FT                   /locus_tag="PSM_B0284"
FT   CDS_pept        323528..323674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70324"
FT                   /protein_id="ADT70324.1"
FT                   /translation="MYVDGYKRPKGLKITFSNLTILLFIKILKIAALLIDLLNKLNSYL
FT                   QLL"
FT   gene            323742..324155
FT                   /locus_tag="PSM_B0285"
FT   CDS_pept        323742..324155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70325"
FT                   /protein_id="ADT70325.1"
FT                   /translation="MTGSMNTDVQNRLQWSLLSLRCGVFIVMVMWTLDKFVNPGHSARI
FT                   FEHFYGISGSTDTIAYILGALQLLLVIAFLVGIKKRITYGAIFIMHGLSTLSSYNQYID
FT                   GFNNLLFFAAWPMWAACFALYLLRDQDVKFTIK"
FT   gene            complement(324148..324270)
FT                   /locus_tag="PSM_B0286"
FT   CDS_pept        complement(324148..324270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70326"
FT                   /protein_id="ADT70326.1"
FT                   /translation="MTHSKWVTNRLLRTTELPTLPVYFIGYRLTLITIFFAFII"
FT   gene            complement(324515..326206)
FT                   /locus_tag="PSM_B0287"
FT   CDS_pept        complement(324515..326206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0287"
FT                   /product="ribosomal large subunit pseudouridine synthase A
FT                   (pseudouridylate synthase, 23S RNA-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70327"
FT                   /protein_id="ADT70327.1"
FT                   /translation="MLTANFTAMSNPASCFTVFDENVDSLALPEQFTFPFYYKPHPLAV
FT                   VAAQQLQQQLKKLDKAILDTDDIDAGKMFGVLVVQNQAQQLGFISAYSGQIAGIDEQLN
FT                   FAPNVALKHIDDAVFSQQSQIINAINAQITALENSEDYQALEQQLATARKNYEQQLVAK
FT                   QQAMQVTRKQRKEQRQTGQEQLNADDFEQLKTTLAGQSIVEKKQLQALKQDWQTQITAL
FT                   EQTQAAMLGEINGLKKRRKTLSKNLQKKLFAQYQFLNAHGEVTDLNAIFAKLPEHTPPS
FT                   GAGDCAAPKLLQYAYKHDLKPVAMAEFWWGAPPKSAIRHHLHYYPSCYSKCQPILGHML
FT                   KGLNVEENPLLTNPAKGKDLTIVYQDDDLLVINKPAEFLSVPGINIDDSVYMRIKTQFP
FT                   AASGPLIVHRLDMSTSGLLIIALNKRAHKALQKQFIERTIEKRYVALVAGNITENSGVI
FT                   NLPLVLDFDDKPRQMVCYKTGKPSLTTWHVLERKNNTTRLQLYPKTGRTHQLRVHCAHQ
FT                   LGLNTPIVGDTHYGEEAERLHLHAEYLAFTHPISHQRLEFEVAADF"
FT   gene            complement(326334..328382)
FT                   /locus_tag="PSM_B0288"
FT   CDS_pept        complement(326334..328382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0288"
FT                   /product="peptidase S9 prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70328"
FT                   /protein_id="ADT70328.1"
FT                   /translation="MLKTSLALAIGLSSSVAFAQSAITVEDIPKIKSVIQTSVSPDGDN
FT                   VAFTRSLPRTLYVDENGSNYSELYVVDDKGVERPFITGSVNIKSIEWSNDSKTIYFLAK
FT                   LKDDKFTSLYQIPVDGGQAQPVLALKDTSISSYKLSPDNKQVAILAMPAADKSEKELKK
FT                   LGFKAEVYEMGLKNKQLFIVDLAKADKPLTPTALNVDNYVSDVNWAANGEKLLVKTQPT
FT                   ALIDDKYTKSMWHLFDIASNKVTLSFKTEGKLGDAELSHDGKYIAILGAEDKHDPATGR
FT                   LFIADTKTAEITEWLPDFMGHVVDFEWSHKRNTLNFIANVGTQSFVASIKTGSNKYKKL
FT                   VNEGEFIASQLSVSDSDKTLALRGNTAKHPNEVFIVRSNKATRLTDSNSWLNDKRFAKQ
FT                   ETITLKARDGVELDGVLVYPLDYEKGTRYPLIMSVHGGPESHDKDGWVTNYSRPGQMGA
FT                   ARGYAVFYPNYRGSTGKGVDYSKLGQNDYAGKEFDDLVDFKNHLVDMGLVDTKRVGITG
FT                   GSYGGYASAWGATKLTKHFAASVMFVGVTNQLSKFGTTDISNEMNLVHARSYPWDKWQW
FT                   YLERSPIYWAGQSETPLLIMHGKDDPRVHPAQSMELYRYMKVQGKDVRLVYYPGEGHGN
FT                   RKVAAQYDYSLRLMRWMDNYLMEGKKEMPAFEIDHAAKLKEVKDANK"
FT   gene            complement(328511..329683)
FT                   /locus_tag="PSM_B0289"
FT   CDS_pept        complement(328511..329683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70329"
FT                   /protein_id="ADT70329.1"
FT                   /translation="MLHKYGTPAYRLEAHLMEVATYLGLKSSFVMSPTSVTFVIWTDGH
FT                   EDEYTHVARVDPGDHDLGSLADTDDLVNKMLNDELTLQEVDQQLDIIFDAPNPYNRVIT
FT                   GIAFATSGGAFAMLMGTSWNDVLWSGLLTFVVYLFVLWSARSKRVAHMLEPLVAIVSAV
FT                   LACAISVHLDAHINIRLIVLSAIIVFIPGLALALGLAELAARHLVSGTARVMDSFMLLF
FT                   KLYFGAFIGIAIGFAIFGQADFVQPEPLPKWTAWLAIFLLCSSLIVIFRTKFKHAAWSI
FT                   ASGFIAYGTSIGSAMYLDYTLGTFVGAFSVGVFSNLFNRVANAPASIVAMQGLIVLVPG
FT                   SKTYIGLNSLIEGQDFVYAEHIGQQTFLIFMSLVAGLIFANVALPPKKSL"
FT   gene            complement(329861..331084)
FT                   /locus_tag="PSM_B0290"
FT   CDS_pept        complement(329861..331084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0290"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70330"
FT                   /protein_id="ADT70330.1"
FT                   /translation="MKKVLVIGYVWPEPNSSAAGTHMMSLLNAFKSQNWDVEFATPAQP
FT                   TEHMVNLNDYGITSQSIALNCDSFDDYVKAYNPDIVMFDRFMMEEQFGWRVDKHCPNAL
FT                   KILDTEDLQCLRNARHEAHKGEREFNHSDLLSDIAKREIAAILRCDLSLIISSYEMELL
FT                   NEVFKVEPSVLHHLPFMVDLSALPEQTKSYDQRQHFMTIGNFRHAPNWDAVLYLQKIWP
FT                   LIRKQLPQAELHIYGSYPPPKATALNNPKTGFLIKGWADDAYEVMQSARVCLAPLRFGA
FT                   GIKGKLLEAMIMQTPSVTTPIGSEGMHNHLPWPGAITQNAEEFANAAVSIYTNQAEFIA
FT                   AQKAGNELLNTLYDKAQLSDNLIEKIQLVSQNLSAHRMKNFTGQMLKHHTMRSTQYMSQ
FT                   WIAEKNKK"
FT   gene            331593..334043
FT                   /locus_tag="PSM_B0291"
FT   CDS_pept        331593..334043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70331"
FT                   /protein_id="ADT70331.1"
FT                   /translation="MNAFRLFIALVGCIVLLPASYAEQGYQTPSPALAALVDAKLAPTS
FT                   SLSNDGQWLALFERKRVVSLDELAKEEFKLAGIKLNPANFSRSRVSAKYSALELKHVQS
FT                   GTVINVNNLPQGIIRSPRWSANSEHLAFIVEQPDNARLWVYSVKTKQAKQLSELALNSV
FT                   LTATPYQWLPDSTAIVANLAVNLDKPRLTNDTQSTVPVIQQSTGEKAPARTYQNLLTSP
FT                   FDEAQFKFYGQGQLAYITLDGKAQPIGRAGLFKSFSISPDSTNILVATIDEPFSYQVPY
FT                   SRFATTWQIWGMRGYALVELAKQPLADNIPQGYDSVRTGRRDFEWRADQGAEVIWAEAQ
FT                   DGGDMKTEVEYHDYLYSLRAPFKRDPKLFAKVERRFAGIQWGNDNIAMLSDWRFSDRQV
FT                   RTYVIQPRNADSNRVLFSERSYNDAYKDPGSAIYERNDLGVSVIKVVGGRYIYLRGDGA
FT                   SEQGNIPFLDQYDVKTNSTKRLWQSAAPYYERVRALLDDEGTKFITIRESKSQQPNFFI
FT                   RDLDKGSLTQLTQFEHPYPAFKGVTKEQLRYTRDDGVELSGTLYLPPGYDKTQGPLPVL
FT                   MWAYPLEYKDKAVASQVRESEYEFTYIGYWGPMPYLAKGIAVFDDPKMPIVGVDGSEPN
FT                   DHFRKQLVSSAKAAVDVLVEKGIADKDNIAIAGHSYGAFMVANLLAHSDLFKVGIARSG
FT                   AYNRTLTPFGFQGEERDFWQAQSVYANMSPFFHAEKINEPMLMIHGQEDPNSGTFPMQS
FT                   ERMYAALKGLGKEARLVMLPYEAHGYRARKSLLHVLWEQEQWLDKYLLKDNVEPVDMDE
FT                   QPIQ"
FT   gene            334286..334903
FT                   /locus_tag="PSM_B0292"
FT   CDS_pept        334286..334903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0292"
FT                   /product="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70332"
FT                   /protein_id="ADT70332.1"
FT                   /translation="MIDVAALAVFIPTFFFVSITPGMCMTLAMTLGMSIGVRRTLWMMI
FT                   GELLGVATVAVAAVLGVASVMLNYPSAFDILKWLGGAYLIYIGINMWRAKGKMSVDTHN
FT                   TTAVSRYSLFSQGFVTAIANPKGWAFMISLLPPFINVQYSVAPQLAVLVAIILLSEFIC
FT                   MMIYATGGKSLRLFLTKGNNIKWMNRIAGSLMVLVGVWLILG"
FT   gene            335025..336029
FT                   /locus_tag="PSM_B0293"
FT   CDS_pept        335025..336029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0293"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70333"
FT                   /protein_id="ADT70333.1"
FT                   /translation="MTQSFDFNKALAELQAGKGLTGEDGVLTPLIKQLTEAALKAELEQ
FT                   HLESETQVNRKNGSTKKTVKSSIGQFELETPRDRSGSFEPQLVKKNQTKLTPEIDEKIL
FT                   SMFALGMSYRDIRGHIQDMYGVEVSEATITAVTGQLIPELKVWQARSLDTLYPFIWLDA
FT                   IHYKIKENGRYVSKAIYTVLGVNIEGRKELLGLYISESEGANYWLSVLTDLHNRGVSDI
FT                   LIACVDGLKGFPEAIATIYPDAEVQECVIHQIRNSMKYVASKHQKEFMAGLKPVYKAAT
FT                   KDAAEAALAELDAKWGKLYPIVIESWRRKWGNLSVYFKYPDYVRKAIYTTNGN"
FT   gene            complement(336268..336828)
FT                   /locus_tag="PSM_B0294"
FT   CDS_pept        complement(336268..336828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70334"
FT                   /protein_id="ADT70334.1"
FT                   /translation="MRNKLLILAVAGVITACGTTPQKSQPLAENDSVPSWVLQPTAPEG
FT                   GLASSSCVVWTGNMAASRAQAIANARADLATQISAKAQVMDTLINKQTQQQDSTTTNSS
FT                   FTQISKQVAEQSLVGAIAKEIGFARLDGKKQLCALVTMENTKPLFDKLIETSGKNLSPN
FT                   DEDMLYREFKLKTTTDELKALDK"
FT   gene            complement(336818..338116)
FT                   /locus_tag="PSM_B0295"
FT   CDS_pept        complement(336818..338116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0295"
FT                   /product="putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70335"
FT                   /protein_id="ADT70335.1"
FT                   /translation="MRHTLLFFALFSAYSGATTPTFEEFKKQQLAKQTTFKNDHQLEYQ
FT                   AFRQAYLEEYDKFRDRLLQNWSRPVQSSLLERVEYSADKKTRIIIDEQNSTVTVQTLED
FT                   SNETGLKATSQEEALTTNQLLNNVKLSPVLTDIFKDLSLLDKAVKTAKVDIKAQPDKHE
FT                   SEVALINEITSQHEQSLSSLDKNEQLPKAQIDIQKEQLTKEKEQRISNLNNALKKTKEQ
FT                   NLTYKRIKSHTFALPDTYLQKKVAPFVTYYSQFSKDQLSLLLAISHAESSFDPNAKSHI
FT                   PAFGLMQIVPNSAGLDVARKQFKKDIAPTAKELFDPKTNITYGAGYLDILTTRYLRKIN
FT                   NPISRRYCAIAAYNTGAGNVAKAFNLNRSTNINKAVALINQLDSEGVYAQLINNLPYDE
FT                   TKKYLQKVSKLDIQYQKNLEQWNLNNKEVNHAK"
FT   gene            complement(338126..338911)
FT                   /locus_tag="PSM_B0296"
FT   CDS_pept        complement(338126..338911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70336"
FT                   /protein_id="ADT70336.1"
FT                   /translation="MSVGNNLEPEANTEENKSLLAKLKGYFILLMVTLMGLGNWADSKA
FT                   LIIEGYNGFITHFTNQIEEKKITALDIGNYLPYAEKKIGIPQVIKTSSLNTDYEYRYYK
FT                   NTKYLLTLINKNTRIVGIAVHSLKYDKAMVPEFTPLIPFNKKMLRVNSLSDVIKSSNEF
FT                   YFDSHNIKYYMQSKQLNAQGMFLNLSVGFSNYAPLLDETQKALFKLDELMLTQDDEKAL
FT                   AKTTEILANTAATFYAVSELSSEYISDSLLTKYEFNAYF"
FT   gene            complement(338979..339845)
FT                   /locus_tag="PSM_B0297"
FT   CDS_pept        complement(338979..339845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0297"
FT                   /product="putative TonB-dependent receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70337"
FT                   /protein_id="ADT70337.1"
FT                   /translation="MLGLIAVGKTMTTRTSSLLLAAIALSPFLTNAASHCSCSSYYAKN
FT                   AQPKWVGIDIVDDEKLASSGSSQCSGLKTIDERRSAKNAREELAKLLSTDISVKEIIKN
FT                   TSSSTVSHSDYKSVIESQTNQLLKSAKVYDRYVDPINCTVYAAISISKADLEEGQQEKI
FT                   KQQQAMLGAKNSCLKVTGENSSQLTELLTEQLLQHGYKLTNSACEVTYLVKNSIIKAQS
FT                   KLVITQLKLQIDTQSKKSIWQQRFEGKGLSYSKRSKTELIHLANQDSTTNLINSIVKLK
FT                   NTAIDSY"
FT   gene            complement(339870..340937)
FT                   /locus_tag="PSM_B0298"
FT   CDS_pept        complement(339870..340937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70338"
FT                   /protein_id="ADT70338.1"
FT                   /translation="MIKGIKIALVSSVMLSGCVVTETINGGIASLNNSFTTAELPITYT
FT                   KAAKESGTEKMKRLAVISNNRNAATGIIETNLSNIRVNGQPYFTFVDKASLSKIIEQQR
FT                   FNESDISNSKNRTRLGKLTGADTLITADYTADVDTSTYYEKDSECIQKGDKWYKCEKSR
FT                   EITIKCSEKIAKVNFKPKAVSVETGQIVFTKQYSRLSSSKVCKGDDPHPSDSVLRGRAL
FT                   AAVIEELKQDVAPHQVTKNVKLMESDDSDLTDKAEELLDLAVEFAEKDMPDHACKTFAK
FT                   AQSQYSESLAINYNNGVCAERANDLELAKAYYEKASNLTLDVDELKFVIEGQTRLVERE
FT                   SDNAKLTLATTSNRL"
FT   gene            complement(341212..341724)
FT                   /locus_tag="PSM_B0299"
FT   CDS_pept        complement(341212..341724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0299"
FT                   /product="MarR family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70339"
FT                   /protein_id="ADT70339.1"
FT                   /translation="MKNEKYISNLIGTFATFVSNDIEKQIAELGGRRLSHESALVTIYN
FT                   HPNETIDVLSKVLGLTHSGAVRLINTLEKEELVERRKSVKDARSVVLYVTDKGSQRVKR
FT                   VLNSRETATSKILNSFNDEQKQSFLSLIELALSSLTSEQIEARKICKLCNEGVCRKRGC
FT                   PVENAIK"
FT   gene            341915..342415
FT                   /locus_tag="PSM_B0300"
FT   CDS_pept        341915..342415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0300"
FT                   /product="haloalkane dehalogenase"
FT                   /EC_number="3.8.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70340"
FT                   /protein_id="ADT70340.1"
FT                   /translation="MFLHGNPTSSYLWRNVMPYLQGKGRLIAMDMIGLGDSKKLDNTHE
FT                   SSKYTFALLEALGVNSNVTLVLHDWGSGVGFNWANTHRDAVKAIALMEAIVTDFPTWDD
FT                   FLKDLHGPISTLRSAEGEKMVLDDNFFIETILPATISRQLTQKEHDEYRRPFINPGRIA
FT                   VQF"
FT   gene            complement(342800..345367)
FT                   /locus_tag="PSM_B0301"
FT   CDS_pept        complement(342800..345367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0301"
FT                   /product="putative excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70341"
FT                   /protein_id="ADT70341.1"
FT                   /translation="MAATPKSTYAVTNAKSALLNPEHSIEVRGARVHNLKDVDLNLPRN
FT                   SLVVFTGISGSGKSSLAFGTLFAESQHRYLDSVSPYARRLIDQVDEPDVDSIEGLPPAV
FT                   ALQQQRGAPSVRSSVGSVTTISNALRMLYSRAGEYPKGQGILYADAFSPNTPQGACPEC
FT                   HGIGRVFNVTEELLVPDPTKSIRDRAIAAWPPAWQGKNLSRILTSLGYDIDKPWNTLPK
FT                   KARDWILFTDETPTVPVFPEYTLKQTQAAIKNEENPSYMGTFSSAKRFVLQSFASTQSP
FT                   RTKKRVSQYMQVSSCPQCDGKKLKKKSLSVKVAGFDIGEISQLTLSELAQTLSIAASKP
FT                   AKSNAANPEKAIVAKRIAGDILKRVEALTKLGLGYLSLERTTPSLSLGELQRLRLATQI
FT                   RSKLFGVVYVLDEPSAGLHPADTQALLAALDELIAAGNSVFVVEHDVSVIRHADWVVDV
FT                   GPNASTHGGNIVYSGPVEGLKQISSSHTSQYLFKNEENHLAHIQHKQHKQRRPKAWLSL
FT                   KNIERNNLQKLDVEFPLGVITSVTGVSGSGKSSLVSQALVELVYDALGQKSQPQIPTDN
FT                   AELLEQELDITTEGQITQGIEHIKRLITVDQKAIGRTPRSNLATYTGLFDHVRKLFANT
FT                   NEAKARKYDAGRFSFNVKKGRCENCEGVGFVSIELLFLPSVYSPCPVCNAKRYNQKTLE
FT                   ITYKDKTIADVLNLTVESAHTFFDDEPAIERALNTLLQVGLGYLRLGQPATELSGGEAQ
FT                   RIKLATELQRAQRGDTLYVLDEPTTGLHPKDVAMLMTQLNGLVDAGNTVIMVEHDMQVA
FT                   SNSDWVIDIGPGAGDEGGHIVAQGKPEKVANVKASKTAPFLLK"
FT   gene            345707..346324
FT                   /locus_tag="PSM_B0302"
FT   CDS_pept        345707..346324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0302"
FT                   /product="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70342"
FT                   /protein_id="ADT70342.1"
FT                   /translation="MIDVAALAVFVPTFFFVSITPGMCMTLAMTLGMSIGVRRTLWMMI
FT                   GELLGVATVAVAAVLGVASVMLNYPSAFDILKWLGGAYLIYIGINMWRAKGKMSVDTHN
FT                   TTAVSRYSLFSQGFVTAIANPKGWAFMISLLPPFINVQYSVAPQLAVLVAIILLSEFIC
FT                   MMIYATGGKSLRLFLTKGNNIKWMNRIAGSLMVLVGVWLAIS"
FT   gene            complement(346358..347242)
FT                   /locus_tag="PSM_B0303"
FT   CDS_pept        complement(346358..347242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0303"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70343"
FT                   /protein_id="ADT70343.1"
FT                   /translation="MSDKLTKTLNIFVRTVQTGSMSKAAADLLMTTSAISQQIKQIELD
FT                   VGLSLFNRSPRELTLTEAGELYYQSCLQMLAVATATSEQLQHLQNCPSGQLKLAAPVGF
FT                   GGGLLSEPVKHLISQFSDIDVHLTLSDEPIDMIRTGIDLVLAIGPLEDSNLIARQLASW
FT                   PLILCVHKNHALAQQPKITLDDLKAHNRIAHIAVDPALTHLTRGESTTLPKARIAINNM
FT                   QTVIQFVLDELGYAILPEPEVRNFLATGELLEICTDWQLPHYDVFALTPARDTLAAKTK
FT                   AAIKALNASFSAI"
FT   gene            347364..349349
FT                   /locus_tag="PSM_B0304"
FT   CDS_pept        347364..349349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0304"
FT                   /product="enterobactin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70344"
FT                   /protein_id="ADT70344.1"
FT                   /translation="MNTVSCKLRPVTAFILSTFAIANPAFADEKKQDMEVMVVTASGYE
FT                   QMLKEAPASISVIDRAQLEKRFYRDLTDAMADIPGVIVTGGGDRKDISLRGMASQYTLI
FT                   LIDGQRQSSRETRPNSDGPGVEGAWTPPISAIERIEVIRGPMSSLYGSDAIGGVINIIT
FT                   RKAPEQWYGELRLDSTIQEQSQSGDINQASFFTSGGIIPDLLGVQLYGQFSKRNEDEFT
FT                   AGFRGKEQSNVKAKFTLTPNDSHELMFELGSAKQTLDETLGKTVAPLAPGENCGRRGCP
FT                   ESATTEYEQQTYSMSHNGFYDFGSSRSYIKYDKFDNNSREMFIENTDIQTTWSLPLFSD
FT                   HNSTFGATYLKESLDDYTSNKISDLTHVENEQWSVFGENEWAATDDFKLTAGLRYDHDG
FT                   NFAGHWSPRLYGVYSASKTITIKGGISTGFRAPNIRQSTAQWGQVSRGGNIYGNPDLKP
FT                   EQSVNYEMGVYYDSGRDLSISTTVFYNEFDDKITRIACPLTQCTDGPNQFGSMPTTYIN
FT                   VDEAKTQGIEISIDYDISTEIDVSASYTYTDSEQKTGQYKGSPLNQLPKHSLQTSLNWR
FT                   PTDKLGGWLRVQYRGEESQPTTGPSQSSLIAPDYTIANLGANYQLSDSVKLGAGIYNFL
FT                   DKEITEQEYGYVEDGRRYWASLVWQF"
FT   gene            349619..350473
FT                   /locus_tag="PSM_B0305"
FT   CDS_pept        349619..350473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0305"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70345"
FT                   /protein_id="ADT70345.1"
FT                   /translation="MKIPKRLQPLVDDGFIDEVISRLMSGKEADVFVVACGDDIRCAKV
FT                   YKDASKRSFKKAAQYQEGRKVRSGRQARAMGKRSSYGRQLEEEIWQNAEVDALSRLSSA
FT                   GVRVPQTYGCIDGVLLMELVSDDEGDVAPQLGAVDLTEKQAIEQHTLMMHYIKLMLCAG
FT                   IIHGDLSEFNVLVDSNGPVIIDLPQAVNASANNSAEAMFARDVNNMRRYYGQFAPALLH
FT                   TQYAKEMWALYEDANLTPHSKLSGEFEDDSEAADVDSVLDEIQAAFDEEQERKERIRDA
FT                   DEQ"
FT   gene            complement(350643..351005)
FT                   /locus_tag="PSM_B0306"
FT   CDS_pept        complement(350643..351005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70346"
FT                   /protein_id="ADT70346.1"
FT                   /translation="MISTYYLHDSESVKIKAALFVSPFFYLTGLYYFLHLLTTPNEITL
FT                   GNNSIEIDGKVYSLGLNTKCSVLFNKASQAEFEITINNKKIVTTSFFYKCDFNEEEFIS
FT                   YYIDNEYVFADSMAFN"
FT   gene            complement(351582..352412)
FT                   /locus_tag="PSM_B0307"
FT   CDS_pept        complement(351582..352412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0307"
FT                   /product="integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70347"
FT                   /protein_id="ADT70347.1"
FT                   /translation="MLCNVFNVHRSSYKYWAIRDTTPTPEQVRLEAEVKAIHAMSGGSA
FT                   GARTIAAIATNNGFELSRYRAAKLMVKLKLESCQVPQHSYKRGGNEHLEIPNLLDRQFD
FT                   VVEPDTVWCGDVTYIWVGNRWAYLAVVIDLFARKVVGWAMSLSPDTNLTLKALELAYES
FT                   RGKPTGLMFHSDQGSHYTSLKYRQRLWRYKIKQSMSRRGNCWDNAPMERFFRSFKTEWM
FT                   PKVGYENFRDAKYSVSDYINGYYNNVRPHHYNAGLAPNESEIRYQDSKTVAKIS"
FT   gene            complement(352451..352774)
FT                   /locus_tag="PSM_B0308"
FT   CDS_pept        complement(352451..352774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0308"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70348"
FT                   /protein_id="ADT70348.1"
FT                   /translation="MGEKMTKLKRATYSAAIKLETAQLVVDQGYTQEDAAKAMGVGKST
FT                   VSKWVTQLKQERNGQSPSASPMTPEQIEIRELKKQIQRIELEKDILKKATALLMSDSLN
FT                   NSR"
FT   gene            352864..353358
FT                   /locus_tag="PSM_B0309"
FT   CDS_pept        352864..353358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0309"
FT                   /product="histone acetyltransferase HPA2-like
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70349"
FT                   /protein_id="ADT70349.1"
FT                   /translation="MDTTIRKAESIDIAAIKMLWQFYQYHQSIFDLEDVGLDGCYDIDE
FT                   EYLECVVRGEEDCIIYLVLVSNQIAGFATVEPTEIVGKEIPELADIFILPKYRKQGIAK
FT                   FVIQNLMPVETNQWHVAVHLNDSSALKFWNSLFAKLNVVRVDKVDPPETEGYHEFVITN
FT                   N"
FT   gene            353478..353594
FT                   /locus_tag="PSM_B0310"
FT   CDS_pept        353478..353594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70350"
FT                   /protein_id="ADT70350.1"
FT                   /translation="MKMSAARILVHLTLLKSFRKLCDSNTLGYLLKLYKLDK"
FT   gene            353662..354447
FT                   /locus_tag="PSM_B0311"
FT   CDS_pept        353662..354447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0311"
FT                   /product="putative restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70351"
FT                   /protein_id="ADT70351.1"
FT                   /translation="MLNAKFYETYYFCNVIKNTLQDQFELARALNEFYGDGNVTYLIET
FT                   FPKFSLFHKYLYFVINRIYYENLNKFAENKSKRLPIEGALKFHSIPHISFQSYMEKNEN
FT                   NTKHYDDLIHNYMEHLNDAYDQLLTHTVEEVFYILFQNRDLLMEFNLMISGALEREDLK
FT                   EIDSDLVTKRGRLKRGHIPQWVKRAVYFRDRGQCVLCNKDLSGIVSLDNKENYDHIVAL
FT                   AQYGFNDVTNIQLLCKECNQNEKKAGEAVTSNSYQKWYK"
FT   gene            355116..355481
FT                   /locus_tag="PSM_B0312"
FT   CDS_pept        355116..355481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0312"
FT                   /product="TonB2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70352"
FT                   /protein_id="ADT70352.1"
FT                   /translation="MKYITIFLVLLLVGCNSTDKVANSSIVYINAQTDSPAKWVVKIEP
FT                   KYPEDAAKKSVEGYLKFKAIVNEVGALERVEVIESAPKGVFEKEGLRALKLWRFKPALL
FT                   NGRLVKVEYAGTLEWKL"
FT   gene            355616..355729
FT                   /locus_tag="PSM_B0313"
FT   CDS_pept        355616..355729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70353"
FT                   /protein_id="ADT70353.1"
FT                   /translation="MLKAKHQESLKLNAKLGKYLFIAAVVIGVLLFVSFLW"
FT   gene            complement(355867..357456)
FT                   /locus_tag="PSM_B0314"
FT   CDS_pept        complement(355867..357456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0314"
FT                   /product="hypothetical protein"
FT                   /note="putative tetratricopeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70354"
FT                   /protein_id="ADT70354.1"
FT                   /translation="MQPNLKQLHQSAINNLNQGNIQQAHKALVELVTQQPDFADGYFLL
FT                   AMVNLQVGQIYKAIKLIEKALSFTKSIEYTAQLAKCYALTGDLQKAKSTALGVKPEHIS
FT                   KALDADTLGVALTQAGLHQQAADYFIFALSLAEASNTRQPQFYYNYGVCAKFLGQFDKA
FT                   QHAFENAIALNPLHHQSHFALADLTKVTEQNNHIARLKNAFEQVNHPDAKLHIGHALAK
FT                   EYQDLGEFSAAFAALQQSKKAKHANKAFDNQASEALFAHIKQLSVKYKNQQTAGNQSCE
FT                   PIFVLGMPRSGTTLIERILSSHSDVQSAGELQDFGLSVKKLSQTPTPQVLDTDTLSQAY
FT                   QLDFAKLGSTYLEATRVVTGSHKHFIDKLPFNFFYIDLITKALPNAKIICLLRDPMDTC
FT                   IGNYRQLFTINNPYYAYSLDLLDTAKFYSRFYKLMQHFSALHSNIKLVKYEELIAAPGQ
FT                   KIKELVSYCDLDWQPQCLDFHLNTAPVSTASKMQVRQPLNNKAIGRWKNFKPHTDEAQT
FT                   HLVNEGVIGLIK"
FT   gene            complement(357567..359981)
FT                   /locus_tag="PSM_B0315"
FT   CDS_pept        complement(357567..359981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0315"
FT                   /product="putative Outer membrane TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70355"
FT                   /protein_id="ADT70355.1"
FT                   /translation="MFKPSLLTLAVSSALSGVLFSSNAVAQEQVIEKNKSLEVIEVTAT
FT                   RRSGSIQAAPLNITALDADVMKDQNISELADVARWVPGLTITDQGGRAGSPIIVRGLNT
FT                   NSSGPSSDGGTVATYINEIPVSVDMRLVDVERVEVLIGPQGTLYGAGTLGGAIRYMLKE
FT                   PELDFTSGEVFGDVFQTQESDSVGGEAGFIFNLPLIEDKLAVRTSLNIYEDPGFIDYAY
FT                   TVREPGVSITDPDWTNLDAVNSNLKNVKDANGETTTTGRMSLRYKANESFEGTLNYFYQ
FT                   KQDTEGRSIVHHNSLNENNGLNDRIGKYESAYRFEEPREKEDQLLSLELKADLGFAELV
FT                   SATGISHFEADGQRDQTDLLIRLDYGYEEFPSFSAFTRELDEVDTFTQELRLVSQSDSD
FT                   LSWIVGGFYNKTDTDASSREFTPGFDQFAVDNFGGAQLRPDSLEYLEITGSKVTESALF
FT                   GEVGYQVTDKLDITIGARFYEYDVESKAAFDFPLANTLYEGAAPDAISINFEENKAGDN
FT                   GNLFKFNAKYQFTDSVMAYATISEGFRIGGSNGLVPCPTPLPEDQQTGCGTPDEMLYDA
FT                   DTTTNYELGFKSTWFRSQLHFNAALFNVDWDNAQIAGATTVGQLPYLSNAGSANAKGIE
FT                   IATRAILSDSFTAYATYAYTKAELTSDAPYLFNADGTDGAKDGDRLPGSPEHQFSMGIN
FT                   YQTEVFNDKTLDINYGLTAQSDVISKVGLRDNGEALPGYSLSNISAKLTADAWSTTLYV
FT                   DNLFNKYAVTSVRRSDADITTANGADIQRNYGYYINRPLTVGIKFNYKFEI"
FT   gene            360357..361451
FT                   /locus_tag="PSM_B0316"
FT   CDS_pept        360357..361451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0316"
FT                   /product="putative NADH-dependent flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70356"
FT                   /protein_id="ADT70356.1"
FT                   /translation="MSKLFSPLSLGKLSLENRIIIAPMCQYSANNGAASDWHTIHLGQL
FT                   SLSGAGLLILEATAVNPEGRISYADLGLWDDTTQAALAKSLTAVRQYSPMPIGIQLAHA
FT                   GRKASTDKPWDGGGALIPDHLNGWQTVAPSAIAYDENSPTPKAMNQDDIDSLISDFVNA
FT                   AKRADELGLDLIEIHGAHGYLLHQFLSPLANKRDDQYGGSLENRMRLLLDVFKAVRTAF
FT                   PSNKAVGVRISATDWVDGGWDLPQSIELAKALDALGCDFIHVSTAGLSPEQDIPVVKNF
FT                   QVPFATAIKQVVNMPVIAVGLITEAQQAESIISDERADGVALARGILYNPHWPWHAAAE
FT                   LGAQVQAPKQYLRSSPHGKPSPIK"
FT   gene            complement(361528..362397)
FT                   /gene="rhtA"
FT                   /locus_tag="PSM_B0317"
FT   CDS_pept        complement(361528..362397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtA"
FT                   /locus_tag="PSM_B0317"
FT                   /product="transporter involved in threonine and homoserine
FT                   efflux"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70357"
FT                   /protein_id="ADT70357.1"
FT                   /translation="MQKSTKELLLAILCILLAMITIQSGASLAKQLFPIVGPEGTTALR
FT                   LGFSAAILCLIFKPWRHFPVASQRLPILIYGLSLGGMNILFYYAIERIPLGIGVALEFT
FT                   GPLAVALFSSRRKRDLFWVACAITGILLLLPDMKGQESLDPIGVILALAAGACWAGYIL
FT                   FGKKTGSQSSGGATVAMGMTISAIVLVPYGGISQSAAFTWDIIPLGIAIAVLSSALPYT
FT                   LEMITLRNMSPQGFSIMMSLEPAIAALAGLVILGELLSIWQWLAILLVIIASVGSSTSN
FT                   SKKQPSPA"
FT   gene            complement(362591..363592)
FT                   /locus_tag="PSM_B0318"
FT   CDS_pept        complement(362591..363592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0318"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70358"
FT                   /protein_id="ADT70358.1"
FT                   /translation="MNFVIVGTNFISDTLLDAASTLSNFNLYGVCSRAESSAERFLANH
FT                   PTHSQAKIFTSIDAVCQDELVEAVYIAAPNSLHKDYAVQCLAAGKHVLGEKPSAANSHE
FT                   LTAILTAAQKHQRLYMEAMMTTHLPNFAVLKNALKRIGTPRKFIGQFSQYSSRYDKLKN
FT                   GERPNTFLPEFANGALVDLGIYPLYLLIALWGAPNSVHASGVLLETGVDGAGDVLLNYA
FT                   DKQAVISYSKISQGENITEIQGELGRIRIEAVSQLKKVEFIANNGQKETISTDFDEHFM
FT                   KYEVAHFIEMIEQNALESHINNHQLSRDVMTVLDTARAQLGVIYPADSKAKL"
FT   gene            complement(363630..364631)
FT                   /locus_tag="PSM_B0319"
FT   CDS_pept        complement(363630..364631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0319"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70359"
FT                   /protein_id="ADT70359.1"
FT                   /translation="MSSLIKATSLQGIDTLITELGGDTANIMRHCAIEVTLNSLETQSL
FT                   TYRHYAELLEYCAHSLNCPSFGLKLASKQSFDILGHIAIAAKSGTDLGEALTWVIKYLH
FT                   LHTPALNLTTHTLEDDQNIFLSFEIKLKPLPVINQVIELTIALALATLKKVSQNQCKPI
FT                   KVFLPQKLDANLRAYHQHFGCNVIEHRNSAGILIAKNDLLLPLNVSDQHKVQAALNFLA
FT                   ANNAHTQSLPSQVSALIRPMLPLFQCSNQTIATALNLHPRTLHRELKKHNTSFVKLKDA
FT                   TRRALCEHYLMQNQFSISHISELLGYQEQATLSASVKRWFNCSARAFRAKYC"
FT   gene            364721..366319
FT                   /locus_tag="PSM_B0320"
FT   CDS_pept        364721..366319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0320"
FT                   /product="putative choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70360"
FT                   /protein_id="ADT70360.1"
FT                   /translation="MHTTSFDYIVIGAGSAGCVVASRLSENKNVSVCLIEAGSRDQSAM
FT                   VQMPAGVAASVPYGINSWHYNTVPQKELNNRCGFMPRGKVLGGSSSINAMVYIRGNKKD
FT                   YDNWAAMGNTGWDYTSLLPYFIKAENNKTFINSPYHGVNGPLHVQELSLPSPVNQLFLK
FT                   ACQEQGVALNDDINAQQQLGARLSQVTQHKGERCSAAKAYLTPNLARKNLTVLTDAQVH
FT                   KINFCGKSATGVTVAVNNKSYVLNAHKEVILSAGAINSPQLLMLSGVGPADHLKQHNIE
FT                   LVTPLEGVGSNLHDHLTVVPLYKAKYSQGTFGISASGAFNIAKGCVDWFAKREGKLTSN
FT                   FAESHAFINLFTDSIVPDVQLEFVIGLVDDHSRKLHYGHGYSIHSSIMHPKSRGTIRLA
FT                   DANPVSAPLIDPNYLSHPDDLQVMLLGLKKTLSIMQSKAFDTIRADMVYPLDINDDAQL
FT                   IEFIRQTADTEYHPVGTCKMGQDDMAVVDSELRVHGVQNLRVVDASIMPSIITGNTNAG
FT                   VIAIAEKAADLIRVC"
FT   gene            complement(366587..367396)
FT                   /locus_tag="PSM_B0321"
FT   CDS_pept        complement(366587..367396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70361"
FT                   /protein_id="ADT70361.1"
FT                   /translation="MYLNPNWNILTVGDGDLSFSNALYNHIKPQKLVASTYDAAATLTE
FT                   KYPDNALASLKAHKIDVLNEFDVTNTQCWQQLAEHLNSFDVVIFQFPLIPAFIGRDAFD
FT                   KNTRNNSMNVLNRALLHQFIKYANEFALNPQGPGLCYITSKDVKPYREWNIEGSLNTHL
FT                   NAAYQGQMPFDISRFDGYKIRNVDRDKHVKDTSGITYVFSENTLPELSDMLTTPNYLTD
FT                   DYCPLCRVGPFLADEDKNKHFAAKKHQQMVKLEQDWQQWLTAFYKSS"
FT   gene            complement(367403..367801)
FT                   /locus_tag="PSM_B0322"
FT   CDS_pept        complement(367403..367801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70362"
FT                   /protein_id="ADT70362.1"
FT                   /translation="MIDQLRQQLTDLGENFVEKNAAFKIKVIPFFCAISIKKDHKSEGR
FT                   LSFYSNQLIEIFMVVLFVLFGLAIYDPQAGFTHGPIHIVFAILITFNLILKQVAIEGLK
FT                   TRLAMYRLHQQLISTPHPDTSPVTNKNI"
FT   gene            complement(367869..368288)
FT                   /locus_tag="PSM_B0323"
FT   CDS_pept        complement(367869..368288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70363"
FT                   /protein_id="ADT70363.1"
FT                   /translation="MEKFVNHIQLGYLGLLPFLGCVGWPLMFGSNSVNLEFFSFYSIAI
FT                   LAFMAGNLWHAGQQSFADAIKAVLPVIPIPFLSFLPIEWMLAWLGASFWLVLIFEKATI
FT                   QWQGYHKDYQKMRFVLTSVVFVCHILIIGMSIYPK"
FT   gene            368586..369155
FT                   /gene="ahpC"
FT                   /locus_tag="PSM_B0324"
FT   CDS_pept        368586..369155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PSM_B0324"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70364"
FT                   /protein_id="ADT70364.1"
FT                   /translation="MSTSLINTKLQPFNATAYHNGDFVELTEKDVLGKWSIFFFYPADF
FT                   TFVCPTELGDLADHYAQLQEMGVEVYSVSTDTHFTHKAWHDTSDTIGKITYPMIGDPTG
FT                   RITRNFGVMIEDDGLALRGTFVMNPEGEIKVVETHDLGIGRSAKELVRKVQAAQYIATH
FT                   DGEVCPASWQPGEDTLAPSLDLVGKI"
FT   gene            369320..370897
FT                   /gene="ahpF"
FT                   /locus_tag="PSM_B0325"
FT   CDS_pept        369320..370897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PSM_B0325"
FT                   /product="Alkyl hydroperoxide reductase subunit F (Alkyl
FT                   hydroperoxide reductase F52A protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70365"
FT                   /protein_id="ADT70365.1"
FT                   /translation="MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVESLANDLAS
FT                   LSDKFSVINNPDTSARRPSMVVHSPEKNTHITFAGVPMGHEFTSLVLALLHTGGHPSKA
FT                   SKDDIEQIQTLEQTLNFEVYISLSCQTCPQVVQALNTMAATNSNIKATMIDGALFQDEV
FT                   EQRNILAVPAVYLNGEPFSQGAMSLTDILNKVDSKGAQRQAASLNEKSVFDVLVVGGGP
FT                   AGASAAIYSARKGLNTGVVAERFGGQVADTLAIENFISIKAMQGPKMVAQLEEHVKEYD
FT                   VDVMHNQRAANLQKGSNGYDITLENGAVLKAKSLVLATGARWREMNVPGEQQYKGHGVA
FT                   YCPHCDGPLFKGKPVAVIGGGNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKANS
FT                   LKNITIIKNAQTTEVLGDGKKVTGLSYTDRLSGESKQLNLAGIFVQIGLIPNTEWLKDS
FT                   DLELSQFGEILIDAKGATSLQGVYAAGDATTTPFKQIIIAMGAGATASLGAFDYLIRQT
FT                   PDAEQSAA"
FT   gene            complement(370993..371184)
FT                   /locus_tag="PSM_B0326"
FT   CDS_pept        complement(370993..371184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70366"
FT                   /protein_id="ADT70366.1"
FT                   /translation="MTNKIIGIVLIVIGIALAIWGYDVYDSAASQVTRALNGETPMEAW
FT                   LGFIGGAVCILVGITRLK"
FT   gene            complement(371233..373257)
FT                   /locus_tag="PSM_B0327"
FT   CDS_pept        complement(371233..373257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0327"
FT                   /product="sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70367"
FT                   /protein_id="ADT70367.1"
FT                   /translation="MNFLRCFHNIVSDQQLSFDQKIADLLAFGLDVFQLDLAIISRVKN
FT                   NSYTVLHAITPDNSLAIGTEFELNGTYCTHTLLANSALAFHNASQSSIANHPCYINFQL
FT                   EAYIGAPIRIGTDVFGTVNFSSAQECAPFSDEAYDYIELLAQWLGSEFARNQDKVNLTK
FT                   NSDTLLKLENVANIGTWEVDLIDNSIFWSQQTRRIHQAEEGYTPNMETAIEFYKAGKSR
FT                   DSINKAVENAVSKGEKWHLELEIITAKQQNIWVSTFGEAEFNNGKCVRLFGTFQDITEA
FT                   VKLREELKQKKALAEQLLQDRSMLFAKISHELRTPLNGITGMLATLIDEHDYDKRAEKI
FT                   KVALRSADILLSIINEVLDFSKINHGELKLEPHHSLLKTVFTDLVSLYSVLFSNKNIEL
FT                   LATNLIPNDVWVHCDTSRLSQIVSNLLSNALKFTEHGSVSLYSQLALDTKHPLLTIKIT
FT                   DTGRGMSKAYLNSLFKPFTQEVDANNNKGGTGLGLAIVKELVGFMNGKIEVTSEINVGT
FT                   CFTLTIPIELGKQQIQTPSLKSINNHGAKLSVLVVDDNEINRLVLEAALDKFNIKSDFA
FT                   IDGQDAILKCKQKHYDLIFMDCIMPILNGFEATKQLRSNNICSPKSTYIVALTANASSQ
FT                   DKLSCKQAGMDMFIAKPFKLPAIEEAITNTLKRLSVATL"
FT   gene            complement(373474..373605)
FT                   /locus_tag="PSM_B0328"
FT   CDS_pept        complement(373474..373605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70368"
FT                   /protein_id="ADT70368.1"
FT                   /translation="MSDKTIPNRLLEVKIAFTHTPKAIEIIKYVYGERYSTCLSIHR"
FT   gene            complement(373595..374464)
FT                   /locus_tag="PSM_B0329"
FT   CDS_pept        complement(373595..374464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0329"
FT                   /product="ratatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70369"
FT                   /protein_id="ADT70369.1"
FT                   /translation="MSMTNNNHTLVVEGGAMRGIFAAGVLDEFLEQGYQPFNRYFGVSA
FT                   GATNVAAYLCKQPTRNYKVITDYSCRPEFINLARFIKGGHLFDLDWLWQETVREIPLNT
FT                   DEFSQSPYDFYIVATAIDSGKAHYLQATGNEMVEQLKASCAIPVAYRDYPTINGIAMTD
FT                   GGVADSIPVKKAYEMGASEITVILSQPLGYRKKDNKVPWLTKQLYKQSPALAEAAIQRS
FT                   KNYNDSIDFLHNAPSDCKINIIAPPTGFKVGRTTKNRAILNSGYQMGISEAKSYLDKPR
FT                   FGSNGYER"
FT   gene            complement(374524..375183)
FT                   /locus_tag="PSM_B0330"
FT   CDS_pept        complement(374524..375183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0330"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70370"
FT                   /protein_id="ADT70370.1"
FT                   /translation="MVGLCLGAFVLAEAGILDGKTASTHWVWANDFAKKYPKVNFDNDV
FT                   LYIDEGNVFTSAGAAAAIDCCLHLLRRDHGADIANSVARRMVVAPHRSGGQVQYIEKPI
FT                   PRHIDSNRLEPAITWALKNLTKPLTIDELASKASMSRRNFSRLFKKAMGTTFTQWLLSQ
FT                   RLTIAQQLLETSNHNIDRIANQSGFSSSVSFRQQFLAAFSISPSAYRKQFKSSEPQ"
FT   gene            375651..376238
FT                   /locus_tag="PSM_B0331"
FT   CDS_pept        375651..376238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0331"
FT                   /product="isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70371"
FT                   /protein_id="ADT70371.1"
FT                   /translation="MTTTLRELNGLDSTPASLTNATLIFVDYQNTYTQGVMELEGWQDA
FT                   LNNAAILLADARAAGSKIIHIMHDGGEGSPYDINAEIGQIHSSVAPIADEKVIVKTAPD
FT                   SFVGTGLGEQVDVIGNNKLIIVGFMTHMCVTFTAQGAFLRGNHATVVADACATRPLQTS
FT                   VSDVLASDLHKSALATINDLYGVVIPSADDLS"
FT   gene            complement(376359..376754)
FT                   /locus_tag="PSM_B0332"
FT   CDS_pept        complement(376359..376754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0332"
FT                   /product="GGDEF/GAF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70372"
FT                   /protein_id="ADT70372.1"
FT                   /translation="MCDIDFFKRYNDNYGHHKGDETLKHVARALKSLCKREGDIAARYG
FT                   GEEFAIILPATNIEQCHKFALLIEQKIKALNITHEFSPIAPYITLSFGCFCSYPNADTH
FT                   TETLIKSADIALYKAKKAGRNQICIFE"
FT   gene            complement(376907..377782)
FT                   /locus_tag="PSM_B0333"
FT   CDS_pept        complement(376907..377782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0333"
FT                   /product="GGDEF/GAF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70373"
FT                   /protein_id="ADT70373.1"
FT                   /translation="MSHDSNNTIWKIFNLINLAVIVYDNKTHNYILNQHAKTLLNINSD
FT                   DALSSDVFNNITLRDFNDDTVITIEQLFSSNITAVLLECEFSPQLLNVNHSIVNDSVSM
FT                   ITLEENHSHAEQYNFDHIISKISTKLIDIQNDNIDQQINFALKAIGTVCKADRSYLFEF
FT                   NTDSETLTNTHEWVNTGITAYKGRLQNVPKAELPYFFDVMNLTHLFKVNDVAQLPPEAN
FT                   SEKAEFEAQSIQSVLCVGLRFDKELVGFIGCDCVNTKRHWSKIDLIRIKLVGEIINNAL
FT                   KNINYKKSCS"
FT   gene            378006..378899
FT                   /locus_tag="PSM_B0334"
FT   CDS_pept        378006..378899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0334"
FT                   /product="putative CzcD, Co/Zn/Cd efflux system component
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70374"
FT                   /protein_id="ADT70374.1"
FT                   /translation="MTEITTHHASRRRLLIALAITCSFMVIQLVGAYYANSLAVLADAG
FT                   HLFVHNSSLFIALIASSFAIHLAKTYNDGHQKAELIGGLINGVLYLAISSLILYEGTER
FT                   FMHHKGGHELVINSYLMSVIAAIGFLFHGAAAWVLYKGRKASINVYAVFLHSFFDLIST
FT                   VSTFAAGVLIYITGWNVIDILSSMLIASFVLFTGIKVIISCLKGLRSNKAKLPKVADIE
FT                   TEITTMEHVANVHNVTVVRKNKKVIVGAHVVLKQHCTIEKHDEECRLKVIKLLADKFNV
FT                   RNSVLQIESYECKHIH"
FT   gene            complement(378942..383440)
FT                   /pseudo
FT                   /locus_tag="PSM_B0335"
FT                   /note="sensory box/GGDEF/EAL domain protein"
FT   gene            383600..384154
FT                   /locus_tag="PSM_B0337"
FT   CDS_pept        383600..384154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0337"
FT                   /product="putative isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70375"
FT                   /protein_id="ADT70375.1"
FT                   /translation="MNYAGNIKAEHSILLVIDLQSKLAPAIASFNDTLDCALQLAKASA
FT                   IHQIPSIITEHYKKGLGESDEKIKSVLPNTRYFEKINFSACAQEGFLDILAQLNRPHIV
FT                   VIGTEAHVCVLQTCLDLLQQGYAVTVAADAVASRNTEHKAIALEQLRQAGAIVSCVETI
FT                   IFQWTTKAGTSTFKQILPIVK"
FT   gene            384285..385751
FT                   /locus_tag="PSM_B0338"
FT   CDS_pept        384285..385751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0338"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70376"
FT                   /protein_id="ADT70376.1"
FT                   /translation="MSSVSRLFTIIFSLLFIESIGIGLYFGTLTEAFLVGLPLCLLPIW
FT                   LLKTQPDSKMTPHVVAAAIMMFSFLHIQQAYGLIEVHFEIFIFLAMLIMFIQWRVFITA
FT                   IVFVAIHHLSFYYLQTQNTGFYVFDPDRLAFSTVLIHAAYAIVEALVAGFIAVTLNRER
FT                   RAGLSLSYATEQIMQDPNQVKLSMRADDTTSKAVVGFNTLLEYLSDVIKQVQVQSDSLK
FT                   NNSKELIHVHDELANSAQQRNAQTDDIANSGAQVAHGFKLVEQESDTLKQQVNSITESA
FT                   NVALEEVLQTDRKSTELLTLLTNTEEQLSHLVAAGDVITSLLNEISGIADQTNLLALNA
FT                   AIEAARAGEHGRGFAVVADEVRSLANSSQATTTKIASTLTDLVNNSRTSTQSMNQCVEF
FT                   VVDLTKISATMKENISSMSDQIQAVSASTNSVAQVVAEQAGNTEQIAMSTDQMRQNQYQ
FT                   EAKIVEQLTAKVQLIDVSIDVLEQSIAKFK"
FT   gene            385735..386259
FT                   /locus_tag="PSM_B0339"
FT   CDS_pept        385735..386259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70377"
FT                   /protein_id="ADT70377.1"
FT                   /translation="MQNLSKSRYFTISLICIWLAFVVSALVYFQLGQLKPFDEGNMLKQ
FT                   QNWFSQFKNQVLWQNKDSAQLVIITQENCGCTIQAQPHLSALQRFATNQGVEVQNFVLN
FT                   NELKSVIPATPAAVLIDKNGEFVYAGPLSEGLACSQGSGFVETVISNLQAGFNSSLLIA
FT                   DTKGCYCVNNA"
FT   gene            complement(386366..386923)
FT                   /locus_tag="PSM_B0340"
FT   CDS_pept        complement(386366..386923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70378"
FT                   /protein_id="ADT70378.1"
FT                   /translation="MDIFLTSTVTVALAEIGDKTQLLSLLLAARFHNKIALILGILAAT
FT                   IINHGLSAWFGDWLSGNFAVEYLPWIVNISFIVVGLWLLIPDKDEEVSHKYDRYGAFLV
FT                   ALILFFIAEIGDKTQIATVLLGAQYQSVLWVTVGTTVGMLIANVPVIYAGKALLKRIPL
FT                   NTVRAIAASVFVLLGIYGLVTI"
FT   gene            387288..387599
FT                   /locus_tag="PSM_B0341"
FT   CDS_pept        387288..387599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70379"
FT                   /protein_id="ADT70379.1"
FT                   /translation="MQSTVVKSTMATIQNGVMKADGKFWITQTDLNFEPFNEKLGLEPY
FT                   TIARDTILKVVECKGKGAGLVPITADAIEVFTQDGSSYQFILSNPSDWINILSNQTSA"
FT   gene            complement(387695..389320)
FT                   /locus_tag="PSM_B0342"
FT   CDS_pept        complement(387695..389320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0342"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70380"
FT                   /protein_id="ADT70380.1"
FT                   /translation="MLNNYSVRTRLAVLALLPIMIFLITSFFSINTMGRLVAGIDSLYD
FT                   DRVVPLKQIKHVSDNYAVNIVDLLHKYRAESITKSALLANINDARNTADNEWKAYLSTQ
FT                   LTAEEKRLVDNVESKLQPVLTHLNNLILSINSGEFLLIPQKQFVYELYQLFDPLSASYQ
FT                   ALIDLQLKEASDFKVKADENYQFIKLIMSVTIAILILLLLIVAYFIYSSIQNPLMSLRD
FT                   TITHIATNADLTARAEVQGKDEIADTASNFNDMLLRIQGLVKDMAGATLTLASAAEEMN
FT                   SISIQVASTATQQEQQSAMIATAITQMSSAIEQVAQNAQTTSDKATSADIKAGQGQQAV
FT                   ADNIESINTLSALVNTNTQLITDLNTQTNDINQVVMMIQSVAEQTNLLALNAAIEAARA
FT                   GDSGRGFAVVADEVRQLAHNTQKATASINEMITKLQGMAQQAVNAMGNAESSAKESVDH
FT                   ANYSSQVLSEINREVTEIADMNTQISTATQEQKMVANELSSNINEFSASITSVSESSQQ
FT                   NAQASQELAQLAAMLQGQVNVFKV"
FT   gene            390487..391059
FT                   /locus_tag="PSM_B0343"
FT   CDS_pept        390487..391059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0343"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70381"
FT                   /protein_id="ADT70381.1"
FT                   /translation="MKINLINCLLSVVIATGVSNMSYAEEVPRSQQVITSLPVLTSQNA
FT                   PAPAEIKNIRMESELMARASAPPLSSMWVYAVGSTDCGWESTVGMTTTACDHGGEQLRT
FT                   AVLEIGYGYNHIAWMNGGLLPSSTMYSSTPVCVTGSNYTWPCTAGQTVVGFLNEYNVDG
FT                   HQNGLFKYQNTSTNSPWNTMSVQISIL"
FT   gene            complement(391103..391540)
FT                   /locus_tag="PSM_B0344"
FT   CDS_pept        complement(391103..391540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70382"
FT                   /protein_id="ADT70382.1"
FT                   /translation="MRVDANVHYFNGNQRTKPSTEASTSFSAALTAAQTDNDKTDSSTK
FT                   QADFTSMTRQEMRDWANTQIRNGEMSLDDGRPFMAMTMKIPVNGGELAGAHSDETRYNF
FT                   IQKTRDGIQGALSRNDETTLKMLESAMSIMQDKSTGVNIRI"
FT   gene            complement(391781..392293)
FT                   /locus_tag="PSM_B0345"
FT   CDS_pept        complement(391781..392293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70383"
FT                   /protein_id="ADT70383.1"
FT                   /translation="MYTFDSVPIISFCHTQFSSKITCCAFKNRRIRFVYTRIHQRYFRM
FT                   AILSIRIDDKLKESLSSEAQKEGISLSEYVKKSLEIKSVDTHILATEKNLKSSVDSIKD
FT                   LALVSQETVHEVELNIQRLNESLKNANHLKEIKKLKWILISISLIFVSISIPIFHFNIA
FT                   YFKTFFY"
FT   gene            complement(392334..393047)
FT                   /locus_tag="PSM_B0346"
FT   CDS_pept        complement(392334..393047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0346"
FT                   /product="putative transposase ORFB"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70384"
FT                   /protein_id="ADT70384.1"
FT                   /translation="MSVYGARKIWKQLQLDDHQVARCTVERLMRVMGIQGVRRGKAHKT
FT                   TIPDEQQDKPLDLVNRQFTAEQPNQLWVADITYVATWSGFVYVAFVIDVFSRYIVGWRV
FT                   STTMHTELILDALEQAIWHRGNPEGLIHHSDRGSQYLSIRYTERLAEAGIQASIGSVGD
FT                   SYDNALAETINGLFKTEIIRRNGPWKNVDAVEYATLEWVNWFNNQRLLSSIGYISPAQY
FT                   ETDYYDNLNESGKVA"
FT   gene            393930..394604
FT                   /locus_tag="PSM_B0347"
FT   CDS_pept        393930..394604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70385"
FT                   /protein_id="ADT70385.1"
FT                   /translation="MKISTNLLPTLFESKISIFTNSDDEKIKSFSTKTSESGLKININT
FT                   THLDPKVKEKKDNNAFDSSLIEGSAYEKVFKKEELNFSNMSIKELHSIVKNVNEMEREY
FT                   TQKYDSDEPVRLGKSGNPIISKKREDMNSLESKLRILSYGGGDVDPDKKINVMEYFSNS
FT                   SEKLDGLAKEYPERQTYQVRASYMKEIINTFDKFISDDTFDLYQEKAALLLTDKKKVDV
FT                   FI"
FT   gene            394591..394734
FT                   /locus_tag="PSM_B0348"
FT   CDS_pept        394591..394734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70386"
FT                   /protein_id="ADT70386.1"
FT                   /translation="MFLFEKSLEHSKTANSLLNTILVVYNTPKRRILHTLIISPIITFV
FT                   NK"
FT   gene            complement(394939..395535)
FT                   /locus_tag="PSM_B0349"
FT   CDS_pept        complement(394939..395535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0349"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70387"
FT                   /protein_id="ADT70387.1"
FT                   /translation="MKPELNHNATGVKRPFKLEEIWRIRTRIEIKNNLMQLALLNLAID
FT                   SKLRSCDLLSLKVRDVATQDQVFERVQWIQKKTRIEVQFEITPRTQQSISRWVQEVKLQ
FT                   PKDYLFRSLRRSNQPISYSYYRSIIRSWAEQLGLDSALYGTHSMRRTKATLVYARTKNI
FT                   RAVQLLLGHTKIDNTIRYLGIEIEDAIKISRETDC"
FT   gene            complement(395842..396456)
FT                   /locus_tag="PSM_B0350"
FT   CDS_pept        complement(395842..396456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0350"
FT                   /product="two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70388"
FT                   /protein_id="ADT70388.1"
FT                   /translation="MIKCLLVEDQTLVRLGLANLLNLDNAINIEAQAEDGLQALALLAE
FT                   HSFDIALLDMRMPNLDGLGVLQKMREKGDKTPVLIITTFEDCDVLVKALNLGARGYVLK
FT                   NIELEELISAIKQVVAGERVLQSAVTDFLLKKQLSPQLCLTGKEQTVLQCLSLGMSNKV
FT                   IAKKLDNSEGTIRNHVSQILAKLEVKDRTQAVIKAINHNLI"
FT   gene            complement(396434..397579)
FT                   /locus_tag="PSM_B0351"
FT   CDS_pept        complement(396434..397579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0351"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70389"
FT                   /protein_id="ADT70389.1"
FT                   /translation="MESTIRHTTDWHFSTLASWLGVTSACAYYANSELALYLQIIVSGS
FT                   ILAILLYVLKQPNKFVHGVALGYFLLILAMIQLSSTSLVFIHLVMFTAVFSPHFSLPKI
FT                   LACVVAAMLVYGLTHYARWENGIPWITFTIWFFFCLMNWFVSRRIVESLNTHYQSRQNY
FT                   KELKATQHMMGAMHAAQERQNISRELHDSLGHKLTALSINLDFAKRAANEATVETLSLC
FT                   HQLSQEVLAEVREIVSTQRNDKTILKQALEAICELTPNLHCDLQLSKETEQLPQDFALC
FT                   VLRFTQEMISNTLKHTQANHFTLHVNVSHVGQQPLLIAKAYHNQPETHLPKQGNGLAGL
FT                   NERMAQFGGEFSQHLEQETLINTMTLPLNLEEKSHDKVPTS"
FT   gene            397718..398899
FT                   /locus_tag="PSM_B0352"
FT   CDS_pept        397718..398899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0352"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70390"
FT                   /protein_id="ADT70390.1"
FT                   /translation="MGTLMNKDSRLHYIDNLRSLALLLGIVFHAALAYSPFFSNIWFTA
FT                   DPSTHGLFDYITHTLHLFRMPLFFIIAGFCSALLIDKSSNARFLHHRSKHILLPFIVFL
FT                   PLSFAVYYHALSFGAGIANPIPPIFAVFKVIKEPVVSTMHLWFLWNLFQFCLIHWLLKT
FT                   TNLLGNKFDALSAHPLFMWVVLPIVLTFSLMGQSIPFPAPDKLTPQLWSYGFYGSFYWL
FT                   GVGLNKKQQLIWSYNKYLWPLILGVALSLTAYFSLLPAAPSLDEVIAAATTGYFAAAGE
FT                   LHVLHVLSQGLSVILLTAITFLLGHRFLNHQSKLSRSISNASYWIYLIHVPVLIYIQMP
FT                   LINTSWPVLVKFIVSVVVTLLIGQISYLLLVKNTWLGALLNGRQTKRKVIQSA"
FT   gene            398950..399249
FT                   /locus_tag="PSM_B0353"
FT   CDS_pept        398950..399249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70391"
FT                   /protein_id="ADT70391.1"
FT                   /translation="MHAITIKSTIATIQQGAIKADGKFWLTNTDIHFAPLNAQFGLGPY
FT                   MFARCEIVKVSKCSGKVAGILPYTHDAIEIVLKDGNKYQFIVSNPIEWIKLINQ"
FT   gene            399322..399684
FT                   /locus_tag="PSM_B0354"
FT   CDS_pept        399322..399684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70392"
FT                   /protein_id="ADT70392.1"
FT                   /translation="MSLFYWAYSKHMDLIKTLLLKLRLGKKAEPLIVLGKKLSNNNNVV
FT                   VKSLELYWFSPEAYFDDISEFEKDNCFIESVDDITPVDALVRALSSANAVVCVINRSEP
FT                   SFTCFATITKARAHSF"
FT   gene            400269..401150
FT                   /locus_tag="PSM_B0355"
FT   CDS_pept        400269..401150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70393"
FT                   /protein_id="ADT70393.1"
FT                   /translation="MKFSHRFGFDPEYKNEPISEEAPNWLKSLFFINVLEPLLYIDGDS
FT                   RQKNEESKPLGVKDLIERLCAENGHETDSEDFDSWTCWDALKCRLMNLEWYQFYDFVEI
FT                   TAIKIKEQEIEYSSAWENSRFESFMFPSYRQKVNDLFSQHKIQWKLNDAGKLETSLPKD
FT                   LETRVSAIDSTLQDKFEPARVHYSKARSYILSPSKDPENSIKESVSAVESVCKTIYPKC
FT                   ATLGDALKAMKREQLISPMLVTVFEKFYAYTNAEPAVRHGSNKMSGVGEMDAELALHMS
FT                   AAFIRTIISRKS"
FT   gene            401379..401858
FT                   /locus_tag="PSM_B0356"
FT   CDS_pept        401379..401858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70394"
FT                   /protein_id="ADT70394.1"
FT                   /translation="MLDITTTNITTIIAASAAVVAAVSACFSYFLSKRIYDEIKSDETL
FT                   IAGRLHQVGLSEKAHNDPLVRTALFNKSARKVFVTTVKVYDQDNQQIPVTWSNSISKDG
FT                   NIEDPTGLLGIVNTENLYIRRNDGSEFRDVSVKITHSFSPNELVLKFDPYQGWWQ"
FT   gene            402260..402454
FT                   /locus_tag="PSM_B0357"
FT   CDS_pept        402260..402454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0357"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70395"
FT                   /protein_id="ADT70395.1"
FT                   /translation="MYICLCHGVTDKKIEQTIDDGATTMRELTKELKVGSQCGKCCCCT
FT                   KKILNRKLIQIADITDQVA"
FT   gene            complement(402561..403025)
FT                   /gene="bfr"
FT                   /locus_tag="PSM_B0358"
FT   CDS_pept        complement(402561..403025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="PSM_B0358"
FT                   /product="bacterioferritin (cytochrome B-1) (cytochrome
FT                   B-557)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70396"
FT                   /protein_id="ADT70396.1"
FT                   /translation="MKGDKDVIAALNKVLANELVGINQYFLHARMFKDFGFSKLDKADY
FT                   KVSIQKMKNADRLIERILFLEGLPNLQDLGRLRIGENSEEMIAANMSFELDTVDELRAA
FT                   IKLAESKKDYISREALDNILNEQEEQIDWLETQQLLIKNTGLENYLQSQL"
FT   gene            complement(403037..403510)
FT                   /gene="bfr"
FT                   /locus_tag="PSM_B0359"
FT   CDS_pept        complement(403037..403510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="PSM_B0359"
FT                   /product="bacterioferritin (cytochrome B-1) (cytochrome
FT                   B-557)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70397"
FT                   /protein_id="ADT70397.1"
FT                   /translation="MKGNQKVIDAFNTLLANELAAIDQYFIHSRMYDDWGLNKLYERLN
FT                   HEMEEEKDHADWLIKRILFLEGVPNMTKRRDLLIGDDVKSMMQNDLTLELEVVECVKEV
FT                   IAICEQQQDYQSREILEKLLFDTEEDHVYWLEQQLGLIDKIGTQNYHQAQMGE"
FT   gene            403892..404053
FT                   /locus_tag="PSM_B0360"
FT   CDS_pept        403892..404053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70398"
FT                   /protein_id="ADT70398.1"
FT                   /translation="MSLHPAHGSVINEVRKAKEQGSGHLLFTQISVKKADKAENLMLPL
FT                   AAATISTL"
FT   gene            complement(404189..405043)
FT                   /locus_tag="PSM_B0361"
FT   CDS_pept        complement(404189..405043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0361"
FT                   /product="putative cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70399"
FT                   /protein_id="ADT70399.1"
FT                   /translation="MGHGHSHSHVDDNQSDKQLTLAVFINVLLTAVQVVGGVFSGSLSL
FT                   IADALHNLSDAASIFIALVARKIGNKQADTTHHFGYKRAEILATLFNSTTLIVIGGYLI
FT                   FEAISSYLNPQPINGWIIVWVAAVALFIDLVTALLTFKAGAKNNMNIKAAFIHNVSDAM
FT                   ASIVVIIAGTLIILYQWYVVDLIATILISLYVIYHGVLLLKASCSILMQAAPIGFDQQL
FT                   ISKKLLQQFAITQIKSIKAWQLDDNTTHCEIVMQTDTLIELNAIKHYLHDEFAIEHCVI
FT                   ECY"
FT   gene            405310..405798
FT                   /locus_tag="PSM_B0362"
FT   CDS_pept        405310..405798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0362"
FT                   /product="putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70400"
FT                   /protein_id="ADT70400.1"
FT                   /translation="MNTAIEIRDAKPSDAKTILHFINELAIYEKEPDAVKTDEQAILNT
FT                   LFCEGATAHSLICLQDDEPIGFAVYFHNYSTWLGKNGLYLEDLYVSPDSRGNGAGKAIM
FT                   KELANRAINKDCGRFEWVVLDWNKPAIDFYNSMGAEPQNEWIIYRLTGQALIDFANKD"
FT   gene            405869..407221
FT                   /locus_tag="PSM_B0363"
FT   CDS_pept        405869..407221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0363"
FT                   /product="putative ADA regulatory protein (regulatory
FT                   protein of adaptative response)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70401"
FT                   /protein_id="ADT70401.1"
FT                   /translation="MGDQHWQKARQSRDARFDGLFYVAVKSTGIYCRPICPAPTAHEKN
FT                   VVYYQFAHSAAQAGFRPCIRCRPDSAPGSAAWQGTKTTALRAKQLIDQDNQHDCEKLAT
FT                   RLGISSRYLRRLFSQYFGISITQYRLFNQCHFAKKLIQETSLPLTEIAFASGFKSVRRF
FT                   NDAFLKQLNIAPSALRTAKHPADIGLTLILPFRPPYNWQALHGFLAKRLIQPIEWLTPT
FT                   SYGRTFTYKSCRGRFDAEFVADKHHFRVQIDIDNTQYLHPVINNIRRILDLDADTYLIE
FT                   AHLSEHINNAFPLTKGLRLPGIWSSFEAGVRAVLGQQVSVAAAHNLVTNLVTQLGEKQH
FT                   QQVYFPEPEVLAHSDFAFFKMPQARKNALHNLAEFCAVNPDCDDLDQWLSLKGIGPWTV
FT                   NYAKLRGQSQPDILLDGDLGVKKAQAAVRSFEPKNCAPFRSYLTFQLWQQL"
FT   gene            407218..407685
FT                   /locus_tag="PSM_B0364"
FT   CDS_pept        407218..407685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0364"
FT                   /product="putative methylated-DNA-protein-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70402"
FT                   /protein_id="ADT70402.1"
FT                   /translation="MIVQTSLPSPIDDIIIQATEKGISYVGFYPPASYISTPLNEINNS
FT                   HVLSCVAQLNEYFAHSRTEFDLELDTGGTPFQQSVWQALCSVPYGKVATYKDIAEQLNN
FT                   PKAVRAVGAANGKNPISIIVPCHRIIGANKKLTGYAGGLERKQWLLEHEAK"
FT   gene            407766..408350
FT                   /gene="tdk"
FT                   /locus_tag="PSM_B0365"
FT   CDS_pept        407766..408350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="PSM_B0365"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70403"
FT                   /protein_id="ADT70403.1"
FT                   /translation="MAQLYFYYSAMNAGKSTTLLQSAFNYKERGMEPVILTAAIDDRAG
FT                   VGKVSSRIGLQADAHIYDADIDVFALIQALNADKKRHCVLVDECQFLSKDQVMQLTDVV
FT                   DELGIPVLCYGLRNDFRGELFIGSQYLLAWADKLIELKTVCHCGRKANHVLRTDENGEA
FT                   IADGKQVEIGGNDRYESVCRKHYKAALNMGR"
FT   gene            complement(408333..409337)
FT                   /gene="ltaE"
FT                   /locus_tag="PSM_B0366"
FT   CDS_pept        complement(408333..409337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltaE"
FT                   /locus_tag="PSM_B0366"
FT                   /product="low-specificity L-threonine aldolase
FT                   (low-specificity L-TA)"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70404"
FT                   /protein_id="ADT70404.1"
FT                   /translation="MIDFRSDTVTKPCNKMRDIMYHAPVGDDVYGDDESVNQLEAYARL
FT                   RFNVADALFCSSGTQANLLALMAHCERGDEYICGQSAHNYKFEGGGAAVLGSIQPQPIE
FT                   NEADGSLCFTKIAAAIKPDDSHFAKTRLLSLENTIGGKVLGIDYLIKAREFVDQHNLAL
FT                   HLDGARAFNAAAELNLDIKEITKHFDSVSICLSKGLGAPVGSLLLGSEQLIAKARRWRK
FT                   VLGGGMRQAGMLAAAGQYALENNTQRLVDDHANARYLAQQLSEISGFEVNMSNTTNMVY
FT                   ATFDNSINITKLAADLKAQGILISPSKQLRLVTHLGITQADIDTFIKALTAHI"
FT   gene            complement(409356..410288)
FT                   /locus_tag="PSM_B0367"
FT   CDS_pept        complement(409356..410288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0367"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70405"
FT                   /protein_id="ADT70405.1"
FT                   /translation="MKAKSTRSKLHPRNQHKNGYDFNLLTSQTPSLTAFLITTPAGNQS
FT                   IDFSNNLAVKTLNQALLKSHYNINFWDIPKHNLCPPIPGRVDYIHYLADLLSEDNQQVI
FT                   PTGRQIKVLDIGTGANLVYPLTGNSEYQWHFTGSDIDLAAIKIAKQLAQFNDLKITLKQ
FT                   QKNPEHIFKGVVNAKDLYHLTMCNPPFHASAEEANKGSERKWKNLGKAPSNALNFGGQS
FT                   NELWCEGGELTFISNMIKESAQFSEQVIWFTSLVSKKETLAALQTQLKQLPICDYKIVE
FT                   MAQGQKVSRFIAWSYFDKTTREQICEEFI"
FT   gene            410418..411326
FT                   /locus_tag="PSM_B0368"
FT   CDS_pept        410418..411326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0368"
FT                   /product="putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70406"
FT                   /protein_id="ADT70406.1"
FT                   /translation="MAVTQQSVFIKLDDHQTLHLRRIANQKPSGPVVLLIHGAVENGKI
FT                   FYTHSNKGLAPFLAEQGYCCYVADLRGRGESKPAICKQARYGQTEAIVEDIPAFIEKIE
FT                   QLESKKPDFLVAHSWGGVLLNSVFARFPELINDVKACAYFGSKRSLFNNHPKKLFQANL
FT                   IWYFMAPILAKKHGYLPAKRLKWGSDDETQKSHYQSMQWAKKNPWIDSDDGFDYAKTLA
FT                   NLTLPPTLHIAAVKDKALAQPIDIQKFIDESGTGVQKMQIYGRRFGHKVDYDHINMLTH
FT                   PQARQEQFIDVLNWFEATRAN"
FT   gene            complement(411295..412737)
FT                   /locus_tag="PSM_B0369"
FT   CDS_pept        complement(411295..412737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0369"
FT                   /product="putative protein-tyrosine sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70407"
FT                   /protein_id="ADT70407.1"
FT                   /translation="MLLKKADQLLSQNKLREAEFHYKMLLQAEPDNGDALFGLGKVALR
FT                   LEQFDAAVYILQRACQHLPYALEPLYALSDAFNAVNSPEDAQKVLEYATSIAADNPDTH
FT                   YYLAQHYLTFGELDKAHATFEEALKLGIAPVTAYVLFELVQLGRFNKANNYIDQLHHFL
FT                   TQTNNLRLKMVCYYALAKSYDKLDDTDQAFNYFVIANQQQHKLSEFNTEDLIGFYDQLI
FT                   EYNNESVLNLANLNKQYPVTPVFIIGMPRSGSTLLEQMLAGHSQWATLGEDTSISNKVV
FT                   AFLEHKTGLRYPQCLTKLATPLINQARAIYLDTLSSSGSNCAFVINKLPSNYQNLGLIY
FT                   ILFPDAKFINLSRNFHATAFSVFTNYFAENEPYFCDLNEFTLYHQLYEKLMSHWQQFNR
FT                   LAIYNLSYEQLIENPKDQLTTLLSFTGCEFEQTCLDFYKNKSAVTTLSKHAIRQPVNNK
FT                   SLDKWQRYEAPLLSLLSLPQTN"
FT   gene            complement(412882..415452)
FT                   /locus_tag="PSM_B0370"
FT   CDS_pept        complement(412882..415452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0370"
FT                   /product="putative TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70408"
FT                   /protein_id="ADT70408.1"
FT                   /translation="MKLKSNALQQAIKFALATTAAGLFVSGSAIAQEEQTEVKVNKNVE
FT                   KIAVVGTRSAPRSIGDSPVPIDIIGGEELSKSGNTDMLELLKGAIPSLNVHSMPISDAA
FT                   SLVRPANLRGLPSDSTLILLNGKRRHRASVIAFLGGGINDGAQGADISVIPSIALKQVE
FT                   VLRDGAAAQYGSDAIAGVLNFQLKDASEGGSFEVRKGQYYEGDGDTTQISGNVGLPFTD
FT                   SGFANLSFQYKTADATSRSVQRYDATQLIKAGVPDIAPITQVWGAPEVDDDISIFGNVG
FT                   LELTNDSQFYMFGNYSERDVRGGFYYRNPHTRPGAYSNDGGETLLVGDLTGDMSGNCPT
FT                   IMIDDNVLDNPDYINGVANNPDCFAFNEMLPGGFTPNFGGNITDTSLTIGTKGEFTGGF
FT                   LEGAYYDLSGTVGYNESRYFIYDTINASLGPDSPRDFSPGKYEQLEKNFNFDISKGFDF
FT                   DLAYDVNIAGGLEWHEETFTVVAGDEASFIAGPLTDQGFGIGSNGFPGFKPSDAGEYDR
FT                   RNYAAYIDIEAPFTEEFLMGLALRYEDYDTFGSTTNYKLMGQYHLTEDLNIRGSISTGF
FT                   RAPTVGQANVSNVQTNLSSGVLVDSALLPPTNPIAIQLGGTELEPEESQSYTFGAVYTI
FT                   GDLFLTVDYYNIQVDDRISQSDKIELSQADKDTLEAAGVPNVQNLAQVSFFTNDFDTTT
FT                   QGVDLVANYSAELFSGSSTFSLAYNWNETEVTRSSDITGAFKVSRLENDLPNHRATLSW
FT                   AQQWESFSAFSRLNYFGEYQGVHVDYDETAKMADAAVTLDVEVTYFMNDSISFSLGAQN
FT                   LLDQEAEKLDFTVAPNNNWGGKYYETSPYGINGGFYYAKATYTF"
FT   gene            complement(415763..415897)
FT                   /locus_tag="PSM_B0371"
FT   CDS_pept        complement(415763..415897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70409"
FT                   /protein_id="ADT70409.1"
FT                   /translation="MSAAAAVVAVHAYGMSTKKNLHSGKNIMVKISIASQFNSIIESS"
FT   gene            416048..416470
FT                   /locus_tag="PSM_B0372"
FT   CDS_pept        416048..416470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70410"
FT                   /protein_id="ADT70410.1"
FT                   /translation="MRLYKVIHRAPWRVAKISKKRQQLRFRRAMVALKIALAQERQETK
FT                   EMLIIYRRYTQGQTNKAELKRANEQFVDILKGLGLGVFALLPFAPLTIPLVVKLGQLVG
FT                   VDVLPSSFSMNKPIKEIDQEIAQQNQEQDSTPSKKK"
FT   gene            416554..417915
FT                   /locus_tag="PSM_B0373"
FT   CDS_pept        416554..417915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0373"
FT                   /product="putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70411"
FT                   /protein_id="ADT70411.1"
FT                   /translation="MSALLRHTSSGIPLSFIVKNELTDWLTQQPSFVQRWLANTDFEKS
FT                   GLALVPNPETGELSQVFCVMQSTDDFWAAGELASKLPAGCYQIQGDESLVAQLALGFVL
FT                   GGYEFSEYKQKATAKAQLGIADKTLYEQVKQQADAINLARDLVNTPAADMMPQHLSQVM
FT                   SDLADTFDGEFSQWIGDELLEQNYPTIHMVGRASENKPRLLDLKWGAVDAPQITLVGKG
FT                   VCFDSGGLDLKPSSGMRNMKKDMGGAAHVIALAQLIMAANLPIRLRVLVPAVENAVSRN
FT                   AFRPGDVVKTRKGIMVEIDNTDAEGRLVLCDALSEAQNDDPELIIDFATLTGACRIALG
FT                   TELPGFFSTDRAVANAIMDSGMQVNDPVWQLPLFEQYKPFLKSDVADMANCASTPFGGA
FT                   ITAALYLKEFIEPNTPWVHFDVMAWNLRALPGRPAGGEALGIRAVFTYLQNRFN"
FT   gene            complement(417955..418341)
FT                   /locus_tag="PSM_B0374"
FT   CDS_pept        complement(417955..418341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0374"
FT                   /product="putative S-C lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70412"
FT                   /protein_id="ADT70412.1"
FT                   /translation="MQLLGIHHVAIICSNYPRSKHFYSEILKLTIINEHYRAQRQSYKL
FT                   DLALPDGSQLELFSFNDAPSRPSYPEAQGLRHLAFKVGCINTAKHYLESHNVIVENIRE
FT                   DEITGKKFTFFADPDGLPLELYAL"
FT   gene            complement(418422..419501)
FT                   /gene="fabH"
FT                   /locus_tag="PSM_B0375"
FT   CDS_pept        complement(418422..419501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="PSM_B0375"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /EC_number="2.3.1.180"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70413"
FT                   /protein_id="ADT70413.1"
FT                   /translation="MPYAHITGWGKCIPPASISNDEISEIVDTTDEWITTRTGIKARRV
FT                   SHVSTAELASVAAKHAIACAGVDAKDIDLVILATCTPSTVVANTASLVQKNIGATGAAA
FT                   MDTNAACSGFLYALQAATAQIQAGMIKKAVVIAAERMTWYVNWARRDSAVLFGDGAGAV
FT                   VLEAAETPAGLLGTKTGCDSEDRDILHITNFGSDLNKYEPIGPSDLLFEGREIFKRAVK
FT                   GMSEACDDVLEQANLKLDDIDVLVPHQANLRIIQAIQNRLKVDDEKVMVNIGEYGNTSA
FT                   ATIAIALCEAVEQGLIKPHANIMSAAFGAGLTWAASYIKWGERVTPIAVSDAELPPCDK
FT                   TGLELVAPAVKACKDAEPS"
FT   gene            complement(419668..419802)
FT                   /locus_tag="PSM_B0376"
FT   CDS_pept        complement(419668..419802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70414"
FT                   /protein_id="ADT70414.1"
FT                   /translation="MRPILAAHSAALKHIWSTKYSYSIKLRKPMSYRVKHAKSLKAFN"
FT   gene            419895..421133
FT                   /locus_tag="PSM_B0377"
FT   CDS_pept        419895..421133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0377"
FT                   /product="putative sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70415"
FT                   /protein_id="ADT70415.1"
FT                   /translation="MLIKTDPAISRLLMLRSGAIAVQLIAVLSVYFLLEHQIALMPLLA
FT                   VITLEAVFQLASIFAYRNVSQAKPVGMLMQLTADVLFLTILLSLSGGATNAFVSLLLLP
FT                   IMIAAITLSARGLAYIAVLAIAAYSMLLIKMPEHSMHQMNMSGHFIGMWVNFVISACVI
FT                   ALVIGAMNRALQQRERTIAKVREKQLRSEQLVTLDGAAAQITHQLATPIANLQLLFEEL
FT                   VEEYPNNEIIQQMQSPLLQCRTQLNDFRKLSMQLRDKNTQTPIKAEQLQNQIHDTLLLQ
FT                   YPNQQINWLNEAPKATLKSDAMLLPAILNLLQNAALANEKKGQMQLELSWQQPDAQSIA
FT                   LIIRDFGAGFLSSELAELGGQLMPSEQGMGIAVMLSNVTFERLNGSLTVYNHPDGGAVA
FT                   KIQMPLLITESAL"
FT   gene            421130..421654
FT                   /locus_tag="PSM_B0378"
FT   CDS_pept        421130..421654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0378"
FT                   /product="putative DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70416"
FT                   /protein_id="ADT70416.1"
FT                   /translation="MKLLIIEDDINLATTLARRLTKHSFNCEVAHNQTEALLRARQQQP
FT                   DCILLDMKLADENGLALIAPLRHLLTHAHIVLLTGFASIATAVEAMRLGANDYLTKPVD
FT                   MASLLKALKVEPVSTVTEIPEEVMSPERLEWEHIQHVLHSNNGNVSMTARQLNMHRRTL
FT                   QRKLQKKPVQQ"
FT   gene            421678..422097
FT                   /locus_tag="PSM_B0379"
FT   CDS_pept        421678..422097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70417"
FT                   /protein_id="ADT70417.1"
FT                   /translation="MTHTAALIKSQKIILFDAQCKLCSAWCNFIIAHDPQAMFKLCSVQ
FT                   SPKGQQILMHFGYSTTDFASMVYIENAQAFIQSHAFFEVIKQLGYPWKLSGIFSVLPNR
FT                   FNNWLYDKIASNRYTLFGKYHYCRIPSKQDQAHYL"
FT   gene            422176..422454
FT                   /gene="ppiCB"
FT                   /locus_tag="PSM_B0380"
FT   CDS_pept        422176..422454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiCB"
FT                   /locus_tag="PSM_B0380"
FT                   /product="peptidyl-prolyl cis-trans isomerase C (rotamase
FT                   C)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70418"
FT                   /protein_id="ADT70418.1"
FT                   /translation="MANTAHALHILVKHKEIAEDIIKQLGKGAKFQTLAKKYSSCPSGK
FT                   KGGDLGEFRRGQMVPQFDKVAFSGAILEPHLVKTKFGWHVIKVLYRT"
FT   gene            422532..423341
FT                   /locus_tag="PSM_B0381"
FT   CDS_pept        422532..423341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70419"
FT                   /protein_id="ADT70419.1"
FT                   /translation="MKLIILCCSLILMAVSFFASSTEQTIALKLGKPSTQDIPKNHYIL
FT                   TLLEKSFAKVNVKLNIAYSLEPMNTKRILEELTRNDDVNLAWLTLPNSLAEQRHLIRTS
FT                   YPIYNGLHSKRLLMVKQSRLGEFSDIKTLEQLKPFIALQKQSWSDYYVLKNNGLTVNDD
FT                   LSYESMLKALDEGLGDYFPRSVTAIKAEIRKHPQYNFVIEPHIMLQYDNYYYFYANENN
FT                   KAIIELLEQGLTKLADSGELNALYEHYYRDVEDGLNLNNRRVFNLKN"
FT   gene            complement(423379..424038)
FT                   /locus_tag="PSM_B0382"
FT   CDS_pept        complement(423379..424038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70420"
FT                   /protein_id="ADT70420.1"
FT                   /translation="MKNLKIDIVSDVMCPWCIIGYKNLETALEELKDEMSADITWHPFE
FT                   LNPDMPLEGQDLNEHLQQKYSLTEEESARNRQNMADAGERAGFTFNFDGKRIMINSFDL
FT                   HRLLMWAREEGKQTELKLAFFEAHFTDLKYLNQEDALLDVVEKVGLNKDTAREILHSDK
FT                   YVQAVRQEQNNFKQMGITSVPTFIINDKYALTGGQPSESFIQALKQISEEEAKQEQ"
FT   gene            complement(424158..425378)
FT                   /locus_tag="PSM_B0383"
FT   CDS_pept        complement(424158..425378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0383"
FT                   /product="putative metal-dependent dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70421"
FT                   /protein_id="ADT70421.1"
FT                   /translation="MTTVGIGTHTPEQALASLSNMTHSVTPIQADEYLVRMAKAQAYMQ
FT                   ANNIDAIYLNAGTNLTYFTGMKWYASERLVGAILPATGEVQYIAPHFEIGSLNGFKVID
FT                   GPIHGWQEHENPFELFVKVLKQLNISDTATVGIDESAQFFIFDGINKASSGLKLVNAQP
FT                   VTAHCRMHKSANELALMQCAMDMTLAVHKATASMLYEGISTVEVEEFIKKAHQKVGAPG
FT                   NYFCIVLFGLATSFPHGVKDPQILKKGDMVLIDTGCKVHDYLSDITRTYVFGEATSRQR
FT                   LFWDFEKAAQLAAFNQAALGETCESVDQAARSYLAAQGLGPEYQTPGCPHRTGHGIGLD
FT                   IHEWPYLVGGDKTPLATGMCFSNEPMLVIPDEFGVRLEDHFYMTDDGPRWFTQPSHSID
FT                   DPFGLNS"
FT   gene            complement(425518..426126)
FT                   /locus_tag="PSM_B0384"
FT   CDS_pept        complement(425518..426126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70422"
FT                   /protein_id="ADT70422.1"
FT                   /translation="MHFSKDRIAALEKHTRTHFINSLSGFKSANLIGTQDLQGNTNLAI
FT                   VSSVIHLGAHPPLVGMIMRPHSVPRHTFENIIETGVYTINQVNSNIYQQAHQTSARYAK
FT                   NESEFDATGLKTEYLNDFKAPFVAQSRLKYAVKFVENQHLAVNGTELVIGEIMDVYVDK
FT                   SALQSDGFLDLQAIDTVAVTGLDSYHTANKLNRLPYAKK"
FT   gene            complement(426138..426863)
FT                   /locus_tag="PSM_B0385"
FT   CDS_pept        complement(426138..426863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70423"
FT                   /protein_id="ADT70423.1"
FT                   /translation="MKTVILFGASSAIAQSYVSHLNQQAAQFNIICVSSSNINHSDINV
FT                   NYFQSDYSAQSLKELTQSLKSQQVDIAQVIIFNGQLHNDQHMPEKKLEEINSDYFMQLM
FT                   HSNTLVPLLCLQSIVPLLNHKTHCTITALSARVGSINDNKLGGWYTYRASKSALNMLFK
FT                   TAAIELARRAKNTKLVLFHPGTTDTQLSKPFQKNVPADKLFTPDFVAQQLFKFTYENPQ
FT                   LELNGEPAYLDWQGNTIKW"
FT   gene            complement(426860..427258)
FT                   /locus_tag="PSM_B0386"
FT   CDS_pept        complement(426860..427258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70424"
FT                   /protein_id="ADT70424.1"
FT                   /translation="MIIFYDGNCPLCNAEMQHLKRADVDHKITLEDLNADDFSERFPAI
FT                   DKQNAMDLLHAQTDKGQMIYGLDVTYQAWRTVGKYRWLKIIRLPVIRFFADHAYTFFAK
FT                   YRHYISRFLMPNAQCSNGQCNIKSKGEK"
FT   gene            427379..430024
FT                   /gene="ppc"
FT                   /locus_tag="PSM_B0388"
FT   CDS_pept        427379..430024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="PSM_B0388"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70425"
FT                   /protein_id="ADT70425.1"
FT                   /translation="MSEQYAALRGNVNLLGQLLGQTIKDAQGQEILDKVEEIRALSKSS
FT                   RSGNEADRQALIDVLHALSDEELLPVARSFNHFLNLANVAEQFHTVSRFNDVGFCQLNP
FT                   LTQTLKTLAAKAEQGQLNHNHLADTLSKLHINLVLTAHPTEVTRRTIINKHVELSDCLA
FT                   SLERTDNLAQEREAILNRIAQLISQAWHTDDIRRSRPSPVDEAKWGYAVIENSLWDAVP
FT                   HFLREFSQHVKQHLSLELPANYSPIEFTSWMGGDRDGNPFVTAEVTKQVLDHGRWMALD
FT                   LYQRDLETLCAELSMSDASDELIKLAGQEFEPYRAVLKELKNQVAETVMYLSAKIKNKR
FT                   TESQDLITDINQIKHPIEVCYRSLLKCNMQVVADGLLLDVIHRVNSFGLRLAKLDVRQD
FT                   SSRHSDVFSELTRHLGIGDYNQWEEQDKQAFLLTELNSRRPLIPRHWQPSPEVQEVLDT
FT                   FDVIAQQDEKTFGLYIISMARTASDILAVQLLLKESGCGFELPVAPLFETLDDLNDGHN
FT                   VITTLLNNEWYRGHIKNTQNVMIGYSDSAKDAGMMAAGWAQYEAMDKLVQLADERGIEL
FT                   ILFHGRGGTVGRGGAPAAQALHSQPPGSLKGGLRVTEQGEMIRFKFGLPNVALQSLNIY
FT                   AGAVLKSNLLPPPEPKLQWREVMALISDVSCQHYRNVVRHDENFVPYFRMATPELELSK
FT                   LPLGSRPAKRNPNGGVESLRAIPWIFAWSQNRLMLPAWLGALSGLKAALEKYGIETLSE
FT                   MSLQWPFFRARLEMLEMVFSKADSWLSEHYDNALVEEMYKPLGVALREELGEAMTLVQS
FT                   LSPQKSLLADQPWIKESIGLRNPYTDPLNVLQVELLRRSRGDDKGNENDIDNALMIIMT
FT                   GIAAGMRNTG"
FT   gene            430120..431076
FT                   /locus_tag="PSM_B0389"
FT   CDS_pept        430120..431076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0389"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70426"
FT                   /protein_id="ADT70426.1"
FT                   /translation="MAIEQIKTIMASATFKVQHNTALSNSHISLNVAQTQALRSQLKTQ
FT                   RGILYSSDIKALCTELNVSDDALLQGLVPMASEFSVAPISKFHVGAIVKGLDSQGNTTF
FT                   YFGANAEFDHQALSLVVHGEQSAINNAWLNGGKKILKIAISDVPCGYCRQFMNELADAK
FT                   ELDILLPAQNFKLAELLPHSFGPTDLGNEHSLFNPAEQTNCFENKQLDEKLMSYALAAY
FT                   VPYSQNYSAVKISTFENGDFYGSYAENAAYSPSLSPLQSAVSQLFLAGLSFDKQTVKSV
FT                   TLLETAGHENQSGVAKAVLASFTGLPTLEVISATLAK"
FT   gene            complement(431065..431820)
FT                   /gene="udp"
FT                   /locus_tag="PSM_B0390"
FT   CDS_pept        complement(431065..431820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="PSM_B0390"
FT                   /product="uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70427"
FT                   /protein_id="ADT70427.1"
FT                   /translation="MEKVFHLGLCIDDLKGAKLAIVPGDPDRAARISQFLDNPTCLAQT
FT                   REFHIYLGQLNGHSVVVCSTGIGGPSTSIAVEELAQLGVRSFLRIGTTGAIQPHINEGD
FT                   ILISQASVRLDGASQHFAPLCYPAVSDFFATQAMVKACENLNIDFHIGITASSDTFYPG
FT                   QERYDTHSGYVPKSLQGSCEEWQKLGVMNYEMESATLFTMCAALGLQAACVAGVLVNRT
FT                   RQEIPNVDHGEIEKKSVAVVLEAAKVLLG"
FT   gene            431903..432019
FT                   /locus_tag="PSM_B0391"
FT   CDS_pept        431903..432019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70428"
FT                   /protein_id="ADT70428.1"
FT                   /translation="MIYSSTLNIQSMAKITNKMSQLTCLLRHYIHTSEQTSS"
FT   gene            432233..433342
FT                   /locus_tag="PSM_B0392"
FT   CDS_pept        432233..433342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0392"
FT                   /product="putative manganese binding agmatinase (SpeB)"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70429"
FT                   /protein_id="ADT70429.1"
FT                   /translation="MSTQFQAFKNKVEHCLCAPGDGVFTVNTAKERKAALRNKLYGQTE
FT                   NVDALWRDSLNELPNSPHKAVMLGISSDCGGGILRGANWGPLFLRSALIDQQTQCRSFD
FT                   LGDVRVIPHLLHDKYLNEATITNCQKALYGNDNNDHFVSPLSITEDVCDSFYATFQDKG
FT                   IFGIGGDHSISYPLTKAYLKAKREQGKRTAIIHFDAHTDLLVERLGIDLCFGSWCTHIL
FT                   EFLPAPHHLIQFGIRSSGKPKSHWESTFGVKQHWAAEIIERGAAAVAADTIAQLKADKV
FT                   DEVYVSFDIDALDAQFASATGTPEENGLTPQHALDILSAIADEFPITGADMMEIAPFTD
FT                   SSLVGQSSSETTLREGAKISAFLIAAMNR"
FT   gene            433464..434141
FT                   /locus_tag="PSM_B0393"
FT   CDS_pept        433464..434141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0393"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70430"
FT                   /protein_id="ADT70430.1"
FT                   /translation="MFIVSHHCAAKLTVVTENFAPAQYLDANNNLVGDAADKVRLVLDS
FT                   AGIDYSISVNDWSMAYNIALRDPQTCIFSISRSPEREHNFIWFAKLAQFDTNFYSLKSK
FT                   GISLTNLEQAKQYRIAVLKDNYSHHYLLSKGFKENENLMLFSSFDNIFKIIQTRSSSID
FT                   LVVIPAQRINHEQSHLLNKLQLELLMPINAHQAPLYFACNKNLPDNVKQQLSAAFSSYE
FT                   SKL"
FT   gene            434262..435551
FT                   /gene="ytfL"
FT                   /locus_tag="PSM_B0394"
FT   CDS_pept        434262..435551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfL"
FT                   /locus_tag="PSM_B0394"
FT                   /product="CBS regulatory domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70431"
FT                   /protein_id="ADT70431.1"
FT                   /translation="MGDLIGIALLILMSALFAMSEISIAASRKIKLRVMADEGNVHALA
FT                   VLKLQEQPGAFFAMIQITLNAIAILGGIVGEQALSPYMQEILQLFYQGPLLGQISFVLS
FT                   FLIITSLFILFADLLPKRLAMILPEAVAVRVVTIMRWVTFALTPLVLFFNGLTNIVLRV
FT                   FKVPSEREDIVTTEDIVAMMDAGAEYGSLQQQEYDLIGNVFDLEARFLSSVMSPREQIV
FT                   YFDIDESSDDIANKIIDHPHNHFLVCKGNLDKLIGSVESKDILRQVLKGEAANINDDML
FT                   DKDIFYLPETLSLSEALNAFKTAVHPFAVVVNEYALVVGIVTVKDLMKGFMGDLITHQS
FT                   EELIIERDASSWLVDGLTPIVELAKVLEIDEFPDQNHYETVAGYLIYTMKHIPKRAEFV
FT                   LFAGFKFEVVDVEGIRIEQLLVSRVNTDNE"
FT   gene            435761..436924
FT                   /gene="acrE"
FT                   /locus_tag="PSM_B0395"
FT   CDS_pept        435761..436924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrE"
FT                   /locus_tag="PSM_B0395"
FT                   /product="putative lipoprotein component of efflux protein
FT                   (exporter)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70432"
FT                   /protein_id="ADT70432.1"
FT                   /translation="MQRSRIAFFVFSALVGSVALSGCDQVAEQPKASAPAATPVGVVTL
FT                   TSQAITLKKELPGRVSAFQIAEIRPQVSGIVQSRLFEEGTQVEQGQALYQINPDIFEAE
FT                   LAASKAAVARAEASIASSKSKASRYKELLEIKAVSQQDFDEADAAYKQASAELLTAKAQ
FT                   LQSAQINLDYSHVSSPISGQISKSSVTVGALVSAAQTTALATVTQLDPIYVDLTQSSNE
FT                   LTKLKRALASGSLGVDSTTQTDVELIMEDGSAYPHKGTLQFSEVTVDPSTGSVTLRAKF
FT                   PNPEKLLLPGMYVRAEVVEGVKSNAILAPQRGVSRNTKGEPTAMVVSKNNTVESRVLKV
FT                   ERTLGANWLVTDGLADGDQLIVEGLQKIRPGAPVAASQVQSSANNSQ"
FT   gene            436936..440067
FT                   /gene="acrB"
FT                   /locus_tag="PSM_B0396"
FT   CDS_pept        436936..440067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="PSM_B0396"
FT                   /product="RND family multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70433"
FT                   /protein_id="ADT70433.1"
FT                   /translation="MSRFFIDRPIFAWVLAIVVMLAGIIAVKSLPVAQYPSIAPPAITI
FT                   TANYPGASARTLEDSVTQVIEQKMKGLDGLLYMSSTSESSGSATLTLTFDAETNPDIAQ
FT                   VQVQNKLATATPLLPEEVQRQGVVVAKSSSSFLLVVGFVSQDGSMTNIDIGDYVSSNVQ
FT                   DIVARVDGVGEVQLFGSQYAMRIWLDPAKLQSYKLTPNDISAAIKAQNAQVSAGQLGGM
FT                   PSLAGQQLNATVTAQSRLQTPEQFKDILVKTNSDGSVVRLQDVADVELGGENYGVVARF
FT                   NGKPASGLGVKLASGANALDTAQGVKDALEELKPFFPEGLEAVVPYDTTPFVALSIEKV
FT                   VHTLIEAVVLVFVVMYLFLQNFRATIIPTIAVPVVLLGTFGILFTFGYSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERLMTEEKLSAVEATRKSMDEIKGALVGIAMVLSAVFIPMAF
FT                   FSGSTGVIYRQFSITLVSAMGLSVLVALILTPALCATLLKPSHVHTDGSFIGRFFSGFN
FT                   RGFDKTNKGAQGFVGRMIKHSKRYLLSYALIVGGMVAIFSNLPTAFLPDEDQGILFNQV
FT                   MLPAGSTTEQTLEVVKKVENHYLEDQSEAVSSIFTVTGFSFAGSGQNSAIGFVSLKHWD
FT                   ERQRDDLSVGAVAGKGMGYFSTIKEAFVFAFPPPAIVELGTANGFNMFLQDRVGLGHDE
FT                   LLKARNQLLGMASQSPILAGVRPNGQEDMPELQLDIDLAKAEALGVSQGDINSTLSTAW
FT                   GSSYVNDFIDRGRVKKVYLQGQADARMVPEDLNKWYVRNKNGDMVPFSAFASSYWSYGS
FT                   PRLERYNGFSAMEIQGSAAPGYSTGQAMDEMERLVKQLPQGIASEWTGISYQERSSGGQ
FT                   APLLYGLSLLFVFLCLAALYESWSVPFAVMMIVPLGIFGAIVAAFMGNLSNDIYLQVGL
FT                   LTTIGLASKNAILIVEFAIHKMEEGLSLVDSAIAAVRLRLRPILMTSMAFVCGVLPLAI
FT                   ASSAGSGAQNALGISIIGGTLAASSLVVIFVPLFFVLVRRLFSGKAKTTSEEEV"
FT   gene            440067..441476
FT                   /locus_tag="PSM_B0397"
FT   CDS_pept        440067..441476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0397"
FT                   /product="putative outer membrane protein oprM precursor of
FT                   a metabolite export system"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70434"
FT                   /protein_id="ADT70434.1"
FT                   /translation="MSLRAISFSAFTLAILSGCQLAPQQEALNLPVPDAYASETGDEQV
FT                   SSLQWQQFFNDEKLKTLISQSLEHNKDLQIAALNVQRVRGLYQIEDSALYPSLDFNASG
FT                   SRQRLPSDLSASGQPQISSQYSATVGMTAYELDLWGKVRNQSEQALQTLYSTQLSQYTM
FT                   QVSLITELANAWLNYATDQQLLALAQETLSSQQASLSLTQKSVDLGAASKITLEQLKST
FT                   VATAKVDIAKYQRLVKRDKNALDLLVGKTVGEDLLPSKSLNYLLDLPSVPVGLPSDLLT
FT                   QRPDIKAAEHQLLAANANIGIARAAFYPSISLTANAGTASRDLSNLFDAGSGTWSFMPS
FT                   VNLPIFNMGRNQANLDVANAEQQVAVATYQQKIQQAFREVADVLADREGYNAQLMALEE
FT                   LLQSRKTTFELSQARYDKGVDSFLQVLDAQRTWYSARQQLITGQQAVLASQINLYKAVG
FT                   GGWQTTTSTVK"
FT   gene            441615..442235
FT                   /locus_tag="PSM_B0398"
FT   CDS_pept        441615..442235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0398"
FT                   /product="TetR/AcrR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70435"
FT                   /protein_id="ADT70435.1"
FT                   /translation="MKPKNKKHLDPVQAQARREQVLTAAADCFRRKGYHGAGMAEIAKT
FT                   AGMSAGHIYNYFESKEAIIESIIEQDMEEMFSIFQEFEDQPGDILTVLLDGLHHGVQRH
FT                   MDTGACVVDLDMMAEASRNKKVALLLREADTQARNRMRDLLVNESSLIKSHSEQELESR
FT                   INVIFSVMAGLLLRKMLFPELTEETVLIALRPAMKTLLMPFDK"
FT   gene            442545..444167
FT                   /locus_tag="PSM_B0399"
FT   CDS_pept        442545..444167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70436"
FT                   /protein_id="ADT70436.1"
FT                   /translation="MWAAVSYLVTALVFIVLGLKVNSVYFAVAFFWTALSLILVSGAYF
FT                   FNAGKIFRKRENGVIPFYIRWAFVPFLLGAQIYNAWSRKHDKVPPIQQINDNLFLACRL
FT                   FPSDIDTLKENGITAILDVTCEFDGLEWTSTQENISYLNIPVLDHSVPTHSQLNQAINW
FT                   IHHHIKKDRRVVVHCALGRGRSVFVMAAYLLSQNKEADVHDILAQIKETRETANLNKRQ
FT                   LRHLVKRHRRGELLIKNKAYLIANPVSGTKLWSEKEHLIVTRLSAYYDLTILKTTPEQN
FT                   GITLAKQAIEHEPDIIIACGGDGTVTEVASVLVGTSCRLGIIPLGTANALAHVLMGIKS
FT                   KFIPVEQACDLIIDGQTNLIDTAYCNNDLMLLLIGIGFEHAMIEKADRESKNKSGQLAY
FT                   LNGFLHSFGENKAQKLMVKLDDNEPEAINTNSFIVANAAPFTTLLAQGGGQPDHRDGLL
FT                   DVNWLTPNKDNETTVLSIAELMFSSITQTHFAINSHYTNAKRVEISADKTLDYVIDGEV
FT                   KSADKVVVNINPASLNVICQEQN"
FT   gene            complement(444210..444518)
FT                   /locus_tag="PSM_B0400"
FT   CDS_pept        complement(444210..444518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70437"
FT                   /protein_id="ADT70437.1"
FT                   /translation="MNNQPKNPLHGITLEQILVELEQRLGFKAMGEQVNIKCFTDSPSI
FT                   KSSLKFLRKTPWARDKVEALYIHTMSNKPLRKPRNKPKPTEPTQPDTSDFVWPSIKK"
FT   gene            complement(444616..444918)
FT                   /locus_tag="PSM_B0401"
FT   CDS_pept        complement(444616..444918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70438"
FT                   /protein_id="ADT70438.1"
FT                   /translation="MRYYFTSFITVLCLCFSALSFASTIKTLPIVDATQLINTNTECWY
FT                   DNKRYSEGAILQVHSVTLICAAKYPQHNNSQLIWLKLDKQGNLIYPKKPATITVN"
FT   gene            445021..445254
FT                   /locus_tag="PSM_B0402"
FT   CDS_pept        445021..445254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70439"
FT                   /protein_id="ADT70439.1"
FT                   /translation="MLFNQTMIDEFTLLAKFPRESKMQGIKLHSDAEPALLSAAQRLFD
FT                   KGVIDSPDGGYLTELGLDLIEHVTVIHSALKS"
FT   gene            complement(445264..445893)
FT                   /gene="maiA"
FT                   /locus_tag="PSM_B0403"
FT   CDS_pept        complement(445264..445893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maiA"
FT                   /locus_tag="PSM_B0403"
FT                   /product="maleylacetoacetate isomerase (MAAI) (glutathione
FT                   S-transferase zeta 1) (GSTZ1-1)"
FT                   /EC_number="5.2.1.2"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70440"
FT                   /protein_id="ADT70440.1"
FT                   /translation="MKLYTYFRSSAAYRVRIALNLKNIDHQLVPVNLLKSEQQSTDYLQ
FT                   KNPQGLLPALETENGVLGQSLAILEYLEEQYPETPLLPGNAWQKAHIRNLSYAIACDIH
FT                   PIDNLRVLKYLSSELNVDDEAKNKWYRHWVEVGFEKIERMLDSKNTFCAGESPSLADVC
FT                   LVPQVFNAIRFKVDMAAYPKIAAIYQRCNELAAFIDAAPENQPDAN"
FT   gene            complement(445901..447202)
FT                   /gene="hmgA"
FT                   /locus_tag="PSM_B0404"
FT   CDS_pept        complement(445901..447202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="PSM_B0404"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70441"
FT                   /protein_id="ADT70441.1"
FT                   /translation="MATQLNYMTGFGNEFETEALPGALPIGQFSPQKVKYDLYAEQFST
FT                   TAFTAPRADNRRTWMYRIRPSVVQGDYTAIDNGLIRTAPITEVPTPPTMLRWDPIDIPA
FT                   EPTDFIDGLITMAANGSANGQAGIGIHVYVANKSMDKRFFYNADGEMLFVPQHGELLLK
FT                   TELGHLSIKAGEIAVIPRGIKFQVQLLTDTARGYICENYGHAYVLAERGPVGANGYAND
FT                   RDFQYPVAAFEDIEGEFELIAKFNDNMFRCDIGHSPLDVVAWTGNSAPYKYDLARFNVM
FT                   NTVSFDHPDPSIFTVLTSPSGTEGVANIDFAIFPPRWMVAENTFRPPYYHRNIMSEFMG
FT                   LIEGVYDAKEHGFVPGGMSLHNCMSPHGPEADVFEKASNADLEPQRYDNTLAFMFESRY
FT                   VISPTKYALEGKERQANYTDCWRTIKKHFNGNQG"
FT   gene            447355..447786
FT                   /locus_tag="PSM_B0405"
FT   CDS_pept        447355..447786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0405"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70442"
FT                   /protein_id="ADT70442.1"
FT                   /translation="MKIDLTTFLPYQLTHLATQVSNDFSSIYKKEFDLTIPQWRIMANL
FT                   AQSGQSTAKQLCIQADMDKSTVSRAVKTLIDEGLIYSELNKHDKRAAFLMLSDKGMALY
FT                   EKITPQALQWERALLSCLSDAEQHQLIAIFDKLKNKLQA"
FT   gene            complement(447835..451023)
FT                   /locus_tag="PSM_B0406"
FT   CDS_pept        complement(447835..451023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0406"
FT                   /product="putative Outer membrane protein with a TonB box"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70443"
FT                   /protein_id="ADT70443.1"
FT                   /translation="MKIQLRKTALSLAIAACVGVSGAAIANETTSAIKGQIKGPNGNPA
FT                   AGTKITILHVPSGSVKTTEVNDAGYFTAKGLRVGGPYKVIVDSDIYADQEFNNIILNIG
FT                   SDYPVNTSLENISDVEQIVVTGRPISTMSGGTGPASTFTLSDLENQPAINRDLKDIIRI
FT                   DPRVAIDDSRGSINCGGGNPRFNSLTLDGVRMNDNFGLSSNGYPTIRAPFSFDSIEQVA
FT                   VELAPFDVQYGGFTSCNINAVTKSGGNDIHGGVFYDYTNDSMKGDKIEGNDVDNGDYSE
FT                   KRYGFNVGLPLINDTLFLFTSYEKLEGVKQFNYSSLVSSAEIDEIKQITRDVYGYEAGA
FT                   TPASSPVEDEKILVKLDWNINDDHRANLIYNYNDGFTLSQSDADGDELAFDSHFYEQGA
FT                   EFTSIVASLYSDWNDNFSTEVRLGKSELDARVQSLDAASGFGEFQISTDNATVYVGPDD
FT                   SRQSNDLNYDTTTAKFSGTYYLDQHTITAGFEYEKLEVFNQFVQHTEGEWRFASIDAYR
FT                   NGIANAVYYNNSASTNNPNDAAANFAYSQNTFYVQDEYSFSDIDASLTFGLRYDSYSSD
FT                   DKPTLNQNFTNRYGFSNQSTFDGIDLIQPRVGFEWYATDALEVRAGVGLFSGGNPNVWL
FT                   SNSYSNDGITNIGAYISDISNSYKVGSGDDEVTLVDLFDTPNVNGGTPGYDVPQDMFDK
FT                   VANTEIGSGDATTNAVDPNFEIPSEWKYSLGATYTTENDYVIALDYLYTKKRDAATLVD
FT                   IALQDSGKTTFDGRPIYERKEDPLNPGKYRSGELLLTNVNGDSGESSIISAAVSKAFDN
FT                   GVSVQFSYAYTDADDVNPMTSSVASSNYGNLATSNPGNPGVASSDYEIPHRFTLNLGYK
FT                   HEFFDGYNTRFNLFGEAYKGLPYSFTYKSNRDTGAGDIQFGDRNSNGARQLLYVPLEND
FT                   PNVVYNMSADEINEFNDFIASEGLKRGEITGRNQQNSDWFVKFNFKITQEVPGFMDGHK
FT                   GEAFFVIDNLTNMLNDDWGVLRKGSFVGNKMVEVNINDQGQYVYSNFSARSAEQSVQRD
FT                   ASLWEMRVGVRYTF"
FT   gene            451211..451354
FT                   /locus_tag="PSM_B0407"
FT   CDS_pept        451211..451354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70444"
FT                   /protein_id="ADT70444.1"
FT                   /translation="MFQYFTVQIVSSFYDKQMKSDFFHKKSHYMHVMAFLILRVFDVQA
FT                   MY"
FT   gene            complement(451351..454557)
FT                   /locus_tag="PSM_B0408"
FT   CDS_pept        complement(451351..454557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0408"
FT                   /product="putative outer membrane protein with a TonB box"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70445"
FT                   /protein_id="ADT70445.1"
FT                   /translation="MTKLRLSKLTGAVILALGVSTSAMAADTSSAMRGKITTPSGASAA
FT                   NVKIKVVHQPTGTISELTTNESGTFIANGLRVGGPYTVIIDSDTFNDTTVENIFLNLGE
FT                   TYRLTSQLAPLNIEKIEVSGYKIVQQSGGSSSTFGEDTINNMPSFNRDIKDIARLNPLA
FT                   SINGSGELTFAGSNPRTNGLTVDGIGQNDDFGLSYGGYPTSQPPVALDAIEQISVDVSP
FT                   FSASKGNFGGGTINAVTKSGTNELKFSGFYETSTPDIAGDVDSISQVFADNRPVLDDDG
FT                   HRTYIVEQVEPNQTEKRYGFNVGGPLIDDTLFYFVNYNKWSSELDLDYGFEGSGATNEY
FT                   DVSEESYNRFLNILNNEYGLTDSLGGDPKDTNETLLVKLSWNIADDHRLDFTYQWQDDK
FT                   DETNFGTGGTSVQFASSRYTYATKFNNFATKLYSDWNEDFSTEIGIAYKDVSSRSLTNS
FT                   DIGSVKVEEYFRGPSYNFGTDEFRHANSSATENLTLSLDATYLMDEHEINFGMQYESLN
FT                   LYNLFAANSLGSWEFDNFNGFENREVGNYKGKYDFSYSNAFTNNPNDTAYDATRNQLAL
FT                   YIEDTFYVGDDLEVTAGVRYERLSSDDKPTLNENFLNTYGFSNQENLDGLDIILPRIGF
FT                   KYYATEALTVNGGVGRFQGGIPNVWYNNSFQNDGITFVDAPQSAINDYYANNQADITQV
FT                   PDAIKGSLVQGAGSTNYVDPNFELPSSIRAQLGFEYDFDSELLGEGFKWQAEIAYHKKE
FT                   NEAVWHNTAIKPVGVAADGERIIYESIYSGDLADNFDIAMTNSTDDGRSVIITTALAKE
FT                   WENGLYISASYAHQDVTEASSGSSSRAQSNYQYNITKSRNEDFAARGAYEVEHSFKVNL
FT                   AYNTEFFSGYATRFNVYFERRSGRPFSYTMGMYQDSDLGDTRDFYSSSAYLAYIPTGAD
FT                   DTNVNWDESGLSWSELETLLNRAGISERGQILDRNSGTQPWVTTMDISVKQEIPGFAKG
FT                   HSGEVYFMIDNFANLLNSDWGVEKRLGFSDQAVYDFGGLDDQGRYIIDSRFNGADVRNY
FT                   SQYQTSSSAWQAKIGVSYKF"
FT   gene            complement(454601..455455)
FT                   /locus_tag="PSM_B0409"
FT   CDS_pept        complement(454601..455455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0409"
FT                   /product="putative S1/P1 Nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70446"
FT                   /protein_id="ADT70446.1"
FT                   /translation="MYKNVKYSLSLTLLISAIFASTDCNAWGQNGHRVVGKIAESHISE
FT                   TTKTALIPYLNGESLAQISTWPDEMRSAPGDFWQKKSSRWHYINADDNATFSFDHDHTK
FT                   HKESVTNILEGIHYSIRVLKDDKSSLAAKQFSLRFLVHLVGDSHQPFHAGRAEDRGGNR
FT                   VKVSFFNQQTNLHSLWDTKLVENENLSFTEYAQFINTNNSELISEYLQSTPASWLEESH
FT                   NLALKIYDSTEEQISYDYIYNNTPIVKTRLQQAGIRLAGLLNTLFDPANTQSKMALTQQ
FT                   TQK"
FT   gene            455692..456561
FT                   /locus_tag="PSM_B0410"
FT   CDS_pept        455692..456561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70447"
FT                   /protein_id="ADT70447.1"
FT                   /translation="MLHKTAIVIFMFLGVLLSWFSGQVIVGEEDITFPVIIETSTTCQT
FT                   TATANKSQLIVFTPSKYVAQLLTQNLCGDKVVAKQYGSVIGYWGYRTVDSLEFVGKGIA
FT                   DLILAKNNIMDAFKAESTYNYQPVVGFSDYTAFFISSKEKPKISKQYFLDKKIGLLDYP
FT                   TSRSGHILPKQAFKELGLNIAQLKITYASSHNELRELLANGEVDLIASFWRESDSQRFS
FT                   KNYITPISSNVAGTRWYLKMQHNNTDLLCAVQSHLLSMSKEQSFQYYQDVEPYWQCNSY
FT                   PVTFIGES"
FT   gene            456603..457508
FT                   /locus_tag="PSM_B0411"
FT   CDS_pept        456603..457508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70448"
FT                   /protein_id="ADT70448.1"
FT                   /translation="MVFSSVFYFSTIQKQQQVNKLQIIQIEKRIALDLPLLDLSNELLK
FT                   HSGNKAALLNYIQTLNTFIDSTGIEVVAITPKHEFDASLKTSTEFIRELNSNNGVVFIV
FT                   LSLRQPYFTRDVIAIYGMLFILSILLTYLIKLAYINKNDDKQVIHAESNTTESKPLTLI
FT                   IDLKSKTLSSSVSLEHQVALANKPLCFYLALVEYCTNNPEIKLNHNKNVPEELIELANK
FT                   YFYRLVELGHTVRKRPNFNNSLEKTLSEIRAALDDVLNDCPEQKGLYYPPKAFGEGSRS
FT                   RMHSYGLANVGQGNIEIIGK"
FT   gene            complement(457634..459253)
FT                   /locus_tag="PSM_B0412"
FT   CDS_pept        complement(457634..459253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0412"
FT                   /product="bifunctional UDP-sugar hydrolase/5'-nucleotidase
FT                   periplasmic precursor"
FT                   /EC_number="3.6.1.45"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70449"
FT                   /protein_id="ADT70449.1"
FT                   /translation="MRILVFLILFLGLYGCVSDSVNKPAAHYLTVLHTNDNHGRFWHNE
FT                   KGEYGMAARKTLIDQLRADAKAQGHQVLLLSGGDINTGIPESDLQFAEPDFKGMSKIGY
FT                   DAMALGNHEFDNPLSVLRQQQQWANFPLLSANIFDKQTNETIFERYKIFNKGGLTIAVI
FT                   GLTTTDTAKIGNPQYIGHLDFKDPVEITASLTQTLKAKYNPDITIAVTHMGHYVDANYG
FT                   INAPGDVTLARSLDKNALDMIIGGHSQEPVCMAAENVTDENFKPGLACKPDRQNGTWIM
FT                   QAHEWGKYVGKAEFKLENGQLSLLSYQLLPVNLYVDKKQKDGSVKSVLAANYIKPDPAL
FT                   QTFLAAYQQKGAKQIEGKIGFVNDRLEGDRNKVRFEQTNLARVIIQAQMNTVGADFGII
FT                   SGGGVRDSINAGDVSYKDILKVQPFKNRVAYIDFKGNDILTYLNVVTRFPPDSGAYMQY
FT                   HNLAFELKEDQVTNVFIAGKPLDINKTYRMSINEYNASGGDSYPKITHMKGFVSTDETD
FT                   AQALKRFFAEHSPVDAHEFAPK"
FT   gene            complement(459329..459523)
FT                   /locus_tag="PSM_B0413"
FT   CDS_pept        complement(459329..459523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70450"
FT                   /protein_id="ADT70450.1"
FT                   /translation="MANNTTICDFGLHQGEPYTQLPVSFLKWMIDVNHQKSQYAHDELA
FT                   RRKRVVEQQREVSLAEKYE"
FT   gene            complement(459498..459659)
FT                   /locus_tag="PSM_B0414"
FT   CDS_pept        complement(459498..459659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70451"
FT                   /protein_id="ADT70451.1"
FT                   /translation="MSECLGVHHGDSFLINFKPSKVLKKPLINHSFFVIISLHSDRSKY
FT                   NGKQHDYL"
FT   gene            459819..460562
FT                   /locus_tag="PSM_B0415"
FT   CDS_pept        459819..460562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0415"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70452"
FT                   /protein_id="ADT70452.1"
FT                   /translation="MKKLILASILTAASFSSAATIVEMQTSQGTIEINLFDQQTPKTVE
FT                   NFLSYVNDAAYNQTVIHRSVDKFVIQGGGFTFSDKMDPITTKPAVINEPVYSNVKGTIA
FT                   MAKQGGNENSATSQWFFNMSDNSQNLDLQNGGFTVFGQITAQSQETLDKIAALVHCAEV
FT                   PLVGITKEQCSDENVVISNQNLVSIQTVVVLDDDPNSAQNLTPKENTLIDNVEVTPPQS
FT                   SDSSGSMAWLLGALLLVAPRLKRTK"
FT   gene            complement(460783..460908)
FT                   /locus_tag="PSM_B0416"
FT   CDS_pept        complement(460783..460908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70453"
FT                   /protein_id="ADT70453.1"
FT                   /translation="MGNVTGERTLQLGSDDLSRLNLQQSVWYLGKAEPMWCGYSP"
FT   gene            complement(460872..461225)
FT                   /locus_tag="PSM_B0417"
FT   CDS_pept        complement(460872..461225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70454"
FT                   /protein_id="ADT70454.1"
FT                   /translation="MGKRRFAAAKNKHIQLSDFAAMRLDNAGDHVRVADRNFSNQFEIP
FT                   VLFYAGCLLALQLNMASVPIAVLACIFVATRIIHSLIHLGSNHLRARFRVFLLGCLSVF
FT                   VIWVMLLVSVLYN"
FT   gene            461445..464327
FT                   /locus_tag="PSM_B0418"
FT   CDS_pept        461445..464327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0418"
FT                   /product="putative TonB-dependent receptor
FT                   protease/peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70455"
FT                   /protein_id="ADT70455.1"
FT                   /translation="MKHIIGLSAIALAILSGCSNTATLTQSPQTSLLSPTLVVSPNDNR
FT                   EYKTLTLANDIEVILVSDPSAEKSAASLSVGVGLLHDPMSQQGMAHYLEHMLFLGTERY
FT                   PDTKGYSDFMTKNGGAHNAYTWLDITNYMFKINNDAFDEGLDRFSDFFKAPKLYPEYTE
FT                   KEKNAVNAEWSMRREMDFFGQFKLARKMMGEHPANRFLIGNLETLGDKADSSLHKETVD
FT                   FYNKYYSSNIMKVALISNLPLKEMQKKAEKYFADIKNKNIEKPKVSAKLDFDNAGGKRV
FT                   FYSPNEDVKQLQLDFTITNNQTEFAVKPNRFVAYLLSNEMPGSPAQILRDKGWVSQLSA
FT                   SASPNQYGNYGSLNVNIELTDEGMKNREAIVATIMQYIDLIKREGVNSKYFNEIRTSLN
FT                   NQFKFLEKGDEFNYVSALTQSMQDYPLNHAINAPYYYAKFDADAVNNVLKQLNADTLRV
FT                   WYISQQEDTDSQLHFYDGKYRISDISDAEIASWEKPSEFNLALPSVNNLLPESFAIKTQ
FT                   AFKEQKHPELSYDKNGVKIWRQASQQFAEQPKGLVEVYINTQTGLHDINSTVLYSVWAD
FT                   LYNTQLSQLRTEAAIAGMNVNLSSSNGLVLSLSGFTDKQDTLLKQALAGFDDEVSSQAF
FT                   NQAIDRYQRDLLNQQKQFPYAQAFSEYSKLTRTGSFDTDALIKAAQSLTLADLQALKQS
FT                   TLANNNLRVFSYGNYNQKDIDAIAAELTAILPNNHTKSEFARSKAWLPQQGEARVLHKD
FT                   IDVADVAVVDMTIHPTPGYKQKAQAAVLQGHFRTIAFDKMRTEEQLAYAVGALARPIED
FT                   YSGIGLFIQTPVKGPKEIQVRFDKFKKEYASELNAMSEETFAQLKNATLVSLKEQPKNL
FT                   SDEMSPLINDWYRENFDFDSKQKLIAEVEKVTLADIKDYYQQTMLNPQAARLNVQLRGS
FT                   KFSDSEFADLPNQTKVTSLDAYYSDIKLQK"
FT   gene            complement(464430..465791)
FT                   /locus_tag="PSM_B0419"
FT   CDS_pept        complement(464430..465791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0419"
FT                   /product="putative Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70456"
FT                   /protein_id="ADT70456.1"
FT                   /translation="MLEPSALTLLPPAVVVVLAVVLRRPILSLLIGALVGLVLADPSKV
FT                   LSNFANTSLKVMTDETIGWLILVCGGFGALIALLVRTGGASAFGSLALKYTRGKRSSLF
FT                   MTFCLGVVIFIDDYLNALTVGETMKRITDKFKVSREMLAYVVDSTAAPICVLVPLSTWA
FT                   VFFGGLLVDNGIAEEGKGIAIYIQAIPYMFYAWFAVLTVVLVIAGVIPTFGPMKKAEQQ
FT                   ALTHAPTLEPAIYTQVQTADEYAVKAAEEHFEDADPKGKLYNFLLPIILLVAFTVYFEI
FT                   DVYKGLLATMAVTLPFYALQKLMSFSEMIERMLDGFKSMIPAIGTVIAAFIFKDVCDLI
FT                   GSLSPYMTAGYLPAVVFIAMSILAFATGSSWGIFAVSIPIVMPLATAVDANIPLVIGAL
FT                   LSASSFGSQACFYSDSTVLAAQGSGCNLISHAVTQLPYTLIAAGFAIIGFLLMA"
FT   gene            466094..466609
FT                   /locus_tag="PSM_B0420"
FT   CDS_pept        466094..466609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0420"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70457"
FT                   /protein_id="ADT70457.1"
FT                   /translation="MNIAFTTERLHIRFAQIADAAELFKLVNQANFTKYIGDKGIYTLD
FT                   DAKKYIKDSFISAHKQHGFGPYIIALHDETLVGIVGFYQRAVLQYPDLGFALKDGFEKK
FT                   GYIFEAANTLLNHRQNLGINQVTAIARCDNRASKNVLQKLGFKTQGQVIIESTNISVDV
FT                   YLLNTERN"
FT   gene            complement(466606..467214)
FT                   /locus_tag="PSM_B0421"
FT   CDS_pept        complement(466606..467214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70458"
FT                   /protein_id="ADT70458.1"
FT                   /translation="MKALFLLLTGVIFISGCSSAIQTTIQYYQFEQPINDSSRNVQDTQ
FT                   AQLRVQTVTLRGALNNRGIAMKVDSNQIHAANYHLWGESPDVMLSASAQQTLFNTMTNW
FT                   MVIKGLPVITDQQQQTFYELEYELHHFNGDLQGNADISGLWRLYYTHPESGRRLLSIHN
FT                   FSSVMPINDDGYDSLVATLEKMWQQINILAAKEIEKARI"
FT   gene            complement(467214..468869)
FT                   /gene="pqiB"
FT                   /locus_tag="PSM_B0422"
FT   CDS_pept        complement(467214..468869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="PSM_B0422"
FT                   /product="putative paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70459"
FT                   /protein_id="ADT70459.1"
FT                   /translation="MTKTANVAQKSSISAIWIIPVVALFVGVWMLYQYQLNKGQTIYIT
FT                   MPQAEGIIAGKTEIKVRSVKIGQIDHVRLSDSQDSVIARAQIDKNYDNLLTEDASIWVV
FT                   KPRIDETGISGMSTLLSGVYLELSPGESNRLKKRFTLQEEPALIGKHVQGGRFKLLSYN
FT                   AEVLDVSTGIFFKNYKIGQIETATFDWKNQAMQYGIFIKAPYENLITLNSIFWVNSGIE
FT                   IDLSADGININTGSLSKLLKGGISVGLPDQQAPGDLAQDGHSFSLSQSYKQALEERFYD
FT                   FDYYLIEFEQSIRGLRVGAPVEYRGTRVGTVVEAPANVIIDGKPAHFRAKNTAVPVLIK
FT                   VEYGRLYHITSVAKEYWETSINEWIENGMRASLKPGNLLTGAVYVDFDFYTDTPKSELK
FT                   KLAQYDVFPSVSSGITVLADQVSDVLNKVNNLKIEDSLAKMQSTFSEYQALASEMRTLL
FT                   NKPDTQNLPGDFNRNLEKITKSMEQFEITMRQFDKTMASYQAGSQMHYQLEQTLLQIKR
FT                   LTEEFQPLTRGLNEQPNMLIFDKSLPNDPQPRKQ"
FT   gene            complement(468862..470094)
FT                   /locus_tag="PSM_B0423"
FT   CDS_pept        complement(468862..470094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0423"
FT                   /product="paraquat-inducible domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70460"
FT                   /protein_id="ADT70460.1"
FT                   /translation="MQTACPSCDLIIDIPEINAKQVALCPRCSHKVRGININHDTEIVA
FT                   LSLSALLMLLSSMFYPFISFSSNGITQTITLPDAARILFNYDSDLLGLFIDISIIILPM
FT                   SLLIILIPLHLGALKALPQAVARRLLKFTLTLEPWIMSEIFLIGVLVSMVKIMSLAEVS
FT                   FGISFFAYVGFVIFYVSALTRLNRARLWSQVSPATTLQNTSTAERAIDENIKACHVCHQ
FT                   LSVESICPRCHSKTYLRNPNSVQKAAAWLVTSLICYIPANLLPIMYTISLGDETPATLI
FT                   SGVITLWNSGSYPIAIIIFFASVVVPLAKALILSFLCFMVTKPANLHTKGYTKVYQLTE
FT                   FIGKWSMIDVFVVAILVALVQLGNLMSVTPGLGIVFFTVMVLCQMMAAHAFDPRLLWDS
FT                   PKIITQRIKHD"
FT   gene            470225..470995
FT                   /locus_tag="PSM_B0424"
FT   CDS_pept        470225..470995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0424"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70461"
FT                   /protein_id="ADT70461.1"
FT                   /translation="MKVVFLLALVCLCGDSFAFVNDNKQQRVIIAANPTVAPYVISEND
FT                   SGIQLEIVKAALNNQDINEVDVHYMSNQRADALLNQGHVDIALNYSGILISGIYRSQSV
FT                   VSYENVVVSLKKSNFTINSIYDLATKSVLAFQNAPAYLPKEFGHNLENLRGYEEVFNQQ
FT                   AQIHHLMAGWVDTIILDRRIFLHYLKEYQKTNTTKDFVIHAIFPPAARPAYFNNDLLRQ
FT                   QFDKGLANIIQSGEYRTIMLNLDKQYTQRDFTAL"
FT   gene            complement(470996..471805)
FT                   /locus_tag="PSM_B0425"
FT   CDS_pept        complement(470996..471805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0425"
FT                   /product="TesB family acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70462"
FT                   /protein_id="ADT70462.1"
FT                   /translation="MHFEQLLKQAAQASQETDPLTNTMQFPANWCQGRTAFGGLSAALL
FT                   YQAMRNKVDSSRRLLSLSTNFVGPLLAEKPFLLSVEILREGKSSTQVLAKAIQDDAVCV
FT                   IVQACFAKNRNSSINVPVSKSLTLHPVNEAHCLGFVPGKMPEFFQHVDLCPQQGAMPFS
FT                   SAQTSHLGGWMRFKHTPQEITEAHVIALTDAWPPTLLQMFKQPAPASSMSWYLEFVQEP
FT                   NLVPGEWLGFEAITHHSKDGYGLEDGCIWSQSGELIALTRQTVALFD"
FT   gene            472045..473961
FT                   /gene="dnaK"
FT                   /locus_tag="PSM_B0426"
FT   CDS_pept        472045..473961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="PSM_B0426"
FT                   /product="chaperone protein dnaK (heat shock protein 70)
FT                   (heat shock 70 kDa protein) (HSP70)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70463"
FT                   /protein_id="ADT70463.1"
FT                   /translation="MGRIIGIDLGTTNSCVAVLDGDKARVIENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPTNTLFAIKRLIGRRFEDEEVQRDIGIMPFKIIKADNGDAWVE
FT                   AGGEKRAAPQISAEVLKKMKKTAEDFLGEEVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGMDKNRGENVVAVYDLGGGTFDLSIIEIDEVEGEHTFEVLATN
FT                   GDTHLGGEDFDNRVINYLVAEFKKDQGIDLQNDPLAMQRVKEAAEKAKIELSSAQSTEV
FT                   NLPYVTADASGPKHMNVKLTRAKLESLVEDLVTKSIEPLKRALADADLSVNDINDIILV
FT                   GGQTRMPLVQRTVAEFFGKEPRKDVNPDEAVAVGAAIQGGVLAGDVKDVLLLDVSPLSL
FT                   GIETMGSVMTALIEKNTTIPTKKSQTFSTAEDNQSAVTIHVLQGERKRSSDNKSLGQFN
FT                   LEGIRPAQRGTPQIEVTFDVDADGILHVSAKDKDTGKEQKITIQASSGLSDEEVEKMVR
FT                   DAEAHAEDDKKFEELVAARNQADALVHGTRKQIEEAGDALPSEDKDAIEAAVVDLEAAI
FT                   KSDDKAEIEAKTQALAEKSQKLMEIAQAKAQQAGGDAGEQQQSAKQDDDVVDAEFEEVK
FT                   DDK"
FT   gene            474177..475316
FT                   /gene="dnaJ"
FT                   /locus_tag="PSM_B0427"
FT   CDS_pept        474177..475316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="PSM_B0427"
FT                   /product="chaperone protein dnaJ (heat shock protein J)
FT                   (HSP40), co-chaperone with DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70464"
FT                   /protein_id="ADT70464.1"
FT                   /translation="MSKRDYYEVLGVSKDASERDIKKAYKRLAMKYHPDRTAGDKDLET
FT                   KFKEVKEAYEILTDAQKRQMYDQYGHAAFEQGGGGGHGGFGGGQGDFGDIFGDVFGDIF
FT                   GGGGGRRQSRQQRGSDLRYNMDLSLEEAVRGKDVEIKVPTWVSCEPCDGSGAKAGSKPK
FT                   TCTTCHGAGQVQMRQGFFAVQQTCPTCHGQGQIISDPCNKCHGQGRVEKTKTLSVKIPA
FT                   GVDTGDRIRLSGEGEAGMHGAPAGDLYVQVSVREHKIFVREANNLYCEVPISFTTAGLG
FT                   GEIEVPTLDGRAKLKIPSETQTGKMFRMRGKGVKSVRSGAQGDLICKVVIETPVNLNER
FT                   QRDLLKELDESMGKDSSKNRPKEQGFFDGVKKFFDDLTK"
FT   gene            475421..475882
FT                   /locus_tag="PSM_B0428"
FT   CDS_pept        475421..475882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0428"
FT                   /product="putative ala-tRNA(Pro) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70465"
FT                   /protein_id="ADT70465.1"
FT                   /translation="MTPAIEQLKKSDIKFDILSYEHDINNTNYGLEAVEKLNLNSAQVF
FT                   KTLVLETSEQQLIVAVTPVTQQVNLKQLAKLCTVKKVMMADPQKVQASTGYILGGVSPL
FT                   GQKKRLKTYIHSSALDFEMIYVSAGKRGLEVTLSAKSLAHITQASFAVF"
FT   gene            476064..476432
FT                   /locus_tag="PSM_B0429"
FT   CDS_pept        476064..476432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0429"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70466"
FT                   /protein_id="ADT70466.1"
FT                   /translation="MKILVVDDMPLMRHVLINMLRQLDYKDIVEATDGLQALNILQNQM
FT                   FDLVITDLHMPKMDGITLLDNIRKDAELKNLPVLMVTCEDSSSTVKKAINAKVSGFIVK
FT                   PFNMNVLSAQLTRLSIKA"
FT   gene            476569..476820
FT                   /locus_tag="PSM_B0430"
FT   CDS_pept        476569..476820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70467"
FT                   /protein_id="ADT70467.1"
FT                   /translation="MAKPNKKGPTKTVDIFCSACKAPLFKYRKGGKGALVKCFIERITQ
FT                   DHTHTECVCPGCERPFARPTIIRGTPAYKMIGGKVTFK"
FT   gene            476966..477247
FT                   /locus_tag="PSM_B0431"
FT   CDS_pept        476966..477247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0431"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70468"
FT                   /protein_id="ADT70468.1"
FT                   /translation="MEKDRRVIALLFDIVGMSGTFLVVGSFFLLQLNKVSPKSLTYNLM
FT                   NLSGAILLLISLCYNFNLASFVIEIFWIAASLIGLYKYFKDKPVVVKA"
FT   gene            477419..479149
FT                   /locus_tag="PSM_B0432"
FT   CDS_pept        477419..479149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0432"
FT                   /product="putative two-component regulatory system sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70469"
FT                   /protein_id="ADT70469.1"
FT                   /translation="MFSIPKKIIFACILLVLLLVVTFSFGRAYDLGQAKIQADQQVIQL
FT                   NNYIDNELARFAAIPQLLTENNVLIRFTNNESQHFNAINNYLADIQQASGASDVYILDT
FT                   HGDVIASSNWQTDYTFLGSNFAFRPYFKQAFAGEKVAYFALGQRSKERGIYFSQAIYLD
FT                   GKAIGVVALKINVAKFENDRSLLNTSKGSHFYLQLADNIIAMSDEPAWRLNSFTELDIT
FT                   ARRDIKQRRAYLDHQPLQIKQQRYKSQGIEQFKIAKDEYVAASRPLTHLNATMTVLVDI
FT                   SNINALQVPRLLWLVLFYWVFIFVGYSLLARFAGYKKLLYSRHSLELEVLERTQALEKA
FT                   QTALVQSAKLATIGQLSAGINHEINQPLSAMNTYLASAKIFLKKGKLNALNENLIIIEN
FT                   LVERVHKIVAQLKHFSKPATMQLRPHPLSALLNNALMITHPQLKQDDVNVSAPQFSQEI
FT                   TVWVDALKFEQVLVNVITNASQAMKGEPVRELSFDVECFEERVKLSILDSGSGIEHHVL
FT                   GSIFEPFYSTKSSNGLGLGLSISKQIIESFNGYLTAHNRPEGGAQFIISLSSIEATKND
FT                   "
FT   gene            479142..480503
FT                   /locus_tag="PSM_B0433"
FT   CDS_pept        479142..480503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0433"
FT                   /product="EBP family response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70470"
FT                   /protein_id="ADT70470.1"
FT                   /translation="MIEAVVCKQIIVIDDEAMIRDSLNQLLTLEGYEVQCFSDASVALS
FT                   RLNRSFCGIVLSDINMPTMDGLTFIDQVKAFDSELPVIFLTGYADVSVAVKAMQLGAYD
FT                   LFEKPLNENLLDCIARASDKRALVMENRALKRAVEKTSAPGVRILGDTLKMQHMMNLLN
FT                   TVIDTPADVLIEGETGTGKELVARYLHDHSNRSSCQFVAINCGAVPEQLIESELFGAIS
FT                   GAFTGATHDRKGKFEFAQGGTVFLDEIESTPLSLQVKLLRVLEERKVTPVGANKAIELD
FT                   IRIVAATKVDLLSLVEKGEFRADLYYRLSLVKVSIPALRDRKADIPLLFKHFSSIAATR
FT                   FHKPLGALNIELQQRLLAHDWPGNVRELRNQAERVVLLGPDLAFAQSDSSNSTLSLDLS
FT                   LAEKVSFYEQSLIEEALELNHGSIKDTMTTLQIARKTLYDKMSKYNLNRDMFTD"
FT   gene            480678..481634
FT                   /locus_tag="PSM_B0434"
FT   CDS_pept        480678..481634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0434"
FT                   /product="putative outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70471"
FT                   /protein_id="ADT70471.1"
FT                   /translation="MKNNIFQGSVLAALCSAATLPATTFAADYTVYGKAEVQIANTDTG
FT                   IMRYADEGTQIDAPFSRIGIKGNHKLNEYFTAVFKYEVQVKGFEHDDTNEPFAARNTYL
FT                   GLKGAFGEVVVGRNDTRFKYSEGKLDNFNETQADISQVIAGQDRLGDTITYTSKYWHNA
FT                   QFSFTYAPKDDNKDNEAGFAATLIYGDRNLNKTPYSISISHVDSLNNIKASRIAGVYKF
FT                   EKLQLGALYQHSESIDGAKSGNGYVLSASYKLDKWVPKVQFAKDDSKLRQTSDATQWTT
FT                   GVDYVFDKQTTAYLLYTDLDLEENADSSVALGLKYKF"
FT   gene            481646..483121
FT                   /locus_tag="PSM_B0435"
FT   CDS_pept        481646..483121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0435"
FT                   /product="putative sodium-dependent transporter (di-or
FT                   tri-carboxylates)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70472"
FT                   /protein_id="ADT70472.1"
FT                   /translation="MTKRILENNANKKPFMQWLFLLLGPCVMLLTCLVEPPVGMSAAAF
FT                   KTAGLAFWMASWWVSEVVPIPATALLPLVISPIVDIAAIKSVAAPYAHPLIFLFLGGFL
FT                   ISIAMERWGLHKRIALKTMLYAGKKPSLQILAMMLVTAFLSMWMSNTATAVMMLPIALS
FT                   ITHLVKSSDPSNEGFGKALLLSIAYGASIGGIATLIGTPPNALMAAYLSDSYQIEIGFA
FT                   EWMIVGVPLALGMLLISWIWLTKFTYKVDANVQANKRIDTKAVFSSQLKDLGLMQRAEK
FT                   GVLFVFVLAAICWIFRPLLGDVTGLKISDTGIAIAAALLLFVLPANKGSDARILDWESA
FT                   AKVPWGVLLLFGGGLTLASQIKSSGLADYIANMIEGASTIPLVMSILVVVALITFLTEI
FT                   TSNTATAAGFLPLLGPVAESVTGSPLVWVIPAAIACSCAFMMPVATPPNAIVFGSGEIK
FT                   MKDMIRAGFVLNIVAIVLITLVTMTIAAQVFGF"
FT   gene            483310..484728
FT                   /locus_tag="PSM_B0436"
FT   CDS_pept        483310..484728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0436"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.68"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70473"
FT                   /protein_id="ADT70473.1"
FT                   /translation="MNTDTLSTGSLRSQFNELKHAFEDTPYLPIEQRLALLKKLRANIV
FT                   TLEQDLIAAVSKDFGYRTAFDTLVGDILPTMQGLAHIIKKLPRWSKPSQRSAGLSLWPS
FT                   KVSVTYQPIGVVGVIAPWNYPIQLALVPVITAIAAGNRVMLKLSEFTPNTNADIEKIFA
FT                   GELSQHCTIIQGGSDVASEFSSLPFAHLLFTGSTAVGKLVMAAASKNLTPVTLELGGKS
FT                   PVIVLEKADVNKAARALLFGKMANAGQICVAPDYVFVPKALEHQFIKALCTLYKKHFKQ
FT                   GVEGKNLTSIISPAHYQRLLGYLEQAQEQGAKITKPLEQNQQDGEKHRMGLHIVTHVTD
FT                   EMTLMQEELFGPILPIMSYDKLEDVLNYIRLRDHPLALYILGQDKQAQQYIIKQTLSGT
FT                   VAVNDTLIQVAADDVPFGGVGHSGMGHYHGKEGFLTFSHAKNTLVSGSVNPRIGLLLKQ
FT                   NKLLIKVLKWLYVK"
FT   gene            complement(484792..485517)
FT                   /gene="ybeQ"
FT                   /locus_tag="PSM_B0437"
FT   CDS_pept        complement(484792..485517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeQ"
FT                   /locus_tag="PSM_B0437"
FT                   /product="protein prenylyltransferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70474"
FT                   /protein_id="ADT70474.1"
FT                   /translation="MSQSNFKALLLAGIMLATPLAHAGLEEGIRAANAGEFEEALKEFN
FT                   YLADKGYAPGIYELGKLYEGGHGVTRDYYKAAELYQQAVKKNHVDSMFALAVLYDEGNG
FT                   VKLDKQMAITLFEKAANKNLPAAQYNLGVMYANGDGVSQDYKAARTWYEKAAANNYTLA
FT                   QFNLALMYFEGLGMPKNLEMSYVWNTIAEYNGNMQASHSRKLDERTMLPKEVAEAKEKA
FT                   DAIYTKILAGTYAGEGRLF"
FT   gene            485834..486697
FT                   /locus_tag="PSM_B0438"
FT   CDS_pept        485834..486697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70475"
FT                   /protein_id="ADT70475.1"
FT                   /translation="MLNNLKNIKLSKIIFITSLLFIASCSTSFAYNNLGWLSSFWIDDY
FT                   VDLNKSQSTQLKVIINNTRDWHREIELPKYKADLLDLRQLLDKQADTAQLMAKITQVKQ
FT                   HWRNLLLYASDPLIELAKTLTPSQRSEMVENIREQINDEIKEHASLTKEEHQQSRLDKQ
FT                   LDYYEQWLGKLTSEQRTLVSQANSEYISTSNLWYDYKLTRLGALEALFNQQTLDDAQFA
FT                   HQLRTIITERELFMSAELIERNEENLRAYAQLLVKLNQTLSSKQIAHVDEEFADLVGTV
FT                   NELLTE"
FT   gene            486866..487831
FT                   /locus_tag="PSM_B0439"
FT   CDS_pept        486866..487831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0439"
FT                   /product="GGDEF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70476"
FT                   /protein_id="ADT70476.1"
FT                   /translation="MCLFFGLLSFIFAVFNLSKNHFYIVGGLEVCFSALCFYIFIQLVK
FT                   NKQRNWYAITVCMTVTLVILCGTFLAPLKNGLFLWAFSLPILYYLLLGRKYGIVLSATL
FT                   LVMQSSVLIYKLPSPYFSSFNLALNLLFIYIIIWVISHVFEGNRAEFSKRLKNLALLDP
FT                   LTGAGNRLSMSHYFEVEIKDKSQLYLFLIDLDHFKQINDEYGHDVGDKVLVELATLFRI
FT                   TFAKGYVFRVGGEEFSLMSNFDSAQSALAKAENLRQAVANKYIEANGITINLTASVGVV
FT                   KYQQQNLAELIAQADKQLYKAKDAGRNAVFSDINLCANAA"
FT   gene            complement(487828..488766)
FT                   /locus_tag="PSM_B0440"
FT   CDS_pept        complement(487828..488766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0440"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70477"
FT                   /protein_id="ADT70477.1"
FT                   /translation="MDTTSRLLMLLEVVEQGSFAKAAEIRNIDRSVISKQISRLEDELG
FT                   VRLLNRTTRSFSLTAAGAEMIKKAGELRSLLGETVRMAENYHQEPRGVLKVTASTLIGR
FT                   RYLQPVINDFQKRFPQVEVELRLDDRLVDIVSEGFDLAFRVGEPKDSSLIARKIARNRL
FT                   LLLAAPAFIETYGMPITITDLAQLPAASYASNSLRVEGINYYNHTGEHCEQKIKSVFRA
FT                   NDAEVLLMKTLSGTTYFLAPAFILDKEVIDGQLVPLLTDVKLMEHSAMYAVYPHRDLPV
FT                   RTRLFFDAVREYIGKERPIWENSIPNFDQMY"
FT   gene            488885..490054
FT                   /locus_tag="PSM_B0441"
FT   CDS_pept        488885..490054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0441"
FT                   /product="putative lipoprotein component of a efflux
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70478"
FT                   /protein_id="ADT70478.1"
FT                   /translation="MNKHLIATALSVALITLAGCADESTAQSAPAQQQQAIDVAEVLVK
FT                   PVQSWHTYTTRLESPQKVALMPRVSGIIEQIEFKEGDSVKQGDVLFRLDDRSFAATVDS
FT                   LSAQVKSAQAALEQAKSEASRAVRLTERKAISTEQAQARTSTLRQREAQLAALQAQLKA
FT                   AKLDLEFTSVVSPIDGVISRANITKGNNVLAGQSVLTSIVSNDKMYAYFDVDERTWNSA
FT                   FDEVTAASKQPVVMQKVGQDDFNYSGHINFIDNQINASTGTLRVRAVFDDRSNELRSGS
FT                   FARIKLAANAVRETVIIPDRAIGTDLKNRFVLTVGENNVLQYKLVTVGERYGPLRAITS
FT                   GLEQGDVIAVNGPARVGPGMPISPNKVAINTQGVAFTLSANPADLVAKQ"
FT   gene            490064..493213
FT                   /locus_tag="PSM_B0442"
FT   CDS_pept        490064..493213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0442"
FT                   /product="AcrAB-TolC efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70479"
FT                   /protein_id="ADT70479.1"
FT                   /translation="MKFSHFFIQRPIFAAMLSLIILIAGSISLFQLPVSEYPEVVPPTV
FT                   VVTASYPGANPTVIAQTVATPLEQEINGTENMLYMFSQATSDGRMTLTVTFALGTDLDR
FT                   AQVQVQNRVNSALPRLPQEVQRLGVVAEKSSPDLTMVVHLYSPQNSHDTAYLSNYADLN
FT                   IKDEIARLPGVGDIRLFGGGKYAMRVWLNPDALASRELTASDVVNALRSQNQQVAAGSL
FT                   GAQPISNDSQFQILLNVKGRLNSIEEFKQVIIKVGEQGQLTRLSDVARVDLGQDSYALR
FT                   AELDNQPALAMPIFQRPGSNAIELSDQVRETMARLSKDFPAGVEYDIVYDPTVFVRGSI
FT                   DAVIATLLEAIVLVVIVVIVFLQTWRASIIPLIAVPISLIGTFAVMQWLGVSINTLSLF
FT                   GLVLAIGIVVDDAIVVVENVERNIEDGLSPLEATRVAMTEVTGPIIAIALVLCAVFIPT
FT                   AFITGLSGQFYKQFALTITISTVISAFNSLTLSPALAALLLKSHDAEPDAFTRVLNKLF
FT                   GRWLFQPFNRVFDRGAKGYEKLVQKLIRMSVVVMVAYIALVGGTIKLFDAVPGGFIPQQ
FT                   DKQYLVAIAQLPDAASLDRTEAVVKQMQQIALEVPGVANTVAFPGLSVNGFTNSPNSGI
FT                   VFTPLAPFAERTDPSMSASAIAAQLNQRFAAIDEAFVAVFPPPPIQGLGTTGGFKLQIE
FT                   DRANKGFEALFNSLQSVIAAAQKDPALMGLYSSFRIQVPQMDIDIDREQALIQGIPLDE
FT                   VFNSLQIYLGSVYVNDFNLFGRTYQVNAQADADFRVDPEQILNLKVRNRADNMVPLGSV
FT                   LTVTPTIGPDRVMHYNGYPSAELNGSPAPGYSSDQAQLAIEAVLAKTLPTGIEYEWTEV
FT                   TYQQVLAGNTMVYVFPLVVLLVFMVLAAQYESLRLPLAIILIVPMTIFSALLGVWFVGS
FT                   DNNIFTQIALIVLVALASKNAILMVEFAKDKHDTGLSHLEAMLAACRLRLRPILMTSIA
FT                   FTAGVIPLVLATGAGAEMRHAMGNAVFSGMIGVTVFGLLFTPVFYMLVVKKQRVEEPSH
FT                   D"
FT   gene            493206..494618
FT                   /locus_tag="PSM_B0443"
FT   CDS_pept        493206..494618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0443"
FT                   /product="putative lipoprotein, possibly associated with
FT                   the outermembrane"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70480"
FT                   /protein_id="ADT70480.1"
FT                   /translation="MTKFNLSALKLSPWLSSALAVAVLSGCASKIDTAVHQQQINEFVA
FT                   KAISAEQFMGEDEQNWWHKLGSTQLNQLVINALANNYDLQTSQLVLKSALARIGEQQAQ
FT                   YLPQDGVAVGAKRSGLGDTNSRQSSANVALDWQLDLFGRITALVDAANSQAMSQAEQVR
FT                   LLQIEVVSAVVKGFVSYQGNLQKQQIIEMQIEALEQSIQVLQAQVDEGVANELDLNRTM
FT                   AQLRQQQALVPAIEYAKYRDLSTLAVLSAQTTQSLSINDERTILTKAFAVSLAKPNDAI
FT                   ALRPDISRALFDFSQANSLSVAASKALLPDISLSGFAGVLSLGSNGFSDTQQQWQVAPQ
FT                   LQWSLLSYPALLAQRDAQQFLSQAAYTDYQQVVLKAINESELSLQYLVNQAQQSRFADE
FT                   RYQFANNAFLQAQAMYEEGQIPYLELLDARQDVLIAQENAVDSTISSLLAKVNAYQSFN
FT                   GRWSYALSNTNK"
FT   gene            494627..495652
FT                   /locus_tag="PSM_B0444"
FT   CDS_pept        494627..495652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0444"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70481"
FT                   /protein_id="ADT70481.1"
FT                   /translation="MPNTADTNPNTIPTLMRSIVLNEPNEDINLSDTQLPVPQCTGNEL
FT                   LVKVEYVGLNPVDAQFAKSGFCTWQYPHVLGLDAVGTVVKAGKGIFPGVGERVMWHASV
FT                   GEQGVLSEYAKVPNYAVSIIPKQLASDKAATLPCAGMAALISLDKLSVTEGDTLFVEGG
FT                   AGAVGQFAIQFAKQRGADVFTTASKRNHKLVKQLGADVVFDYNDKALCDKIRRELGPQG
FT                   FDAVIDIMGGESTIQNIELMRFCGRIACLNPLPNFEQQLMYRRAPNISIVSLGGAWLAN
FT                   SLCAQQRMSFMGNLLLETVANGEITPPEVLAVDFNANAVSAALNNQLAGGFTGKQVVKI
FT                   S"
FT   gene            495946..498201
FT                   /gene="fadE"
FT                   /locus_tag="PSM_B0445"
FT   CDS_pept        495946..498201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="PSM_B0445"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70482"
FT                   /protein_id="ADT70482.1"
FT                   /translation="MSLRTKLKKVLPSISVTEQEALDAGDVWLEGSIYRGKPDFSALRD
FT                   VPAAKLTADEQAFLDGPVQELLGMIDDSVIQNGIHLPNDILEFLKKERFFSLIIPKSFG
FT                   GLEFSPYANSTIVGTIATKSSAVAVTVMVPNSLGPGELLLHFGTEEQQAHYLPRLANGT
FT                   DIPCFALTSPEAGSDAGGIPDVGTVTKGMYNGEEVLGLEITWDKRYITLAPIATVLGLA
FT                   FKVVDPDGLLGGKENLGITCALIPKEHPGVELGNRHDPMGIRFYNGTTRGNKVFVPMDF
FT                   IIGGQKNIGRGWQMLVSCLGAGRGISLPALGVSTAQVAFKSASEYAAVREQFGLSIGQF
FT                   EGIQEKLADIAGKTYLQEAMRVLTTEGLGMGLKPSVVTAIAKYHMTELGRDVLDSAMDI
FT                   QAGKAIQNGPQNTLASGYVAQPIAITVEGANILTRNLMIFGQGVMRCHPYLQSMVESIH
FT                   SDDKNADAEFNGILRKTIGYSTANSLRAFRLGVLPFTAGANSALPEVRDYEKAVHKLSA
FT                   KLAVYADFSLLVLGGKLKQAEMLSARLGDVMSFLYAAMASIKYYEQKVASSEREQAAPY
FT                   FHYATRFALQSAEEALHKFLDNFPASGTRKFIRFITMNYSTKMPKISDDLIRELAKQAQ
FT                   LDTAFKAQITHLVKPIEGDGHHINEQAYKAKMASLELLAKVKKALRAKTFKPGTRFSIT
FT                   LENALAAKVINDAEFVQLSDYNKKREKAIRVDEFDFDMNILDDNAQPVNPLKSVVNQ"
FT   gene            498576..498842
FT                   /locus_tag="PSM_B0446"
FT   CDS_pept        498576..498842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70483"
FT                   /protein_id="ADT70483.1"
FT                   /translation="MGIVNGNMVQSKHVGRDIMAGLKGIVGGELKGYTEMLMEARNVAL
FT                   ERLIEDAKKLNADAIVGIRFTTSSVTDGASEILVFGTAVKLRT"
FT   gene            499083..499787
FT                   /locus_tag="PSM_B0447"
FT   CDS_pept        499083..499787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0447"
FT                   /product="polysaccharide deacetylase"
FT                   /EC_number="3.5.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70484"
FT                   /protein_id="ADT70484.1"
FT                   /translation="MSKIIKLSALVLIIFIALWQLSKNEKFQFFGNLIDRVETTEKVVA
FT                   LTFDDGPTRLKTKEFLQIPDESEIKATFYLVGKAIEENIQETKNIIDKGHEVGNHSYTH
FT                   QRMVLKSYNFVADDLEKTNELITEAGYKGEIHFRPPYGKKLFSLPYYLNNNNITTVTWD
FT                   VEPETYLDKNASASDISDYVVQNTKPGSIILLHVMFKSRGNSMAAVPLIVQQLKDKGYR
FT                   FVTVSELIGSSA"
FT   gene            500307..500816
FT                   /locus_tag="PSM_B0448"
FT   CDS_pept        500307..500816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70485"
FT                   /protein_id="ADT70485.1"
FT                   /translation="MAGAHSSLILAKLHTLHIAALGAMSVKFALPHFLEGIQTQETYLK
FT                   WLTRKAVAHIKRDRNRGNVVATTSSYKVAIHEAVCESGGFDFYTGEKLDWTLLSQYNND
FT                   DSKKLKREYKKRFALLPSVDHVDDGLSHANFKICGWRTNDCKNDLSHEELVDVCKKIIR
FT                   HYEKRT"
FT   gene            500924..501436
FT                   /locus_tag="PSM_B0449"
FT   CDS_pept        500924..501436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70486"
FT                   /protein_id="ADT70486.1"
FT                   /translation="MKNFILIILVSLIAGCAANIKQSVKTSNMQQGAIPNSISVAISSS
FT                   NSISKSRDLTKSITELNTLITTDYKGNLIPSNSSNQADISVEITIEHFRYVSGFGRFMA
FT                   GVMVGDAELMLNVKLVDLSTNQIVSESQLDTRSEFSEGIFGATTSRQLEAMSKKIVDII
FT                   NSSAKNS"
FT   gene            501556..501939
FT                   /locus_tag="PSM_B0450"
FT   CDS_pept        501556..501939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70487"
FT                   /protein_id="ADT70487.1"
FT                   /translation="MILLVCTFGAHSGEEVLSIDRVVPNSFNLAFPNESNIQPEQSDFS
FT                   VNNFVLMSNDSGERWAVVTLTNMASGRRSLTNKHLMAIVADGQRIAPLEFLQSFKADET
FT                   LSLTINFGESKFPLLSIYSRSGK"
FT   gene            complement(501948..502064)
FT                   /locus_tag="PSM_B0451"
FT   CDS_pept        complement(501948..502064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70488"
FT                   /protein_id="ADT70488.1"
FT                   /translation="MQISPYKGLKRNGDLVKLGQAQTQSPCSFDILARLRAF"
FT   gene            502076..502462
FT                   /locus_tag="PSM_B0452"
FT   CDS_pept        502076..502462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0452"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70489"
FT                   /protein_id="ADT70489.1"
FT                   /translation="MNIRHILLLVIILFISGCTTSGQLYYIDTKGNEKLGCDVEFVGMP
FT                   RVDKFAVEYALSLCAKSIVKKGGVIQEEHLLMVDTTIPLAPCEKAWTHELAKQQYQAKK
FT                   LTKKEYGYIVANIDLGLATVNKCT"
FT   gene            502591..502980
FT                   /locus_tag="PSM_B0453"
FT   CDS_pept        502591..502980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70490"
FT                   /protein_id="ADT70490.1"
FT                   /translation="MEESVQVKNNEDSIEKSRSVEKNKIQNETITTELHFELLKQYAWL
FT                   SSAIIGAVVILIQLKVLTFGSKVYIPLGCFCFSILNSLIAQDYIVESLTKGKTIYDISK
FT                   KVYILRNFSIFGLGLGVGLLANSFI"
FT   gene            503093..503260
FT                   /locus_tag="PSM_B0454"
FT   CDS_pept        503093..503260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70491"
FT                   /protein_id="ADT70491.1"
FT                   /translation="MNIQVFRPKQFVDMARDYKLFADDVEVATIKRGVTQTVNIPDSTK
FT                   NIQAKIDWCL"
FT   gene            503321..503644
FT                   /locus_tag="PSM_B0455"
FT   CDS_pept        503321..503644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0455"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70492"
FT                   /protein_id="ADT70492.1"
FT                   /translation="MGEKMTKLKRATYSAAIKLETAQLVVDQGYTQEDAAKAMGVGKST
FT                   VSKWVTQLKQERNGQSPSASPMTPEQIEIRELKKQIQRIELEKDILKKATALLMSDSLN
FT                   NSR"
FT   gene            503683..504513
FT                   /locus_tag="PSM_B0456"
FT   CDS_pept        503683..504513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0456"
FT                   /product="integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70493"
FT                   /protein_id="ADT70493.1"
FT                   /translation="MLCNVFNVHRSSYKYWAIRDTTPTPEQVRLEAEVKAIHAMSGGSA
FT                   GARTIAAIATNNGFELSRYRAAKLMVKLKLESCQVPQHSYKRGGNEHLEIPNLLDRQFD
FT                   VVEPDTVWCGDVTYIWVGNRWAYLAVVIDLFARKVVGWAMSLSPDTNLTLKALELAYES
FT                   RGKPTGLMFHSDQGSHYTSLKYRQRLWRYKIKQSMSRRGNCWDNAPMERFFRSFKTEWM
FT                   PKVGYENFRDAKYSVSDYINGYYNNVRPHHYNAGLAPNESEIRYQDSKTVAKIS"
FT   gene            504786..505892
FT                   /locus_tag="PSM_B0457"
FT   CDS_pept        504786..505892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0457"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70494"
FT                   /protein_id="ADT70494.1"
FT                   /translation="MIKSILIIFTLFLASLATAEEFTDVSEITERLEDDIPKILDKHKA
FT                   PGVALAFVNGNRVLEFRSYGFADVAAKTEITQSTMFNVGSISKLVTVWGVMQLVAQGKV
FT                   DLDAPINQYLKRWQIPKSEFNAKKVTLRNILSHTSGLSLGPYTGWESPEKLTSIVDSLN
FT                   GNNNGAGSVELIHVPDTKWSYSGGGYSVVQLLIEDVSGMAFEDYMQQYVFKPLNMKDST
FT                   FNITKKVIKKSATPYDNSGKVTGMVYFNEKAAAGLQTTPIDLARFNMAVLRNNDGDYNG
FT                   LGLLPEKLIDLMIKPAPNTNGRWSMSYVVDAKNSSLGFAGFNRGWVSLSRSITDLNFGY
FT                   VILSNSSICAVNNDIDSLILSIVKQSHN"
FT   gene            complement(505913..506059)
FT                   /locus_tag="PSM_B0458"
FT   CDS_pept        complement(505913..506059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70495"
FT                   /protein_id="ADT70495.1"
FT                   /translation="MFLIKGLSKKLCMFFHNPVCKKRMLVFEWAAKLSMPLQTYRRIER
FT                   FTR"
FT   gene            506098..507051
FT                   /locus_tag="PSM_B0459"
FT   CDS_pept        506098..507051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0459"
FT                   /product="putative protein containing kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70496"
FT                   /protein_id="ADT70496.1"
FT                   /translation="MAMSFYLPLLIPHFQRIAIGETLTSLWSGCGQIVKCQLDEQACVI
FT                   KAIKVPDHINHPKIKQSSFALTRKRDSYHVEYTFYQQFSHKLPKQAAAIECIKAINKGD
FT                   EFALVFKDFSKLGYTQATTENIKAILKWLGQFHAFHLNTKFDGLWPQGSYWHLDTRPDE
FT                   FNNLPEKSDIKQAATQLNNALKQCDYQTLIHGDAKLANFAANSQGHILGYDFQYVGAGV
FT                   GVVDVMYFMTSCMDDSELHKHAQTYLDYYFSQFKNALSHYQPAVNADDVIAQWAHLWPV
FT                   AWADFYRFLLGWSPEHKKINGYMQAQVNNWLASNNS"
FT   gene            507185..507817
FT                   /gene="upp"
FT                   /locus_tag="PSM_B0460"
FT   CDS_pept        507185..507817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="PSM_B0460"
FT                   /product="Uracil phosphoribosyltransferase (UMP
FT                   pyrophosphorylase) (UPRTase)"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70497"
FT                   /protein_id="ADT70497.1"
FT                   /translation="MAIHVISHPLVQHKLGLMRAHGISTKSFRELCSEVGTLLTYEATK
FT                   NLELEDNEITGWDGNKLKVEHIKGKKITVVPILRAGLGMMDGVMQLLPAAKVSVVGLER
FT                   NEETLEPVPYFEKLVGNIDERLSLVIDPMLATGGSMIATIDMLKKAGCKEIKVIVLVAA
FT                   PEGVEKTLAAHPDVEIFTASVDSHLNEKGYIIPGLGDAGDKIFGTVY"
FT   gene            507827..509065
FT                   /gene="pyrP"
FT                   /locus_tag="PSM_B0461"
FT   CDS_pept        507827..509065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrP"
FT                   /locus_tag="PSM_B0461"
FT                   /product="Uracil permease (Uracil transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70498"
FT                   /protein_id="ADT70498.1"
FT                   /translation="MQNNSTFSIKTILTGAQMLFVAFGALVLVPILTGLDPSVALFTAG
FT                   LGTLLFQFVTKGQVPIFLASSFAFIAPIIASVQMWGIPATMGGLMAAGFTYMLLSLLVK
FT                   FKGTKTLHKILPPIVVGPVIMVIGLALAPAAVNMAMGKSGDGGTQIIAYDSAIIISMFS
FT                   LLVTLLFAVWGKGVFKLIPILAGVVAGYTLSLFMGVVQFETVSNAQWLAVPNFVLPEFK
FT                   WQAILFMVPVAIAPAIEHIGDMMAISQVTKKDYLKKPGLHRTLFGDGLATSAASLFGGP
FT                   PNTTYSEVTGAVMLTKNFNPKVMMWTAIIAICLAFVAKMGAGLQTIPVPVMGGIMILLF
FT                   GSIAVIGLNTLVKSGDDLSEPRNLSIVALILICGIGGMHIGSSQFSLEGVSLCAVLGIV
FT                   LNLVFPKAQSNEN"
FT   gene            509216..510955
FT                   /locus_tag="PSM_B0462"
FT   CDS_pept        509216..510955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0462"
FT                   /product="putative protein with predicted kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70499"
FT                   /protein_id="ADT70499.1"
FT                   /translation="MEANSVDINAFLVKHQLPLKYQYISEQYFSVIAQDILTSKKNAPL
FT                   FVAINGCQGSGKTTLGDYLVTWFEQNTHLNCVALSIDDFYLSTQKRQQLAQDVHCLFAT
FT                   RGVPGTHDVALMDKTISRLLNKEVNVPLPRFDKQQDEPVAKNKWLTNSQPVDIVILEGW
FT                   CVASEPQQPFTLIEPINELEKSYDQQGLWRRCINSCLANEYKTVFNKIDYTIMLKAPSF
FT                   DDVFAWRQEQEHKLIAKQGQGAGTMTDEQLLWFISHFERITRENLSTLSAKANALIELD
FT                   SHRDVVAMQLTSDNIGQPIIFTDLDGTLLNHRDYNTEAVDTLLQELQYSGVPVVFNTSK
FT                   TFSEVVALQQALNIKQPFIVENGSAVYIPENYFTLRPIGCSEYQGYWCYSFAAPISNLW
FT                   ADLTHLKKDYSDQYSLFSELSCEQVMHITGLNEIQAAQAQNRQYSDPLCWHGEEHKLNE
FT                   FINAITVYGYDVKVGGRFIHIGKNTDKSMAQQWLVKQFTAQFTKPLSIIALGDSDNDKQ
FT                   MLEEADIAIIIANPESKKPVKLTHNKARYSQLPAPLGWVEEITALPCINSILPNFEEYS
FT                   LHG"
FT   gene            510948..512168
FT                   /locus_tag="PSM_B0463"
FT   CDS_pept        510948..512168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70500"
FT                   /protein_id="ADT70500.1"
FT                   /translation="MADFYQNGIITTLHNIANRPVDDLEKELLSFSKQRPMGLILPSLF
FT                   SELEGPALQNIVKELQKVPYLSQITIGLDRADESQYRYALNFFKALDQNHKVLWNDGPR
FT                   LQALDKELQALGVAPRELGKGRNVWYCMGYKLATAEVESIALHDCDILTYDRGLLARLI
FT                   YPVAHPRFNYEFCKGFYPRTANGKINGRVSRLLVTPLLRSFKTILGSRDYLEYMDSFRY
FT                   PLAGEFSFRRDVLNDIRIPSDWGLEIGVLSEMYRNYSHNRLCQVDIADNYDHKHQELSL
FT                   DDQTAGLSKMSIDITKALFRKLATQGVTFTSETIRSLKATYYRIGLDFIETYHNDALMN
FT                   GLTLDIHQEEKAVEMFAQNIMNAGQHFLENPMEAPFVPSWNRVASAMPDVLERLKEAVE
FT                   LDNEQYS"
FT   gene            512189..513967
FT                   /locus_tag="PSM_B0464"
FT   CDS_pept        512189..513967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0464"
FT                   /product="putative sucrose phosphorylase"
FT                   /EC_number="2.4.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70501"
FT                   /protein_id="ADT70501.1"
FT                   /translation="MNIVKELFFQRVEQHLHAIYQDVELPIAISELTEELITLILGDNP
FT                   LRDPTPHTNRWDEQDVVLIAYGDSIINHEDSDLAVGTPLEAPLKTLHRFIKEQCDHQLN
FT                   ALHILPFYPYSSDEGFAVMNYAHVNEALGDWQDINAIAKDVKLMADLVINHCSSRSIWF
FT                   ENFLTDTHPGKDYFKTASLTDDLSQVVRPRTSPLLNTVTTTSGEKHVWCTFSHDQVDFD
FT                   FENPEVLKEFVGIIRHYLDNGIRLFRLDAVAFLWKQLNTSCINLPQTHEVVRLLRTLIE
FT                   HAEPSVVIITETNIPNQENLSYFGNANEAHAIYNFALPPLLLHTLLSGDSTALKHWMMS
FT                   MPPAQNGTAYFNFIASHDGIGLRPIEGLLQPSEVASLVSTTMQFGGRVSMRTSHDGTHT
FT                   PYELNIALFDALQGTHNGADKFGLERFLCAHAIMFAMEGIPGLYIHSLLGTTNDYERFD
FT                   NSQHNRAINRHRWQESKLLAAIAEKYSHHHQVFNGVKQLLAVRKRQAAFHPNATQFTLH
FT                   LGEGLFGFWRQSIDRQQSIFCIYNISSQPQSLTLADLNLINTQQWYELLSKTVLDEELK
FT                   TMQLAPYQTLWLSNRA"
FT   gene            complement(514020..515099)
FT                   /locus_tag="PSM_B0465"
FT   CDS_pept        complement(514020..515099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0465"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70502"
FT                   /protein_id="ADT70502.1"
FT                   /translation="MPLFKLYRLITYTCLLFSSYSINALEIIFINPGFSNSIEAESNKT
FT                   GDFWFHVSKIMQNAATDLDVTLTIKYANRNHILMKELIQQAINDKPDYLILVNEKNVTS
FT                   QYLSKIDSNKVPIYFLLNRPSPASLEQLQKNGVNVVGSITPNNRVAGKSLMQQLYKKFT
FT                   NKTKTPAHTLALLGDYTTPASTLRTQGLMDFLAQTPKVTLTAKEVANWSEQEGYIKTMA
FT                   YMQLAPEINIIWCANDAIAFGAKRALTQLNKQSQVFVGGINWDSAPNNAYALDISIGGH
FT                   VLLGAHAIINLFDNHTDLKRWPLFHSTNDIFQPLNDTNKPLYNAINANNLAEIDFSQFS
FT                   KTRPDKVEFTIENLLLALE"
FT   gene            515235..515624
FT                   /locus_tag="PSM_B0466"
FT   CDS_pept        515235..515624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70503"
FT                   /protein_id="ADT70503.1"
FT                   /translation="MKAVLLLIVLLFSQTVAANDVSDLEKTMKNIGLAYKQSVEATQLQ
FT                   EFNGAIDQFIGLIEQGKKAKFYKEAQKSVQGLDKVLVQAQLAKKVANEQGLEAAKKPLK
FT                   AIDNLRKKYHKLHEPPGFFELLFGK"
FT   gene            515634..515996
FT                   /locus_tag="PSM_B0467"
FT   CDS_pept        515634..515996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0467"
FT                   /product="putative osmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70504"
FT                   /protein_id="ADT70504.1"
FT                   /translation="MEISVSMLDGQKLSAKFGEHEVISDQSINAGGGAEHPEPFDYFLV
FT                   SMVLCAGFYARKFCQQREISTDGMTLTQNNENVDENGKKRFSIEIGLPEGFPDKYKKAL
FT                   IAAVNTCTVKKVIQAG"
FT   gene            516048..517250
FT                   /locus_tag="PSM_B0468"
FT   CDS_pept        516048..517250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0468"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70505"
FT                   /protein_id="ADT70505.1"
FT                   /translation="MTQSFDFNKALAELQAGKGLTGEDGVLTPLIKQLTEAALKAELEQ
FT                   HLESETEVNRKNGSTKKTVKSSIGQFELETPRDRSGSFEPQFVKKNQTKLTPEIDEKIL
FT                   SMFALGMSYRDIRGHIQDMYGVEVSEATITAVTDQLIPELKAWQARSLDTLYPFIWLDA
FT                   IHYKIKENGRYVSKAIYTVLGVNIEGRKELLGLYISESEGANYWLSVLTDLHNRGVSDI
FT                   LIACVDGLKGFPEAIATIYPDAEVQECVIHQIRNSMKYVASKHQKEFMADLKPVYKAAT
FT                   KDAAEAALAELDAKWGKLYPIVIESWRRKWGNLSVYFKYPDYVRKAIYTTNAIEAVHRQ
FT                   FRRLTKTKGAFPNENSLMKLLYAGILNASKKWTMPIHNWNLTLSQLAIHFEGRLDGVLD
FT                   I"
FT   gene            complement(517376..517510)
FT                   /gene="rpmJ"
FT                   /locus_tag="PSM_B0469"
FT   CDS_pept        complement(517376..517510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="PSM_B0469"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70506"
FT                   /protein_id="ADT70506.1"
FT                   /translation="MKVLSSLKSAKQRPGCQIVKRKGRVFVICKDNPRFKAVQGMKKK"
FT   gene            complement(517507..517773)
FT                   /locus_tag="PSM_B0470"
FT   CDS_pept        complement(517507..517773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0470"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70507"
FT                   /protein_id="ADT70507.1"
FT                   /translation="MKPNIHPDYHVVAFHDTAADSYFIIGSTIKTDRTIEIDGNTYPYV
FT                   PIDVSSDSHPFYTGKQKTLASDGRVAQFNRRFKNLSSAKKESK"
FT   gene            518026..518295
FT                   /locus_tag="PSM_B0471"
FT   CDS_pept        518026..518295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70508"
FT                   /protein_id="ADT70508.1"
FT                   /translation="MSDAQTKQDQIDQGVMDTLRERDHSVLAKQVDSLACSHNDIIELL
FT                   AHYLALSEQEDDELFDDWFDSLSKEQHTVLKVFEVYRGQYEHQN"
FT   gene            518573..519379
FT                   /locus_tag="PSM_B0472"
FT   CDS_pept        518573..519379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0472"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70509"
FT                   /protein_id="ADT70509.1"
FT                   /translation="MQHLNEILSRNNVKIIGKGDKTLVLAHGFGCDQNMWRFIIPALEQ
FT                   HFTLVLFDYVGSGNSDVSKYNKQRYSTLDGYAKDVLEICAALELTDITFIGHSVSGTIG
FT                   ALAAIEQPELFSKLVMVCPSPCFLNLPPDYFGGFEKQDLHELLNLMDKNYIGWANYLAP
FT                   LVMGNSHPDEFIAELSGSFCSTDPLIAKTFAEATFLSDYRFILEHIKQPTLILQSENDA
FT                   LAAPSVGEFVANEISNATLKVISAHGHCIHMTHPETVSRLIFDFVS"
FT   gene            519384..520295
FT                   /locus_tag="PSM_B0473"
FT   CDS_pept        519384..520295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0473"
FT                   /product="diguanylate cyclase (GGDEF domain) with PAS/PAC
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70510"
FT                   /protein_id="ADT70510.1"
FT                   /translation="MSLDKVDEKLADYSADHFLNGALVTNADNIIVYANTYFQKELQWN
FT                   CNELIGKSVDKIITKSSKIFLQSYVLPTLLHEKACQEMQLIMLSAQGERMAVTVNAQLD
FT                   EKGYIYWSFFNATQRDKLYDELIKTREKLEAQTERLQSLASTDELTNLLNRREMNCRSV
FT                   LLLEQAMRSKQSVALLIIDIDNFKVVNDTFGHLEGDRVLKELGQRLKHFGRQTDLISRY
FT                   GGEEFLIMVPDTNKADTLSFCQRLHLLIAEIKVGNRPVTASIGASLSTAKTTFTDLFAQ
FT                   ADNAVYEAKERGKNRTQLYDNP"
FT   gene            complement(520364..521404)
FT                   /locus_tag="PSM_B0474"
FT   CDS_pept        complement(520364..521404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70511"
FT                   /protein_id="ADT70511.1"
FT                   /translation="MDSLTQVALGSAVGYAVLGNKVGRKAVLWGAILGTLPDLDVFLPY
FT                   GGSVEAFTYHRGFSHSFFVHLLISPLIVWLILKIHTGMQAYKTRWFWLVFLCLSTHALL
FT                   DALTVYGTQLMWPLTEHPFAISNMFIIDPLYTLPLLVGVIGTLIPKITAPTAYKINAIT
FT                   LTVSTLYLCCSLILKVVIDDKVNTALQNRDITVNEYISTPAPFTTLLWRVVVMSDGKYY
FT                   EGYASVFDTPNEVTLNAYQTTPSLLNEIKNEWGVKRLQWFTKGFYSVREQQDKVILSDL
FT                   RMGMECAYVFNFVVGQKDGSAISVGNFEKISQRPNLNNLPKIWDRIWHPDTVLASPLAK
FT                   NNCVEQ"
FT   gene            complement(521518..522417)
FT                   /locus_tag="PSM_B0475"
FT   CDS_pept        complement(521518..522417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0475"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70512"
FT                   /protein_id="ADT70512.1"
FT                   /translation="MSEFMPVQAKTEDLEMFITIVDCGSFSGAASLLDLNVAKVSRALS
FT                   RLESRLNCTLLNRTTRRLELTEEGHIYIEYARKALNTLLLGEETIKLLKQAPSGHLRID
FT                   AASPFVLHQLAPLVNEFKKQYPQITLDITSHDNIIDLLERKTDLAIRIGDLKDSNLHAR
FT                   KLGQSKLKLVASTDYLKNAPPLQQVSDLKNHNLIGFSEPNTLNQWPLKHEQSLHFDLRA
FT                   SSGETIRHLCIADQGIALLSQFMIAEDLAKKRLIEVLPHSVSSPNNRESIYGVYYKNEA
FT                   VSSRIVAFLDFIQPRLSL"
FT   gene            522455..523693
FT                   /locus_tag="PSM_B0476"
FT   CDS_pept        522455..523693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0476"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70513"
FT                   /protein_id="ADT70513.1"
FT                   /translation="MPFIAKAFLLTLYIYFKNEDVTMPLALWALTLSAFAIGTTEFVIV
FT                   GLVPTIANDLGVSLPSAGLLVSLYAVGVAIGAPVLTALTGRWSRKVVLISLMGLFVMGN
FT                   LLAWQAPSYETLIIARILTGLAHGVFFSIGSMIATSLVSKDKEASAIAIMFTGLTVALV
FT                   TGVPLGTWIGQHFGWRATFLVVSSLGIIALIGSAVLVPKNLKQSIPATFKEQLQVVTKP
FT                   RLLLVYLMTILGYGDTFTAFTYLAPILEQQTGFASSTIGIIMLVYGVSVAVGNIWGGKL
FT                   ADKRGPISALSIIFSALTVILLIFTFTMESKVAAVLTILVWGAFAFGNVPGLQLYVVKQ
FT                   AQQHTPNAVDVASGLNIAAFNIGIALGSITGGLVVEHMELKDTAWIGAVVSLLALIVTR
FT                   YSGRLDKQNVQAK"
FT   gene            523841..524656
FT                   /locus_tag="PSM_B0477"
FT   CDS_pept        523841..524656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0477"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70514"
FT                   /protein_id="ADT70514.1"
FT                   /translation="MTQRVIEMPDLGMGTFRLEGKTAYESVKMALEVGFRHIDTAQIYG
FT                   NEEQVGQAIKDSNIPRDELFITTKVWNNKLNKNDFIASVEKSLEKLQVDSVDLLLVHWP
FT                   APSNNEPMSEYLTELLKAKKLGLTKHIGVSNFTIANLKEAMQTLDSREIFTNQVEVHPY
FT                   LTNTKLRAFCAQHDIHVTAYMPFVVGKVLNDQTIIDIANKHDATPAQVVIAWENANGMT
FT                   TIPSSTKRKNLEDNFNDKVKLDDEDIARIDGLDCNDRQATPDFAPQWDQ"
FT   gene            524723..525010
FT                   /locus_tag="PSM_B0478"
FT   CDS_pept        524723..525010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0478"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70515"
FT                   /protein_id="ADT70515.1"
FT                   /translation="MLTVIATLSSENSDAERLLTELENLQQSSRQEVGCLRYELSVKND
FT                   AAQTTYLVSEQWASNEHFEAHKNAPHFKAFGDAVGAFITSTNIDVYKTIG"
FT   gene            525370..526098
FT                   /locus_tag="PSM_B0479"
FT   CDS_pept        525370..526098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70516"
FT                   /protein_id="ADT70516.1"
FT                   /translation="MGRKSRLKKERRGLEQHGLIERTANTLLLFGEHNQSIYRFFQEEW
FT                   QADALARGEVWLSTLEACRAYEDPEQGDPEEAYETYNSGYAVGGSNDPGFVEVARRSGV
FT                   YIGPGCSNITLSNNTMKTILPDAYVLCTTTEFSPEKLSETFGRYCVEVTNPKDFFVLIS
FT                   ESLEKSKKIKEAAAGKVIYKDRSYTGMESPPGRIGFVKPPDLYATQREFRLLWVPENSS
FT                   GLAPFLLKCPEAAHFCKRIV"
FT   gene            526387..526641
FT                   /locus_tag="PSM_B0480"
FT   CDS_pept        526387..526641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70517"
FT                   /protein_id="ADT70517.1"
FT                   /translation="MLEDMERPFILGAQSVDPKLPSIAQWGASSRFGLDSLDTIEGKLW
FT                   KDWRFSLEMLGVSWVIPIIEESVIKDDVSHAVNEIISKS"
FT   gene            complement(526779..527432)
FT                   /locus_tag="PSM_B0481"
FT   CDS_pept        complement(526779..527432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70518"
FT                   /protein_id="ADT70518.1"
FT                   /translation="MRLSDYLSTHFYHTDELCQALNIDTETLENWQAQSIFPKPSYCIK
FT                   NQMSCSSYSGLYECEEYDDYYPRGCVNWGQGLVKQKIESSNQAFNLFAQHYTQSLAKLA
FT                   QQGFIFNEELFGCEIEEHLQQVWQQFLCSKYGVLTQNGLIDEIVAVDIGRLFVDDITEL
FT                   RSKASLDKDERTRIHPAMKLLNKALSHGADHEKQLTLRSRYIDALILKYDLSIK"
FT   gene            527605..528522
FT                   /locus_tag="PSM_B0482"
FT   CDS_pept        527605..528522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0482"
FT                   /product="putative dihydrodipicolinate synthase
FT                   (dapA-like)"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70519"
FT                   /protein_id="ADT70519.1"
FT                   /translation="MRTLEQIKQASLITAIKTPYLANGEIDLAKYDELVEIQIAAGVDG
FT                   IVVGGTTGEGQLMNWEEHLMLIAHSANKFGEQLLIVGNTGSNNTREAIKATKYGFASGM
FT                   HASLQINPYYGRTSIAGVKEHFKRVLDIGPAFIYNVAGRTGQDLTPDIIEPLAQHEHFI
FT                   GVKECGGNERIAHYERQGIACWSGNDDEAHDARHTHKAHGVISVTSNLIPGLFRQLMDS
FT                   KNDALNNSLQPLMNWLFCEPNPIAINTAMIMTGAVNPVFRMPYVPLSDEQQQQGETLIN
FT                   QLNEQDFVGSRAQCVDISKVLILS"
FT   gene            complement(528595..530412)
FT                   /locus_tag="PSM_B0483"
FT   CDS_pept        complement(528595..530412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70520"
FT                   /protein_id="ADT70520.1"
FT                   /translation="MKPLFYLISAFLFISFSSSATQSISVLAKHPIWLKLGHYKNQPAT
FT                   ISYITNASFFIADNGRTDPAAELKATIHAFNNLPSMPCRYPARYQWLKEQGLTFSMPAA
FT                   ECPKLKQWREQQAIHSVSLVFASGYMSNPASLYGHLLLKLNRSTESKNKLLDYIINYGA
FT                   HVPDNENGLVYILKGLFGGYKAGFSDQLFYRHQHNYGEIELRDLWEYTLNLNERDVVFI
FT                   ANHLWEILGTEFDYYFADENCAFHLAQIIELVIGDQLTSEGAPWVIPATIFSRLNSATY
FT                   QGQSAVKNITFTPSRDTVFSKYVQSLSEKELSFAKQIFAESAVLKNESFLALPVQSQKA
FT                   IIGALFELVQVKQIQKQTPVKISELKNALIKARLKLPMGENKVRFQFTQQPPHKGQKPS
FT                   NSSVSAVHTAEQTQYTLGFRLSYFDTLASDIARIPFSNLEMLDTELMFTDGETYINKVH
FT                   LLDLESFNPNQLSWANESKWSWKINVGFDRQPALCRTCKRSFVMGGAGQAWQFSNNTLA
FT                   YSLINGYLGDLAKNSHFYDSSVEVGIITGTNSGIKLKASYEKSFLNAKNPAQTKLELAV
FT                   PLSQDIDIRLAVTRANSAMWQLKLNYYWQ"
FT   gene            complement(530452..530919)
FT                   /locus_tag="PSM_B0484"
FT   CDS_pept        complement(530452..530919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70521"
FT                   /protein_id="ADT70521.1"
FT                   /translation="MIKRCLTAAVLVSAFVSMPSQAKSGINPWQQCGIGAMVFPDNGVA
FT                   AAISNIIWDLGTTAVSSNISSVESCEGANVKTAQFIQQTFPVLEQEIAQGEGEYIAAML
FT                   NVRGCDVTAHQQIITSVRNDYANAPIDNAQAFYELVEGKITTNFSSQCAAI"
FT   gene            531237..532538
FT                   /gene="rhlE"
FT                   /locus_tag="PSM_B0485"
FT   CDS_pept        531237..532538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="PSM_B0485"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70522"
FT                   /protein_id="ADT70522.1"
FT                   /translation="MNFKSFSFAPELIQALDELNYHTLTPIQRAAIPAVRKGKDVLASA
FT                   QTGTGKTAAFALPIIQKLFESDSSTTNAPSALVLAPTRELAEQIANNFKDFAKYTSLKV
FT                   VSLFGGVNTAGQEIALKEGVDIVVATPGRLLDHIRLGNLSLAQVKHLVLDEADRMLDMG
FT                   FINDMQSVIKSCADERQILLFSATFPAAIKQFASKVLKQPEIVRVDQTNSTASTVQHVV
FT                   YPVEERRKQELLSELIGKKNWQQVLVFVNMKETADELVTELNLDGIPAAVCHGDKSQGN
FT                   RRRALREFKEGKVRVLVATEVAARGIDIDGLPRVINIDLPWLAEDYVHRIGRTGRAGNQ
FT                   GQAISFVSREEENMLFEIETLIGQKIKRVYLEGYEVSNREVLIDKIGKKPAHLRRTRAN
FT                   KPSGQATGEARAKNRSRISNVRKSLKGEKLSLKK"
FT   gene            complement(532567..534072)
FT                   /locus_tag="PSM_B0486"
FT   CDS_pept        complement(532567..534072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0486"
FT                   /product="amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70523"
FT                   /protein_id="ADT70523.1"
FT                   /translation="MIIKRLLLTLFVCTIPNLYAADNNTELKTISDIHNAYKNNTTTAE
FT                   QLTRTYIDRINELNPKYNAVISIEPTAIEQAKQLDALFKAGKWAGPLHGIAVLLKDNIE
FT                   TTGTLPTTAGSLALKNNVTNKDAFVVKQLRQAGAIILGKANLSEWANFRSSYSSSGWSA
FT                   IGGQTHNAHDVTRNPCGSSSGSAVAVALNFAPIALGTETDGSITCPASVNGVYAIKPSM
FT                   GQVSRAGVIPLSSSQDSVGPMAHSLKDALAVLSVIQGEDSDDGSTLNVNRTLDGIAPKP
FT                   SLRIGALPANKFTVATQKLYAKQLQTLKDAGHTVVNVAVKDDLSTLYVDEYAILLYDFK
FT                   AEINHYLSKTPTQVTVKSLDELIAFNIANKQQEMPYFEQDILQQANAVDLSEKQQYKST
FT                   KARYRALAKRAISNLYRNNKLDIVIAPTVSPAWKTDLINGDNFKGSSSSLPAIAGTTHI
FT                   TLPVGKVSHLPVGLSVIANQNDEAAAYAYAAIIDNVLGTKKPE"
FT   gene            complement(534165..535772)
FT                   /locus_tag="PSM_B0487"
FT   CDS_pept        complement(534165..535772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0487"
FT                   /product="putative uncharacterized dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70524"
FT                   /protein_id="ADT70524.1"
FT                   /translation="MIRLTEIKLPLDHDENAIGQAIINKLNISPEQLHSYNVFKRGYDA
FT                   RKKSAILLIYTLDVEVDNEAQLLTSFEKDQHVKVSPDTNYKFVAHANSSIKERPVVIGF
FT                   GPCGLFAGLVLAQMGFNPIILERGKEVRERTKDTFGFWRKKALNTESNVQFGEGGAGTF
FT                   SDGKLYSQVKDPKHYGRKVITEFVEAGAPEEILYVSKPHIGTFKLVTMIEKMRARIIEL
FT                   GGEIRFSTRVDDIHLDNGQVTGLTLSNGEQLETRHVILAVGHSARDTFKMIHDKGIYVE
FT                   AKPFSVGFRIEHKQSMIDECRFGDNAGNPILGSADYKLVHHCNNGRTVYSFCMCPGGTV
FT                   VAATSEEGRVVTNGMSQYSRSERNANSAIVVGISPEKDFPGHPLAGIDLQRKLEEQAYE
FT                   LGGKNYDAPAQLIGDFLKGKSSANLGDVQPSYTPGIKLTDLSNVLPPFAIEALREAIPA
FT                   FNKQIRGFSTNDGLLTGVETRTSSPISIKRDKTFQSINTKGLYPAGEGAGYAGGILSAG
FT                   IDGIKAAEAVALSMLENA"
FT   gene            535961..536284
FT                   /locus_tag="PSM_B0488"
FT   CDS_pept        535961..536284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0488"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70525"
FT                   /protein_id="ADT70525.1"
FT                   /translation="MAFVVTENCIKCKYTDCVSVCPADAFFEGPNFLAISPIDCIDCGL
FT                   CVPECAADAIFQEDELPESQKEFTQLNAELAEIWPRITQVKPAPEDADSWNGVANKLKL
FT                   LDT"
FT   gene            536426..538672
FT                   /locus_tag="PSM_B0489"
FT   CDS_pept        536426..538672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0489"
FT                   /product="putative membrane associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70526"
FT                   /protein_id="ADT70526.1"
FT                   /translation="MQYFIPIKITTLLFFISFSLGLTLSPNALADKLNYQLAHINKNID
FT                   VDGVLNEPHWQQATHVAVNYQDEPNEKGTPPVKTDAYLYDDGHNLYVAFVAYDPDPSKI
FT                   RAALRDRDTLWQDDTVGLVIDTFNDERTGYEFYVNPLGAQGDLRMTDTDEWVSDLSWDA
FT                   IWDSAGTINEQGYVVEMRIPFKALRFAQNKDQSTWGFAVMRNYQRDVLYQLSSTGFDRD
FT                   IKCSLCQFDKISGFNNLAPSKNLQLTPTLTALRNDQKTQVPGAWDNGDVDTEVGLDLRW
FT                   GITKDAVINATINPDFSQVETDSLELDVNTTYSIYYAEKRPFFLDGASYFKSNLFELLY
FT                   TRTIAEPNIGAKLTGKTDSHSYALMFADDDNSNVLLPSNQGSGFASLNDKTKAAVARYQ
FT                   YDIGQQGTIGVTSTYRESSDYHNTVLSVDGSYWFNQSDTLNYQIAHADTNNSQFLVDNY
FT                   NLADTQSDMAYALKLTRDKRDYKLYATYDNIGEDYRTDLGYQEKVDYEKVGFGGGQTWY
FT                   GDEHDMLTTWSYTADWDKTWAQNGELLEEEYEGYMTFQGQKQSVFELGLLNRYENYNGK
FT                   FYNQNIGYFYTAFRPSKDLRLSLYAEYASRIDYTNEQLGDVLTTQSQAVWDINNHWQVD
FT                   VRHNYSHLDDYQGRRVFTANLIDFRLYYKFSMRAMLKLILQFEDIDRNEDAYFYQVSEI
FT                   NKDYGSQLVYSYKINAQTLFYLGYSDKGYQDDSLKSIERDQRTFFTKVSYAWQL"
FT   gene            complement(538772..539476)
FT                   /locus_tag="PSM_B0490"
FT   CDS_pept        complement(538772..539476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0490"
FT                   /product="putative periplasmic or outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70527"
FT                   /protein_id="ADT70527.1"
FT                   /translation="MNNKLKQLFIALPFTVLSTTAAANWSTTITAASDYTFNGVSQTDN
FT                   DPALQASLDYAYDNGVYAGVWASNVDFGDDTDFELDAYVGRYIQLNEQVSLDYGIAYYT
FT                   YQGNNSDGNYAEAYTKFGYTSDYGQTELNFWYSWDYFGYDTGHVISMIAHTYELAPNHA
FT                   IRASFDISNSLDGNKFQWDEAKGDKSYYHYRLAYQTSYEGFGIEVAAENTSLDYDYADE
FT                   RIVLAISRTFDL"
FT   gene            complement(539485..540702)
FT                   /locus_tag="PSM_B0491"
FT   CDS_pept        complement(539485..540702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0491"
FT                   /product="putative quaternary ammonium permease"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70528"
FT                   /protein_id="ADT70528.1"
FT                   /translation="MTIWLNAGIIFTLLAIVTILIKWGNVRVVGVTPVRTFTFIAILFT
FT                   SGLDVGLIMFPLTEFAGYADIKASPEYAFANPLSIEFGYWGFLIWGFYFLTCFYFCVIE
FT                   PKVKFFEIPWVKFLNNVVIIGTCAFTAYLLLSNLPWYLPELGDGSNVIPAFYLIVLAAI
FT                   CFAVYSSTDIKYVRFLSIATTWLFIALIGFMWADAFLFGDSELSAFTKNIGLIGNYFAN
FT                   INEFVLPLNDYHEFYLFWWFAWSIMIGQFTSRFVGGLKTYQVLGAMLIFPSIPIAIWFS
FT                   VLYHYHEAGIPTEGIKNFAMVFVGIVFVINSLDSLIRLYTDNLNLTVKRFGKFKYIAMN
FT                   VVALSLLTLLFKLEFLQIQWVGALVIGLFFICLGFIAYSKLKTVSNIEGSPKANKIDYT
FT                   KIETIS"
FT   gene            complement(540781..540912)
FT                   /locus_tag="PSM_B0492"
FT   CDS_pept        complement(540781..540912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70529"
FT                   /protein_id="ADT70529.1"
FT                   /translation="MPLIGKLHNEIKPFNLACHKGHSFKQNALRSAFMRLAVAHKHK"
FT   gene            complement(540869..542536)
FT                   /gene="betA"
FT                   /locus_tag="PSM_B0493"
FT   CDS_pept        complement(540869..542536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="PSM_B0493"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70530"
FT                   /protein_id="ADT70530.1"
FT                   /translation="MNHSFDYIIVGAGSAGCVLANRLSEDSSNKVLLLETGGSDKSIFI
FT                   KMPTALSIPMNTDKYAWQFHTQPEKYLDNREMHCPRGKVLGGSSSINGMVYVRGHAKDF
FT                   DEWQQHGANGWDYQACLPYFKKAESFYLGENSHRGGKGPLGVNNGNNMENPLYSAFIDA
FT                   GAQAGYATTADYNSAQQEGFGPMHMTVKNGVRSSASREYLDPIKHRSNLTIVTGALAQR
FT                   VILDGKKATGVEYKINGTVKTATASKEVILSAGSIGSPHLLQLSGIGDTQILEKAGVEV
FT                   KHHLPGVGQNLQDHLEFYFQYKCKQPITLNGKLGLFSKGLIGAKWLLTRKGLGSTNHFE
FT                   SCAFIRSKPGVEWPDIQYHFLPAAMRYDGRSAFAGHGFQVHVGHNKPKSRGSVTIASAD
FT                   PTQPPKIVFNYLEHQDDIEGFRACVRLTREIIEQAAFDDFRGEEIQPGQQVQTDEQIDA
FT                   FVRQAVESAYHPSCSCKMGEDDMAVVNSNTQVHGMQSLRVVDSSIFPTIPNGNLNAPTI
FT                   MVAEKAADIILGNKPLAHTGVDVVNATDWQTSQRNKTL"
FT   gene            complement(542546..544021)
FT                   /gene="betB"
FT                   /locus_tag="PSM_B0494"
FT   CDS_pept        complement(542546..544021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="PSM_B0494"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70531"
FT                   /protein_id="ADT70531.1"
FT                   /translation="MEPNVTTPIYQNFINGQFLANKSGETFDVVNPATGQVNYAVEVAD
FT                   EYVQNAAIESAKQGFKVWSAMTPIERSRILLNAVAILRKRNDELALVEVLDTGKPMQEA
FT                   NCVDVETGADVIEYFAGLAPAQVGQQQMVGDDFYYTRKEPLGICAGIGAWNYPLQIACW
FT                   KSGPALAAGNAFIFKPSEETPLGAIKLAEVFIEAGVPAGVFNVVQGASEVGQWLTAHQD
FT                   IEKVSFTGEVGTGKKVVASAAGTLKDVTMELGGKSPLLVFDDANIEQAVSAAMLGNFYT
FT                   QGEICTNCTRIYVHKNVYQQFIDELKTRTENNIIAGDPQDLNTNFGALISKKHQDLVLS
FT                   YINKGLEEGATLLTGGSTLSPASAPNGYFVAPTVFVDCNDEMTIVKEEIFGPVMSVLVF
FT                   DDEDDVIARANGTHLGLAAGVFTSDIKRAHRVIHQLQAGICWINAYGNSPAEMPVGGYK
FT                   QSGIGRENGIQTLDHYTQTKSVYVGMADIESPF"
FT   gene            complement(544011..544601)
FT                   /gene="betI"
FT                   /locus_tag="PSM_B0495"
FT   CDS_pept        complement(544011..544601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="PSM_B0495"
FT                   /product="transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70532"
FT                   /protein_id="ADT70532.1"
FT                   /translation="MPKVGMEPVRRQQLIDATIESVAQKGLQATTINSISKNAGMSSGI
FT                   ISHYFGGKQGLIEATVRYLLSNLKDDLISKVNEKTTPTQRLMFIVESNFALVQQRKDTT
FT                   RTWLSFWAQSMHDKELHRLQNVNSKRLQSNLTVSFKQLMPLAQANLAAELTAAMIDGLW
FT                   LRAVLSQSDENQFKHSESLAKNYVHSLIKQYGA"
FT   gene            complement(545025..545282)
FT                   /locus_tag="PSM_B0496"
FT   CDS_pept        complement(545025..545282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70533"
FT                   /protein_id="ADT70533.1"
FT                   /translation="MLFINQVIAQLKAEPEKLQLIKNNLAYYRAQTHLKRGFLLAIERF
FT                   DWVFEATDNIDEICDQIMADDYIGNRLRRYPLLFKGVVET"
FT   gene            complement(545327..545584)
FT                   /locus_tag="PSM_B0497"
FT   CDS_pept        complement(545327..545584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70534"
FT                   /protein_id="ADT70534.1"
FT                   /translation="MKNEIDNKQILAVYERIQQRGEVTEEGKFYQGITAYSDIDGYTVY
FT                   LQGSGVLLRFGFHNTYHLDYEHDKHKDDFLKKLYNIANEE"
FT   gene            545731..547011
FT                   /locus_tag="PSM_B0498"
FT   CDS_pept        545731..547011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70535"
FT                   /protein_id="ADT70535.1"
FT                   /translation="MIDKALLLKTRELSDQLIALQTPIRILDAINWDKQIKEEFFRQKC
FT                   QKNPLIDRAYYQQRDLGFVPSELRQAFSTLHRNIINQLGQLNPIAQYMGKMCTEYKTVL
FT                   SMLEYRGTPEFHDLSVELFGHPKDLFHAGEPSLSELANMLEQPLKNLLAADILPEDPKN
FT                   IDASDAVRILSEQVNTSMPGINVEVMLSDGIVSDAAAGANNIKLNQDVKFSQRELDILE
FT                   VHEGWIHVGTTQNGLAQPYLTCLSKGTPSSTVTQEGLAVLTEIITLKSTPRRLSKLVNR
FT                   IQAVTKVIDGAEFIDIYRDYVAQGLSKDDSYTLAQRVFRGSTATGLPFTKDIAYIKGFV
FT                   LVYNLIRVAIQLGRIDQLPLLLVGKISIDDFRLISQLHDLGVIENPQFVPPHFKDLRGL
FT                   ATWLSFGRFIGDLSFEQLENDYKPLFL"
FT   gene            complement(547226..548029)
FT                   /locus_tag="PSM_B0499"
FT   CDS_pept        complement(547226..548029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70536"
FT                   /protein_id="ADT70536.1"
FT                   /translation="MHTDVNTLFDNLWQNYLSVTPSADKIHDLLGSTQKDDIINDHIAL
FT                   RTFNIEKVGLEKLAAHFLAIGYKECGEYHFEAKKLYAKHYEHSDPTQPKVFISELLVEK
FT                   CSPELQAIVTDMVAQIDESAVTADNFLYSGTHWQVSTDTYKKLLAESEYAAWMSAWGYR
FT                   ANHFTVNINTLAKFDNIHDVNQALKDAGFSLNTSGGEVKGSPEVLLEQSSTLADEYAVT
FT                   FSDGDMRIPSCFYEFAIRYPKPDGEIYTGFVAASADKIFESTNAR"
FT   gene            complement(548057..549523)
FT                   /locus_tag="PSM_B0500"
FT   CDS_pept        complement(548057..549523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0500"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70537"
FT                   /protein_id="ADT70537.1"
FT                   /translation="MNTQLINNQWLVGKGPAFDSINPSNGEIVWQGNGANAEQVDSAIK
FT                   AARAAQVQWADMPIEQRITILENFVAQLKEHSEEFATIIARETGKPLWETRTEVGAMTG
FT                   KVAIAIRAYNERTGTTENPMPGAKALIRHKPHGVVAIFGPYNFPGHLPNGHIVPAILAG
FT                   NTVVFKPSELTPHVAQFTLELWLKAGLPAGVINLVQGELETGKALASHQDIDGLFFTGS
FT                   SNTGHLLHKQFAGHPGKILALEMGGNNPLVVKDVADVSAAVHDIIQSGFITSGQRCTCA
FT                   RRLFIEKSPNGDAILEKLISATKNILVDDSFADDQPFMGAMISEKAALGMVAAQAELVK
FT                   QGAEILVELKQLKSGTGFVSPGIIDVTNISEIADEEHFGPLIKVYRYTDFNSAITEANN
FT                   TSFGLSAGLLADSEDDYSHFLKRIRAGIVNWNRPITGASSAAPFGGIGASGNHRASAYY
FT                   AADYCAYPVASVESEKVNLPQTLAPGLIIE"
FT   gene            complement(549532..550566)
FT                   /locus_tag="PSM_B0501"
FT   CDS_pept        complement(549532..550566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0501"
FT                   /product="putative arginine succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70538"
FT                   /protein_id="ADT70538.1"
FT                   /translation="MQVLRPITVNDFAALKEIAIESGHGFTSLPVDDGQLQEKIDRAQN
FT                   SFTKNVDKPIDESYLFVLEDSETGKVIGTTAIEAAVGLSVPLYHYHLGKTVHHSPTLNV
FT                   YNTVDILSMCNDYTGCSEICTLFLREDSRKGLTGRFLSRSRFLFMAQHSERFADTVIAE
FT                   MRGVSDEDGHSPFWQWLQEHFFSIEFPQADHLVGLGDKVFISELMPKYPIYVNLLSKKA
FT                   QAVIGHVHDKTKPALKLLEKEGFEHRGYVDLFDAGPTVEAKLGNIRSIRDSQVCPITIG
FT                   ELEHINEQSSDTLAICNQGVSDFRATFTKHAHYNQAKHTLIISQEVADALHLKQGDAAR
FT                   FFRL"
FT   gene            complement(550648..551853)
FT                   /gene="argD"
FT                   /locus_tag="PSM_B0502"
FT   CDS_pept        complement(550648..551853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="PSM_B0502"
FT                   /product="bifunctional
FT                   N-succinyldiaminopimelate-aminotransferase/acetylornithine
FT                   transaminase protein"
FT                   /EC_number="2.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70539"
FT                   /protein_id="ADT70539.1"
FT                   /translation="MQVTRDLFNDVMVPNYNPSAVVPVRGEGSRVWDQNNNEFIDFAGG
FT                   IAVNCLGHCHPALVGALKEQGEKIWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGA
FT                   EANEAALKLARRFALDKFGAEKTKIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPADI
FT                   VHCDYNDIAAFEALIGDDTCAVMMEPLQGEGGIVPPTNEFAQKVRELCTKHNALLIFDE
FT                   VQTGVGRTGHLYAYEGLDVIPDILTTAKALGGGFPIGAMITTTEIAAHLKVGTHGSTYG
FT                   GNPLACAVAEAAFDTVNTPAVLDGVKEREQMFRDGLNAINEKYHVFSEVRGKGLLIGAV
FT                   LNEKFEGRARDFLVASANNGLMNLVAGMNVIRFTPSLVIPFEDIKEGLARFEKAVRDVV
FT                   NG"
FT   gene            552045..552473
FT                   /locus_tag="PSM_B0503"
FT   CDS_pept        552045..552473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0503"
FT                   /product="AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70540"
FT                   /protein_id="ADT70540.1"
FT                   /translation="MITPQDEKLLSVLKTNARASISDLARHLSLSRSTVQSRMLKLEQS
FT                   GIIKGYSVDFGDDFLNSLVSAHVSIKVKQKLTTKTNIELKQIDAISQLYAISGEFDLIA
FT                   IVEAQNLEQLSHLLDDIGNLDGVERTRSSVILETKFKR"
FT   gene            552730..553104
FT                   /locus_tag="PSM_B0504"
FT   CDS_pept        552730..553104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70541"
FT                   /protein_id="ADT70541.1"
FT                   /translation="MKYTTMAAVALLIGGSYLSAKATLFDPAQSITVETYSDIFFKLES
FT                   SPVSINEIITGASQFADSLCDESIYQEVIGESVNSCKQKFKQSQAQCAEFIIKNNEPMY
FT                   TDKVAITQLSEKFINCMTNS"
FT   gene            553254..554279
FT                   /locus_tag="PSM_B0505"
FT   CDS_pept        553254..554279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0505"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70542"
FT                   /protein_id="ADT70542.1"
FT                   /translation="MQENLLNSVIKITKNRDVDSLEYSLISTIQEFIGCKEVSVYKDIE
FT                   VQGQLTIEQSLCLKVTGEKQFEWVQRQIVAQPEDELLSCLRSACIITVQSADGIERRWL
FT                   PITRQEKTVAAISVVSKSLDSSAQVMLNAFCRIFENYLVILHENERDKLTGLLNRQTFE
FT                   KKIKQLIEKQVLKMHGSSRDKDKRQQKQASTSWLAILDIDHFKNINDQYGHICGDEVLL
FT                   VLAQKMRHFFRSTDLIFRFGGEEFVIVFEPTDADSISNKMAEFIQLIRDTSFPFVENMT
FT                   ISAGLARISPYDFPIAVLESADKALYYAKNNGRDKFCIYEDLLAENLISVQVNSSEIDL
FT                   F"
FT   gene            complement(554281..555204)
FT                   /locus_tag="PSM_B0506"
FT   CDS_pept        complement(554281..555204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70543"
FT                   /protein_id="ADT70543.1"
FT                   /translation="MLKKSILITSVIVFSIITAVVGSSIYTLYSKKVVSVDPKLKEISG
FT                   IEFDKHKRLWAINDSGDEPKLYRLNDDGSIAKEVLVTNAKNIDWEDMTQNKFGHFFLGD
FT                   FGNNKNERKWLTIYKIENPIDIKTNTTEAEIIKFTYPELDGSPIQPDQRNYDLEAFVAF
FT                   GRHLYLFTKNRTEPFDGITNVYKVGDHAANFDAQLIDSFKTCTTMEKLCWITSAALSPD
FT                   RTKLALLDSTSIWLFENFKGDKFFSGDVFKIDLGIVTQKEAITFYDDNTIAFTDEEFKG
FT                   IGGNVYFIKLDQVTKVKVQRSHPQPQ"
FT   gene            complement(555391..555552)
FT                   /locus_tag="PSM_B0507"
FT   CDS_pept        complement(555391..555552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70544"
FT                   /protein_id="ADT70544.1"
FT                   /translation="MPQAKQLKKAMWNPFIHIKTALKLIKTLFTHYYSALFILPHWFGA
FT                   ILTIKTDF"
FT   gene            555589..555891
FT                   /locus_tag="PSM_B0508"
FT   CDS_pept        555589..555891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0508"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70545"
FT                   /protein_id="ADT70545.1"
FT                   /translation="MLNKRFFKTKNEAEVTFEFSHPDADDVCLLGEFNDWQPVPMKHNK
FT                   KLGVFKCKQRLPVDKEFHFRYLINGKQWDNDHQADGYIANNFGTENSIVNTQRIN"
FT   gene            555901..557889
FT                   /locus_tag="PSM_B0509"
FT   CDS_pept        555901..557889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0509"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70546"
FT                   /protein_id="ADT70546.1"
FT                   /translation="MDALSQLFYLHGIGYEYTKYTGEHVIFSEDTRKSALHCCGVDTRD
FT                   TAQITQLNYQLDAATWLTLAPAVSIIDQASNVLKVRVNEADTHHKITLTVAALNIKLQF
FT                   EHIAQYAALGEYFVNGCRYIEIALPLTHLPTGYYDALLTMGEQSAKTQIWSTPKQAYQI
FT                   ADKKRFGLSIQLYTLKNKAGLGIGDFSDLLELATLCAKQNMDYILLNPLHLLFADNPEC
FT                   ASPYNPNNRALLNPLYIAINLSPDSFNNSDLTKLLSANTSSKYSDQGVAFIDYKTVTEC
FT                   KYAAFKLLFKHFQQQGSQARQNEFSAFCKQYSDVLAMLETTEPTFEYYLQWQAHSQLTQ
FT                   CQQHCIAQGMAIGLINDLAVGCANEGTEFKYQQGLFSQDATLGAPPDPWAPNGQNWGLP
FT                   AINPQRLADNNYQFYRSLIRANMDAVGGLRIDHVMAIRRLWWCFINNNTQDGCYVYYPF
FT                   EHLLAILKIESHLNQAIVIGEDLGVVPPEVKEALVDSGIFSNSLFYFEKQQNDEFVNSD
FT                   DLSDQCLLMIANHDVPPFVGWWQHSDLKIKQQYGLIDTDEYQQLVQQREQEQHRLLRFL
FT                   NPQNTSLSLNTDAFDVYSTLAVCLAKSPSRLFALQLDDLDKQHYPVNIPGTDKEYPNWR
FT                   RVLTHTCDDIFKDNAALLAAIHSIRNA"
FT   gene            557890..560112
FT                   /locus_tag="PSM_B0510"
FT   CDS_pept        557890..560112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0510"
FT                   /product="glycogen branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70547"
FT                   /protein_id="ADT70547.1"
FT                   /translation="MGSTKNRVSTQLVDYDAQVNALTAGRFKDPFSFLGAHNTQSGTEI
FT                   RVYLPAALRVELLIDGQVISALRYKHSDLFIAELSSMPSSVYQCQVSYENSDVRFYDEY
FT                   SFSSTLDEQAMYLFNEGSLEHAYTHLGAQFTTQQGVDGVRFCVWAPNAASVSVIGEFNF
FT                   WQANRHFMRFHPASGVWELFIPGLSADMCYKFAITTLSGEVLDKADPFAFKMQQAPGTA
FT                   SILQYKPAPILLSEQAIINRQKRNHIDAAISIYEVHLGSWQRAEHNRYLSYTELADKLV
FT                   GYVIEMGFTHLQLMPISEYPFDGSWGYQPVGLFAPTSRFGDYNSFKYLVEQCHKANIGI
FT                   LLDWVPGHFPSDPHGLHCFDGTHLYEHADMRQGFHPDWNTYIYNYDRPEVKSFLISNAM
FT                   YWLSQFGIDGLRVDAVASMLYLDYSRKEGQWVANCYGGRENLGAIECLKQVNLRSYKNN
FT                   PGIMMVAEESTAWPGVTQSVEHNGLGFGYKWNMGWMNDSLDYMQQDPLFRKYHHHKMTF
FT                   SMVYAFSENYILPLSHDEVVHGKGSLLNKMPGDDWQQFANLRAYYAFMWAHPGKKLLFM
FT                   GAEIAQRKEWDHDHSLDWHLLEHQSHQGIQHTVKRLNQVYQAHPSLYELDSCATGFSWI
FT                   DNNNSQQSMFSFIRYAKNADHFMVIVANFTPTAYQHYTLGVPAKGTYKVVLNTDEVCFF
FT                   GSGYRVTEDKNQLIHSVVQPSHGFDHSITVNIGGLTTLYLEKVNDE"
FT   gene            560105..562168
FT                   /locus_tag="PSM_B0511"
FT   CDS_pept        560105..562168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0511"
FT                   /product="glycogen operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70548"
FT                   /protein_id="ADT70548.1"
FT                   /translation="MSNCFEVTQGAPLPLGSSVQNQGVNFALYAPNASQAFVCLFDKSG
FT                   HTEILKIAMNINEGGVWSIHIAPLSTGALYGFRVDGEYSPEKGMLFNEHKLLIDPYAKD
FT                   LFNEFTWSERHYGQMPIGTKSVVNNAIDMPKSKVTAPVAYSNNKPQHSWANTVIYECHV
FT                   KGATCRHPDIPKALQGTFLGLSHPSFIEHLKSLGVTAIELLPVHAFISEQFLTAKGLQN
FT                   YWGYNSLNFFTPHKDYLVNDDINEFKQMVSELHRANIEVILDVVYNHTAEGGNDGPILS
FT                   LRGLDNLTYYRTIEGQPNVYINDTGCGNTLNIDHPKTLQLVLDSLRYWVEVMGVDGFRF
FT                   DLATILARSNTGFSASHTFLQAIAQDPVLNKVKLISEPWDIGPGGYQLGAFPSPWREWN
FT                   DQYRDVIKRFWQSEKGIISDVAKRLHGSFDIFEHSNRGPLNSINFITSHDGFTLADLVS
FT                   YEQKHNQANGENNQDGHSANYSFNCGIEGFTSDPEVMSLRLQQQKNFLLTLLLSKGVPM
FT                   IAAGSEMAHSQGGNNNAYCQNNRTSWLAWKDSQLNHSLIQFIDDALKIRRGHSAFKHSV
FT                   FLDDIDERFTVKWFTEQGKKMDETHWHEDTRQFLMYSLLDKQNKHALLIILNASKQPVV
FT                   CQLPQSPIIAPWTLVLSSVNNASSVIQEDATVNISAQSSWVFSANLEGDDYD"
FT   gene            562161..564686
FT                   /locus_tag="PSM_B0512"
FT   CDS_pept        562161..564686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0512"
FT                   /product="Phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70549"
FT                   /protein_id="ADT70549.1"
FT                   /translation="MTKQDEQVCVVKGWQAGPVIDESTLSDDLTRHFYYTLGRDVVGES
FT                   QLYLYHALALTIRDRLVARCRETNQQIKQQKRRKTAYLSLEFLMGRALGNAVLNLDLES
FT                   QVTKALQAYCTELESVEQAEHDAGLGNGGLGRLAACFLDSCASLALPVVGYGIRYEYGM
FT                   FNQSIKEGNQVEQPDNWLREGHPWELSAPEQAKRVKFSGYVQSYTDKFGREHRQWISSQ
FT                   DVLAVPYDVPIPGYKNNIVNTLRLWKSEATDEFNLTEFNAGSYSEAVAQKNLAEQITMV
FT                   LYPNDSSENGKELRLRQQYFLSSASIQDVLTQWIEQYGNDFTEFAQHHVFQLNDTHPSI
FT                   AVAELMRILVDDHELDWDQAWNITTKTMAYTNHTLLPEALEKWSVSLFAKLLPRILEII
FT                   YEINARFLAEVAMHWPGDVQKQRDLSLIEEGGEPQIRMAFLAIVGSYSVNGVAALHTQL
FT                   LTAGLFKDFYALWPDKFNNKTNGVTPRRWLAYCNPSLSQIISEKIGKDWIGDFAQISQL
FT                   RRYYDDPQFHIKWQQAKQQNKQRLVDLVKQRCGVEFDINMLFDVQVKRIHEYKRQLLNI
FT                   LHVIHLYDRIRRGDTQGMVPRCVLLGGKAAPGYMMAKKIIKLINNVAEVINKDPQVSAF
FT                   LRVAFLPNYNVTAMETICPATDLSEQVSTAGKEASGTGNMKFMMNGALTIGTLDGANIE
FT                   IRDAVGAENFFLFGAQAEHIDDIKAHYNPSEIIANNPDLNSVMHLLESGHFNLFEPGLF
FT                   DDVINGIKGNNDPWLTAHDFASYIAAQRDVDKAYADQTYWTQMSILNTAASGSFSSDRT
FT                   ISQYCDDIWHLTPLDTTHQTVKTNTDTNS"
FT   gene            564707..565981
FT                   /locus_tag="PSM_B0513"
FT   CDS_pept        564707..565981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0513"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70550"
FT                   /protein_id="ADT70550.1"
FT                   /translation="MPSYANRYISNLTRETYALILAGGRGSRLHELTDWRAKPAVYFGG
FT                   KHRIIDFPLSNCINSGVRRVGIATQYKSHSLIRHVNRAWGHFKKELGESVEILPASQRH
FT                   GDEWYCGTADAVFQNMDIIRHELPKYVMILSGDHVYRMDYGGLLAKHVENGADMTVCCL
FT                   EVPVEEAAGTFGVMTVDEESRVRRFDEKPAEPSSVPGKPGTCLASMGNYVFNTEFLFEQ
FT                   LQKDAQTEGSGRDFGHDIIPAIIEEHNVFAYPFRDPAQVGQPYWRDVGTLDSFWEANME
FT                   LVMPEPQLDLYDPTWPIWTYQEQLPPAKFIFDDDDRRGMAVDSTVSGGCIVSGSLVRKS
FT                   LLFSNVHIRSYCTIEESVILPGAIVNRGCKIKRAIIDRSCEIPPGLEIGFDRKTDEANG
FT                   FRVSKKGIVLVTRDMLMKLDNKSHR"
FT   gene            566040..567572
FT                   /locus_tag="PSM_B0514"
FT   CDS_pept        566040..567572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0514"
FT                   /product="Starch (glycogen) synthase"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70551"
FT                   /protein_id="ADT70551.1"
FT                   /translation="MHVLMVAAENDALPNAKVGGVADVIRDVPKALVAQGLTVDVVIPD
FT                   YGFELGERCFIGEVSVAFKSETHVLSLFEIPQNQKGVRQIVISHPLFSQSLSVYCNDND
FT                   NRPFATDATKFALFNAAICEALIQGVLTQPNTLHLHDWHIACVAVLLKFNPRYGKLAKL
FT                   RLVYTVHNLALQGIRPFKGDDSSLEAWFPSLSYDGQRLCDPRYPHCFNPMRSAINLADK
FT                   VHVVSPSYSQEVQIASNDAHGFFGGEGLERDLQQAAEQGKLIGILNGCDYAIQDEHEAT
FT                   YSQLLEQIESTLFSWMAKSAQLHSSHYIAHQRVLQFMACDKQGPLVTSVGRLTEQKVLL
FT                   LCQQQSKDLTIDSVCQIINQFKGRLLVLGSGDSKLEHLFTCAMARNNNFLFLKGYGQGV
FT                   GDLMYQLGDLFLMPSSFEPCGISQMLAMRAGQPCLVHSVGGLKDTVEHNVSGFCFNGDT
FT                   LSTQADALLQSLTEALSLYQTNPKQWQAIKRRAADARFSWDSVVTDYITYLY"
FT   gene            567656..568870
FT                   /locus_tag="PSM_B0515"
FT   CDS_pept        567656..568870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70552"
FT                   /protein_id="ADT70552.1"
FT                   /translation="MSVFVARQAILNRNQNVVAYELLFRDSPENCFPGVSDGQATARLI
FT                   MENQLNLGTRHITSGKKALINIGPESLKLDLCDFLPCKDVVIELLETIEPTDDTYELCR
FT                   KLFHSNYKLALDDFVYTPQWERFLKLVNLIKFDIRLTPLAEIPLVVNKLKKHKNIKLLA
FT                   EKIETDEEYKLARKMGFDYFQGYYFARPVMIEQKDIHYNYGLVIAIYSEVMKPDPDVKV
FT                   ITGLFELDAALAYKLLRLLNSGVFPLQSQISSLKQALVYLGQARLKKFVSLIVTAHTAR
FT                   SKPIELMQMCVIRARFCELIAAKVAKQVQGEAFLTGLFSLLDAILDKPMDLLVDKLPFP
FT                   EDIKAALTGEKNNLYYILETVKAYETGSWWALEKAVLLINLDSAFLPKLYKQAVQWADS
FT                   YKDNI"
FT   gene            568898..569983
FT                   /locus_tag="PSM_B0516"
FT   CDS_pept        568898..569983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0516"
FT                   /product="putative unknown integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70553"
FT                   /protein_id="ADT70553.1"
FT                   /translation="MDFIRGIAVLGLVFINCFSFAIFELNYTPLTTPPPSDQFLNILSL
FT                   IFFEGRFRTLFTLLFGAGLYIQYQRYQCTEPLKKRLHWLIVFGLIHGFLLWAGDILFLY
FT                   GVSGLFILRYLDYTNEELKNKAALFTFISLMTIAIFMLGLNETPLYRDSPEYYEIYTSY
FT                   YQSIGAHFSQNIAMSAYMLLAVPILLLWASAGFMLIGILAYKYGVFSKGLSKALLIKLI
FT                   LLSALFISLRLMLVPYNQGIGYALQEPVNELAALCVALLYIHLIVKLCDNSAHIGGLIQ
FT                   QVGRLAFTLYISQTIMQLLLFKVFFPQWTLGFNRLDYWLLAISLVIVQLIFTAIYCRYF
FT                   KQGPLEYLWRKLAKINREKIA"
FT   gene            570027..571016
FT                   /locus_tag="PSM_B0517"
FT   CDS_pept        570027..571016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0517"
FT                   /product="putative ribosomal RNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70554"
FT                   /protein_id="ADT70554.1"
FT                   /translation="MTDLKRLNKFISETGFCSRREADKYIEQGRVTVNGELPEMGVKVA
FT                   QSDVVLVDGKQLKAPPKRVYIAYNKPVGITCTTERKIQSNIVKAVNYPERIFPIGRLDR
FT                   PSEGLIFLTNEGDIVNKILRAGNNHEKEYVVTVDKPLNRQFVNKMANGIPILDTVTKKC
FT                   KVTQTGAQQFSIILTQGLNRQIRRMCEYLGYEVVTLKRVRIMNVTLKGLKVGQWRHLSD
FT                   AEMAVINDSIADSGKTQEHSLYDDTEQRKYTEQDKNSGAKSAHKRDFQGGKLRRENNDE
FT                   QQKHAKKNSRNTPYQKRSTTYVGKSNTHKANTATGNKTRSSGTLSLKK"
FT   gene            complement(571074..574139)
FT                   /locus_tag="PSM_B0518"
FT   CDS_pept        complement(571074..574139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0518"
FT                   /product="AcrB/AcrD/AcrF family metabolite exporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70555"
FT                   /protein_id="ADT70555.1"
FT                   /translation="MGFAQLSIEKKVISWMFTLLLLIGGSVSYFDLGQLEDPEFTLKKA
FT                   MVITLYPGASPQQVEEEVTFPIENAIQQLPYVDYVTSISSNGKSQITVEMKSTYRKQEL
FT                   RQIWDEMRRKINDLSPSLPSGVYPSNVIDDFADVYGVMFAVTGDGYSYDELKDYVDYLK
FT                   RELVLVKGVSKVTIAGQQQPQVMVEVSTQKLAQLGIAPSHIYDLLQSQNTVSNAGRIRV
FT                   GDESIRLHPTGEFKDVKELETLLISKSGASELIYLGDVAKVYREYAEVPTNVIHYNQQQ
FT                   ALLIGVSFMSGVNVVDVGKHIDEHLASLEYQRPHGIDISSVYNQPKEVEQSVDGFIVSL
FT                   IEAIAIVIVVLLIFMGFKSGVLIGGILLLTVLGTFIFMKLFAIDLQRISLGALIIALGM
FT                   LVDNAIVVTEGILINLKRGQTKLKAAVNIVDQTKWPLLGATVIAITAFAPIGLSSDASG
FT                   EFAGSLFWVLFISLLLSWITAITLTPFFAHLMFKETEFKHEHNQEHEDPYQGIIFNGYK
FT                   AILNLAMRFRKTTLVLMVALLCSAVVGFGAVKQSFFPASNTPMFYVDYWQDQGADIRAT
FT                   LEGIKQLEAYLQKNELVTEITSTVGQGAPRFMLTYAPEKSYPAYGQLIIRVTNREAVAK
FT                   VMQKVRDYAKQHPLSAKLKVKPMEIGPSTDAKIEARFSGPDPVVLRQLSSQAKEIIAKD
FT                   DGAFNIRDDWRARTKMIRPQFNEQKARRLGITKFDLDQVLLTSLSGKQVGVYRDGTQLL
FT                   PIIARSPASERLNVDSVHDLQIYSPVLRVFVPVTQVVDEFIVEWEDSLIMRRDRKRTIT
FT                   VMADHDVLGDETPAKLFARVRAEVEAIDLPRGYEMQWGGEFESSSKAKKAIFGSLPLGY
FT                   LAMFAVTVLLFNSVKKPLVIWATVPLAIIGVSAGLLVMNAPFSFMALLGLLSLSGMLIK
FT                   NGIVLVDQINLELSEGKSPYQAVFDSGVSRVRPVAMAAITTILGMIPLLFDVFFQSMAV
FT                   TIMFGLGFATILTLIVVPVLYTVVFRIDYPKQ"
FT   gene            complement(574142..575224)
FT                   /locus_tag="PSM_B0519"
FT   CDS_pept        complement(574142..575224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0519"
FT                   /product="putative multidrug resistance protein (substrate
FT                   binding lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70556"
FT                   /protein_id="ADT70556.1"
FT                   /translation="MPLFRLCLLSATLLSLIGCSEPEKIVKEEPIRPVKLFSIGHDSQT
FT                   NIRSFPAEVVANQGSYLAFRVNGELVEFPVLAGEQVKKGQLLAKLDPEDFQLQYNERKA
FT                   RYELAKSQLKRIKQLFDKNITSQSELDQAVANEQVAESAFKIAETNLEYSELRAPFAGI
FT                   VAKVFVKNFESIQAKQNVLRLETRDFMDVAIQVPEKIVARIQKDTQYQPMVEFDGYHDK
FT                   QYKLTLKEWDTQADPATLTYKVVFSLPVPEDFNLLAGMSGQVMIDLSKVTRSQTPYTIL
FT                   PIESVFSDPNKSLSDNAYVWVFNQQTGTVHKQAVQVGQLHHDTIEVLSGVKEGQQIVSA
FT                   GVHSLQEGMSVRPWNKERGL"
FT   gene            575347..576249
FT                   /locus_tag="PSM_B0520"
FT   CDS_pept        575347..576249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0520"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70557"
FT                   /protein_id="ADT70557.1"
FT                   /translation="MKLNQLQILDAIVQSASLSGAALKLHKTQPALTLAIKNLEAKLGF
FT                   DLLDRSKYRLQLTEKGRIFHREAKQLLNANEQLTQLATELALGNEAQYRVCYEQICHVQ
FT                   SYNEIISNTFKHFSSTEFRLTSGKRFVSLEQVNTGQAELGIGPWFDLFHATGDLESLPI
FT                   GKLDIGIVGAKGILPKQLTYDELQLYPCLAMFESGLSIDSDRLSYSKGAAVMKIDDIST
FT                   LKSFLLSGAGWAMMSLGHCKKEITAGSLQQIIVTDREHQFSAQIRAFRQHAMHHGPVAR
FT                   KIWQQFELLSQEYLNNNGR"
FT   gene            576239..576544
FT                   /locus_tag="PSM_B0521"
FT   CDS_pept        576239..576544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70558"
FT                   /protein_id="ADT70558.1"
FT                   /translation="MDVNKETVIYTIIASIPSGCVASYGQVAALAGYPNNARLVGRLLK
FT                   EMPKDSTIPWHRVVNSQGKIAFAQGSALYQTQREKLLSEGVTFNNQRINMAKHRWQ"
FT   gene            complement(576546..579518)
FT                   /locus_tag="PSM_B0522"
FT   CDS_pept        complement(576546..579518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0522"
FT                   /product="sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70559"
FT                   /protein_id="ADT70559.1"
FT                   /translation="MLITLLISTLASVYSISLLDQYIYQQKQNSIRKVAGSYVNHIRNN
FT                   LNQALSAAYPIAALIRTQNGETKGFEELASEMLSLYPGLDALQLHKNGILTHVVPLKGN
FT                   ESAIGNNVLENPLRTQEAFLAKKTGKLTLAGPFELFQGGMGAAARLPVYLDTSQGNQFW
FT                   GFATALIRFPDILQGVNLAQLPQAGIGYELSKVMPDTNDVQIIATSDNQITKNTVDFNI
FT                   QVPNGVWVFKAYPIMGWQDNSMLLLGIAIAVAFTFLTTLSSYLITRLRASHLKLEKKVE
FT                   QRTHALQNNIKALTDTERRLLLSQKVGGIATWEWDIKTNIIRFSEHGIRLITGNVKQLE
FT                   MTKNEYLASIHPNDRANIVSDINQCIDAAKEYNVDHRIITKRGNVRWFNTKGTLVRDNS
FT                   GSAITMLGVSVDITERKLFEEKLHLSSRVFRDTHEGIIITNADKVIVDVNPAFCHITGY
FT                   SHDEVIGRNPSFLNSGKQTESFYKNIWKQLSLYGHWQGEVWNCKKDGELYAELLNISVL
FT                   KDDNNVTFYLGIFTDITQAKRQQEQLSRIAHYDLLTNLPNRVLLADRLSQTMLQCRRHN
FT                   NSLAVVFLDLDGFKHVNDSHGHDIGDKLLIALSIRLKDALREGDSLARIGGDEFVAVLT
FT                   NLGSVADCVPVLERLLAAAAKPVTVNDIVLNVSASIGVTIYPEDNLDAKQLMRHADQAM
FT                   YIAKQMGKNRYHLFDTSQGDTVKLQQTGISLIREALANNWFVLYYQPKVDMRTGSMIGV
FT                   EALIRVQHPERGLLSPIEFLPVIENNALMIDVGEWVINAALSQINHWQILTPSLNIKVS
FT                   VNVAAVQLQQPEFTARLTELLLAHPQVDARNLELEVLETSALNDVAHVSKTMQDCKALG
FT                   VEFSLDDFGTGYSSLTYLRRLPASLIKIDQSFVRDMLEDSNDLAIVKGVIALANSFKRS
FT                   VIAEGVETPEHAATLMLLGCYLAQGYGIAKPMKAEDIPIWLDEWTADEIWALTDLQKMD
FT                   N"
FT   gene            complement(579779..580408)
FT                   /locus_tag="PSM_B0523"
FT   CDS_pept        complement(579779..580408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0523"
FT                   /product="putative hemolysin III"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70560"
FT                   /protein_id="ADT70560.1"
FT                   /translation="MSVEAPYSKKEELLNVVSHALGILFAAFVIWDLFKQANSVKGYAS
FT                   TVVYGSSLFILFLSSTLYHASVRPKLRAFYKKCDHCAIYMLIAGTYTPFLLLSLSGVWS
FT                   WATLVFIWTVALAGVAYKLLVKNGNKKVSLATYLLMGWFALAIIYPLYSNLPINALYWL
FT                   LTGGLFYSVGTLFYSAKNTQYSHAIWHLFVIGGCVSHYIAITHYVY"
FT   gene            580706..580984
FT                   /locus_tag="PSM_B0524"
FT   CDS_pept        580706..580984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70561"
FT                   /protein_id="ADT70561.1"
FT                   /translation="MKTSINMTLASLLLLGSSQVHATEVDLDITDMLTKTVTTYVSQAT
FT                   HELEQSVKEAVSFDAQAILDGLLQTNPVVDNSGIDEKQLVVKTQQKQ"
FT   gene            581195..581791
FT                   /locus_tag="PSM_B0525"
FT   CDS_pept        581195..581791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70562"
FT                   /protein_id="ADT70562.1"
FT                   /translation="MKEVDFMKRAIFPLPIFILPEGYTRLRIFEPRYLTMVKNALKTNS
FT                   GFVLCTFEHDTPFNISAQGCLMDIIDFDQDESGMLLIDVFASKSVQLDNVYQDEQELRH
FT                   GEVSACNTPYWYNSSNHDIGEHQLLQVALEEVFSNNPQLQSLYKHTQFNQLTWVVARWL
FT                   ELLPISIEKKQQLAFETNFDNLLNFLHTVINNEFA"
FT   gene            581862..582485
FT                   /gene="sigY"
FT                   /locus_tag="PSM_B0526"
FT   CDS_pept        581862..582485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigY"
FT                   /locus_tag="PSM_B0526"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70563"
FT                   /protein_id="ADT70563.1"
FT                   /translation="MVSQQQTLRCEPNTGKYTAMPETPSTELREALVNVAQSRDKKSFA
FT                   YLFEYFAPKIKRFGIKQFGVEAQAMELVQETLTSVWRKAHLYNSDKGAATTWVYTVMRN
FT                   ASFDMLRKMKSNKEENISEDIWPLLNESEDTHHEYSDHLEDKQIKRYLDKLPQAQREVV
FT                   RGVYFQDMSQEQLAQQLNIPVGTVKSRLRLALQKLRNEMGDQHD"
FT   gene            582478..583143
FT                   /locus_tag="PSM_B0527"
FT   CDS_pept        582478..583143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0527"
FT                   /product="putative transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70564"
FT                   /protein_id="ADT70564.1"
FT                   /translation="MIKHHPSETLLTQYCAATLPASLSLAVSIHVDMCPICQAEVEKLE
FT                   ASNAKAVFSDNMNVNNDEQSDDIADSGLLELITSDDSIDEVYAVEPVTIEVNDYNYSLP
FT                   RALTRISHSKFTQVGKLARSRIALDDGHLRSSLLHIDAGGEIPEHTHTGFEVTLLLDGE
FT                   FTDEEGSYVPGDFIWQDGRHQHTPLTKEGCLCFTVVSSALHFNKGLSKLLNPIGSLIY"
FT   gene            583152..584105
FT                   /locus_tag="PSM_B0528"
FT   CDS_pept        583152..584105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70565"
FT                   /protein_id="ADT70565.1"
FT                   /translation="MQTDTIKIGISACLAGEKVRFDSGHKKSNFCMEELAKHVEYKMYC
FT                   PEVAVGLPIPRPTIRQVRTADTIKVCRPDGTGDVGPQLTEYGKKIATEQAGHLSGFVFC
FT                   AKSPSCGMERVKIYNEAGTGNTSEGIGFFAEQIMKHNPLLPCEENGRLNDVHLRENFVM
FT                   RVYTLYNWQQLVKEPITVHRLTQFHAQYKYLLMAHNYQAYRDLGHLLGTYLGDDINALA
FT                   DEYILGLMTALKRPASRKNNSNTLMHLQGYFKRDLSKIEKEEMRDAIDEYRQGLVPLYV
FT                   PLTLLKHHLKVHPNEYLSKQIYFNPYPNELKLRYGL"
FT   gene            584105..585499
FT                   /locus_tag="PSM_B0529"
FT   CDS_pept        584105..585499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0529"
FT                   /product="putative deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70566"
FT                   /protein_id="ADT70566.1"
FT                   /translation="MNTLFWFRRDLRLFSNEALIEALNNGAKHTIFFVCEKQWAQHNTA
FT                   PIQIDLLKRRVSYIREKLAEYGINLHVIEAPYFTDCQTKLLDFCQQYEIKHIIANKEYE
FT                   LNEFNRDKAIQAQCDQQQITFTLYEGDIIAPVGSVRTQNNEMYKVFTPFKRAWLKQYQD
FT                   THFSLVSWPLSSNPIDIESCELLSSDDSSKKWPVDDDTLASVVDNFIHDKLASYDDVRD
FT                   IPSVKGTSGLSPYLALGVVSSKQLMVNIQQQYPDILTTSKSKTFTWVNELIWREFYKHL
FT                   IAEFPKLSRGANFNEKYDSVAWRDNEAEFKLWCEGRTGYPLVDAAMQQLLQTGWMHNRL
FT                   RMVVASFLTKHLLIDWRKGEQFFMQHLIDGDLASNNGGWQWAASTGCDAQPYFRVFNPI
FT                   TQSERFDPSGQFIRKYLPELEKVPDKHIHFPHTYLAATGQSEHCYWPAIVDHKAARARA
FT                   LDAFKV"
FT   gene            585501..585929
FT                   /locus_tag="PSM_B0530"
FT   CDS_pept        585501..585929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70567"
FT                   /protein_id="ADT70567.1"
FT                   /translation="MDNQLSVDKFVEIYQKLDKNNLELLTEIYAKNIQFIDPLHEINGL
FT                   EDLRRYFCGLYSNVKDCRFDITDSFTNDNNAFVYWTMYYSHPKLNAGKTITVQGHSKLV
FT                   FEGDKIVKHRDYFNAGELLYKHIPLLGNIINFIDKRAG"
FT   gene            585932..586642
FT                   /locus_tag="PSM_B0531"
FT   CDS_pept        585932..586642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70568"
FT                   /protein_id="ADT70568.1"
FT                   /translation="MITLITGATSGIGEQLAIKYAEQGDTVIACGRNTQKLAELAKHNN
FT                   IETCQFDATNLQDIKAATLGYTQFDRVILNAGNCEYVDDARNFDSALFERVINVNLLSM
FT                   GYCLEALLPKIVSGGQLVMVSSSVTYLPLPRSEAYGASKAGVSYLAKSLAVDLTDVDVT
FT                   LVHPGFVKTPLTDKNDFPMPMAVTAEKAADYIIKGVAKRRKEVHFPYRFTLILKALRIL
FT                   PLSLWLKIAKGLTR"
FT   gene            586639..587892
FT                   /locus_tag="PSM_B0532"
FT   CDS_pept        586639..587892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70569"
FT                   /protein_id="ADT70569.1"
FT                   /translation="MKKIAIIGTGVSGLTCGHLLHKHYDVTLFEKNDYIGGHTATVDVE
FT                   HSGINYAVDTGFIVFNDRTYPYFEKLLERIGVKRKPTQMSFSVHNEATGFEYNGHTFSS
FT                   LFAQRRNIVRPKFWRLLYDIVRFNKLCKALHAKGHYTEQSLGQLLQQHGFNDFFKYHYI
FT                   LPMGAAIWSTSIKEMENVGVEFFVKFFFNHGLLDITNRPQWYVIPGGSREYIKPLIAGF
FT                   ADNIKLNSHIKSVTRNAEGVTITFADDQQAQFDKVIFACHSDQALALLGDPCEQETTVL
FT                   GAIPYTENSVVLHTDESLLPDRKAAWASWNYLLNNNTDKAAVVTYQMNILQGIESDTQF
FT                   CVTLNHLEGINQSKILREFTYHHPVFNQESIAAQQQKHTVDGQNNTYFCGAYWYNGFHE
FT                   DGVRSAVDVAKQLGVEFD"
FT   gene            587885..588622
FT                   /locus_tag="PSM_B0533"
FT   CDS_pept        587885..588622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70570"
FT                   /protein_id="ADT70570.1"
FT                   /translation="MTNAVYLGDVKHRRFAVKHHAFSYPLYMMWVDLNNIEALNGVHKQ
FT                   LGTTGFKALKFKQSDYLKGLANTDNKPIVERAHAQLAALGVTEKFSHVYMLGQLRCLGI
FT                   YFSPVNFYFFGHDDNQFSYMVAEVSNTPWNERHYYLVPLQKKVNFKKVFSVSPFMNLDM
FT                   NYHWTVRQKQDNILIRIENKRDDELLFDASLRLQRQTLCTAQMSKLLKRFPAMTWSIFK
FT                   GIYYQAFKLFVKKVPFLGHSGRS"
FT   gene            588677..589939
FT                   /locus_tag="PSM_B0534"
FT   CDS_pept        588677..589939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0534"
FT                   /product="putative cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70571"
FT                   /protein_id="ADT70571.1"
FT                   /translation="MEKVSSLRVQERTSWFTNLYKKLVFKAFSSIETGQIVLVDNNQQS
FT                   VFGDTSSELKVTVTVNDTAMYKAFALSGSIGAGESYILGQWQCDNLTRLIEIFAINQDQ
FT                   LDAFEKKFAFFSNIAHRINHIKNKNSHSGSKKNIVAHYDLGNDLYESFLSKEMLYSSAV
FT                   YPSKDATLEQAQQYKLQRICEQVELQQGDIVIEIGTGWGAFAIYAATHYDCHVTTTTIS
FT                   DEQHDYVANKIKELGLENKITLLKQDYRLLTGKYDKLVSIEMIEAVGHEYLPSFFTQCG
FT                   QLLKDDGAMLIQAITISDQRYQHYLKNSDFIQQYIFPGGCLPSLNEMSEQIKNHTDMNI
FT                   HTVSDIGAHYARTLADWRDRFIASWPNLDSNKFDERFYRLWLFYFAYCEGAFRTRATST
FT                   VHLMARKPRFTSSNDEIALAY"
FT   gene            589917..590417
FT                   /locus_tag="PSM_B0535"
FT   CDS_pept        589917..590417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70572"
FT                   /protein_id="ADT70572.1"
FT                   /translation="MRLHSLINFVLFQVVWFLCLLLEQHSIVYSTVVIALMFYLSAQKK
FT                   QDAFLLLKCLPLALLSEFIAVKFGLIEFKVAPFPLWLVFLWAALLLCINTSMSFLTTIK
FT                   PWQAFIVCLVFAPGSYWAGARFDVLELGLPLWQFWPLYGALWAATFSVILFINGKIGAF
FT                   IKQ"
FT   gene            590448..590936
FT                   /locus_tag="PSM_B0536"
FT   CDS_pept        590448..590936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70573"
FT                   /protein_id="ADT70573.1"
FT                   /translation="MKTLLNLVLIYALFNHAAYADTQFNKVGEARMEYLFWDVYDATLF
FT                   TPSGSYSPKQTPVKFTLTYLRDFDAKDIVKATKEQWQHLGKSQLSARYADKLLAIWPDI
FT                   KKGESLTLLTDQQGHSIFFHNDNEIGRIEDTTFADDFLAIWLSENTSEPSIRNQLLGI"
FT   gene            590938..591477
FT                   /locus_tag="PSM_B0537"
FT   CDS_pept        590938..591477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70574"
FT                   /protein_id="ADT70574.1"
FT                   /translation="MINLKRIKVTLLLVVSFFIASCSAPSVEHYKGSEPNFDFKTFFSG
FT                   DLKAYGVVQDFKGELTRKLVVDLSATWDGNQGVIEEDFVYDDGETQKRIWKITLNDDNT
FT                   LTGTASDVLGTATGKSEGSVFHWNYNVEIPYDGSTFEVNFDDWMYLVTNTRLINRTSIV
FT                   KFGVEVGEVTLVIEKI"
FT   gene            591686..591961
FT                   /gene="hupB"
FT                   /locus_tag="PSM_B0538"
FT   CDS_pept        591686..591961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="PSM_B0538"
FT                   /product="DNA-binding protein HU-beta (NS1) (HU-1)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70575"
FT                   /protein_id="ADT70575.1"
FT                   /translation="MNKAQLVEKISTDAEISKAAATRALDAFTGAVTSSLKEGNSVALV
FT                   GFGTFSVKERAARTGRNPQTGAEIQISAATIPSFKPGKGLKDQVNL"
FT   gene            complement(592027..592527)
FT                   /gene="ilvH"
FT                   /locus_tag="PSM_B0539"
FT   CDS_pept        complement(592027..592527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="PSM_B0539"
FT                   /product="acetolactate synthase 3 regulatory subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70576"
FT                   /protein_id="ADT70576.1"
FT                   /translation="MRRILSILLENEPGALSRIVGLFSQRAYNIDSLTVGTTDDESLSR
FT                   ITVTTKGDDRIVEQITKQVNKLVDVLKVIDLTEMSHIERELLLVKVFAQDEATRAAVTR
FT                   VVDVFQGAILDMGRQSYSLQLVSSTDKIESFLDTLRHETDIIEVVRSGAVGIGRGDKAL
FT                   KAK"
FT   gene            complement(592527..594251)
FT                   /gene="ilvI"
FT                   /locus_tag="PSM_B0540"
FT   CDS_pept        complement(592527..594251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="PSM_B0540"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70577"
FT                   /protein_id="ADT70577.1"
FT                   /translation="MSKQEYNGSELVVKSLKELNVKYIFGYPGGSVLDLYDALFQQDDI
FT                   EHILVRHEQAATHMADGYARATGEVGVVLATSGPGATNCVTGIATAYMDSIPMVVLSGQ
FT                   VPTNLIGDDAFQETDIVGCSRPIVKHSFNCRSASEIPNILAKAFYIASSGRPGPVVVEL
FT                   PKDMLNPELTFAYNFPAATELRTYNPNTKGHSKQIRKAVTAILEAKKLVIYSGGGIVLS
FT                   NTSEQLTHLVESLNAPITNTLMGLGGISGIHPNFIGMLGMHGTLEANKAMANADVILAL
FT                   GARFDDRVTNNVQKFCPNATIVHVDVDPTSISKTIKAHIPVVGCLATVLEQLQTAIDKS
FT                   PIKIDRSAQEDWWRQVISWREQKCLNYNTDGDKIKPQAVIEAIYKATNGDAYVSSDVGQ
FT                   HQMFAAQYYPFKHPRQWINSGGLGTMGFGLPAAMGVKLAFPDKESLCVTGDGSIQMNIQ
FT                   ELSTCLQYNLAVKVISLNNRSLGMVRQWQDMIYGGRHSSSYMESLPDFVKLVESYGHVG
FT                   IRVNTLDELQPAIDKAMSITDRLVFLDILVDEKEHVYPMQIKHGGIDEMWLRKGVKA"
FT   gene            complement(594713..595720)
FT                   /locus_tag="PSM_B0541"
FT   CDS_pept        complement(594713..595720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0541"
FT                   /product="isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70578"
FT                   /protein_id="ADT70578.1"
FT                   /translation="MAKQTITVIKGDGIGPSIIDSALEILKAAGCDFDYEFVDAGLAAL
FT                   EKTGELLPQETIDTIAKNKITLKGPLTTPVGEGFTSINVTLRKQFGLYANVRPVKSFAG
FT                   TKARYDDIDIITVRENTQGMYSGAGQVVSADGNEAEAMSVITREGAEKIVTFAYELAVR
FT                   EGRKKVTAVHKANILKSTSGLFLKVAREVAERYPEIESTEMIVDATCMKLVMTPEEFDV
FT                   IVTTNLFGDILSDLCAGLVGGLGMAPGANIGEDAAIFEAVHGSAPDIAGKNLANPTSVI
FT                   LASIQMLEHLNMGDTAERIRSAVADVIKSGDRTTRDLGGSHGTTDFTQSVIDRL"
FT   gene            complement(595900..597582)
FT                   /locus_tag="PSM_B0542"
FT   CDS_pept        complement(595900..597582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70579"
FT                   /protein_id="ADT70579.1"
FT                   /translation="MEAPLSGNLKKLLESTQLLLGSHNNKNQWHTFYPIVCKLAEQYAA
FT                   LYKQNPAALQAQLNLYKTHYSFATNLVVNQCVLTCALSASQNYDKHLTELYISVSLVEH
FT                   LCVANQLNKLAQQQTFTNTDTKMWQLRHKLAAKVILTSQQPAHQIAHILAKLAKYKHAL
FT                   LNTPKVMLYDGASVLVALANILALNVTCNAKQQHISFYKAVADLYIRTPNSFAQRLLKD
FT                   LVAHVGQYVPGSQVVYADQTMIYLATDSAGRHIIVNNANSKMAWYRIKASLEDGSKAWP
FT                   CNDDRLFLKVWDSEYLHIVHKSDDTQSSLYELVKQIKNQQEYSYKALSTLLTPYPNVIK
FT                   SVCHAVKQYNKELQPAKDLRHSLSMVGYDKAPAIIQGMVFEQLVNSIAHPLHTFLCTRM
FT                   GCLINIVELLVKHDKNLQSERISLSLYAYLYYLLINYSPEVSRKITLDQTPNKSLDTPI
FT                   CTFFGINNVDTPHLTNELNELLSSDPWAIALLKAETLPKKQLDDSAKLWAALKVVAQRV
FT                   LKPNQPLTAWQQQILNQQLTRHGWKSEAIFYQSLQQLGLHNSI"
FT   gene            complement(597582..597947)
FT                   /locus_tag="PSM_B0543"
FT   CDS_pept        complement(597582..597947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70580"
FT                   /protein_id="ADT70580.1"
FT                   /translation="MGLGLYALIATSVIMFYKDDPQAMIWQDREAFNKRYIEKLRLEDS
FT                   FTLNAVLEYLGSPDLTYAKRDGEQVWQVIFYRTQHKTSDGITTMDECTGLLFKNGQLIM
FT                   WGPSAYEKYLEQNDGTI"
FT   gene            complement(598047..598820)
FT                   /locus_tag="PSM_B0544"
FT   CDS_pept        complement(598047..598820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0544"
FT                   /product="exonuclease IX"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70581"
FT                   /protein_id="ADT70581.1"
FT                   /translation="MNPHLLLIDALNLIRRIYAVDANQTHHSDEHMLKACCARVAHACK
FT                   KLITTTNATHAIAVFDGDKSWRYHFYKDYKHSRAPMPQTLKEALPHFKAAIEETGIVVF
FT                   EPTNDEADDIIATLAHKAANNQINNTIVSTDKGFLPHLNEQIEVYDYFKKQQLTQQHIQ
FT                   ERFGVAQHKLIDFWALAGDKTNDIPGVKGIGVKSAQQLVNQYNTLEEALSDESLSARLQ
FT                   KKLADDMDMFVISKQLVSLRTDIHLGFSLKQLRLN"
FT   gene            complement(598829..600172)
FT                   /locus_tag="PSM_B0545"
FT   CDS_pept        complement(598829..600172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70582"
FT                   /protein_id="ADT70582.1"
FT                   /translation="MLIQLNPTGVLDLLSQLEVDLLEQSSTSERYRLFRNCVLAVLNVG
FT                   SHTDVSNDIYEKHKDFDIRLVSRERGIKIELENPPQTAFVDGHIVTGIHEHIFSVIRDI
FT                   LFICQKYEKNLQETKAITHMVFDMLRNADALKVNSEPNMIVCWGGHSINEIEYKYTKQV
FT                   GYELGLRGLNICTGCGPGAMKGPMKGATIGHAKQRITNNRYLGLTEPSIIAAEPPNPIV
FT                   NELVILPDIEKRLEAFVRTAHAIIIFPGGAGTAEELLYLLGILLHPENEKQCLPVILTG
FT                   PKQSEAYFEELCQFIQMTLGDAALDKFEVIIDDPQLVSQKLKSAMNGVREYRKSQGDAY
FT                   YFNWTLKIDSDFQQPFYPSHEAMASLDLHLDQPKQQLAANLRRAFSGIVAGNVKEEGLN
FT                   AIKKDGPYVLSGEPDLMKAMDTLLQAFVEQGRMKLPGSKYIPCYTIKA"
FT   gene            complement(600250..601758)
FT                   /locus_tag="PSM_B0546"
FT   CDS_pept        complement(600250..601758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70583"
FT                   /protein_id="ADT70583.1"
FT                   /translation="MEQKLKQAIDSRKVIESARKHQVDTLSNFAAKLSLSCKGLDIELD
FT                   NRLAKFRSALNKGMDFEDFSPLVDDILALLKNQEAIQLAHQRDLLTSVQNAGKQLQQTK
FT                   GLPDETRRTLRHLLDNQLDDIQSVHGFIPILNQLITFYHQALIAKSNNTFEPPNLSVLT
FT                   EKLFKLVSELVLEEEANESLYLIKKRIAKNKAVDQLLDAAIDVITLIVKSIHVERESAQ
FT                   SFLASLNQTLEELHRSLVSTSEHSESMNVEFDSINQRIGEKLESLNTQTKNATSITALK
FT                   QLVENELRSLSADILEKEQLEQKDRRILVASFTQINERINSLENKVSNYKKRLNEQRFK
FT                   SLLDSLTKLPNRAAFDERYNHEINLFNEQPSDITLVVIDVDHFKSINDRFGHTAGDITL
FT                   QVIAKALQKSIRQSDFIARYGGEEFVLLMPRTSLENATAHLNKLRQSIKKIPFKFKDKQ
FT                   IEITVSLGATQFKEGDTPLKAFDRADQALYDAKNSGRDRLCISK"
FT   gene            601984..603774
FT                   /locus_tag="PSM_B0547"
FT   CDS_pept        601984..603774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0547"
FT                   /product="peptidase M61 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70584"
FT                   /protein_id="ADT70584.1"
FT                   /translation="MKKLLALSILAACSAPVFADVNYALNISQPEHHLGDVNVEFPKTA
FT                   QSFLDVKLPAWRTGRYEILNLANGVRYFKASDDEGNALKWEKIDHSTWRVHLNEPTEVN
FT                   IDYQVYANELGKRARHIDDSHAFIDASGFFMFSESFRQEPVTVELNVPKAWRSVSGMEN
FT                   YKNKHSFKASDYDVLVDSPIETGINELRTFEVDGREYELVVWGEGNYDIELMLTDLKKL
FT                   VATGNVIWDSYPYERYVFMVHATSGASGATEHLNSTIIQRPRDRFAKREDYLGFISTAA
FT                   HEFIHTWNVKAYRPKGLAPYDYTNINYSKLLWIAEGSTSYFEDHLLVRSGIQTNDEFFK
FT                   VLSKTINRHLTTPGREVQSASETSFDKWINQGGDHARNYSTNIYLEGSLLSMALDIDLL
FT                   ENSQGKISYRDVHKALYKQHKLPAGFTEQDVLAILKQLSGRDYSAWWQANVSSPANLDF
FT                   DALLAKVGLSLELPEKAKATPSLDALTKNTGELLTLTHVRRDGAAWQGGLTTDDKLVAI
FT                   NKKHVGKDLTASLETFKAGDKVTVDFIRRDALMSTELVLSEDFDKPKKVVANKNATDEQ
FT                   KALFKAWMGVAHPNDVKKDD"
FT   gene            603919..606089
FT                   /pseudo
FT                   /locus_tag="PSM_B0548"
FT                   /note="hypothetical protein"
FT   gene            complement(607090..607983)
FT                   /locus_tag="PSM_B0550"
FT   CDS_pept        complement(607090..607983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0550"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70585"
FT                   /protein_id="ADT70585.1"
FT                   /translation="MKILIVDDSQATLEIVRRGLEKFGYRKLLIEKASNAKSALTLIGS
FT                   WHPDIVLTDWHMPDMCGVTLLRAIKQRQLNIIVAMLTTVDEKSQIEEAISFGASFVLSK
FT                   PFTDAQLHDKLLPLVQLVENNEIIPDEIELNSDLALPKLSQLERLFHKHISQSLIVNTI
FT                   QPQVFDESKVPCVMAVYEDPKSQKVRAIAILDIYAACVMASGYSSLSAEDISNSILSGV
FT                   VTNTALSACKKALTETAFAFLDKRTRVSLQIKTVKVITTPFRKLTLLYKTPAEKRIDFS
FT                   CQLEGMAQGKIMLVGI"
FT   gene            608082..608882
FT                   /locus_tag="PSM_B0551"
FT   CDS_pept        608082..608882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0551"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70586"
FT                   /protein_id="ADT70586.1"
FT                   /translation="MPYAVFPPEVYHYIAINFGLLILAAWFYILLLILREFRAFALSMV
FT                   KSNGTMDDATLAMCRESVDNAMSYVNDNRKTIAELISVQMLLQQQLTEVTSSTKDHVTE
FT                   KEQQLIDDLNKKLKRSHQLIRKLKGDLDKSVEKLKVTRQKLYAQYDAVTVLQEEKDQLQ
FT                   ADYEALKTASENSDKTSSADTSSTPDQTRLLNTLNEYKRQIAEQDQLLQQLQLQTDGPE
FT                   SSEELDTLKQELEKTQYALKHLTKEKKFIEGRYLEMMKNSQKPS"
FT   gene            complement(608916..609050)
FT                   /locus_tag="PSM_B0552"
FT   CDS_pept        complement(608916..609050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70587"
FT                   /protein_id="ADT70587.1"
FT                   /translation="MVNTYLGLTLAQCEIAATGQYMAFLRSLKGLILQIEVNEQKTQA"
FT   gene            complement(609684..609815)
FT                   /locus_tag="PSM_B0553"
FT   CDS_pept        complement(609684..609815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70588"
FT                   /protein_id="ADT70588.1"
FT                   /translation="MYIPIFSKYGLGVILAILGWFFVYYKSSPYILSKDNVALYGSD"
FT   gene            complement(610039..610287)
FT                   /locus_tag="PSM_B0554"
FT   CDS_pept        complement(610039..610287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70589"
FT                   /protein_id="ADT70589.1"
FT                   /translation="MQAPWNGEKVNLFIRSLAIIFIICALIAFSSLLIAFFERGNVSFD
FT                   NLDFRAVFGMLSAPYFFLLFLKVAVTGHAPKSWIPWK"
FT   gene            complement(610367..611218)
FT                   /locus_tag="PSM_B0555"
FT   CDS_pept        complement(610367..611218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70590"
FT                   /protein_id="ADT70590.1"
FT                   /translation="MEYILSILSGGLSGAVLVWLAKGWISERLKQSIQHEYAEKLESYK
FT                   TELNSKVEGIKHENQVSQLRTSLFFDHQRDAFAALITKIAQVNTDWLKHYDPDEGLYEP
FT                   VPFEGYREFKSLLYKHQLFLDEECLMAMSLITSAYTRSFPYDDRSGAPPHQNDSSSHVS
FT                   YIEYLQPRIASIFRSKIGVASDPQHLVDIAVLSAIELVNGYHFLEVDIPPKGNLSTKGI
FT                   NNASDKVALGLKNKDELISLLENFDVYLNRDGGWLHEAQLKVKRTLNVLRKMPNKGIQV
FT                   EK"
FT   gene            611573..612844
FT                   /locus_tag="PSM_B0556"
FT   CDS_pept        611573..612844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0556"
FT                   /product="putative cystathionine gamma-synthase or
FT                   beta-lyase, PLP-dependent"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70591"
FT                   /protein_id="ADT70591.1"
FT                   /translation="MKLESLALHHGYESEATTKSAAVPIYNTSSYTFDNTQHGADLFDL
FT                   KVPGNIYTRIMNPTNAVLEQRIAAMEGGIGALAVASGMAAITYAIQCLCEVGTNIVSTS
FT                   QVYGGTYNLFAHSLPRQGIEARMIKADDFDGFENAIDENTRAVFCESIGNPAGNIVDIA
FT                   RLAKIAHSKGVPLIVDNTVATPYLCRPFELGADIVVHSLTKYINGHGTAIGGMIVDSGK
FT                   FDWKANATRFAMMNEPDPSYHNVVYTDAFAEAAFIGRCRVVPLRNTGAALAPKNASDIL
FT                   IGLETLGLRMDRHCENAQKIAEYLESHPKVLWVNYAGLKSSPYNEISQKITNGKASGIL
FT                   SFGIAGGLEAGTRFIDALNMILRLVNIGDAKSLACHPASTTHRQLNDEELANAGVSRDL
FT                   IRLSVGIENIDDIIADVSQALDKA"
FT   gene            613008..613571
FT                   /locus_tag="PSM_B0557"
FT   CDS_pept        613008..613571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0557"
FT                   /product="Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70592"
FT                   /protein_id="ADT70592.1"
FT                   /translation="MLEHYSEHEIEVIDPLDYDFDPVFKPHFAYSQAEVPKQLDDLAAK
FT                   IKASDGFVMVSPEYNHSMSPALANLLNHFGSSLFGYKPSAIVTYSAGQWGGVRAAVGMR
FT                   SFLSELGCLPVSAMIHVPKAQDVFIESGDANNAAEQTSWDSYFSRTFNQLIWWAEGASK
FT                   QREALDPKRLSKDFKRDPSQRNAP"
FT   gene            complement(613588..613710)
FT                   /locus_tag="PSM_B0558"
FT   CDS_pept        complement(613588..613710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70593"
FT                   /protein_id="ADT70593.1"
FT                   /translation="MNGYCTGCGRTSDEIFDWIILTDEQKQAILASPREDAKKD"
FT   gene            complement(613791..614306)
FT                   /locus_tag="PSM_B0559"
FT   CDS_pept        complement(613791..614306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0559"
FT                   /product="putative orphan lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70594"
FT                   /protein_id="ADT70594.1"
FT                   /translation="MKTYISLVLTGLILSGCSSLTTEQKAKLDNLTPCEKMDGLIAAYD
FT                   NRFEALKDTKVKTPYLDVWSAKYNVFGNNCQVTSFNNQTVTYRCQENYKDQQQAVAMHK
FT                   QAVELTRQCLTKNSNWLETQKESETSLRTTFVLDDRSPVISVYTSKTLSKIKTWSTSLE
FT                   VGKPVATK"
FT   gene            complement(614730..615344)
FT                   /gene="hisI"
FT                   /locus_tag="PSM_B0560"
FT   CDS_pept        complement(614730..615344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="PSM_B0560"
FT                   /product="bifunctional: phosphoribosyl-AMP cyclohydrolase
FT                   (N-terminal); phosphoribosyl-ATP pyrophosphatase
FT                   (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70595"
FT                   /protein_id="ADT70595.1"
FT                   /translation="MLVTQENLTQVDFAKSEMIPAIVQDARSGVILMQGFMNSEALAVT
FT                   LESNKVTFYSRSKSRLWTKGESSENYLNVVSVHTDCDYDSILVLANPEGPTCHLGTQSC
FT                   FGDAAKPSLSFLAQLEDVIVARKNDDPAKSYTASLFAEDLSRSCQKVGEEGVEVALAAM
FT                   KHDNNELTNESADLLYHLIVLLQRQGLELTDAVACLQGRHK"
FT   gene            complement(615338..616114)
FT                   /gene="hisF"
FT                   /locus_tag="PSM_B0561"
FT   CDS_pept        complement(615338..616114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="PSM_B0561"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70596"
FT                   /protein_id="ADT70596.1"
FT                   /translation="MLSKRIIPCLDVKDGQVVKGVKFKGHEVVGDVLTLAKAYSEAGAD
FT                   ELVFYEISASVEKRLLDVNWVENIARHIDIPFCVAGGIKSVADAARVLERGADKISINS
FT                   PAIARPELIKELHDEFGKQCVVVGIDSFYDEKTGEYLVYQLTGDPNASSRTRYKTQEWV
FT                   QRVQDLGAGEIVLNCMNQDGVRNGYDNEQLSKIRELCDIPLIASGGAGTMQDFVDVFKQ
FT                   SKVDGALAASVFHKNVINIGELKQFLIDNQVAARLC"
FT   gene            complement(616410..618392)
FT                   /locus_tag="PSM_B0562"
FT   CDS_pept        complement(616410..618392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0562"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70597"
FT                   /protein_id="ADT70597.1"
FT                   /translation="MPLQRLLILFISLALSEAIIMMLLASFVTKYTGIWFSVILDASLI
FT                   SFIAIITIHYLFNDSDFVKNQQSRTEFLTFKIAMIVFTIEALVMFAFNFDEFVLQQWQV
FT                   IAIDSLILSSLSVPIIYFSIIKPAFLPLQEQNSQKLNTTIFTSLLTYFCSAIILYIALY
FT                   MFYENQIQTRIGSVIQKEKNELKQAKYSFLQQLNHASRDLLILKNNHHFKEQRFFSNEN
FT                   KTLLEQDYFNFITIKNYYTQIRILSLKGQELIRVQRENNSTVIVPPDKLQDKSDRYYYK
FT                   RGIKLSPDDIFISPLDLNIENGQIERPLKPMIRLGSVLVDKNNEKIGLLIINLGGVHLL
FT                   SQLENISKSSLGDIMLFNEESYWLFGDVQKQWAFMFANKPQQRFQDIHPDIWQAMETKT
FT                   NGIIEKDNNIYIFEHMTLLDQVPTLDNPRNSNGKWPKWKLVNKVPLSLIENEFSSLKKL
FT                   IVLLYLGVMLLMIFVIYTFANHTIARREYEAKVESYAFVDSLTGLYNRRIFLDKLDKEL
FT                   NKAQFNESPLVLMYLDLDYFKPINDELGHGAGDEALKEVATRIKSCLRKHDIIARIGGD
FT                   EFAAILPQLNDKDVISEIAQRIITNISKPFILFDQKRTLGISIGITITNGQAHTSLEVK
FT                   THADQALYEAKNSGRNCYRFSKETR"
FT   gene            complement(618477..618611)
FT                   /locus_tag="PSM_B0563"
FT   CDS_pept        complement(618477..618611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70598"
FT                   /protein_id="ADT70598.1"
FT                   /translation="MVKCYEHFDQDSPYFSQKLQNKRTTIMAINALSNYYINIKQQYF"
FT   gene            complement(618631..621690)
FT                   /locus_tag="PSM_B0564"
FT   CDS_pept        complement(618631..621690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0564"
FT                   /product="AcrB/AcrD/AcrF family metabolite exporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70599"
FT                   /protein_id="ADT70599.1"
FT                   /translation="MDLAKWTINNKLISTILIILTLGFGFSSYKNMARFEDPEFIIRTA
FT                   QVFVSYSGASPLEVAKEVTEPLERAIQELQEVDTISSTSSTGLSEIKVEIKSEFSPTKS
FT                   ELQVIWTKLRNKINDTRPTLPPGTGTPKVFDDYGDVYGLSYLITAEGYSPDELHAYAKT
FT                   LQSDILQVDGVAKVAMTGVQQEGIFVEIAREELASLGVSINNIYGILDEQNAVLSAGNT
FT                   QIGDQRIFIDPTGELNSVDTIKNLLVSASAKGKTIYLKDIANVYRGFQSPATKLVRYNS
FT                   KPAISLGVASVLGANVVKVFDRVDDKVKQTENLRPLGISVHEFYHQGKVVQDSVDNFVV
FT                   NVLVALVIVMVTLLLFMGLRSGIIIGAVLLLTIFATLATMDFSGIPMHRISLGALIIAL
FT                   GMMVDNAIVVTEGILVGTQQGRKKLDIASEVVKQTKWPLLGGTLVGIVAFAPIGLAPGD
FT                   TAEFTGHLFWVILISLLYSWLFAITLTPLFCYCLFKEQDGDTSGSAKPNKLMALYQSVV
FT                   VSALHHRWLTVTVVVAMFSVSMWGFQFVKSGFFPASTTPQMVVDFWLPQGTDIEKTKKD
FT                   MLKLEAFVKQQNGVEGIQTLIGGGGLRYMLIYGSESPNSSYGQILAKVDDYKKLDQLLP
FT                   RVQNYIDNNFVDAQGKVWRFVMGPGGGSKIEATFKGPDPSVLRELAAKAKAILIDDGGA
FT                   LSIKDTWRQRISVIEPQYSAINAQRAGVTRKAVAEALQQNFSGQVVGQYREGEELIPII
FT                   VRAPQKERVDINDIGNIQVQSNITGETLPLAQVTNGFKTVWRDGILKREDREWTIKAQA
FT                   DPLPGELASELFNRVKPKIEAIELPQGYRLEWDGEYGQSKESNEMLASTIPLGFLAMVL
FT                   IVIVLFNALKQPIIIWLVVPLALIGVVFGLVTTQIPLEFMGILGLLSLSGLLIKNAIVL
FT                   VDQMDMEIRQGKPRYEAIIDSANSRVRPVMMGTLTTVLGVIPLYFDAFFQSMSVVLVFG
FT                   LLFATLLTLIVIPVLYAIFMNVKTDEHIHS"
FT   gene            complement(621701..622768)
FT                   /locus_tag="PSM_B0565"
FT   CDS_pept        complement(621701..622768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0565"
FT                   /product="putative substrate binding periplasmic component
FT                   of a multidrug resistance protein (metabolite exporter)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70600"
FT                   /protein_id="ADT70600.1"
FT                   /translation="MINKPCFTKFNFISIALLLLAGCSDSEVSTQKQNKPRPVKLITID
FT                   DGSQSKTLTYPATIDTINSSKLAFQVSGKLEKLNVIAAQNVKKGDVIAALEQRNFVNEV
FT                   KSSKIQFETANNDYQRGLKLAKDGVISQRDIEQLKSKKEMAESQYDSAQKALSDSKIIA
FT                   PYDAIVAEVPVKQLENISAGQHVVTLFGKGEMEAVVNIPASIVATVDSKQNNVATVILQ
FT                   DVSAAPIPATFRRANLEADSASQTYEVRFSFAVPNNLNILPGMNASLKIERQTSSNATR
FT                   LAVPTFAIFEENGQHFVWTVDQQTMQVSKTLVAIEQGIGEQLIITEGLKAGDVIVGAGA
FT                   NYVTEGMKVRPWTKA"
FT   gene            623324..624331
FT                   /locus_tag="PSM_B0566"
FT   CDS_pept        623324..624331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0566"
FT                   /product="catalase-related protein"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70601"
FT                   /protein_id="ADT70601.1"
FT                   /translation="MSKKITLIAIITLFALTILYFTGAFNSDAVTAQRFVNLQQGDQAH
FT                   AGFRRAHAKGICLAGSFESTGELAKYSQAKVFDLGATPFVGRFSIAGNNPTAPDLKAPV
FT                   RSLAFSITTDDNQEWRVAMNTPPVMAVATPDAFFKQLQALSPDPVTKKRSPEKIKAFFA
FT                   AHPESAAFNNWKASYKPTSSFATEQYHSINAFYLVDENNKKHAVRWIAKPQLSDENIQP
FT                   LNNDSADALQLQLKDQVAQAPVKFDMLFSFATEEDDENNPTVLWPQSRKTINAGTLVIS
FT                   RLQAQEGGVCADMNFDPLVLPTGIEPSADPILRARGAAYAESFRRRAKEVLLNN"
FT   gene            624348..624887
FT                   /locus_tag="PSM_B0567"
FT   CDS_pept        624348..624887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0567"
FT                   /product="cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70602"
FT                   /protein_id="ADT70602.1"
FT                   /translation="MKTINKYSASSMLIHWAMALIILSMLFLGLSMVQSLAVWQIEAIA
FT                   LHKSFGILALVLVAIRLINKVVTTSPALPPSVPKAQALAAHLTQVGLYASMILMPISGW
FT                   LMQSADGRHVGFFDLFTLPSLVSKDIELYAFFREAHGLIAYAFLLFIFMHVSAALYHGL
FT                   IKQDGVLGSMLPGKHK"
FT   gene            complement(624954..625679)
FT                   /gene="hisA"
FT                   /locus_tag="PSM_B0568"
FT   CDS_pept        complement(624954..625679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="PSM_B0568"
FT                   /product="N-(5'-phospho-L-ribosyl-formimino)-5-amino-1-(5'-phosphoribosyl)-4-imidazolecarboxamide
FT                   isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70603"
FT                   /protein_id="ADT70603.1"
FT                   /translation="MIIPALDVLQNQIVRLYQGKYDTAQFYPFELGARLKEYADSGAGK
FT                   LHLVDLEGARDPSKKQWQHIQAATKALDVPYQVGGGIRSEQDVSDWIKAGANQVVIGSM
FT                   AVEKREQVKAWIEQFGAEHFVIALDVNKTESGWAPATHGWLNESEFGLFELIDFYVELG
FT                   IIDFLCTDISKDGTMTGPSFALYEDLINHNADIKVQASGGVSSLDDIKKLNELGVGGVI
FT                   LGKSLLDGAFSVEDALKLS"
FT   gene            complement(625713..626303)
FT                   /gene="hisH"
FT                   /locus_tag="PSM_B0569"
FT   CDS_pept        complement(625713..626303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="PSM_B0569"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH (IGP synthase glutamine amidotransferase subunit) (IGP
FT                   synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS
FT                   subunit hisH)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70604"
FT                   /protein_id="ADT70604.1"
FT                   /translation="MIAIINTGCANINSVRFAFERLGKTPTVITSPEQLAGYERAILPG
FT                   VGHASVAMKRLVDNGWQQAINEYQRPLMGICLGMQLLCESTEEGNVQCLGKIPGQVKAL
FT                   DVGSLTSPHMGWNNLSIQQAHPLTKGLHKDDQVYYVHSFAHTVNDATLVSSEYGQTFSA
FT                   IVAKDNYAGMQFHPERSAKVGTRLLQNFLDWQL"
FT   gene            complement(626300..627361)
FT                   /gene="hisB"
FT                   /locus_tag="PSM_B0570"
FT   CDS_pept        complement(626300..627361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="PSM_B0570"
FT                   /product="imidazole glycerol-phosphate
FT                   dehydratase/histidinol phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70605"
FT                   /protein_id="ADT70605.1"
FT                   /translation="MSNPYLFIDRDGTIIEEPITDKQVDSLEKLAFLPGVIPALLQLQA
FT                   AGYRLVMVSNQDGLGTDSFPTADFDIAQDKMMDILNSQGINFEDVLICPHFDEQNCDCR
FT                   KPKTGLLTELMRSGNVDLARSFVIGDRQTDIGLAQNLCCEGILYDGSWPAIVTKLTTAN
FT                   REGRVTRNTKETQIDVAVNLDQTKNGSIDTGLGFFDHMLDQIRTHANIGLNIKAKGDLH
FT                   IDEHHLVEDIGIALGVALKQALGTKSQIARYGFALPMDECKAEAQIDLSGRASFVLNAN
FT                   FSREKAGDLDVQMVEHFFKSLSDNAAISLILSVSDGNCHHQVEGLFKAFSRALRMAIAQ
FT                   DTSQQTASSKGCL"
FT   gene            complement(627358..628458)
FT                   /gene="hisC"
FT                   /locus_tag="PSM_B0571"
FT   CDS_pept        complement(627358..628458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="PSM_B0571"
FT                   /product="histidinol phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70606"
FT                   /protein_id="ADT70606.1"
FT                   /translation="MSNESAQATSLLPENIKALAAYSSAKSEKLTGTTWLNANESPYAK
FT                   NLELSIEDLNRYPDPQPQLVIDRYAAYTELKSDNVLMTRGADEGIELLVRTYCQPAKDS
FT                   IALFLPTYGMYKVTADTHNVAINALTQELLLTANVDDIVTAVGSSKLVFICNPNNPTGS
FT                   LTPLDKVKAIATALAGKALVIVDEAYIEFCPEQSATQLINEFSNIVVLRTLSKAFALAG
FT                   LRTGFTLAQASVLAPIRKVIAPYPVSSVVASIAAQAIAPDAITSMRRQVSILNSLKLKL
FT                   IEWLNASPAVLKILTGEGNFVTLKLADKNSFKVALEQGLVMRAFTLYGEDDWLRISIGS
FT                   EQELEQVKIWLDGLTTPTALSQQEVS"
FT   gene            complement(628448..629749)
FT                   /gene="hisD"
FT                   /locus_tag="PSM_B0572"
FT   CDS_pept        complement(628448..629749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="PSM_B0572"
FT                   /product="bifunctional HisD: L-histidinal:NAD+
FT                   dehydrogenase; L-histidinol:NAD+ dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70607"
FT                   /protein_id="ADT70607.1"
FT                   /translation="MLRWNEESSQVQAAALMRPAVSASEKVESICQTILAKVNAQGDAA
FT                   LLALAKEFDNRAEPRLRVPLDEINAAEKMLSPELKYAIDTAYANVKCFHQAQLPKDIKL
FT                   STQPGVECELKYQAIEAVGIYVPGGSAPLPSSVIMQGVLAQLSGAKTVVLTTPVQGDKA
FT                   INPAILYAAKLCGITTIIESGGAGAIAAMAYGTESVPKVNKIFGPGNSFVTMAKQLVAQ
FT                   TIPGMAIDMPAGPSEVLVIADERANPEFIAADLLSQAEHGADSQVILLCNSETIIKQTQ
FT                   DALTRQLANLSRKDTAEQALANSSLILVDSIAQAFDVSAQYGPEHLILQLADASPYLDA
FT                   VKNAGSVFVGDYTPESAGDYASGTNHVLPTYGYSATYSSLNLLDFFRTYTVQTISKSGL
FT                   TELSKAILPLADAEGLDAHANAVSIRLEAINNEQ"
FT   gene            complement(629755..630654)
FT                   /gene="hisG"
FT                   /locus_tag="PSM_B0573"
FT   CDS_pept        complement(629755..630654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="PSM_B0573"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70608"
FT                   /protein_id="ADT70608.1"
FT                   /translation="MNNSNRLRIAIQKGGRLSKDCQDLLKQLGVKLNLREQRLIAHSTN
FT                   MPIDVLRVRDDDIPGLVMDGVCDLGIVGENVLVEVQAERERQGVPSEVTKLSKLDFGYC
FT                   RLALAWPQELGKQDKSWFEGKRIATTYPEILSQYLKREGINASTVMLTGSVEVAPRAGL
FT                   ADAICDLVSTGATLEANGLMQGDTILESNACLIQNTQLQDADKLALINKLMPRLRGVKQ
FT                   AKESKYIMLHAPKDKLDEICEILPGSGQPTLLALAGSDEYVALHMVSSETLFWETMEQL
FT                   KALGANSILVMPIEKMME"
FT   gene            631051..631284
FT                   /locus_tag="PSM_B0574"
FT   CDS_pept        631051..631284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70609"
FT                   /protein_id="ADT70609.1"
FT                   /translation="MDIMIPYLGPITRLTLESKGAFHIAGVQQSASAKKVELEERKKRE
FT                   VEKQHKLAFDENKSRNKTAEEDDDKPHLDTWA"
FT   gene            631369..631503
FT                   /locus_tag="PSM_B0575"
FT   CDS_pept        631369..631503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70610"
FT                   /protein_id="ADT70610.1"
FT                   /translation="MHGYELRVFKTTPYPFKIDYPSFKAQQVKSFPCNYMLIEQSISD"
FT   gene            631781..633964
FT                   /locus_tag="PSM_B0576"
FT   CDS_pept        631781..633964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0576"
FT                   /product="secreted metalloprotease Mcp02"
FT                   /EC_number="3.4.24.25"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70611"
FT                   /protein_id="ADT70611.1"
FT                   /translation="MNLSKITIATFAALTLVQATNAVAANKKYLNQQPTINNMVQSNSA
FT                   SLLSVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGML
FT                   KKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQ
FT                   NKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQHANATGPGGNLKTGKYLYG
FT                   TDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDA
FT                   HFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSL
FT                   DVSAHEVSHGFTEQNSGLIYNGKPGGLNEAFSDMAGEAAEFYMKGSNDWLVGKDIFKGN
FT                   GALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMAR
FT                   ANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCATPQPPT
FT                   DDEVLTNGVTRTGISGAEKEQLFFTLEVPDGATNLQFNTMGGSGDADLYVKFASRPSLN
FT                   NYDCNSTTSTSTESCNISNAQAGTYYVMVEAWSAISGVLLTGSYSDGNGGVTPINRTES
FT                   NINVTTNNWSRFTQDLSEGYSTLNISIAGGNGDADLYVNFGSPSSTSSYLCRPYKNGNN
FT                   EECTFDNPQAGTWYIDLRGYSLASGVTLNVTAN"
FT   gene            634036..635892
FT                   /locus_tag="PSM_B0577"
FT   CDS_pept        634036..635892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0577"
FT                   /product="metalloprotease II"
FT                   /EC_number="3.4.11.10"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70612"
FT                   /protein_id="ADT70612.1"
FT                   /translation="MNYFKQLAVITTLTLSFNCLANENPDNIWVTIDSTAAQHYHHEQG
FT                   TFLQKMQFAHRKSSILPDVDLLSVPRDAVNNLSEFMHQNYNRCGGFVAHSSFEEANDYA
FT                   KQLAVVQNSQATSAFNYSIDNAQTVQSLISAQSPINLQSTVNSLTSFNNRYYTSQTGVD
FT                   ASQWLQSYWQQIASVRSDITIESYQHSWAQSSVIVTIAGAENADEIVIIGGHLDSINQA
FT                   NPAQGRSPGADDNASGIAVLTEALRAIVDTNYKPQKTIQIMAFAAEEVGLKGSKAIASS
FT                   YRSLGKNVVGMVQFDMTGNNGSIEDIIMMTDYTTNAQNQFLAQLIDTYLPQISYGFDQC
FT                   GYGCSDHASWYQQGFAASMPFESKMNDINPLIHTQNDSNFDADHAIKFANLAVSFVAEL
FT                   AKNAGDVTPPNNNELVNGEPISGINATAKEQLIYTLNVPKGAQNLSFETSGDNGDADLY
FT                   VKYNQAPTLTDYDCKSTSATSNERCDIPTSNEGTYYVMVEAYSAISNVSLTGSFEPAGA
FT                   LEPINRVEDNVSVNTGGWQRFEQRLAAGYASLNVAISGGSGDADLYLNFGAPSSNTQFV
FT                   CRPYKNGNTESCTISAPQAGVWHIDVKGYRNASGITLTINAQ"
FT   gene            635993..637909
FT                   /gene="yoaA"
FT                   /locus_tag="PSM_B0578"
FT   CDS_pept        635993..637909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaA"
FT                   /locus_tag="PSM_B0578"
FT                   /product="ATP-dependent helicase YoaA"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70613"
FT                   /protein_id="ADT70613.1"
FT                   /translation="MIGIIKQLFSATGPLALSIDGYSPRQPQIDMAVAVEDALKTSSQL
FT                   VVEAGTGTGKTFAYLAPALKSKGKTIISTGSKALQEQLYHRDLPVLVKALGAAKKTALL
FT                   KGRANYLCTYRLTQHVAHVPTDDPDVMHQLAMVAKFASETHTGDLADCIGIEEDAKVLP
FT                   YVSSTADNCLGKECPDFQECYIRKARLKAGDADVVVINHHLFFADMAVKESGFAELMPN
FT                   ADAYIFDEAHQLSEIASDYFGETMSTKKLVDLINDLRAIYRAEIPDMLQLGKSLNKLET
FT                   SVADLRLQFGVDGSRGDWREKLSNKLICSALHRVISDLEFVYQVLKHCLERSDKIEHPF
FT                   ERVLAFKGQLERVFDTAQTGFSYWYETTRRYLTINITPLNVSAKFALMMKESGAGFVFT
FT                   SATLSVDNELTHFNASLGLKPKQSMMVDSPFDYENQALLCLPRYLPETHADNMPHAIVK
FT                   LTLELIKSAKGRCFVLFTSYRMMHLVAEGLTTQMDYPVYMQGQMSKRIILEKFTRHGNA
FT                   VLLGTASFWEGVDVRGSTLSCVIIDKLPFAAPDDPLLQARMQDCQMQGKDPFAHIQLPQ
FT                   AVIALKQGVGRLIRDNKDKGVLVICDNRLVTRQYGQVFLKSLPPMRRTRSLEDANTFLK
FT                   HIN"
FT   gene            637975..638619
FT                   /locus_tag="PSM_B0579"
FT   CDS_pept        637975..638619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0579"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70614"
FT                   /protein_id="ADT70614.1"
FT                   /translation="MHYQGKTFHHFEECPQQHSQKILPLIDELLNKANCKLKDLDVIGF
FT                   GQGPGSFTGVRISVAIAQGLGYSTNLPLVGVSTLAVMAQQAFEQFGDEVVYPSIDARMG
FT                   EIYFAQYQVNNNLMTLQGEERVFKPELLDASLIDTNKTATGVGTGFKSYPDALTTFTNV
FT                   SVHPEITLPDAQYMLALVDAQYLAGNGVKASDAQPKYVRDTVTWKKLPGRE"
FT   gene            638694..639023
FT                   /locus_tag="PSM_B0580"
FT   CDS_pept        638694..639023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70615"
FT                   /protein_id="ADT70615.1"
FT                   /translation="MSLPISSGFFTGDIPAKVRSTAVVTAKPERLSEQPIPQKTNTDYV
FT                   KSSPEGLELAKEFVKANTKEAQYSQTIYDQPSAQVSKAISTYTEFANLERRAEVQSLIG
FT                   VDIYA"
FT   gene            complement(639092..640378)
FT                   /locus_tag="PSM_B0581"
FT   CDS_pept        complement(639092..640378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0581"
FT                   /product="putative alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70616"
FT                   /protein_id="ADT70616.1"
FT                   /translation="MKKQFGLLALLCTTGAFAQTAPKNVIYMIGDGMGPAFTTAYRYYK
FT                   DDPTTKEIETTVFDTMLKGMAHTYPDDHTYVTDSAAGATALSSGHKSYNGAIAVDTAKK
FT                   PVKTMLEIAKEQGMTTALVATSQINHATPASFAAHNESRRNYDDIANDYIDNKIAGKLP
FT                   VDLMLGGGTQYFIRDDRNLVDEFKKAGYQYGDDIKNLGQITQIPAIGLYAPKGLPFALD
FT                   ENPTRLKQLTSKAFDLLDGQNDKGFFVMIEGSQIDWCGHANDIACAMAEMDDFAKSIET
FT                   AKAYVDNNPDTILVITADHSTGGLTIGAHGQYKWETDIIKGVKATAGTLTKLLMGSDNL
FT                   KTVWQANTRIEFTTENEIKLKQAKAMGEKTLNLAVKSIINDLSFTGWTTGGHTASDVQV
FT                   FAYGKNSDDFIGSQNNTDIAKKLISYIEQ"
FT   gene            640566..641417
FT                   /locus_tag="PSM_B0582"
FT   CDS_pept        640566..641417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0582"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70617"
FT                   /protein_id="ADT70617.1"
FT                   /translation="MQPFSVKANDLDIHGIKFGDGEDVVIALHGWLDNSASFVPMLSRA
FT                   ATSQTWYCIDFPGHGLSSWRSPQAHYYFIDYVDDVYALITALKLKKVHLVGHSMGAMVA
FT                   GLFASCFSEYVKSVSFIEGLGCVTTDSDEVCSQLRNAILNRARLSTKKSRVYTSKQQIY
FT                   QARAKTTDLNNEQIALLMDRNIKQMHSGFELTCDPKLKNHSGFRFDEAQCIGAIKELIA
FT                   PCQLILGDQGYPFVKQNLDKYSKYYNNLSVIDVPGGHHCHMQSSGLCFEHIHAFMVQSS
FT                   AC"
FT   gene            641569..643185
FT                   /gene="fadD"
FT                   /locus_tag="PSM_B0583"
FT   CDS_pept        641569..643185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="PSM_B0583"
FT                   /product="acyl-CoA synthetase (long-chain-fatty-acid-CoA
FT                   ligase), acyl-adenylate activating enzyme"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70618"
FT                   /protein_id="ADT70618.1"
FT                   /translation="MPETIDPEHYNSLLEVFEKSFNDYKDLPAFTNMGKTLSYNEIDAA
FT                   TKRVAAYIQNDLGLKKGDKVAVMMPNLLQTPIAILGILRAGCVVVNVNPLYTVRELEHQ
FT                   LKDSETSAIFILANFAVTLEKALPNTDVKHIVVTQVGDMMGGLKKHLVNFVVKHFKKMV
FT                   PSYTLPNTINFCDLLKADLNGYKRPEVNLSDLAFLQYTGGTTGVSKGAMLSHGNLVGNL
FT                   EQVSGCLDNVLERGKEVVITALPLYHIFALTANCLAFMKYGGLNVLITNPRDMPGFVKE
FT                   LSQHKFTAITGVNTLFNGLLNTPGFSELDFSHLKMSLGGGMAVQRPVAEKWQKVTNSKL
FT                   MEGYGLTECSPLVTISPYDLEAYNGSIGLPAPSTDIKLMLDNGEEAAKGEPGELWVKGP
FT                   QVMLGYYNRPDATAECLKDGWFATGDIATYDDEGFFYIVDRKKDMIIVSGFNVFPNEIE
FT                   EVVAMHEGVLEVAAVGIPHDISGEQVKVFVVKKDPSLTEKDIIKHCRDNLTNYKVPKLV
FT                   EFKDELPKTNVGKILRRALKD"
FT   gene            643236..644366
FT                   /gene="rnd"
FT                   /locus_tag="PSM_B0584"
FT   CDS_pept        643236..644366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnd"
FT                   /locus_tag="PSM_B0584"
FT                   /product="putative RNase D, processing tRNA precursors"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70619"
FT                   /protein_id="ADT70619.1"
FT                   /translation="MHYQLIQTQNELNTFVEQIKNKPILAIDTEFMRRRTLYPEVALIQ
FT                   VYDGEHLALIDPLAELSLFDFWQILKDPKVLKVLHSPSEDIEVFQKYAGFVPYPLFDTQ
FT                   FALQLLGEGNCMGFALMVKTLLNIEIDKSESRTNWLQRPLTQKQLEYAAADTYHLLPCF
FT                   ELIIDSIKAADLFDIVINESELVANKRAFQIPDELLYKEIKNAWQLKPHELAVLKELAV
FT                   WRRNKAIRKNLALNFVLKEHNMTEIAKRGPSSLNALRQIPGVEPIEVNRSGVEILKCIE
FT                   QAKAIPAEQHPQVLKRLIDFPTYKKVAKEIKQKITKVAKEHNIPEDVMASKKQINQLIS
FT                   WNWKLTAQQKEKHIKPDLLSSWRYDFVKDALKEWDN"
FT   gene            complement(644421..644684)
FT                   /gene="minE"
FT                   /locus_tag="PSM_B0585"
FT   CDS_pept        complement(644421..644684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="PSM_B0585"
FT                   /product="cell division topological specificity factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70620"
FT                   /protein_id="ADT70620.1"
FT                   /translation="MSLLDYFRSEKKNSASLAKERLQIIVAHERSQRGTPDYLPQLKQD
FT                   ILDVIRKYVNVGADAVQVQFDQNEDDLAVLELNVTLPDEEKK"
FT   gene            complement(644686..645495)
FT                   /gene="minD"
FT                   /locus_tag="PSM_B0586"
FT   CDS_pept        complement(644686..645495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="PSM_B0586"
FT                   /product="cell division inhibitor, membrane ATPase,
FT                   activates MinC"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70621"
FT                   /protein_id="ADT70621.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTSSAAIGTGLALKGYKTVIIDFDIGLRN
FT                   LDLIMGCERRVVYDFVNVINGEANLNQALIKDKRVEKLFLLPASQTRDKDALTRDGVER
FT                   VLNELKEDFDYIVCDSPAGIEAGAMMAMYFADEAIVTTNPEVSSVRDSDRILGILHSKS
FT                   KRAEEGLENIKEHLLITRYNPDRVSKGEMLSVEDIQDILAIDLLGVIPESQAVLSASNS
FT                   GQPVILDSESDAGQAYADAISRLLGETVEFRFLDVEKKGLFKRIFGG"
FT   gene            complement(645501..646205)
FT                   /gene="minC"
FT                   /locus_tag="PSM_B0587"
FT   CDS_pept        complement(645501..646205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="PSM_B0587"
FT                   /product="cell division inhibitor, inhibits FtsZ ring
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70622"
FT                   /protein_id="ADT70622.1"
FT                   /translation="MSDQIFELKGNLFTLSVLHLYSTDINLLAEQLYVKIAQAPKFFEG
FT                   APIVVNLIEVKNSAIDFVHLKSLIERMSFNAVGVCNGSDEQHKQAKAAGLSVLNYSQDV
FT                   KSEPARVESNTSVVEKTVYLPAQIINGAVRSGQQVYAKDRDLVVLGAVSHGAEVIADGN
FT                   VHIYGTLRGRAIAGAKGLENAYIFCNKLEAELVSINGNYWISDSLQGEHWGNAVQIQQK
FT                   NESLEISALVKG"
FT   gene            646361..646642
FT                   /locus_tag="PSM_B0588"
FT   CDS_pept        646361..646642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70623"
FT                   /protein_id="ADT70623.1"
FT                   /translation="MLTAVYKSKKKADTFLFIEKRDDFSKVPEPLMAMFGQPQYVMIIN
FT                   LAKRTQLGVADLDTLKQSLSDQGYYLQIPPPEENLLSQLRKQNGADSD"
FT   gene            646635..647651
FT                   /locus_tag="PSM_B0589"
FT   CDS_pept        646635..647651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0589"
FT                   /product="putative periplasmic lytic murein
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70624"
FT                   /protein_id="ADT70624.1"
FT                   /translation="MIKKLAVVLCGVCLSSSVMAKTQAEFQQYLTNLKQEAIAKGYDTQ
FT                   LIEQAFATASYKEKVISADKNQPEVKETLETYLPKRVPQWKIDRARKLYKENQEVLEKV
FT                   AKDFGVQARFIVAIWGLESNFGAIQGGHNVISSLVTLAFDGRREALYKRQLWAALDILK
FT                   SGHITLDKFKGSWAGAMGQTQFMPTSFNAYAVDYNNDGRKDIWTTKEDAFASIANYLKQ
FT                   EGWNDNLTWGRQVQLPADFDQQYILKRGTKTRKQWLEYWDKSERSLADWQALGVRRVDG
FT                   SDLPTVAVDAALVMPDDINGRMYLAYDNYKVFMHWNRSYYFATSVGYLSDRIAYPKI"
FT   gene            complement(647699..648247)
FT                   /locus_tag="PSM_B0591"
FT   CDS_pept        complement(647699..648247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0591"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70626"
FT                   /protein_id="ADT70626.1"
FT                   /translation="MTLSEKNFAFVMHCGEMGSRWGFNRTIGQMCGLLIITKDPMTANQ
FT                   IADALSISRGNVSMGIKELQSWQLIKVMHIPGDRKEYYAPAGDIWDMANRVFEERKKRE
FT                   VEPTLSLLRDNLLDEASNDDEIYAQKQMGEIHNLLETVTKWSSELQRLTPEQLNKLMKL
FT                   GSGIGKVIDLKDKIFKKEQ"
FT   gene            648241..648360
FT                   /locus_tag="PSM_B0590"
FT   CDS_pept        648241..648360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70625"
FT                   /protein_id="ADT70625.1"
FT                   /translation="MSLLQVSKINEIYASTLVKYGKRLAWIKNHVLRLMIDID"
FT   gene            648464..649474
FT                   /gene="adhP"
FT                   /locus_tag="PSM_B0592"
FT   CDS_pept        648464..649474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="PSM_B0592"
FT                   /product="alcohol dehydrogenase, propanol-preferring"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70627"
FT                   /protein_id="ADT70627.1"
FT                   /translation="MKAAINTEYKGKLEITDLPIPEVGPNDVLVKIAACGVCHTDLHAC
FT                   HGDWPVKPKMPLVPGHEGVGVIEKLGSNIKHLEVGDRVGVPWLYSACGHCEFCLDGRET
FT                   LCLSQHNTGYSIDGGYAEYCLAHGDYIIKIPEGLGFAEAAPLFCAGVTTYKALKVSDAK
FT                   PGQWVAIVGVGGLGHLAVQYAKAMGFNVIAVDTGKEKMALAKELGADITLDFKEVVPSE
FT                   AIFEQVGGAHAVVCTAVSKPGFEQAYKSVRRGGKCVLVGLPPEDMPLPIFDTVLNGVSV
FT                   VGSIVGTRKDLQECLEFAAQGKVKAIIEEKKLEDINEIFDDMLKGEINGRIVVTI"
FT   gene            complement(649525..651945)
FT                   /locus_tag="PSM_B0593"
FT   CDS_pept        complement(649525..651945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0593"
FT                   /product="putative Ton-B dependent protein (could be
FT                   involved in iron transport)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70628"
FT                   /protein_id="ADT70628.1"
FT                   /translation="MKRFQYSLLTLACLNAHLALANESQVNSDIERISVYEQQNRVVMS
FT                   SGLATKSDMSLMETPAPVVIVDKALIASQGIDSLQDVIRNVSGLTQAGNNYGIGDNLVI
FT                   RGLGANYTYDGMYGGAGLGNTFNPTRSLTNVESIEVLKGPATGLYGMGSAGGVINLIEK
FT                   KPQFNEQHTLEMDIGQWDSYSLALDSTNAITDDLAYRVMAKTASSDGFRDLKEQRDEIY
FT                   SSLKYVLNDQHAFVLSGAYIKDAIAVDSIGHPIRIFNSESVNGLTAGEVSGADLVNDPT
FT                   ASGLQLSEAQRNELANSLASNDGLTPFNFGTNGIISPMAKDNEGEELRFKLAHNYYISD
FT                   DLFVNQQLQYRNYTSSFARQTGAYNYVYWKRNGVINQDPRAPLVVDDVLYPFAARRQEY
FT                   RQVEADEKSWQYFLDLRYDFMLGNIENELLVNANYEDRDIRFKQYSIYDADKVIKNKAG
FT                   EVIYQGALPYIFDMRQPNWPTSEFNDYDPLKTRDYNKKVQAWGLGLQHVAYINDKITTR
FT                   IGIAHNRIKQSYEHFGVDPRYSQSRANPTPEANTSDSGLTYNLGATYQLSADMALFLNH
FT                   SKGRTAYSVLGSVAGNEADREDSESVSNDLGFRFKAFDDQLLASIVVFESARTNLEYAN
FT                   PLYEAGVSAPNVVESFFDGEEQTKGVEIDLNAYLNDQWKVNINGVYQDARDKTNPNSTS
FT                   FDTRQKGVPYVTASSWVTYSAALFELPHAIDLSAGLTFVDKRSTNSSSFGIDNGYVPAY
FT                   TVYDAAVSYKADNWQMQLNINNLFNKKYYSKAMFLGGMPGEERNAKLSFSYTL"
FT   gene            complement(652239..653519)
FT                   /locus_tag="PSM_B0594"
FT   CDS_pept        complement(652239..653519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0594"
FT                   /product="putative secreted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70629"
FT                   /protein_id="ADT70629.1"
FT                   /translation="MIKIKKHLLTTSIALLSLTSASTLATTYISAKALLDVKTGELKAN
FT                   PLIAIDEGVISQIQFNKKPTLTSNDELINLPELTVMPGLMDMHVHLTSDPTVSRSERIG
FT                   QSVPRMAIKASYFAKKTLEAGFTTVRNLGAEGFSVIAVRDGINAGDIIGPRIWAAGPSL
FT                   GITGGHCDNNRLPPEMKYTASGVADGPWAVRIKVRENIKYGANAIKLCATGGVFSKGTK
FT                   VGIQQYAFEEMKAIVDEAHMRELPVAAHAHGTNGIKTAIKAGVDSVEHASFLDDEAIEL
FT                   AIKHGTWLSMDIYNTEYTLSFGEQNGVDEENLNKERLVSKKQRDSFKRAVEAGVNMVFG
FT                   TDAAIYPHGDNAKQFSRMVEFGMSELQAIQAATINSAKLLKADSQLGQIKTGFAADIIA
FT                   VSANPLKNISTLERIPFVMKAGVVYKQ"
FT   gene            653670..655487
FT                   /locus_tag="PSM_B0595"
FT   CDS_pept        653670..655487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0595"
FT                   /product="putative lipoprotein, ounterparts found in
FT                   phytopathogens"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70630"
FT                   /protein_id="ADT70630.1"
FT                   /translation="MKVIKIALVASSVMFALSGCMSTSSQSNTNQPVVPVISELSAEQQ
FT                   LDVLVAQYYDESLTFNPLSATYNGRHEFDDQFLPVISQANRDKKTAFYKKYQQRLTLID
FT                   ESQLTGQALLNFEVLSRDLALKLEGMQYKDYLLPINQMSGAHNTFAGFGSGQSAQPFNT
FT                   VADYEQFIKRADGFVKWLASVEQSMAQGVKQGVVLPMPLAKKLLPQFKVHVVTNAEDSL
FT                   FYSPIKAMPDSFSNAQKQQLTEQYKTLILDKLVPAYQRMSEFLLNDYIPHARDSVGYAD
FT                   LPDGKAWYEYQIKKNTTLSLSADEIHDIGLREVARILSEMKTVKNTVGFEGDLASFFDH
FT                   LRDSDEFYYKTADELIAAYEDIKLKIDARLPRLFNIEPKAPYIVKAVEAYRAQSAAGAS
FT                   YAGPAPDGSRPGIFYINAYNLKAQPKFLLETLSIHEAAPGHHFQIALQQEVESLPDFRK
FT                   FGGYTVFAEGWALYAESLGKELGLFTDPYMWYGRLNDEQLRAMRLVLDTGFHAKVWTRQ
FT                   QGIDYMLANSSMAKSDVIAEVERYIAWPGQALSYKLGEFKIKELRDYAHQQLGEQFDIK
FT                   AFHTQILIDGALPMPILEQKIKRWVKSQQ"
FT   gene            655584..656096
FT                   /locus_tag="PSM_B0596"
FT   CDS_pept        655584..656096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70631"
FT                   /protein_id="ADT70631.1"
FT                   /translation="MFDQQLAKTQFWLSKSLNEMNQQEWEAICDGCGKCCLNTFIDSED
FT                   EDDFTATDQLREGEQLIFTNIVCQYLDNTTCGCSEYETRQTLVPSCVKLTKENLKDIFF
FT                   MPQSCSYRRLHEGRGLATWHPLLNNGDKTKMHELNISVKDKTVKDCDVKLEDFDLYIAE
FT                   WPTKDCN"
FT   gene            656096..656611
FT                   /locus_tag="PSM_B0597"
FT   CDS_pept        656096..656611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0597"
FT                   /product="putative cold-shock RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70632"
FT                   /protein_id="ADT70632.1"
FT                   /translation="MSKLQASIGLINPKSPTNVGGVLRAAGCYDAQQVFFTGNRYLNAQ
FT                   KFHTDTKNVVQRIPLTATDNLASSKPQGAKVVVIELIEGATPLPEFTHPENAFYVFGPE
FT                   DGSVPKDVLKWCDEVVYIPTIGCMNLAATCNVVLYDRLAKLGGIQSSDETIITSRDTNN
FT                   KMKWQKQP"
FT   gene            656796..658451
FT                   /locus_tag="PSM_B0598"
FT   CDS_pept        656796..658451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0598"
FT                   /product="peptidase M1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70633"
FT                   /protein_id="ADT70633.1"
FT                   /translation="MVVTLIYILSACTSKPAKLDPLVANTGQPLSSVAQSTDVIFYDLK
FT                   LAVFPEEKQIAGTGKTVFRVVKETQQIELKLDSRFSINTVTVADKKAEFLHSHGVITIN
FT                   LYEKKYPGEVVEVAINYSGKPHIALNPPWSGGFVFSETNDGKPWIATAVQGEGCDLFWP
FT                   CKDHFSDKADSMRIRVTVPTGLYVASNGVLKNITVLQNKTTEFDWFLSEPASDYNIALN
FT                   IGPFERVQQQYTSINGTDIPVEFWVLPENRQKASNLLTNDVYQQMAFFESVLGPYPWGQ
FT                   QKLGFVETPHLGMEHQTINAYGKGYTRDPSGYDWLIQHELAHEWFGNLMTHEQLNDAWL
FT                   HEGFGFYMQPSYSLYTFGEAAYNHAMYKAYLGIKNCQPIVKEGELSSKEAFNSDIYGKG
FT                   GWTLHTLRWLIGDELFWQATRELIYGSSDTQSLSYPIQSRYRNTQQFIDIVNRITKKDY
FT                   NWLFDVYLKQASLPTLSMERQNNVANLYWSKSEKDATPFKMPVPISINGQLQVYIPIEG
FT                   VITIKAKPVDHIIVDPQMKVLRQLPITSQCQQDE"
FT   gene            complement(658587..658718)
FT                   /locus_tag="PSM_B0600"
FT   CDS_pept        complement(658587..658718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70635"
FT                   /protein_id="ADT70635.1"
FT                   /translation="MEVNLSELNISTLSINHYYQSLFNKFLTECLSKYDFNEIKEQK"
FT   gene            658690..660579
FT                   /locus_tag="PSM_B0599"
FT   CDS_pept        658690..660579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0599"
FT                   /product="putative chemotactic transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70634"
FT                   /protein_id="ADT70634.1"
FT                   /translation="MFSSLKFTSKITIAASLVLVLVLGVFTINNYFSMRHQTQEQLSLV
FT                   LEQNSESVSKNIASWLNNKLAIVISIAKTYQDDDAKPLTLSQLNTAELAGDFKNTYIGK
FT                   SSGTFILNDQSVVLPSDFDATSRPWYKLVENKTTTAFTTPYIDVTTNELTISAVAPINS
FT                   NGQFKGVAGADIDMQTIAEIIGDIDFLGLGYGFLLDNKGQILSHPDSKLNSKTVADLIG
FT                   KNAPLAREFTEYQVAGETSLVSFTKIRGIENVDWYLGVVVNKDKAYSSVSSFGQKAIVF
FT                   LIIGILVIVASLEFLLRYLMRPMYRLNDAIRDIAQGEGDLTCRLSVENDDEFGQLSNSF
FT                   NIFIEKIQNSIIQVKSSTQLLETAVAKLVTQTDSTLTMYDDQSERTNSVASAINQFSAT
FT                   STEISTSASNASTLAKDADQYCAKNQQTLTNNVSSIHQLSQNIEQAQETINSLDSHTAN
FT                   IGNVLAVIKGVSEQTNLLALNAAIEAARAGEAGRGFAVVADEVRQLAQRTQQSTQEIEN
FT                   TVIELQKGSSSAVELMKTSLEESEKSVQQADAVGDVMKQIISAIKQITDANHSVANATD
FT                   EQNQVVKSLHSDIHVISDLSIQGQSNLNLTLEECTKLKHQFSDLERMVKKFKV"
FT   gene            660576..661682
FT                   /locus_tag="PSM_B0601"
FT   CDS_pept        660576..661682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0601"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70636"
FT                   /protein_id="ADT70636.1"
FT                   /translation="MISKTKINKPSWLNLINIDSVYSFDKQRQVFSLFTMIAIALVLIT
FT                   YLVIANHHVYAPILTIALIVVNVTIVGCIIYFMKTKQIDAIALITLVIVFVMCLALVYT
FT                   GGKENTALYWLMFYPVAAFAILGVKFGAWLSSAMLLSCIVMLYGPDMGQVIYGAVEKTR
FT                   FVAAFSLVLVFSFIGEYFRHRSHLAIADITLEQKQHAHTDQLTGAPNRRFITSHFLKLA
FT                   ASRPEHYLPLSILLIDLDKFKQLNDSYGHDFGDTVLIEFTKLLESQFPATALKARYGGE
FT                   EFVVILPQQTTLEASILANRFRECVQNHVMLTDKHQRVSLTCSMGIAQANSVDDYNNAL
FT                   KQADQYLYSAKAQGRNKVVSVHDQHASE"
FT   gene            661660..662280
FT                   /locus_tag="PSM_B0602"
FT   CDS_pept        661660..662280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70637"
FT                   /protein_id="ADT70637.1"
FT                   /translation="MINTPQSKLIYVHDPMCSWCWGYAPTWHALEAALANKLPIEYRVG
FT                   GLAADTDLPMSQDMQLQLQAIWQKISSQLGTEFNFDFWRDCQPRRSTYPSCRAALIARS
FT                   FNKEPQMIAAIQQAYYLQAQNPSDEAVLIKLSEIIGLDARLFAQLLHSNELKRRFDDEL
FT                   NYVRSLPIQGFPSLVLIHNNRAYPIAINYTDWRQTLIEIQSYL"
FT   gene            662504..663256
FT                   /locus_tag="PSM_B0603"
FT   CDS_pept        662504..663256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70638"
FT                   /protein_id="ADT70638.1"
FT                   /translation="MKGVKPLILAGIVAASAAVHANDLNTVIDKSSEINNLAAQSQTKI
FT                   DKIADSMQGRLQQFKTLNKEIDGLAVYNAQLTKQLNNQIEEMESINLSMDQVSIIERQI
FT                   TPLMLRMITGLEQFVALDVPFLKQERKQRLESLNAMMERADISSSEKFRRVLEAYQVEV
FT                   DYGRTIEAYTALLDVDNKEREVDFLRIGRLELIYLTRDGKQAGSWDQQSQSFVALPDST
FT                   ISQINKGLRIARKQLAPDMLTLPIHAAE"
FT   gene            663267..664634
FT                   /locus_tag="PSM_B0604"
FT   CDS_pept        663267..664634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0604"
FT                   /product="putative Tol protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70639"
FT                   /protein_id="ADT70639.1"
FT                   /translation="MKLLTKMTKMAVFAASLSFVGTSIAAEPMNLDALLKTLEQGKSAQ
FT                   SEQNKQREQEFAARQNEQVQMLKNTQAKRNQMLSESERLETQFEENEIKLANLTDTLSK
FT                   RMGSLKELFGVLQQVAGDSSNKFATSVVSAQLPGRSTFMDELAQKMGSTSKLASIEDIE
FT                   KVWFELQREMTEQGKVSRFNTDVIVDGGNKVQKEVVRVGAFNLISDGQYLEYTPATNTI
FT                   SQLTRQPSSRFTATAADLQQANTGVVPFALDPTGGSILGLLVQAPDTSEQVHQGGAVGY
FT                   VILGVGLLALLIALERFVSLMLMGGKIRRQLKDDTPRDDNPLGRVMKVKDQYPNVAYDT
FT                   LELKLSEAILREMPKITRNLTLIKIISVVAPLLGLLGTVTGMINTFQAITLFGTGDPKL
FT                   MAGGISQALVTTVLGLVVAIPTVFLYTLLNTRSKGLLLILQEQSAGIIAERSEKGA"
FT   gene            664638..665165
FT                   /locus_tag="PSM_B0605"
FT   CDS_pept        664638..665165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0605"
FT                   /product="putative TonB system-dependent transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70640"
FT                   /protein_id="ADT70640.1"
FT                   /translation="MVLLIDSINAIRDFLDTGGQVLLVIAVLIFAMWLLILERFMYFFN
FT                   GYRHYKKDVKNTWKTRSERNSWNAEQIRQAMVSRASMRLNANLPLINVMVALCPLLGLL
FT                   GTVTGMIEVFDVMAITGTGSARSMASGVSKATIPTMAGMVGALSGVFASTYLQRKAKRE
FT                   VELLQDTMVLDH"
FT   gene            665219..665629
FT                   /locus_tag="PSM_B0606"
FT   CDS_pept        665219..665629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0606"
FT                   /product="putative TonB system-dependent transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70641"
FT                   /protein_id="ADT70641.1"
FT                   /translation="MRAPLGNLFQEDEAEEINMTPMLDVVFIMLIFFIVTASFVKEAGI
FT                   DVNRPEAATAVKKERANILVAISDQGEIWINKRQIDVRAVQANIERLKAENPQGSVVIQ
FT                   ADKKATTETLIKVMDASRAAGVFDVSIAAQEG"
FT   gene            665636..666241
FT                   /locus_tag="PSM_B0607"
FT   CDS_pept        665636..666241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0607"
FT                   /product="putative TonB2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70642"
FT                   /protein_id="ADT70642.1"
FT                   /translation="MRYVLALIIAGVVTFILFLGMQALITGGEGAMTEPAKGNVLDFVR
FT                   LKKEETVQKKERKPQKPPTPKEPPPPMESPQMQSSDNNAASNNFDFAANVDADVNLAGG
FT                   LALETSDGEYLPIVKVAPVYPRRALSRGIEGYVIVEFTVTKQGTVKEPQVIKAEPESLF
FT                   DRAAMDAALKFKYKPRVVNGEAVEVAGVQNKISFQING"
FT   gene            666279..667607
FT                   /locus_tag="PSM_B0608"
FT   CDS_pept        666279..667607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0608"
FT                   /product="putative unknown membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70643"
FT                   /protein_id="ADT70643.1"
FT                   /translation="MKLKLTTKLLKLSMLCTVAISASVVTPSALSVFPGINLATVQAAE
FT                   QQKTTRVPALREKVYSQLARAQKLADDGDSKAGLAALDSIQARSSSMNSYEIAMMHNFY
FT                   GFIYYNENDLVKAIASFEKVIAEDGIPETLRLSTTFSLAQLAMANSDYKKVIAFLDKWD
FT                   AINTKPKTDAYYLLRAQTYYQLKDYEQGLSYITQAINLSDSEGKVPKENWLVLQRAMYY
FT                   SLNQTDKVVSVLERMVKLYNKPEYWVQLAGMYGETGQEKQQLSVLEAAYQQGFLTSKSD
FT                   LRQLAQVYLYNQLAYKAASVMSKAIESGVAEKSAKNYAFIAEAMVQAKEDNKSVSYFAK
FT                   AAELSEHGKYDQRMAEVLVNLEQFEDAADAARLALDKGSLDFESNAYVALGMAQYSMQN
FT                   FDASILAFEQAEKHKKSQRLAEQWIKYVKREKLHAETLRTALL"
FT   gene            667918..670707
FT                   /locus_tag="PSM_B0609"
FT   CDS_pept        667918..670707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0609"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70644"
FT                   /protein_id="ADT70644.1"
FT                   /translation="MKLSGLFKISLLASAITLAGCGGGDININVEETVAPPTPPTPPVP
FT                   TDLPGEYSQSLSTEASAALGREVKVQVLSGEITEDTTLTTDAFWALDGAVFVGKDKADS
FT                   ATLTIEPGAVIFGNNGSDYLVVSRDSKIEATGTKSDPIIFTSKQDVMGETTASGQWGGM
FT                   VLLGNGISNKCPAEGDCALQVEGVEAGAVFGGTDNADSSGTLKYVVVKNAGYELSTGNE
FT                   LNGITFGAVGSGTTVDYLQVHNNSDDGVEFFGGAVNLKHVVLTSIDDDSIDWDNGYQGK
FT                   MQFVYVEQDKNSTDANRGIEADNDGKTPSKEPKSLPIISNLTIIGNNFKGEDEAEGIYL
FT                   REGTGLHLYNSVITGSDEMGECLELEGIALDDNGDALFSDSETVNNANDGTILMQNTFM
FT                   SCTNGENFKDPKGADGSTLLALESWFSQQTGNVINDKPMLGVNGQPIAGSPLLGAGQDV
FT                   ANTVDAFFDTVDFVGALNDSDDWREGWAFGYGGGEVTAPAAVAGCPAGTTSISPADNVT
FT                   TTCEISGRITSDLTLTAGNLYAVDGAVFVGNDNADSATLTVEPGVTVYGRNGKDYIVIS
FT                   RGSKIEANGTKDKPISFTSSQDVAGQATAAGQWGGLVLLGNAPSNKCPETGECALQVEG
FT                   VEAGAVFGGTDTADNSGTLRYVRVMNGGYLLSPGNEINGITFGAVGSGTTVEYLQVHQN
FT                   ADDGVEFFGGNVQAKYLVLTSIQDDSIDWDNGFQGKLQHILVKQAADNSDANRGIEADN
FT                   DGKTPSKMPKSNPMIANLTIIGNTFKGEDDGEGMYFREGTGAQIYNTIVTGPVGMGECL
FT                   EVEGIPVDENGAPIFTESETVKNAQDGTLTIKSSVIACSENFKDPSGVDFSVENWWTAT
FT                   LGNLVASGQTDVVNGIYTIDITTPTDVNAVDSFFDTTSHIGAVSSDNDWTAGWTVGLE"
FT   gene            670788..673421
FT                   /locus_tag="PSM_B0610"
FT   CDS_pept        670788..673421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0610"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70645"
FT                   /protein_id="ADT70645.1"
FT                   /translation="MKQFSKKFCLSTLSAAILCSLSVSAHAAEAEDEAVLEEVVVSASR
FT                   LKGTATAVLEERKQQAFVADIMGADQISRSGDSDAASALRRVTGLTLVDGKFIYVRGLG
FT                   ERYSSTQLNGAAVPSPDPTRSVIPLDLFPSGIIESLSVQKSYSLSMPASFGGGNVDIRL
FT                   KSIPDQFVFDVSGQLGYNTNNFDDGIEYNGGSNDWYGVDDGTREIPDSIMDIYNSGQSL
FT                   DDLTPEQSRALALDLNRDYDPQATSVNPNTKFTATLGNSFESGDWRYGFLSAVSYDNKY
FT                   FVGEEYQGEDFRLGENSAAMVRGYDKIIATEHNVKMSGMVNFGIEYNNAHRIDLSTLIL
FT                   RDTEDKIRDRLGIDENNNQSDNKRIRSYDVRYEERELIVNQIKGMHTFDFLNYAGFDWK
FT                   YSNGRSNRYAPGNMQTRFIVNDANEDGNYDLVNEIALTNATTAARYTFQDLNDEVENYG
FT                   FNFTFPIMLDGLDIELKSGADYVSKERSASNRRFDINTRAFKDLDLNGNELNTILSDDA
FT                   IANAELNLPILNDTTFAGDDYRSAQKTDAYYFEADFFFNNKWRLTGGLRWEDFRQVSVP
FT                   LDPFTGGLDPSIDYDDLGNLAFQEDDIYGALAFTYIQDDQTQWRLSYGETVVRPDLREI
FT                   SESTYIDPLTEYPVGGTPGLRTTQIKNYDFRWENYFDTGENFSVGLFYKDMIDPIESVQ
FT                   SPSQDGPPLVRIANAEDGYVAGVEFDYLKDFTFLGGFWQDVFMSGNVTLSDSEINLDRQ
FT                   AIVDQTGVSAAITNTKRRLTGHSKYVVNMQLGYDAPSGEHAATLVYNVFGERIIIPGIE
FT                   GQDDWMEQPFHSVDLNYTYYPDFNSSIKFKVLNILGQKSEIESAGTLTRSKEKGTEFSV
FT                   EYKYQF"
FT   gene            673673..674788
FT                   /gene="asd"
FT                   /locus_tag="PSM_B0611"
FT   CDS_pept        673673..674788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="PSM_B0611"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70646"
FT                   /protein_id="ADT70646.1"
FT                   /translation="MKKVGLVGWRGMVGSVLLERMEQQHDFAHIDTTFFTTSQAGQLGP
FT                   ELAGAAKPLLDASDISELAKMDIIVTCQGGDYTNAVYPKLRESGWDGYWIDAASALRMS
FT                   DDSIIVLDPVNKDVIEQGLEQGVKTFVGGNCTVSLMLLALGGLFEQDLIEWVSPMTYQA
FT                   ASGAGARNMKELIAQMGAIHASVAQQLDNPSSAILEIDKIVSEKMASRDLPQDQFGVPL
FT                   AGSLIPWIDVPMPSGQSKEEWKAQVEANKILGSSKQPVPIDGLCVRIGAMRCHSQAMTI
FT                   KLREDISVEKIEEILASHNEWVKVIPNERDITSTDLTPVKVTGTLSIPVGRIRKLAMGP
FT                   KYISAFTVGDQLLWGAAEPLRRMLRIIVDNK"
FT   gene            674937..675806
FT                   /locus_tag="PSM_B0612"
FT   CDS_pept        674937..675806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0612"
FT                   /product="Zn-dependent hydrolase, glyoxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70647"
FT                   /protein_id="ADT70647.1"
FT                   /translation="MHSKFHVHAFLDDDSETFSYVVSDSNSQQAILIDPVLNFDYKSGR
FT                   SCESGAKKIGEYLQSHSLSLEWVLETHAHADHISAAPYFKKHIGAKIAIGEHIKTVQQS
FT                   FKALFNLEKEFLPNGADFDRLLKDGDSFNVGQLSIRVMHTPGHTPADLVYIINEEAIFV
FT                   GDTIFMPDVGTARCDFPGGSSETLYDSIQKLLSMPDEATIYVCHDYPTEKRNHRFAVTV
FT                   KEQKETNIHVKTKISKEQFVQMRDSRDEELPMPRLILPAIQMNIRAGNPPPAEDNGISY
FT                   LKIPLNQL"
FT   gene            675940..677386
FT                   /pseudo
FT                   /locus_tag="PSM_B0613"
FT                   /note="chemotaxis sensory transducer, Cache sensor"
FT   gene            complement(677419..678225)
FT                   /locus_tag="PSM_B0615"
FT   CDS_pept        complement(677419..678225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0615"
FT                   /product="putative cation transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70648"
FT                   /protein_id="ADT70648.1"
FT                   /translation="MMLSQLQELFQRIDKSKLFQSFVIAVIVVSALTVGAHTYSLHPTA
FT                   ELILHWMDIGITVFFLIELIIRYIASKGIKDFFSKGWNIFDFIIVIGSLYPAAGSTIFI
FT                   ARLLRIFRVLRLVSMIPELRLLVNSLIKAIPQMGYIALLMFVIFYIYAATGSMLFADIN
FT                   PVLWGDVSISMLTLFRIATFEDWTDVMYETMAVYKLSWIFYLTFIFLTAFVFLNMMVGA
FT                   ILEVMSEEHRNAREEQANIDSLPATQGQVNELKAQLAELKELLKNK"
FT   gene            678323..678532
FT                   /locus_tag="PSM_B0616"
FT   CDS_pept        678323..678532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0616"
FT                   /product="putative orphan lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70649"
FT                   /protein_id="ADT70649.1"
FT                   /translation="MLNNKLKYLFSLSALLVLAGCSSDSRYHEIQSARLGECSYMADKE
FT                   YHECVKQQQDSYKEFKEQQAREQQ"
FT   gene            678536..678826
FT                   /locus_tag="PSM_B0617"
FT   CDS_pept        678536..678826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70650"
FT                   /protein_id="ADT70650.1"
FT                   /translation="MTKTQKQLDKRIRQQLTLACEQIKDIVEDFSFLTHSAHLNNLPSK
FT                   FKVSCYFIDDIALEQAKQKNQFDYIEQLICNALASLNIHIKANAISFSKQP"
FT   gene            678957..679151
FT                   /locus_tag="PSM_B0618"
FT   CDS_pept        678957..679151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70651"
FT                   /protein_id="ADT70651.1"
FT                   /translation="MAVPTRSQITPGTEVNIVLKQDQRSGTLTNGIVSRLLTKSPNHPH
FT                   GIKVQLEDGQVGRVKEIIA"
FT   gene            679148..679666
FT                   /locus_tag="PSM_B0619"
FT   CDS_pept        679148..679666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70652"
FT                   /protein_id="ADT70652.1"
FT                   /translation="MSDLTLTDFWRLVTVNDRTAEPESVCQSLKAALSDLSDEQLIEFD
FT                   KQFSICMRQSYTWDLFGAAFVIAGCNDEYGFSEFRCWLISRGEAVFKAALENPDSLAQC
FT                   TPLYFLNEQPYPYLDEYDLIAGLLYEERNDDELPFIPSGLEQPKGKRFKDKPKFLKQNY
FT                   PQLFAKYWQ"
FT   gene            679959..680414
FT                   /locus_tag="PSM_B0620"
FT   CDS_pept        679959..680414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0620"
FT                   /product="hypothetical protein"
FT                   /note="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70653"
FT                   /protein_id="ADT70653.1"
FT                   /translation="MKLFTLVLLTISLFSCYAVAGPSNKTRFIPLLQTKLGNYEVTSSN
FT                   SGLCTNSRLQFNNPEDPEQGFSLGKEILFNSLHNGTRTIEKPNYCFITSSLKYKTDGLE
FT                   NSLRMSRCDNPIHEGTIKQSITFLTSNTLKYTLDNPSVECEFIKVAD"
FT   gene            complement(680411..681667)
FT                   /gene="umuC"
FT                   /locus_tag="PSM_B0621"
FT   CDS_pept        complement(680411..681667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="PSM_B0621"
FT                   /product="component of DNA polymerase V with UmuD"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70654"
FT                   /protein_id="ADT70654.1"
FT                   /translation="MYALVDAVAFYASAEKVFDPAIRSKPVVVLTNNDGCVCAVCPIAR
FT                   KLNIPKFGPYFKVKQLLEQNNVVVRSSNYELYANLSDRMMSVIGRFCDTQHVYSIDESF
FT                   LHFNGYQPLINDWQAYGQLIRRTVWRETKLPVGVGFGPTPTLAKAANHAAKKLTGFNGV
FT                   AVIDDEVSRRTILQRMHCQDVWGVGKRLAKKLALMDIHTAWQLAEQSPKTIRRQFSVVL
FT                   ERTINELNGITCLNWDDVRQDKQAIFSTRSFGQRLCDPDAVKTALINHASVVAQKLRAQ
FT                   QSLTHRIYIFAASSSHEHAFYKKSVMHQFDPPTNDTRVMANAVSKSFEQIYQPGIRFYK
FT                   CGVGALELSPQQFQQHHLFDKQTDNPQLMSCLDAINHRYGKGMLSVASSQLNDHWHMNR
FT                   AFLSPQYTTRWRDIPKIQC"
FT   gene            complement(681655..682068)
FT                   /gene="umuD"
FT                   /locus_tag="PSM_B0622"
FT   CDS_pept        complement(681655..682068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="PSM_B0622"
FT                   /product="component of DNA polymerase V"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70655"
FT                   /protein_id="ADT70655.1"
FT                   /translation="MFVIPIYIEAGVCGFESPAAQYTELGVSLDELLIKHPDATFIGIA
FT                   SGCSMQEIGIFEGDLLLVDRAEIPKDGDVIVANLNGLFVCKLLDKTNARLLSASSAYKP
FT                   VQLTESDEFQLEGVVTRSIRLHRQSPELLSCMP"
FT   gene            complement(682150..682569)
FT                   /locus_tag="PSM_B0623"
FT   CDS_pept        complement(682150..682569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0623"
FT                   /product="putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70656"
FT                   /protein_id="ADT70656.1"
FT                   /translation="MNSSLANTLFALMQNYRVTIREAINAGELGLNAMHVRCLHIIAAT
FT                   PQCTANDIVNQTQRDKAQIARLVKELLALNLIHKNASEHDKRCFILSFTAQGCTLYDKL
FT                   LNAEQHVNAQMCKNLNPQQINDFLNTAQQMIKNMD"
FT   gene            682672..683418
FT                   /locus_tag="PSM_B0624"
FT   CDS_pept        682672..683418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0624"
FT                   /product="putative protein involved in iron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70657"
FT                   /protein_id="ADT70657.1"
FT                   /translation="MGKKVRKATVLSTKQITPHLQRIIVGSDEFNDLSAQYIGNYVKVL
FT                   IPQNGRVDFNIKTTCMRSYTIRHVDEHTGALTLDFVINMHQGPATNWAKEAKVGDEVGI
FT                   AGPGPKKLDNYDHSYYLLLGDLTSVNAIKGYVQQLPINAKIDAIIHAPTKDDVISLDSS
FT                   RDVTWLITNNPDTDMINALKSLPLSEQQPIVFMALEAGLVRKAKTILTDELAIPRSQIV
FT                   ASGYWKKGLDSEAYKLKRQHTAAKNS"
FT   gene            683563..684555
FT                   /gene="yhbW"
FT                   /locus_tag="PSM_B0625"
FT   CDS_pept        683563..684555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbW"
FT                   /locus_tag="PSM_B0625"
FT                   /product="putative alkanal monooxygenase (FMN-linked)"
FT                   /EC_number="1.14.14.3"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70658"
FT                   /protein_id="ADT70658.1"
FT                   /translation="MLSTIPFSLLELAPMPKGATVSDTLNKSTAYAQKAEELGFNRFWL
FT                   AEHHNMPGIVCAATSILVGHIAGNTKKIRVGSGGIMLPNHASLVVAEQFGTLESLYPGR
FT                   IDLGLGRAPGSDPVTSRALNNDISRAENFPNEVSELQTLLGPYEGTKRVRAIPGENTNV
FT                   PIWLLGSSLFSAQLAAQKGLPYVFAGHFAPRFVHDAIALYKREFKPSNVLAKPYVMLAL
FT                   PLVAADTDEEAQYLSTTSKQRVLSLIRGDELWLKPPVETMEGLWSEQERAHVESFLGLS
FT                   VTGGPASIKHKLEMIVNQLGVDELIFTNDLFDNEKRHKALEILMQIKHG"
FT   gene            684780..685775
FT                   /locus_tag="PSM_B0626"
FT   CDS_pept        684780..685775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0626"
FT                   /product="putative hydrolase YjjU"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70659"
FT                   /protein_id="ADT70659.1"
FT                   /translation="MKSQNSTTPHSGNNSVQPKVALIAEGGGQRGIFTAGVLDAWLEQE
FT                   YDPFDLFIGTSAGSQNLTSYLARQKGYAKRLIRGLSRHKRFFQLGRGLMGKHIVDLDWY
FT                   FDKTTEVNRALDFKTAKASLGDRELLITATNARDRKPYFLSPTGEGQQWRELLKASSAL
FT                   PFLYKQGVKLTPWLNALAANELGKTEIQSESDFYLDGGLAAPLPVREAYNRGARKIVVI
FT                   RTVDEAFQAQSAWVSKLKSFVEVSGYCPKTIDYLLQHEQAYEDELAFIANPPKDVEIIQ
FT                   IFANQKLYSKLLGSSNDDLRFDYKLGLAAGHNYLKNHHPDQDDYKHSYIA"
FT   gene            685780..685905
FT                   /locus_tag="PSM_B0627"
FT   CDS_pept        685780..685905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70660"
FT                   /protein_id="ADT70660.1"
FT                   /translation="MFIISKVINHHLLFSWQSFSREKFSFFYLKNNARTVIKARD"
FT   gene            686105..687511
FT                   /gene="yaaJ"
FT                   /locus_tag="PSM_B0628"
FT   CDS_pept        686105..687511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="PSM_B0628"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70661"
FT                   /protein_id="ADT70661.1"
FT                   /translation="MFDTLIKSVNSLLWGEGQVLIYILLFAGIWFSVRLKAIQLVKFTH
FT                   MFSLLKGSSKCDKNNISSFQALCTGLCARVGTGNLAGVAVAISLGGSGAIFWMWVIAIL
FT                   GMATGFAESILGQIYKIRDSNGDFRGGPAYYIQQGLGSRGFAIVFALCLFLGYGFTFSA
FT                   MQTNTITDALNYAFEIPTHYSGIVITLLAGSIILGGFKAIARFAERVVPVMGIVFVLVA
FT                   VIITLINFTQVPSMLKDIFLSAFGLQEAGAGAMGAAIKNGIQRGLYSNEAGAGSVPHAS
FT                   ASASPIPNHPVTQGYIQMLGVFFDTIVLCSCTAVIILLADVNISGEMEGIRLTQSAMTS
FT                   HLAQGGVYFVAAAITLFAFTSVVANYAYAESNLHLFKLDNKVGRGIYTLLYLSMMLWGA
FT                   SATLKQVWDLADIALGLMTVVNVIAIILLTPTILSVTNDYHAQRDKGIEPEFKVKNVKV
FT                   QGKCEDGIWD"
FT   gene            687606..688652
FT                   /locus_tag="PSM_B0629"
FT   CDS_pept        687606..688652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70662"
FT                   /protein_id="ADT70662.1"
FT                   /translation="MIDIFAGKTAAKIINEQGFKPELFTSFLGASGGPKWFTLFGLDKY
FT                   IFGEFFKHRIQPLNLIGSSAGAFRSACFAQNDPVKAIERLAKSYSQTRYSSNKPTPTEI
FT                   TTKARALLEDVFGDDGVTEIINNPVFKAHFIVAKSNGFIASENKLIQLLGLSKSYMLNR
FT                   VNRKLLGSQYERFIFGAPNSDLSITDSYNFKTQNIALTQTNLKDALLASGSIPLVMQGI
FT                   KNIAGSPPGIYRDGGIIDYHFDLKINNPGLILYPHFNSEPKAGWFDKNLKRKVSPQNYD
FT                   NVVMITPSKEFVAGLPYGKIPDRNDFTDLDADTRIKYWNTVFSETEKLAEAFDKKLNAE
FT                   NFDLKLYN"
FT   gene            complement(688885..689031)
FT                   /locus_tag="PSM_B0630"
FT   CDS_pept        complement(688885..689031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70663"
FT                   /protein_id="ADT70663.1"
FT                   /translation="MNDCICNQLIKKGFSPFSLILRTVIYTVISYQLSAISYQLSAISY
FT                   QLK"
FT   gene            complement(690105..690716)
FT                   /locus_tag="PSM_B0631"
FT   CDS_pept        complement(690105..690716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0631"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70664"
FT                   /protein_id="ADT70664.1"
FT                   /translation="MLNADLLTIYLIKGKIMKKLLLLSMLVISVLLTGCATTGSASPGE
FT                   KRALVQSMKSNTLTALYEKKPDVKTQIANSAGYAVFDNANVNVILASFGGGYGVVKNNL
FT                   TGKSTYMNMGEAGLGLGLGVKDFNIVMVFHDQAALNRFIKHGWAFGGNADAAAKYQDKG
FT                   GALVAEAIADQVTVYSLTESGLALQAVLKGTKFWVDSELN"
FT   gene            690808..692019
FT                   /locus_tag="PSM_B0632"
FT   CDS_pept        690808..692019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0632"
FT                   /product="putative site-specific tyrosine
FT                   integrase/recombinase; may be used for the termination of
FT                   replication of chromosome 2"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70665"
FT                   /protein_id="ADT70665.1"
FT                   /translation="MLVALVDTLKQLRYQIAHLEDNTLSSEYPELASFIQQVSLTVTES
FT                   KADLNFLYQFLYVYGRKSEATYSRFRNELERFYLWSWLIAEESVFELKREDIEAYVDFM
FT                   VEPDKKWASKSVQWRYKDEQGIRRLNQNWRPFMLKESIASQQTLSAMFTALNVFYKFAI
FT                   LEEKTFANFVPVVKKNSPYLVVQSQIQIPDTLSDIQWEYVFGVTRDICEKKPEYERNLF
FT                   TLACLKGLYLRISELSERPQWSPVMSHFWQDNDGFWFLRIMGKGNKLRDVTLSDDFLEY
FT                   LKRYRLYRGLPALPRVDESDPLVHKIRGQGGMTVRQIRRLVQQSFDIAQQSLLDDGFKD
FT                   DAEQLEAATAHWLRHTGATHDAQTRPLKHLSEDLGHAKIATTDQIYIQTNIKERAKSGI
FT                   KRKI"
FT   gene            692019..693218
FT                   /locus_tag="PSM_B0633"
FT   CDS_pept        692019..693218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0633"
FT                   /product="putative Na+/H+ antiporter, may regulate cell
FT                   volume and cold resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70666"
FT                   /protein_id="ADT70666.1"
FT                   /translation="MEYLVISFIGVLFLVYSLTFRQLEKTEVTGPMFFVIGGILLATLL
FT                   PNESSRIKTGIDFLLPFIELTLSIFLFSDAAKSKLSVLRHSFQYPSLLLFIALPLTLLL
FT                   GIAVGLFLFADLSVIQAALLAIILTPTDAALSKGLLASTQVPEKIREGINTESGLNDGL
FT                   CVPIFLIFILLAKNPESAITATQTLSVFGRELGLALLIAFTSTAIFIPCLNFAMKRHYF
FT                   AQNTSPFLLLGFAMAVFSITQYFHGSGFIAVFVAGLLFDKYATTKISKELIEDSEHIAD
FT                   FTSLMIWCLFGFVCAYLVLPKLNLAIITYALLSTTLIRIIPVMLSLQFTALTIKERFTF
FT                   AWFGPRGLASIVFTLMVIDTQIENKFQIATIAMTTILFSVFIHGISTKPIADSFAKKTK
FT                   "
FT   gene            complement(693292..696339)
FT                   /gene="ydiJ"
FT                   /locus_tag="PSM_B0634"
FT   CDS_pept        complement(693292..696339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiJ"
FT                   /locus_tag="PSM_B0634"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70667"
FT                   /protein_id="ADT70667.1"
FT                   /translation="MIATITQQDAATELVANYLNTIKNQGFTGDTDASYATRLTASTDN
FT                   SIYQQLPQGVIFPKSEKDIQIALQTASHDPFLSLTFGPRGGGTGTNGQSLTPGIVVDLS
FT                   RYMREILEINVEEGWVRVQTGVIKDQLNDFLKPYGFFFSPDLSTSNRATIGGMISTDAS
FT                   GQGSLVYGKTSDHVLGLTTYLVDGTAMCTSPIDIEKAKIIADQDSLIGQIYKTVLDISI
FT                   SERDAILAKFPRLNRFLTGYDLEHVLSEDLQTFDMSRLITGSEGSLGIVTEAKLNLTPI
FT                   AEFKTLINIKYDSFDSALRHSPFLVDARATSVETVDSKVLNLAREDIIWHSVSDLITDV
FT                   PNKDMQGLNMVEFNAVSPQDIKDKVDTLCKLLDECVENQTNGVIGYQLTSDKSDILKIY
FT                   AMRKKSVGLLGNVKGSQKPLAFAEDTAVPPENLADYIVEFRALLDSYNLQYGMFGHVDA
FT                   GVLHVRPALDMCDPEQEKLLRTISDEVVKLTAKYGGLMWGEHGKGYRSEYGPEFFGEHL
FT                   FTQLRKIKSAFDPNNKINPGKICTPIESKDSLVSVDGQKRSYFDKQISIDVKTSFNNAM
FT                   TCNGNGLCFNYDENSPMCPSYKVTGDRRNSPKGRAGLMREWLRLQESKDVNLLEVEKEL
FT                   NKGEVITWWERFVHSREKNKGIYDFSHEVKASMDECLACKACTTACPIKVDVPTFRARF
FT                   LNYYHSYYARPLKDYLVGSIENSAPLMSKFARIINPIVKTSLVSSIIKKTVGYVDTPQL
FT                   SIPALGKRVNKAQKFDLDLLKKLSADEQNDYVLIVQDPFTSFYEAELVESFITLITQLG
FT                   KKPMLLPFKPNGKPQHVKGFLHEFKVTAKNAAEFLNQLNEINAPLVGLDASLVMCYRDE
FT                   YNTILENNRGDFHVQLAHEWLETQSFKQLTAKQNLNTEFTLLSHCTETTALPKAANVWK
FT                   TIFDELGLTLKTTSTGCCGMAGTYGHEAQNQDNSRSLYEMSWKPIIDKNKPEQLLSTGF
FT                   SCRSQVKRYEKFKPKHPIELLANVLS"
FT   gene            696484..696702
FT                   /locus_tag="PSM_B0635"
FT   CDS_pept        696484..696702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70668"
FT                   /protein_id="ADT70668.1"
FT                   /translation="MKKLLIQISGTLFILLGLLFAVVPGPSLIFFIAGLLCFSMYYPKA
FT                   RGYLAWCQKALTRSCAYLDKKLAKHTF"
FT   gene            complement(696750..699089)
FT                   /gene="ppsA"
FT                   /locus_tag="PSM_B0636"
FT   CDS_pept        complement(696750..699089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="PSM_B0636"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70669"
FT                   /protein_id="ADT70669.1"
FT                   /translation="MQDVPRVGGKNASLGEMISNLANAGVQVPGGFATTSDAFNEFLEQ
FT                   SGLNAKIHDILDTLDVDDVNTLAKVGADIRQWIIDTPFQPSLDKAIRDAYSQLHGDTTA
FT                   DVSFAVRSSATAEDMPDASFAGQQETFLNVVGIDSVMTAIKHVFASLFNDRAISYRVHQ
FT                   GYDHRGVALSAGIQRMVRSDKSASGVMFSIDTESGFEDVVFITSSYGLGEMVVQGAVNP
FT                   DEFYVHKPTLLKNKPSVVRRNIGSKAIQMIYSQDKAHGKQVEIVDVDPALSNKFSITDE
FT                   EVQNLAKQAVIIEKHYGRPMDIEWAKDGNDGKLYIVQARPETVRSNEDTNVMERFQLNG
FT                   SSNVVVEGRAIGHKIGSGVVRVLDSIKEMDQVQVGDILVTDMTDPDWEPIMKRAAAIVT
FT                   NRGGRTCHAAIIARELGIPAVVGCGNATDLIKAGQEVTVSCAEGDTGFIYEGILDFEVL
FT                   TSRVDEMPELPMKVMMNVGNPDRAFDFARLPHSGVGLARVEFIINRMIGVHPKALLNFD
FT                   AQTDALKAEITDMIAGYESPVEFYIGKLVEGISTLGCAFAPERVIVRMSDFKSNEYANL
FT                   VGGQQYEPEEENPMIGFRGAARYISEDFRDCFALECEAIKRVRNTMDMTNIEIMIPFVR
FT                   TLEEGKRVIELLEEHGLKRGENGLKVIMMCELPSNALMAEEFLEYFDGFSIGSNDLTQL
FT                   TLGLDRDSGLIAHLFDERDPAIKKLLSMAIKTAKEKGKYVGICGQGPSDHEDFAAWLVE
FT                   QGIDSVSLNPDTVLETWLYLADKLAK"
FT   gene            699279..700088
FT                   /locus_tag="PSM_B0637"
FT   CDS_pept        699279..700088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70670"
FT                   /protein_id="ADT70670.1"
FT                   /translation="MRTAFYISDGTAITSEVFGHATLSLFPVEFNHKTIPFVETEEKAH
FT                   EIKALINATSSKQGEKPLVFFTFVNHKLSEIIRSADAVSYDFLSTYSEKIEKELNVAPV
FT                   PKVHRTHSIHEKSYDFRIDAVNYALMNDDGGNIKNFAEADIILVGVSRSGKTPTSLYLA
FT                   LQYGIKAANYPITEDDLESEGLPKCLVPYKHKLFGLTIDPERLAAIRDRRMANSKYASI
FT                   RQCRIEVREVEMLYKKHKIAHLNSTHHSVEEISAKIISDTGLERRKY"
FT   gene            complement(700178..701533)
FT                   /gene="aroH"
FT                   /locus_tag="PSM_B0638"
FT   CDS_pept        complement(700178..701533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="PSM_B0638"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase
FT                   (phospho-2-keto-3-deoxyheptonate aldolase) (DAHP
FT                   synthetase) (3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   synthase)"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70671"
FT                   /protein_id="ADT70671.1"
FT                   /translation="MNMQSWNPNSWRELPILQQPQYPDQDVLKSVESQLKSAPPLVFAE
FT                   ETRSLFKQLEDVCEGRAFLLQGGDCAESFSDFNAANIRDTFKTILQMAVVLTYGGKCPV
FT                   VKIARMAGQYAKPRSADLETIDGVSLPSYRGDIVNNFEFTEEARIPDPQRLMTAYHHSA
FT                   ATLNLLRAFAQGGLADLHQVNRWNMGFVAANPQKAKYQQLADKIQDALEFMEVCGINST
FT                   IAPSLKETDLYTSHEALLLGYEEALTRRDHLSGDWYDCSAHFVWIGERTRQLDHAHIEF
FT                   FKGIKNPIGVKVGPGMDPDELIRLIDALNPDNIPGRLTLITRMGADVLPEKLPALVRKV
FT                   QQEGRKVIWSSDPMHGNTEKASSGYKTRSFDNIMREISQFFAVHKAEGSYAGGVHLEMT
FT                   GQHVTECTGGAYGLSDDDLAQRYKTQCDPRLNADQVLELGFLVADLLKDARK"
FT   gene            701862..702008
FT                   /locus_tag="PSM_B0639"
FT   CDS_pept        701862..702008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70672"
FT                   /protein_id="ADT70672.1"
FT                   /translation="MLLNYAFLNIYANASYKAQCLNSALLLFPLKYMKQKYLKNHKEHI
FT                   ILN"
FT   gene            702119..702994
FT                   /gene="tus"
FT                   /locus_tag="PSM_B0640"
FT   CDS_pept        702119..702994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tus"
FT                   /locus_tag="PSM_B0640"
FT                   /product="DNA replication terminus site-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70673"
FT                   /protein_id="ADT70673.1"
FT                   /translation="MVTKVQIRSQFDLLNELTLSLIDELKGVGFAKAEYFQLPEISSTE
FT                   ENIIPESISVSKITGELAHKAILNAFSDMYKKPGLSSRVLKRHPGLLVIKEANKQAIID
FT                   RIAQVNSAKAAFKNCILAIDNNDARFEAVHNAMPNLITLAAYRKIHSEIESPFSVRFTW
FT                   MHKHATKTLTKKMALEMLEKSAGYKNPRMIDQQKWQSLVAQEQVRVASLGEKEKLRIRR
FT                   PTRVSPQVNVRYTAQNRYHVSAALPFILINPQPDVKFGELPSYQKPLSHPRKREYDFLV
FT                   DRLYLEQVTK"
FT   gene            complement(703057..704271)
FT                   /locus_tag="PSM_B0641"
FT   CDS_pept        complement(703057..704271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSM_B0641"
FT                   /product="putative replication protein (repA-like)"
FT                   /db_xref="EnsemblGenomes-Gn:PSM_B0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADT70674"
FT                   /protein_id="ADT70674.1"
FT                   /translation="MSRKVNISVDNLPDTLRGQIHGVESAIDNESLALFTDNKDVRISI
FT                   ENAAHGLRAYSNTFNHYDLWGRFVRSGHKKLPLEEAPKKTIITRKISEKVDGILYDGEI
FT                   KITPAVVSTRKDGEDVEYLVWPSDREEKVERALIRLASKGKIVKINFKSGIQYAVVFSM
FT                   NELAQELKAVGQSMPYPQIKESLEALQGSKLSFKYSATDTKNSDIDDSFYESNMNFLSS
FT                   LHFSGKKGQGGNVKCVACLNAFVHNMIDNLEYKGYYFNSAQELKRGLSRWMMLRLYHLW
FT                   RYAAPGKTYHFRLLSIMEKYGSIYSTDDITENKLKALRRDMTTTMKDLIEKGAISEYSI
FT                   TNVKDDKTGNIVDYTYEMHPSDQFCDEILALNKHNKRIEIQGGKRIVENAVLIDEDKLE
FT                   EIVEK"
XX
SQ   Sequence 704884 BP; 210540 A; 134595 C; 146070 G; 213679 T; 0 other;
     tatttaacca tacttaaact tctttattta tactaagcaa tcttaaaggt gtaaaaatta        60
     ttttatatgt catgtattta aaagacatgt cgccttaaat agttgtttac agctaattga       120
     atggacatta tactaaacac ctaactttga ggaataaagt atgtctatca ataaaaacgc       180
     gctagatact tatcgacttt tgaaagcaac cgcagaagtt gctgaaaaat cactagaagg       240
     acgtatccaa cattatcgcg cccatcttaa atctgaagaa aaagaattaa gaacttacac       300
     ccaaaaagca gcagctgatt tacttggctg taataatcgt accttaaaaa gacgccatga       360
     caatggtgac tttgacgatt taaatataaa acgcggtgca aacggccact atgcctacac       420
     cttagttaat atttttgcta tggctgatat tatggacata cagcctgatc accgcgcatc       480
     aacagacaaa ctccaagtta ttgttattaa ttcattaaaa ggtggttgtg gtaaaacaac       540
     aagcattgtt aacattgctg ctgcactcgc taccactaac attaaacgtt accgtatcgg       600
     tataattgat ttagatcctc aagggtcatc atcaagcttt ttcccatctt cagagcccga       660
     tccaattacc gttggtgatt tgatgcgtga ttgcattgac cttgatgaag gtgaaacatg       720
     gccagaattt gtgtctaatt cttttttacc tactcatatt cctaatattc gtgttttacc       780
     atcaggtatg gatgactttt actttgaaca cgaaacagca acattactca aagacacctc       840
     caattatgag caaacacgcc attaccacaa actactagaa cgagtaataa atccggtaaa       900
     agatgagttt gacattcttt taattgatac agcgccaacg cttaacttta tgttttacaa       960
     tgcattaatg gcttcaacgg cgatgctaat tccggttcac cctgaagcgg tagactttga      1020
     tgcaaataat aaatatttaa aacgtttagg tgagatttat catacagttg ccgctcttgg      1080
     ccatgatggt tgggatttca tgcaattttt agttactaat tatgtgaaag gcaatcactc      1140
     acaacgcgac atagttaaag atgtgcgtag tgcttttggt cgccaagtaa tgagctatcc      1200
     tatcaatcat agttcagcaa ttaccgccag ttcatcgtcg ttcaatacta tctttgacca      1260
     aaaagcatct gacagcttag caagtagaga gtcattaatg cgcgcacaag aaaatatcaa      1320
     agatgtagtt gatgaactcg aaatgctaat tcgttctaat tggcaatcca ctcaatctaa      1380
     attaaatacg cctaagtaag gatgttgact aaaaatggct aaaaaacgta aaaatgacac      1440
     ccgcttagat ccctttgcaa ccgctgttgg cagtagcagc ttagatgccc ttttagagca      1500
     agccaatgca ggcgatgtta ttcgtatgcc tgctcctagt gatcctaatc gggaaattac      1560
     gcttgtttgt aaagtgatag cacataacga gattgaaaac tcaactcagg tttatggtaa      1620
     aaatcgtcgc gtacaagcgc ttttaaacga aaagtcagtc gcagatattc ttcctgctat      1680
     taaagaagat ggccgtaatc agcaccctgc tctattgtgg gagcaaggtg atatgagcct      1740
     tgtattagct ggctctagac gtcgtaaagc ctgtatttta ggtggcgcag actacctcgt      1800
     attgagttct agtgacttta gcgagcaaga tgccaaagta cttgcggttt catcagatca      1860
     atacattgcc ccaagtcttt gggagttggg tcaagcgtat cagcaaacta gaaacgatct      1920
     tattcaacaa ggcaaaaaag gctcgtaccg tgaaattgct gttattgaag gggtatcgca      1980
     tacagcgatt gctgatgcga taaaagcgta tgagcaaata tctgcagatg ttatagccct      2040
     ttacccaaca gctaatcatg ttggtagaga agttgctaaa aagctgatta acgcaaagga      2100
     gcgcgatgag gaagcattta acgagttagt tgttgcactt gccagcaatg atgaaattaa      2160
     cgccttagaa gccgacgaca agcgcgctat gctaattact aaatacctaa ctgcagagcc      2220
     taaaacagca tcaaaacgtg aagcggtttt agaaaatgac tttattagtg tgcaacgcaa      2280
     ccttaaaagt ggtgacgttt caattaaaat aaataataaa gtgatgacag acaagcgctt      2340
     agagcaactt actaagttat taagtgcctt taattagtta gtaatatcgt gatctgtaaa      2400
     aggggttggg ttagttaaaa catgatctaa acctcttttt tagttggtaa aaatctgatc      2460
     tttagtggca taaaaaggct aaaaacatgg cttaaaccat caaggatcat atttttacta      2520
     actaaacacc tccttttaat gccatttttc accttgttag taaaaacctg atctaagcct      2580
     aactaaatct ccttttaaag ttaattaatt gtttttattt tgtaatttaa acgtactttt      2640
     ttagtgagca aaattaaaca atgatcgcca attcgctata aaccaatttt ttactaacca      2700
     atcagatcca accagtttat tttaaaaata atattgcttt agctcagcgc tgataaggca      2760
     tatactggaa aaattgtttt taaattttaa tactttgagt gacatgtctg ctaacttatc      2820
     aaaaaatgat ttaatggcta tttttgaaga aattaaaaat gagcaggcta cccagtttcc      2880
     tctttctgag cgattcataa aaaaattatt taaacccgcg gtgttggcca aaggaaaatc      2940
     gtactataaa aacggccaaa tcagttggtt agaacataat gcagattttt ctgtggttga      3000
     ctctacggtg caaggtgata aaggaatcgc gttcaaccaa cgtattgaga tcagtaaatt      3060
     accaactggt tattcggtcg atacccactg tacctgtaat gttaaaacaa aatgccgcca      3120
     tttggccgct attttgttaa agcttaaaat tgagcattct ggtgagtacg gtgaagatta      3180
     ttttattaat gattggttta gtgaactaag cgcacttaaa aacaccgacc aagctcaacc      3240
     ctcgcaagta ttactgtttg tattagacat agaaaacaac aaagtatttt taacccctaa      3300
     aattgccaac tacgataaaa ataataatta tgcacttggg cgaaatttaa ctgagcaaca      3360
     gcttaatagt tttgtaaccc ctagcgattt gctcgaaagt gattttagat tatatagctg      3420
     gatccgatcg caaaatgcgg tcggtaatat tgagcttaaa ggtcaatggg gttttaatgc      3480
     gctgcagcaa ttactagcca cagacagatt atttttacaa cgctctcgag tacctattaa      3540
     agcgcaacct ggtttacctc ttaactttgt ttgggaaaaa caaaaagagg taacccagtt      3600
     aaaaattcac ttggatcaaa ttcctaattg ggcgttaatt aaaacaacgc cgcctatcta      3660
     cttagattta gataaatata aattaggccg tattcgtacg cccctcagtg ctgatgaaat      3720
     tgcgcactta caaactatac cggcgctgca cgatacaaac tttgaccgaa tttataagca      3780
     gcttgctgat aactttggag taggtgttat tccccaccct actaatacac caagcacgcc      3840
     tgttaagtcg ttgagtaatg ccatacttaa agttagcatg tcgggctcag taatggctat      3900
     ttcgttatcg tttaagtata aaaataaaaa ctatttagcg ggcaccgcgc ctgcaaagtt      3960
     aattaatagc gcctttgaaa acaccgttac caatgagtta gtcaacttag gcttcgattt      4020
     ttgtaaaggg ggtttacaca gcgagtttat ttttagtcag gaatcggcta ttcacttaca      4080
     ttggctagtt cacgaggtac tgcccagctt taaacaacgc ggttggcaag tatcaatgag      4140
     caaagttaat gttgctgata ctaaaagcca aatctcattg catgtaaaca gagctgcaaa      4200
     tcatcaaatg catagtaaag taatgctaaa cgataccaaa gtagccaccc tattaaatgt      4260
     aaataataaa ctgtatgaat cgttaaaccg tcaaagtgaa ttattttatt actaccctgt      4320
     tggccgtcaa tttggggtta ttgataaagc agcgtttaat ttattaattg agtttaaact      4380
     gcggtttgaa tttattaaaa cccgtgacga atttaacatt ccgctttcat acttacctga      4440
     attagttcag cacacagcta ttaatgtaga gctacatgac ccgtcattag agcgttacct      4500
     tgatgaacta aataacgatg cactgctatc acctaacact gccattcatg gcttacacga      4560
     ttctgtagta ttaagagagt atcagcaaga aggcgtggct tggcttaact ttttaaagcg      4620
     taatcagtta ggtgggattt tagcggatga tatgggcttg ggtaaaacgt tacaagtgat      4680
     tgcctactta gcaagctcat acaatacacc gcaagcaggg cctacgctta ttgtgtgccc      4740
     tacaagttta gtgagtaatt ggcaaaacga aattaccaag ttcgcaaaaa gcttaaaagt      4800
     gaccactatt tttggtgcac accgaaatga ttcgttgcag catttggcac aagcgcagtg      4860
     tattttaacc acgtatccgc tattaaaacg tgacattgct tattactcac cgctgtattt      4920
     tgaaaacatt attcttgatg aagcccagta tattaaaaac gataccgcac aagtttcgcg      4980
     gttggtaaaa cgtttaaatg ccgactttaa gctttgttta agtggcacac caattgaaaa      5040
     caatttattt gaattaaagt cattgctcga ctttgcaatg ccctcgcttt taggttcaca      5100
     ggcgcacttt aagcagcatt ttcaaggccc tattgaacgc gaaagcaaca ttgaacgtgc      5160
     agagcaacta aaagcgttaa ttatgccgtt tattttgcgc cgtactaaag cccaagtggc      5220
     tcaagagctg ccgcaaaaaa ccgaacttat aaaagagttt gagtttgaac ctaaacaaaa      5280
     agatatgtat cacggcatta cgcgtgcgct tgaagaaaag ctcatcgatt tatttgctga      5340
     gcaaggtgtg caaaaaagta aactcgcctt tttagaagcc ttgttaaagt tacgccaaat      5400
     ttgttgtcat cctaaactca ttgaacctga aactgaggca gccagtgcta aattagaatg      5460
     gttatcgagc cacttacctt taatgctaag ccttggccgt aaggtcatta tattcagtca      5520
     gtttacctct gcccttgatt taattgccga gcgtttaaat gagctaaata ttaattttag      5580
     tatgctaacg gggcaaacgc gtcatcggga taaagtaata gacgaattta ccagtggtaa      5640
     cacttctgtg tttttaatta gcttaaaagc cggtggcaca gggcttaatt taacccaagc      5700
     cgacacggtt attcattttg atccatggtg gaaccctgcc gttgaaaaac aagccaccga      5760
     tcgtgcttat cgaattgggc aaacaaaccc agtgtttgtt tataaactaa ttatggctaa      5820
     ctctattgaa caaaaagtat ttcaaatgca gcaagataag caagcgcttg tagatgcatt      5880
     atttaccgaa aaatcaatga gttttaccca gtttgacgaa caacaaatgc tgtctttaat      5940
     taaaagctaa aataatttta aaaaatcatg acgagttttt gaacttattt aaattgtagg      6000
     cgtctattaa tatgcttggt taaattgcag tttctccaag ctttcatgtt gatatcccat      6060
     atagtagtta ctagacatag taatgattaa gccagccagt aatgcgctgg cttttttttg      6120
     cttttaaaaa tatttatttt ttatttaatt tattttgaac taatcacaaa tggctgggtc      6180
     tattattatg cttgtagttg atgtgttgtt atacaagttt catgttgatt tccctgtttg      6240
     attactaatt tagtaatatt gagccagctt tattagctgg ctttttttat gcctcaaatt      6300
     caactttttt aaaattattt tgaactaatt taatcagagc gcgtctacaa ttatgcttgt      6360
     agttgatatg ttgttttaca agtttcatgt tgatttccct gtttgattac taatttacta      6420
     atttactaat ttagtaatat tgagccagct ttactagctg gcttttttta tgcgcttaat      6480
     ttagtgtttt accctactgc taaagagcgt aattcgttat gatggcatgt cactaaattt      6540
     taaaagttta ttctatgttt acttcgtttt tatcccattt agattggtta agtgttggta      6600
     ctggcgctat agccggtatg gctattttca gcgttgtatc agtccagtta agtaaaaaaa      6660
     taaagcgcca agtgagtgag cagcaacaag agttattgtt attacaaagc cagtatgagc      6720
     atacgcaaaa tcaatatgcc tctttagtgg aagagcacga cttgttaggg cttactcatc      6780
     aagagcaacg tgatcaggcg caacatttta aaacgcgatt aactgagcaa gaaaaacaaa      6840
     gtcaacttta taatcaatat tggcgtaaaa ccgaagccga gctaaccgcc ctgcgcgagc      6900
     aatacaatct gcgcgatgtc gagcttaata atatacgcac cacccttgag caaaagcagc      6960
     aacatttcag cgagcaactc gcccatatag agcaaagtaa agaaacgctt aaaaaagaat      7020
     tcgaaaattt agccaatcaa atcttagaag aaaaatcgca aaaatttaaa accctcaatc      7080
     aagaaagcat agagcagtta ctcaagccgg ttcaaggtga gctaaaaggc tttagagata      7140
     aaatggaatc tattcacgtt gaagacttaa aacaacgtgc tgcgcttaaa accgaactat      7200
     tgcatttaca agccaaaagc caagccatta ccgagcaggc tgacaagctc agtaatgcgc      7260
     tgcaaggaca aaagaaaacc caaggtaatt ggggcgagtt aatgcttgaa aacgtgcttg      7320
     atagcgcagg acttcgagct ggcacagact ataaacgcga agtgtcgttt aataccgaag      7380
     acggccgtct tcgtcctgat gtggtggtgt atttacctca aggtcgccac ttagtgattg      7440
     atgcaaaaac atcgttaaat gcctataccc gttatgtaaa tgccgaaaca gagctggaat      7500
     ctcaacaagc gattaaagag catgtaaatg ccgtaacttc ccgtataaat gagctggcca      7560
     gtaaatcgta tgaccgttta ccagggataa actcgcctga ggttgttatt atgtttgtac      7620
     cgattgaatc tgcgtttgta gaagcactta aataccaaag cgacatttac cagcaagcaa      7680
     tcgaaaaaaa cattttggtt gctactccta ctaccctgct aaccagttta aatattgtta      7740
     agcagttatg gcgctttgaa gagcaaacta aatattcaaa agagctggct aatcgtgctg      7800
     agcgttttta cagtaagctc aacggctttt taaccagtat ggaaggggtg ggtaaacagc      7860
     tcgataaagc caaagaaacc tacgataaag cattctctca gttataccgt ggtaaaggta      7920
     acttaattaa acaagcctca gaatttaaag agttgggtgt atcggtgcaa aaagagttac      7980
     ctcaagaaag cgttgaacgc gctcacttag agcttgatga ataaacacca catataatat      8040
     ttgcgcactg aggttgtgcg tttatgtggc tagttattta ctaactgcgc aggcactata      8100
     ataatatctg tcctttagga ttaaccacat gcaacgccca accgtctttt tcatttctca      8160
     tggtggcggc ccaatgccat tactaggtga tgctaaccat gcagaaatgc gagcctgctt      8220
     agaacaagtt gccgctacaa tcccaaagcc tagcgctatt ttaatggtca gcgcgcattg      8280
     ggaagctcaa ccaattagta taactgcgca ctcttcaccg ccgcttattt acgattacta      8340
     tggttttcct gagcaggcgt accaattaac ttacccttgt actggccagc cgcaacttgc      8400
     taatttagta cagcaagcgc tcgcaacaca taatattgac tcaaaactcg atccacagcg      8460
     tggttttgat cacggtatgt ttgtaccgtt aaaaattatg tacccagagg ccgatattcc      8520
     ttgtgtgcaa atatccttgc atccaagtct tgatccgctg ttgcatgttg aaattggtaa      8580
     agtgctgcaa cgtattgatt acgataactt attaattata ggctcaggct ttaccttcca      8640
     taatatgcgc gcttttggtg ttacccaatc aagcgatgtt aatcagcaaa atcaggcatt      8700
     tgaaaattgg ctggtaagca caatcgcaga tcaaacatta accgagcagc agcgtgaaca      8760
     gcaattatta gcatggcagc aggctccagc tgcacgcttt aatcacccca gagaagaaca      8820
     cttgttaccg ctacatgtat gctatggtgc tgctatgtgt tcaagcactg aggtatttga      8880
     attaaatatt gccaataagc gagccagtat gtatttgtgg caataataaa aaacacgcca      8940
     gactttgcta ggcgtgtttt ttggttcttc tgcatttatt gcagcggtta agcggcaatt      9000
     accatttcat ttcgccttta tgaactttag cgccaatgct aagagccata ggtaatacag      9060
     cctctgggta tgagttggtc attttatcta tcagcagttt actgctaccg ctactttgct      9120
     tagcgtgtgc aaaatccttt aaatactgaa ttgaaaaatc aatatttgca gcatctaatt      9180
     gggtgcctgc tttcatatgc cctgggatca ccacgtcagg tttaagtgct ttcatttcat      9240
     taagttgttt tgcccaggca tcttgctctg cttgagtttg cgcatcggcc atccataaat      9300
     gaacattagc gtatacagcc acattcccta aaatggcttt gttatcaggt atccataaat      9360
     aagggcgatg attatgctca ccctctgtac cacgaatttc aatggtatgg ccttctattt      9420
     ttaagctatt accattaaat accttaggaa caacggggtc ctttggggcg ttttcaccca      9480
     tttttggcgt ccagaaagca agtttacctt taagctttgc tgctattttt tggtgcactg      9540
     ccggtgtggt tataatcttt gcgtcaggaa aaaactgctg taacacttca gcgccaaagt      9600
     agtaatcagg atcggcttgg ctaataaaaa tagtttttag ttgtttacca gagtcaatta      9660
     ctttggcggc aatgcgcagt gcatctgctt tggtaaatcc ggtatcaatt aaaattgcat      9720
     cggtacggcc ataaaccagc gtggcattaa catgaaagct attgctgtca gcgttataca      9780
     catcaagggt tagtggggtt tcgtctgcaa tagcgatatt gctggctaat agtgtgctta      9840
     gtaaaagcgt gcgtaggttc atagtattct catcattggt tgttaatgcg agcataataa      9900
     aggtttgata tgttcagaaa aacaaccaat aattagcatc attgtttcat aaatcgtgca      9960
     aatactatgg ataaactcac cgcagcgcag gtttttgtgg atgttgccta ctcaggcagt     10020
     tttactgcca ctgccgatcg gcttgaaatg tcacgcccta tggttactcg tcatattgag     10080
     tcggcagagg cctggttaaa tacgcgctta ttgcatcgca ctacccgtaa agtaacgctt     10140
     accaccgccg gcgaggcctg tttacccgaa atagagcaat ggttagcaca ggctaaccgt     10200
     ttagttgaac aaactaaaag ccagcaacag ttgtcaggta aaatacgagt agcgaccagt     10260
     atgtcgttag gttttgcaca attagcccct atatttacac gctttatgaa acgtcaccct     10320
     agcgtgcaaa tagacataga tcttgaagac tcaaccacag atctaataga gcagcgtgtt     10380
     gacttagcaa tacgtattgc agccaatcct gatccttcgt taataggtaa acctattgcc     10440
     gagtgtgaat ctatattagt ggcctcagcc agctaccttg ctgattatcc gccaataacg     10500
     acaccacaac agttaagcac tcatcaatgt ttaggctata aaaactttga ccgatatatt     10560
     tggcatttac acaacgggga tgaatttcaa tcggttgatg ttaaatgtaa tttaagtgca     10620
     aacgaggcca ccacattact tcatgcagcc atagccggtg gtggtatttc agtgcagcct     10680
     acgtatttgg caaatcaata tatactggat ggtcgcttgc agcgtgtatt agcgccatgg     10740
     acattaaacc caatgaaaat atatgtgctt tacccttctc gtcagcattt atcagcaaca     10800
     gtaagagcac taatcgacac gctcagtgaa gaatttaaaa atccagcatg gtaattaatt     10860
     ataaaagttt gggtttaaac catagctttg tgcgttaagc atgctgatat tgtgtacgtt     10920
     attttgttac agtaaatgta ataagcgcct taatctataa aggtcaacag acccaaggaa     10980
     caataacaat gaatctgatc aaaacatcgg gcttggcact ggccattgtt gcgggcttag     11040
     gcttgcaagc atgttcaagt accaacataa caaccaacaa caatgcagcg atgagtaccg     11100
     tgaataatcc attaagccta gcgcaaattt ataaagataa agagtttaaa acccagcgta     11160
     gcacctactt taagtggcta gacgatggta ctggctacac tgtgcttgaa gagcgcgaaa     11220
     gcgataaaaa gcaaacagac gacacccaag ccgatgacga aaaagagcac ggcgtaaaag     11280
     gcaacgacat tgtattttac aatgctgacg gcacaggccg taaagtactg gttgagtttg     11340
     aaaagctgtt gccagagggc gcagacgagc catttgcaat cgaaagctat cagtggtcaa     11400
     aagacggtaa atggctgatg gtatttacca acagtgagca agtttggcgc tcacgcagcc     11460
     gaggcgactt ttggttactt aaccttgaga ctaaccaatt acagcaactt ggtggtaaag     11520
     acgttgagcc aactaagtta atgtttgcta agttctcgcc agatagctca aaagtggctt     11580
     acgtacgcga taacaacatt tacatgcaat cggttggcag taacgatgta accgcgctta     11640
     caaccgatgg ctgcgccacc atagttaacg gtaattttga ttgggtatac gaagaggaat     11700
     tcaccattgc cgatggtttt cgttggagcc ccgacaacaa atcaatcgcc tattggcagc     11760
     ttgataccag tgacgttaaa tttttcacta tgattaacaa caccgacgaa ctgtacccta     11820
     cccttaaaga attcccttat cctaaagccg gtgaaaccaa ctctgccgtg cgtgttggtg     11880
     tggtaagcct tagtgataaa caaacccgtt gggctgagct tgaaggcgat aaccgcgacc     11940
     gttatattcc gcgtattagc tgggctggca ccggtaatga attaatgatt caagacttaa     12000
     accgcccgca aagccataac aaagtgtggt tgtttgattg gcaaaagcag caactgacca     12060
     agattttaga agacaaagac gatgcgttta tcgaatggtt ttataaagca aactggtcaa     12120
     aagacggcga gttttttatt tggcatagcg aacgcgacgg ttggcgtcat ctttatcgtg     12180
     tatcgcgcga tggcaagact attatcgacc taacccctgg cgattacgac attattgata     12240
     tgcttaccat caatgaagac aaaaacgtga tgtattttat tgcctcgcca aacgatcctg     12300
     gtcagcgtta tttatacagc acaccgcttg atggcagcag caaaccggta cgggtaacac     12360
     ctgctgagtt tgagggatca aacagctact acatgtcaaa agatgcctca tgggcaatgc     12420
     atacttactc aaaatttggt acgccaccga ctaaagagat cattaaagtg agcgatcata     12480
     gtaatgtaaa aaccttagtt gaaaatacaa agctcaaaca aaagcttgct gagcaaagct     12540
     taccaaagca tgagttcttt aaagtaaacg cgcaagatgg cactgagctt gacggctata     12600
     ttatgttccc agaaaacatg gataaaagta aaaaataccc aattgttttt tacgtatacg     12660
     gcgaaccatg gggctctacc gtgcaagacc gctgggaagg taacagttac ttatataaat     12720
     cgttactaac gcaaaaaggc tttattgtgg catcggttga taatcgtggt acacgtgcac     12780
     caaaaggccg agattggcgc aaatcaattt ataaaaaaat tggctcaatt accgtgcaag     12840
     accaagtaga cgcgcttgat gctatggcta aacgctggga tgtaatagac accgaccgtg     12900
     ttggcgtatg gggacactca gggggcggta gttcaaccct taacttattg ttccgccacg     12960
     gtgataaatt taaagtaggc attgcctcag cacccgtgcc agacattcgt ttatacgaca     13020
     ccatttacca agagcgttat gcgggtaacc caaataccga tcctgagagt tacgataaca     13080
     cctcgcctat tacctttgct aaaaacctaa ccggtaagct attgcttatt cacggcacag     13140
     gcgatgataa cgtgcattat caaggctcag agcgtttaat tgacgaactc gttaagcaca     13200
     acaagcagtt tgagtttttc tcatacccta accgttcaca cagcttgcgc gaaggcaagg     13260
     gcaccacttt gcattaccat actatgatgg ccgacttttt tgaaaagcac ttattaaaca     13320
     agtaatcgct ttaaaaaaat aaaatactaa agccgcacac taattattag tgtgcggctt     13380
     ttttaatcaa aatgtaacgg gggtttacaa agcgtaagtt ggatagagtg caacgaaact     13440
     caacaataat aaaaaatgac ttatacactc aatgtcatct aaaacagcca aggctcacca     13500
     tgttattagc catttttcaa tttcgatagc atcatcacga tcaaacacca ttaaacttga     13560
     atgagagcga gcattaaaag ttattttttt tactaactca ttttgtatag atgaaaagta     13620
     agccgggggg gatagagagt caacatctga gttaattaac aatacaggct ttttagtctc     13680
     agttaattta ggcaataaat ttgtttcttg aatggttact cctgcctcaa acattgcttg     13740
     gttaacaata ttatcaatct cgctatgaaa aaaatgacta agcaaaggcg atttataagg     13800
     taagtactcc ttagctgcaa cgtcaaaact catcattggg gcaagtaaaa tagcagcgtc     13860
     aacatattct gatgataata agttacttgc agtaagtgct cccatagaat ggccgactac     13920
     aacagtctgg ttatttattt gatttaaaag tgattcagca agcagttcat ttaaaatgcc     13980
     gtgctctttt gctgcaaata caaatgcttc agttgattca ccatggccaa aaagatctgg     14040
     aataataacg ttcataccaa gcgctctaaa atagatagct gaagccatca ttgcttcttt     14100
     actgccccca tagccatgaa gtaataaagc agtgccttca aaacgattaa atgtgtctgg     14160
     tgtcattctg tgtgaaattg tattttctac attattacca gttgcatgaa ggttgtaata     14220
     aacagaactc tcttgcgaaa attcggctgc ttgataaggt tcagcagtca gatatgtaat     14280
     gcattgagtg gtactaaaag agcaaaactt ttgtttttca aagccaatgt cgctaggttt     14340
     tgcttttata aactgtgctt cagaaagata gataccgggg tttgacatga cgtaactgcc     14400
     aattgaagta cagccagaca aagaaaatat ataaagtgta attgctaata gtttggtgaa     14460
     attttccatt ttcgcttcat tagttaaact tgaacatcaa cactttaatt aagcagataa     14520
     cgtcctatga ggtggaggag gttttagccg ttagttaggc atttttttat catttcaaag     14580
     taccttaaca gtatcttcta tccacctcaa ttttctcaag taaataaatc tgtttggcat     14640
     taagtagaca cttgcttatt aatcaaaacc caaatttagt gcttagttac gattttgagt     14700
     tttttttatc taagttttat ggatttaggg gctgaaattt aactctcttt tttaatcaaa     14760
     atggtgtgag gggtttacag ctgaggtcaa aggttaaagg aaaaagggca aaggttttta     14820
     gttattgtga gttgggtaga gtcgaacaaa gcccaacaag gaaatactgc tcaatggcaa     14880
     taattgaatc atttattgct aaacataact tggaattaga gaggtattaa aaaagtagca     14940
     tccttgctac tacaagtgcg atattaagag cttggttgcg aaggttgata cttattaacg     15000
     agaatgtgct gcaaactttt aagtgctcgc tttatcgctt gcagcatact tcttcccttt     15060
     gtatttacat taatactggg tagcccaggc aaaagaatat taattttgca ttgctgcaaa     15120
     gtgccgtggc gatcactcga aagatcattt atttgaatct caactttacg aatatttaaa     15180
     gcatgttttg ccaattggct ttttatcaac tttaaaagcg acatcttttc acttgcgtta     15240
     attatcttgt ttttaactgt aagttttagc ttcatgcaat tacacctttt aatagtaact     15300
     atgttgcagg catgactgta atctactaac ttagtggcaa aggaaaaagc tgattatttc     15360
     ttactttaaa acaggtattt tcgaatgatt accaacatta actacaatca cttatattat     15420
     ttttggcaag taagtaagca cggcagtatt gcagcggcga gtaaaatact taatttaacg     15480
     ccgcaaacgg tgagctcgca aattactaac ttagagcaac gactaggaaa accgctattt     15540
     attcgtcaag ggcgaggcct acagttaacg gaatttggcc atgtaaccca gcaatacacc     15600
     aatgatatgt ttgctattgc ccatgaatgg ctagaaacca cgcaaggtga taccacgcac     15660
     tattcacgaa cgttaaaggt gggtatttca gacgtgttgc ctaaatcact ggtgtcgaag     15720
     tggctagcgc ctttaattaa taacgaccgt attacaaact tacactgtat tgacggccaa     15780
     caagatgagc tgcttgcaca aatggcgatt cataagctcg acttagtgtt agccgataaa     15840
     ccactcgata ccaccttgcc atttaaggcg ttttgccatg aaataggtaa aagccaaatt     15900
     gctctttttg gtaacgaaac atggcattcg cagttacata agcagtttcc gcagtcttta     15960
     aataacaagc ctttagtgct ccctgcaaaa gaaagccccg tcgcgcgtgc tatttattat     16020
     tggctgcaag agcaagagat tgaaatgaca atagctggcc atgttgacga cagcgcatta     16080
     atgaagtcac tcggtgagca agggtttggt atattccctg cgcctatttt ggtaagagcc     16140
     gaagttgaac gccattacgg cgttaattac attggtacaa ttgataatgt ttatcagcat     16200
     tattatgctt ttacgcctga caggctcatt aaagacagta tttatgatga atttataaag     16260
     cacgcgcaaa tgacgtagat tttagttaac cgtcttaaga ttaacgggcg tcggggtgcg     16320
     ggttacggat ctaaaacctt acacttctca tacttcaaat aaatatatta aaaatatcaa     16380
     caaagcgata aagaatatcg gagtgagcaa ataaaatatg atattggcta ctattttatt     16440
     gttatctcta aactttaata ttttttggcg tgcggcaatt aaggctggaa atgtaataaa     16500
     cccttggata ccgatagcta aagtaatagt aagttgcatg ataataattt gccagtattg     16560
     ctctgggtca tcaattaacg atgcttgttg atagtcgctg cctgtcgttc caagctgatg     16620
     agcagttcct gtaattaacc ctataatagg tgatatcaaa aagaacaaag caacacttaa     16680
     gattgtttta tcaactttat cccttaattt aactattttc atagcatcct tgccttaaag     16740
     ttttttattt caaaatatat tcacaagcaa gcctgcgaac tttaacctta tcgagtaaac     16800
     atattaattg ccattacaat taataagccg gcaaatattt tctttatggt tgaaactggc     16860
     aaataatggg tggctttagc accgagtggc gcagtaaacc atgaggtgca tacaataccc     16920
     aataaagcgg gcaaatacac aaagcctgca aatccttgtt ttaggctaaa taactggctg     16980
     cctgagctga tataacccag tgaaccaaac agcgctatca caatgcctga ggccgaggcg     17040
     cagcctatgg cttttttcat atcaacagaa aaaaacgtca gtaacggcac caatactgcc     17100
     ccgccgccaa taccaatcat ggcagacaag ccaccggtta tggtcgtata aacactgagt     17160
     aaccctttgt ttggtaacgg gcgcgctatt gctgaatcat tcttaccaga aaaaatcatt     17220
     ttaagtgcaa ttagcaccac acttacagca aataccaaac gcactacatg ctcaggtaac     17280
     agcgcagcca taaagccact aataagcgcg ccaaaggcaa cgcctaccat aacccaaggt     17340
     gcaatattcc agggtacatt gccattttta tgatgcgcaa tagccgacga ggtcgaggta     17400
     aataaaatag aggccagcga ggtcgcaatg gcaaccacca ctacttgctc aggtggcaaa     17460
     gcattaaagt gcagtaatat catgctgagt atgggtacaa taaccagccc gccccctatt     17520
     cctaataagc ctgctaaaaa accaacaccg ctacctaata tggcgcagta tataattaac     17580
     actattaaat cactcattcc ttttgtctct tcttatgtta agggttgtta tgctctgtgg     17640
     cggtgagttg cgtgtaaaaa acgtttaata aaacatctaa gctcaccaag gtttattcga     17700
     gtatatcaac aaccgtttat gcaaatggca ctttaagtac ttataagtat tgaataatac     17760
     tcacgttttg tatgaataaa tcacaacacc cgtaaaaaca tctagaaatc tagacttcta     17820
     aagcggtttt tgtgagaggg tcataggtaa ttagctgaat ttacccattt aactttgcta     17880
     cagaatgaat ctggctcatg ttttacctga aataataccg tttttcttca tgctacatag     17940
     cgcgtataaa tttattaact ctgcagagca ccattacagc taacccgtta tgtcggtttt     18000
     aacagcgagt aatgcgccat caataaaagc agcaacaact caaattgaaa ggatacggct     18060
     atgagcactg atcttacatt tactattaaa agcactaact tggatgaaaa ctatcatcca     18120
     tcaaataaca cacgtatcac gaccaacttc gctaatttag caaggggtga aagccgccaa     18180
     caaaacctgc gtaataccct aaaaatgatc aacaatcgtt ttaatgctct ggctagttgg     18240
     gataacccac aaggggatcg ttacgaggtt gagctcgaga tcatttcggt tgatttagac     18300
     attgcaggca gtggccaagc atttccgtca attgaggtat taaaaaccaa tattattgac     18360
     cgtcaaacca acgagcgaat tgaaggcatg gtgggtaata acttttcatc ctatgtgcgc     18420
     gactacgact ttagcgtgtt attgcttgag cataacaaaa gcaaaccgca atttagtatc     18480
     cccgataatt ttggtgactt acacggtaag ttgtttaaat gctttgtaaa ctcagatacc     18540
     tataaacagc attttaaaaa gccaccggtt atttgtttaa gcgtgtctga taacaaaacc     18600
     tatcagcaaa ccgaaaatct acaccctatc ttaggcgtag agtatcagcc taatgaatcg     18660
     tcgttaactg agcaatattt taaaaaaatg ggcttacaag tgcgctactt tatgccacca     18720
     aacagcgttg caccgttagc gttttacttt tttggtgacc tacttaacga ctacagcaat     18780
     cttgaactaa ttagcaccat tagcaccatg gaaacgtttc aaaaaattta tcgtccagaa     18840
     atttataacg ctaatgccgc cgcaggtagt cgttataaac caaatttaaa aaatgatgat     18900
     cattcattaa cgcaaattgt gtatgaccgc gcagagcgag gtcaattagc ggttgagcaa     18960
     ggcaaattta ccgagcagca ttttattaag ccttatcaat cagtgctgca gcagttctca     19020
     gcaagtatcg cttaaccaca caacaaaatt aaaggcagca tttattatga aaaaactatt     19080
     acccacatca tcagcaggca gtttgccaaa accgtcatgg cttgccgaac ccgaaacctt     19140
     atggtcaccg tggaaattaa aaggtagcga gctgattgat ggcaaacacg acgccctgcg     19200
     tatttcccta cacgagcaac aaaccgcagg cgtagatata gtcagcgatg gcgaacaaac     19260
     tcgccagcac tttgtaacca cctttattga gcacttaaat ggcgttgatt ttgaaaaccg     19320
     taaaacagtt aaaattcgcg accgttacga cgccagcgta cccacagtgg ttggccctgt     19380
     gtctcgcact aaatcggtat ttgttgaaga cgccaagttt ttacgccaac aaaccaacca     19440
     accaattaaa tgggcattgc cagggcccat gaccatgatc gacaccctat atgacgatca     19500
     ctataaaagc cgtgaaaaac tggcatggga atttgctaaa atacttaacc aagaagccaa     19560
     agagctagaa gccgcagggg tcgacataat tcaatttgac gaacccgctt ttaacgtgtt     19620
     ttttgatgaa gtaaacgact ggggcatagc ctgtctagag cgagccatag aagggttaaa     19680
     atgcgaaacc gccgtgcata tttgctacgg ctacggcatt aaagccaaca ccgattggaa     19740
     gaaaaccctc ggcaccgagt ggcgacaata cgaagaagta ttccctaagc tgcaaaaatc     19800
     gaatatagat attatttcgc tagaatgcca aaactcacat gtacccatag agctactcga     19860
     actcgtacgt ggcaaaaaaa taatggtagg cgcaattgat gtagccacca atactataga     19920
     aacccccgaa gaggtggcca aaactctacg cgaagcgctt aaatatgtag atgccgacaa     19980
     actatacccc tgcaccaact gcggcatggc ccccctgccg cgcgacatcg caaacggcaa     20040
     actcaacgct cttagcaaag gcgcagagct agttcgtaac gagttattag cagcgaatgt     20100
     cgcttaattt ttagttacag ttgctgaaaa aagccacacc taaacataag ttaaagtgtg     20160
     gcttttttaa tcaaaatgta acgggggttt acacaacgag gttaaaggca aaaggtgcta     20220
     ggtgaaaggt ttaagttcgt tgagtgttag ttgggttgag tgcaacaaat tagcttaagt     20280
     aatcaaacct aaccgagccg ctaggtatta ttgattgagt gaaaagtgcc tcttgcagac     20340
     tatcaagatc tataatgtct gaagtcaaga tttgacccct tccgttcata gcaaaaatag     20400
     ttaaatttaa ccgagccgct aggtattaat gactgagtga aaagtgtcaa ttgtagaaga     20460
     tggcaacgcc gcattcagcg gcttgcccgc ttcaatgctt tgttaaatga tatttcaccc     20520
     actagctctt ctatgcttat attccccttt cggtgaagca ttgcatgaca atttgggcaa     20580
     actggacgta aatctcttat cgggttaata tcatattcag atttgatctc cgacacagga     20640
     gtgaggtggt gcacatgaat gtaaccttca cctcgctttc cgtaaaactc aacgaaacta     20700
     aaatcacata cgcagcaacg agttccgtat tctttgatac acaaatttct tgcttcgggg     20760
     ttgcgctcgt atgcatttac agtaattgtt tttcttgctc cttccttgag aagctcgtta     20820
     acttcttcag caaaggaaaa attatctaaa agataaaccc ctcgacttgc tagctcacta     20880
     ccccaatcaa gttcacaggc aatctttatt tgatgtcgct gccaagcaaa gtccatgtcc     20940
     tgctttttgt gaaattcaaa ataagacttt gacggaaaca aagctctgtc agggtggttc     21000
     ttattattta tgatgattcc ggtaacagca ggcaatttat tattatgaag ccattcagct     21060
     aacccaccca tagcatgttt gttcaaacta tagccaggtg ttcttccatc atttggaaat     21120
     tctaaatcat taagtacctt cgaatagggt agatgtgtca ttgggttatt tgtatcaata     21180
     gcaccacttt ggatatgtga aactaggtaa tttagaagcc tttcctcatt cgaattcaat     21240
     ggcgatgctg ctcgggtttt gaactccaag aactctaaat aggctttcaa tgcagactgg     21300
     cagtttcccc aataattttt ttctttaagt gaagctttca aacgtcgtag aatatcctta     21360
     acagactcgg agctatatac agaatctgca gttatatcaa tgtgtagatg atttgtgatg     21420
     gcagataaat atgtagggta gctatttacc gtaccctcga ctaagcctct cacatccctt     21480
     aggtatgatt tgtagccttc aacatcttct atcatcacaa cctccatatc atttatcgcc     21540
     ttgctcaacg gcataggtga cagcttacct atgtccgatt gaagcttttt ttaggcactt     21600
     tgcttattct taattttgtt aatcagttct tggactgtac ttttcttagg gcgctcccat     21660
     agcgcttttc caagccaaaa aacacatagc cccgccgata ttatgaatat tgcagcccaa     21720
     gtatcagcag ctatgcttaa tgattcttta aactgcgttg tagttaaaac caatacaatg     21780
     gttatcagca aagcaagagg agtatgccat gtgttgcgcg actcaattga cgagagatgc     21840
     tctgccaata acagtttgag cttatcttca gtaatttcta ttagctcttg tccgacattc     21900
     ctgtgaattt cttcgatttc cactcctggt gaacgccggt aacgaatact attactctga     21960
     gacattagta cctccgagca tagtttgaat gtctactcgg tataaactac ctagttttgc     22020
     gacattggct agaatataga tcaattcccc cttttctgtc tcccccacct caataggctt     22080
     tcctgtactt acacctattg gggagtccca atttacgaat gtaagggaga gataattttc     22140
     ctcacctgaa aatctgaggg atcttgtttt tccttccttt tcattttcag gctcttctat     22200
     ttcaaaatta agagaaaatc gttgctgatc cccgtcatgc tcaaactcca gaagcgctga     22260
     ttcagcctca ggaaccagca atgaagaaaa gtttattact tcatttccat ttacttttat     22320
     agtcacgtat tactctctat ttcgcctaac gcctctataa ccggcgcagc tctgctgcgt     22380
     ccggcgccga aggcgcgaag ttgattgact tgtatggata ataaacccat aaattaatta     22440
     ttattttaac ctagttcggg taatgtgagg cccaagcttt ggctgcaacc aaagcctttt     22500
     atacagtagt tcgattgatt gaaggctcct ctattgagag accggtaaca agttagaacg     22560
     ctgtgtaaac tccaagcatt aaactcggat agtcaacggg gcctcgagcc cgaatagcaa     22620
     ggcagagtca gcttattatg aatacaaaaa ataatcaaaa tgaaattaac gtaggtgtcg     22680
     atacaggtaa aaaacaactc gatatttata tcaggccttt agacatttac tttactgtag     22740
     aaaacaatca aagtggcatt aaacacgcca ttcaaatctt aaaaaaacac cccgtaacgc     22800
     gcgtcactat tgaggcgact ggatgaacca aaggggtctg aaccaaaggg gtcaaatctt     22860
     gacttcagac atcaaattta ttgaaccaaa ggggtcaaat cttgacttca gacatcaaat     22920
     ttattgactg acccgttatc cttattttgc ctattagaca aagtctaaag caacaagata     22980
     aatcagtaat cccctacttt tagctattac tttgtttgat ttctaactag cacttacaaa     23040
     ctcaacagtc cttctaccca ttctaagaca aagcgtgtgt ctcggatttc aaaggattgt     23100
     ttattaatta cttgatcaaa taccatctta caatgcggta tttttaacca aaccgtaacg     23160
     ggggtttaca gtaacagctt aaaacgtcgg tgctgttact gtactttatt aactgataag     23220
     gtaattaata caaagcaata aaatcgcgtt ttagtaacga ttgaacagga gtaataaatg     23280
     gcaaccacac tggcgtttga tgtatacggt acgcttataa acacccatgg cgtggtgtcg     23340
     ttacttgaaa atatggttgg tgataacgcg cacgcatttt caactacttg gcgtgaaaaa     23400
     caactcgaat attcgtttag acgcggctta atgcaaaact atgtgccgtt ttcggtgtgt     23460
     actgagcagg cacttaatta tgcgtgttta ctacacaagg taactttaag cgatgagcaa     23520
     aaagcacagt tattagcacg ttataaaacc ctacccgcat ttgatgatgt aaaagcaggg     23580
     cttgagagct taaaagcaca aaactatcgg ttatttgcgt tttctaatgg tgcggccagt     23640
     gcggtaaata ccttgctaga aacggcgggt ataagtgatt attttgaagg cgtagtgagc     23700
     gccgatgaca ttaaaacttt taaacccaac cccggtgttt atagtcattt tttacacgag     23760
     gcacattcaa ccggtgctaa tacctggtta atatcgagta acccgtttga tgtgattggg     23820
     gcgttatcgc atggtatgcg tgctgcgtgg atacagcgct caagtgaggc tatttttgat     23880
     ccctgggaac taacgcctac aataacggcg tgcgatttac atgatttaaa aaccaagcta     23940
     gccagtaata aataaccaat gatttagtgg gcaggggtta aattacagca atgaaaggct     24000
     aggtttgcgc ttacaaacct agctgttttt tagtcttcaa ttgcaatagc aatttctatc     24060
     tcgttactgc ttttatagta ctcaaagtcg ctagtgtagg tgcgggcata acggcaatcg     24120
     tctgagctga agtattgcca aatttcgccc cataaatcga ttactgcatc gggcatttca     24180
     ccctcacctt taaataccaa ataacgcccc gcttgggtgg ttactttttt agcttcaggg     24240
     agtttaattg ataaattatc gcagcaggca attacgtcaa agtccccagt gagatcgctt     24300
     tcgtaattag tatacacacc atacactttg gtgttttctg taaggctgtt ggcaaacttt     24360
     tcaccaaatt tttgccaaag ttcagctata tttgcagtgc cagcattcat ttcattggcg     24420
     ttgcaggttc ttacttttaa gccgattaag gtctgacttg ctaattgttt tacttccatc     24480
     atgacgtcct ttagcgttaa tacaaacacc aacgtaacag aaaaaccgcc aatactttaa     24540
     attttgtatt aaatatttca taaacagtga ttattaacct caatttcgtg tttattgctc     24600
     atgttgaaat aggagccaat cgctaaacgt agctttgcta ccgctaaaat aattgctcaa     24660
     ttcccccttt tttaacttta tttttgcatg taatgcttgt cgtttaataa tatggtttat     24720
     cgattttagt taaaaatata cgacaagctt attagctcta attaaaaaaa agttgctatc     24780
     taaccttttt tcattattgt aaatgggaat cattatcatt aagatcctta cacctaaaaa     24840
     gtgtactcaa ggaatgttga tgtgtctcaa tctcaagtgt taaatattaa taccattgaa     24900
     aaacaggctg tatttgaaca aagcggcttg cccccacaat tcaatttaga gcagttcatt     24960
     aattatcaga tagcgtcatt gcaagggttg tcggcagttc agcaagcgat ggctaaagcc     25020
     caaaagccat tttcaggtgt gtcggtaaat gcgttagcag aagtcgtaaa cgatgttgat     25080
     ttatcacagc cattggctga ctttccggcg gtgcttgaag agctaaaagg cgtgtattta     25140
     gatcatgctg tgtattttca tcatccgcgt tatatggctc atttaaactg ccctgtaacc     25200
     tatcctgctg tggtggccga acacattatt gccgctatta atacctcggt agatacgtgg     25260
     gatcaaagtg caggcgcgac gttaattgag caaaagctga ttgattggac atgccaaaaa     25320
     gcagcattgc caagcactgc cgatggagta tttactagtg gtggcacaca atcaaactta     25380
     atggcaatgt tagttgctcg tgaagtggct gttagccgct atgcgccaga acatcaggta     25440
     aaacttcagg gcttaccagc tgttgcctcg cgctttaaaa tttactgctc tgaggtggcg     25500
     cactttagta ttcaaaaagc agcggcgtta ctgggcttag gttacaacgc cgtggtgcca     25560
     gtggctacaa acagcaaaat gcaaatggat atgcaggcac ttaaaaccgc catagcaaca     25620
     agcaaagcgc aaggtgattt acccattgca gtagttatta ccgcaggcac aactgatttt     25680
     ggctcaatcg atccaatcca taatattgcc atgctggcta aagaagagca gctatggtgc     25740
     cacgtagatg gcgcttatgg tggcggtttg ttggtaagcg agcaccaccg caatgcgctt     25800
     aatggcattg agttggttga ttcaataacg attgattatc acaaatcatt tatgcaaccg     25860
     gttagttgta gtgccttttt attaagcgac aaacgtcatt ttagccacat tactttgtat     25920
     gccgattatt taaacccatt agcagaggcg ggaaatggca cgcctaattt ggttgataaa     25980
     agcctgcaaa ccactcgccg ttttgatgcc ttaaagttat ggctaacact gcgcaccact     26040
     ggagaagcac cgcttggccg cgcgttcgat aaagttattg gccttgcgcg ccaaacgcat     26100
     attgtactta acgaccatcc cgactttgaa gtagttaact accccgagct tagtgccttg     26160
     gtatttagat ttgcccctga tgacttaaaa catgaccttg atttactcga ctctttaaac     26220
     ctgcatgtac gacaaacgtt tttacaaacc ggtgaagcca tggttgcccg tacaaaaata     26280
     aatggtcgtc attaccttaa atttacattg cttaatgcgc agtgccaatt atctgatgta     26340
     cgcgctgtta ttgagcaaat tagccacatt gcatggcaaa catataggga aattgcataa     26400
     tggataatca accttacgat tttatcgcta ttggccttgg cccatttaac ttatctttag     26460
     cgtgtttaag tgaaccgctt gaagatgtaa aaagcctgtt tttagaacaa cgtagtgaat     26520
     ttgactggca cccaggaatg atgcttgagg gcgttacatt acaaactccg tttatgtcgg     26580
     atttagtaac catggcagat ccaaccagcc agtatagctt tttaaattat gccaaattaa     26640
     ataatcgttt atacccgttt tatattcgcg aaagcttttt tttattgcgc cgtgaataca     26700
     acttatattg ccaatgggtt tgctcgcagc tttcaaatgt taactttgaa caaacagtca     26760
     ctcaagttga gttttgcgcg caaagtgagt gttataccgt tagctgtaac acccccaatg     26820
     gtacgcaaca ttatgtgact cgccatattg ttttgggcac agggcctgca ccgtatattc     26880
     ctgattgcgc tgtgcaaagt aactcaaata acgtaatgca cagtagcgat ttttgtcatc     26940
     ggcttgatga attaaaggca gctaaacggg ttactgtggt aggggctggg caaagtgcag     27000
     cagaaattta ccacacctta ttgcaacaag cagtaccgca aggcttgcag ttagattgga     27060
     tagcacgctc accgcgctat tttccgcttg agtatactaa gctcaccctt gaaatgacct     27120
     ctcctgagta tgttgattac ttttataatt taaaaactga gcagcgagat tggctcaatc     27180
     aaaaccaaaa aaatctattt aaaggcatta acggcgattt aattaacgac attttcgaca     27240
     ccctctacgc gcaaagcctt gatgggccaa tttctactac atttaaaact aacagcaagc     27300
     taacaatcac tcaaaaagta ggtaagcgtt tactgactga gttttatcat caggagcttg     27360
     agcagccctt ttcaatagaa accgactttt taatttgcgc cacgggcttt aaatatcagc     27420
     gccctgcttt tttaaataat attgcccacc aattacccca agatgagcaa ggtcgttatt     27480
     tagtgagtcg tgaatatgcg gtagatagcg aacaaaaacg tatttttgta caaaatgccg     27540
     agcagcatac tcatggtttt gtaactccag atttaggtat ggcttgctac cgtaatagta     27600
     ttattttacg tgaaatttta ggttattcgc cttatcaggt tgagcaaaaa attgcttttc     27660
     aaaactttga tttaagtgat gtaaccctat cagcacaaca gcagagtagc gccgcatgag     27720
     tcttcgttta gcgctaattt tgctgacggt tatttcggtg gtatgcgata ccttgttgct     27780
     accgttttat ccgcaatttt ttgctagtga atttgctatt agtaacgcca cgttaatcgg     27840
     cctctttgtg gctaactgtt gtattactgt aatgctggct ttaccactat gggctaaggt     27900
     cgctaaaaaa tacaatgagt tggctttgtg gttagtaacc caagtagtag ccgctggttt     27960
     tggcctgctt tgctactttg cgaccaatgt gtgggagttt tggatttact accaacttat     28020
     gttggtgcta aaggcaagct acctacttat atacccattt gcactgcgat tagagcaaca     28080
     aactaagcat ttatctatta ttggtttgtt ttctgtattg atgcactttg gtgcgattgg     28140
     tggtgcttta attggtggtt acttctttag tttagcagag ccacgctatg cgttattact     28200
     cagtagtgcc ggtgacctag ttcaggtttt attatgcgcc tacttaatgt attcattaaa     28260
     aacaggtatt tatcagcaag caatagcgac tgaaaaaccg cgagaacgta ttccctattt     28320
     tatttggcaa ttttgctttt taagtgtggt ggtttatttt agcgcgtttt taattcgccc     28380
     cttctttact actcattggc aagcattaaa cgcacaaagc agcacgttgc aaagcgctgt     28440
     tgtatacgcc attcctgcct ttgctgcgct tgttatgctg gtttttaacc attatagaca     28500
     gcatttacca ctgccaacat taagccgcac gagcactttg ttatgtgcac ttattttggg     28560
     ggcacttggg ctttatttac aagcgcaggc gtcggtgggg ttagtgattt tatcacgtgt     28620
     tttatatggc tttgcgctat ttcaagtgat ggtactacta gaggtaatgc tatttgctaa     28680
     aagtgagcct gcacattacg gcagcgactt tgccaaagtg cacattgctc aaaatgtcgg     28740
     ggttatttta gcgtcgttac tagtgggtat gagcgtagag catctttcaa ctacggttgt     28800
     gttttacttt gctgccattg gctttgcaag ccttgccttt attttgcttt ggcggtttaa     28860
     ggctgttgct cgagctgcgc gttcagcgtc ttagttttta agatttattg gagtttttat     28920
     gtatttttca tcttttgtaa ccaccctaca gcataccggc aaagtgacga tgcggttatt     28980
     acaacaaaca gatatgccaa caatatgcga ttggcttaag caaccgtatg cgcacttttg     29040
     ggggatgcag cagcaaaccg agcaacaaat aactaaagtg tatcaagcta ttattgatac     29100
     gcctcatcat caggcatacg tgatcgagca aaataataac ctattggctt tagttgagct     29160
     ttatagccct gagcacgaaa gcttaatgaa agcggcgtac gaggttgaac ctaatgatgt     29220
     gggtatgcat attttattag cgcctaacac ggcacctaag cgccatttta gttttgaaat     29280
     gatgcagtgc gtgctgcaaa gtatttttgc tcaaaacagt gccgcccgtg ttgtggttga     29340
     gcccgacatt gctaatagta aaattcatac gttaaataaa cgtttggggt ttgtgcatac     29400
     ccagcaaatt caactgggcg aaaaagccgc ttatttaggc ttttgtaata aagcagcctt     29460
     tgataggcac agccaactat ttactgattc gttagcgcct ttgcaaactg attacgtgat     29520
     acagccacat tggcaatggg caaatcggca tttacaagct aaagcactca ccgagctagt     29580
     gcacgagcgt ttattggccg cagagacaac aaagcgaggc tttaaagtga atgttgaagg     29640
     cggttacttt atttttaatg gccgtgctat ggcactaaac catattgata tagacgagcc     29700
     aagcctatgc ttttacaacc ttaacgaaga gctgcagccg ctagatgtgt tgcacttttt     29760
     tagtatgcaa gggcctgcgc taggtttaac gggtaagcgc cttgccacct acattgaaga     29820
     gctaaatgct actttagcca gtgcgtgctt taaacgtgaa aataacacgt taacagcggc     29880
     gcagttagct aatttagggc tgcaaaaaat agaagctgca atgagtgaag gtcatcctgc     29940
     ctttgttgct aataatggcc gcattggttt tagtaaagct gactttttac gttatgcgcc     30000
     agaagtaggc aaaccgttta aagtactgtg gttagcagcg cataaagcgg tatgcgactt     30060
     tgcccatagt gaatactttg ccgactaccc aagccatata agtgatgaac tagatttaac     30120
     cactcgagat gcgtttaaca aagcgctaaa agctcaaaac cttaaccccg atgattactt     30180
     actcattcct gctcaccctt ggcagtacca acacaaattg agtgtggtat ttgcaaatga     30240
     gttggcaaat cagcgattag tgtatttagg tgaaggtgac gatttatatc aagcgcaaca     30300
     atcaattcgg accttatata attgctcgca cccgcataag ccgtatttaa aagtggcgtt     30360
     gtcgatttta aatatgggat ttatgcgtgg cctatcgcgt gcttacatgg cggtgactcc     30420
     tgccattaac gattgggtat ttgaaaaggt tagccaagat caacaactcg caggcgctaa     30480
     ttttacagcg cttagagaat acgccacctt aggttatgcc catcatacgt ttgagcaaca     30540
     cgcccttggg gatacaccct atcgtaaaat gtttgcctgt ttatggcgag aaaacccaaa     30600
     tcataattta aatagtgatg aacaactgac cactatggca gcgttattac acttagataa     30660
     taatggccaa agtttagtgg gcgaatggat agcgcaaagt ggtttgagca cgcagcagtg     30720
     gttacatgag tactttaatg cctatttaat tccgctagta cattgctttt acgcgcataa     30780
     attagtgttt atgccccacg gtgaaaacct cattttaaag cttaaaaatt cggtgccagt     30840
     gggcgcatat atgaaagaca taggtgaaga ggttgcctta cttaatagca ctgaagtatt     30900
     gcctgcaggg gttgaacgta ttcatttttc tatgcctaaa gagcttgagc tgttaagtat     30960
     atttaccgat gtatttgact gcttctttag atacttagtg gcaattttag tgcgagaaga     31020
     gcgtattaca gagcatgact tttggcagtg tgttacgcaa agtgttaaag catatcaaca     31080
     tgctaaccct gctttaaatg agcgatttaa agagtatgac ttttttagtg atgagtttgc     31140
     tcactcttgt ttaaaccgct tacagctggg taataatgag caaatggttg atttaacgga     31200
     tccggcaggt agtttgcagt ttgctggtaa cttaaacaac cccgtatcgg caaagctgta     31260
     tggctaaacc gattaccctt gcgcagtttt tatattgcca tcaacccgta caacgaactt     31320
     ttaaaccgag cttattatta gtgcgcgctt taacagttcg ttgtaaggcg cagtacccga     31380
     ctgcgcctaa gcaatttatt agtcggcatt tgtatttgca gctttgttgg caagctattt     31440
     acgcttattg ctattggttt gcttgcaagc aaagtacggc tgaccccatt aacatgccgt     31500
     tagcgctaaa tggcgcttat tgtcgtgggt ttaacctgaa taatggcgtg ttagtaagta     31560
     aaactgagca aatccaagcg tttactcatt ttataagcca agttggtgaa tgggtaaata     31620
     ccgactatgc gctgggtaaa aaagaacaag cacggttatt actcgattcg ttaagtagcg     31680
     ctactgagcg agctcatagc ttagcccttg ctaccacttt acatatcaat aattgccatc     31740
     gtcagctgca cacccttatt tgtgaacact ttaatcttga tgcgctattt actgaaaacc     31800
     ctcagcgttt aacctgttgc cgctattatt tagcaggtta cagcaaatgc caaacctgcc     31860
     ctaaaaagga cattaaaacc aatgaaccaa cgtcttaaaa cgattgatct tgcgcgtggt     31920
     gcgagcgttt tcattatgat tattgtgcat actttatgga tgtatgccac cacagcgctt     31980
     caaagtgaaa gcgcatttgg tacggttgtg catatacttg gcaaaggcac tgcctcgttt     32040
     ttagtggcaa tgggactgtc tatggcactt tcgcgcaggc aaacaccctt gctgttaatt     32100
     aagcgtggca tacagctttt actgcttgcc tatttaatga atgcggccaa gttttggcta     32160
     cctattgaag tatttaatac catgcctgag gcgtttataa atgcttatgg ctggcaaagt     32220
     ccgctcagtg ctgggcagtt acaatttatg gtgttaacag gtgatatttt acaactggct     32280
     ggagttagct tattgctgtt tggtgtgctt aatattgccc gttggaaaac aatatggatt     32340
     gcggttttag ccattgcaat tgcagttatg agccagtttg tgagggggca gcaatttacg     32400
     ctttcacctt atattagcga tttgtttttt gctagtaact atcaggtgta ttttccggta     32460
     tttccttggg taagtgcgat attaacgggg tatgtacttg gccgtttata tcttagtaac     32520
     caacaaaatg ccgattactt atataaagta tgtgcacaac ttggtgctgc tttacttgta     32580
     attggcggca tatggttagc cattgatttt aaagggcagt ttggcaactt tttccattta     32640
     aatggcggcg gtattagcta tttagttggc ttaaatttat gtgccctagc ggctatacag     32700
     tatatttttg ctgataaata taatggccct attacacgtg ctcttttata tgccagtaaa     32760
     catgtaaccg cgctctatgt tattcaatgg gtacttattt gctggtttat gggggcgctt     32820
     ggttatcata ccctcagcct gtggcccaca ctttgtatga tggtactgat gactttactg     32880
     acttttgctg tgcataaggt ttatttaaaa agcaaacaaa gtctcacaaa cattacgcaa     32940
     aaaactaaac gtacagctta agctgtaaag gggctttacg ggcgctgatt tgggtgccct     33000
     agcctgcttt tatcgcgtta ataacgctat gcatacgctt tgctaacggc ctatttcggt     33060
     gatggcacac ataaatattt tcgctaattg gtttggttaa atgatgcgtt ttaataagcg     33120
     caggtttatt aaaagcactt actgcgtgtg cgggtaaaac cgtaaaaccc aatcctaaac     33180
     ttaccggctc cagtattaaa cttatttggt tagaaaaccc cgtttgctta atttgatcaa     33240
     catgttcaaa ctcactgtag ttttcactta ataaaagctg tgcatgatgt tttgcatcgg     33300
     ggtggctaat aaagcccagt tcatttaatg cgctccatgt tgggcttttt attgcggccg     33360
     gtgttaccaa tagtaaaggc tcttggccta ttttatggct ggttacctcg cttagagtag     33420
     gtgcttgagt taaaaagcca atatcggcac tatggtttgc cactgcttgt tcaacactgg     33480
     tatttggagc aaagcggtaa tctataatta gctccttgtg ctctacttgc agtgctaata     33540
     gttgattgta aaactgcagc ccgcaactgc ctggcgactg tattttaact aaaccgctgt     33600
     aaggtgaatc atcttttaat tgctgctcta aaaactgcca ttctttgagt aactgactac     33660
     cctgctgata taaattttga ccctgaacgg taagcgtaaa ttgtttaccg tggcgctcaa     33720
     gcaaggcgca atctacttgc tgctctaact tttttatatg ttggcttacg cctgactggg     33780
     tcatataaag gcgctcggca gtttgggtaa aatggtttac ctcaactaaa gtacaaaatg     33840
     tatttagcca tgtaggattt atcattacaa aatatactca aaatgatgat taatgataat     33900
     tttacttaat gttggtcagt tcgtaaacta actccatcaa ctaaacatag ttaagtagga     33960
     gtatttatta tgagtcatac atatccacgt agtttttcgc acattggtat ttcagttccc     34020
     gatgttgaaa aagccgtaga gttttacact aaggtgatgg gctggtacac cataatggag     34080
     cctaccgtga tcactgaaga taacagccca attggcgaaa tgtgtaccga tgtatttggt     34140
     ccaaattggg aaaaatttaa aatagcgcac ctttcaacag gcgatcgtat tggtgtagaa     34200
     atttttgaat ttaaagacca agaaaaccct aaagacaact ttgaatactg gaaaaccggt     34260
     atcttccatt tctgtgtaca agacccagat gtagaaggct tagcggatcg tattgttgct     34320
     gcaggtggta aaaaacgtat gccagagcca cgttactatt accctggcga aaagccgtac     34380
     cgcatgatct acatggaaga cccgtttggt aacatccttg agatttacag ccacagttat     34440
     gagcttatat acagcgcagg cgcttattaa attgtaattg gtatatatct aacttagctt     34500
     aaataaaaca aaggccgcag taataaatac tgcggctttt tgtgcctaaa aaaaatacat     34560
     aatctaaatg agttagtgct aataactcag cctttaagtc gaaattttta ttagcattaa     34620
     gggcaattat ggagacttaa ttgaaagttg taatctaagc taattataaa aaggaggtat     34680
     cagctcgaac aggttacatc actcatatca aaagtatgcg ttaaaccatc agaattttta     34740
     tcaattacta tcagattatt cttttcaatg taaaacgtgt attcgcgcat ccaattgagt     34800
     ttagcaattc gctttagctc ataacggcca aatgctagcg ggcaatttaa atacgcataa     34860
     tgataggctt tccccattgc cccagggtct gcggtataaa tataaatagt acgatcagta     34920
     aacgtgtttt gtttgtgaat ataatcaggc gttgataatg aagaaccatt gactaaaatc     34980
     cctaaacaca aaaaaggaat ttgtattaca ccgactaatg taagaatgat atagaacaac     35040
     cactgggcta ttttattttt aattatgctt ttaatttttt taggtttggt gaaaagcagt     35100
     attaaacccg taattaccaa cactaatttt atataaagta gattatggct taatgtatcc     35160
     ataagccgtg gtgagtgcca atttaacccc catagcgctc ccccgtgcat gctttctagg     35220
     aatggtaaca ataaacatgc agaaataaga aaaataatta acgagctatt attgctgctt     35280
     gtatccattt atttttgtcc tttaaatcta accggagtcg ctgtatttta gtgtgatatt     35340
     tataacatgt tttataatac agcgtaccta aaatgtcata atgcagacag ctattttatg     35400
     atatgaaagt gactgtaaag ggggttaaca gcggctatgt attatacaaa aaaataaaaa     35460
     agcgccttaa ccactacatt aagacgcttt ggatgaaaaa ctataaataa ctagacgtta     35520
     aaatagctaa tcgggactat gaaattgtta gaattgatag gccaatgaca tcttaaattg     35580
     agtaggcgca ccggggtaaa cccataatgc gttgtagcta ctttgagcat attcttcatc     35640
     aaaaatattg ttaacactga tatttaactt ggtgcgctcg gttaagttta cctgcccaaa     35700
     aataccaact agttgataac tcggtaagtt aaatgttaaa tcggcggcat cgcctaatcg     35760
     ttcactggtg tactgataac tagcccctag ctcaagctct ttaccaagca aggctgtttg     35820
     atggctaagc gttaggttta agttattttt aggcacattg actaatgggc tgcctttttt     35880
     tattggcacg ccccaatcag catttattat gtcgtttgcc gtactggcat ctatataagc     35940
     gtaagataaa ttaaactttg tatcatcagt aatgtaagta cttaaatcga gttcaacacc     36000
     tttactattt gctttaccaa taggcgctga aaaaccaacg tttacagggt cggctactaa     36060
     catattactt ttagtggcat caaataatgc tagggttccc gttatgcctt ggtagctaaa     36120
     tttagcgcct acttcaaatg agtcactgta ttcaaagcca aatgggtcgc catttgcatc     36180
     tgtaccactt aatggtaaaa agccttcgga gtagctgctg tataaggtta cagcgttgtt     36240
     tagttcatat actaagccta ctcgtggact tacctgactt tgtgaactgc ttgatagcac     36300
     accacttttg gtttctaaaa tgtcttgatc tacgctatcg aatctaaggc caactaatag     36360
     cttaatttta tcagtcagat ccatttgatc ttgaacgtat ataccataag catcttgttg     36420
     ttcgttgttt tcgtagagca aacctacttc aggacgagca acgttataat tcggctgata     36480
     aatatcaact gtgtaagtgc cattaccgcc ccgataacga taaagtccag ttcgtaagtc     36540
     gtatttgtat gcgtcggctc ctattaataa gtgatgggta atacctgcgg tatcaaaatg     36600
     cccacttagc tcaaatttaa ggctggtatc atcaacttca taatcgcggt agcgctgttg     36660
     gcgggtaagt gtgcggccat catcgaataa tgattggcgc gagggtgcaa gttcagcatc     36720
     agacgaaaac ccagttagtg tagagctgcg gtagtttgcg cctacaacga gtgaccattc     36780
     attgtttata tcgtgattta aagttacttg gtgaccacga gaatatactt gcgtgtcacc     36840
     atcgtttgga ttgcctaaat agcgtgagct aggaacagta ttaaaattat cattaagtac     36900
     aacaacacca cggtcaaata gctgggctaa atcaacgtat tcaaattcat aagtgatact     36960
     ggttgaagcg tttatttgat gataaataga tggcgtaacc acctttttat gggtgtacac     37020
     ctcatcgcgg tagctgtcgc tatcttgcca tgcgccattt attctaaatg ctgtgttatc     37080
     gttaatgccg tttgtatagt caccttcaac gcgattaaag ttatcactac ctaagctaag     37140
     ctttagctca ccctgttgct caaattgagg ttttttggtc acgatattta ctgtaccgcc     37200
     gggctctgag cgcccgtata gtgcagaacc tgggcctttt aatacttcaa tgtactcaat     37260
     gtttgataca tcacgagggc cgctgaatcc acgtccaccg ctaaaaccat taattaagta     37320
     acccgatggc atgttttcgt tacccgataa tccacgaatc gaaaagctat cccacaatgc     37380
     gccactgtta tttttacgtg aaatactggc agaaaaatcc agcgcatctt gtaattgagt     37440
     tattcctttt tgatcaagta ccgcgttatc gagggtttcg attgattgtg gcatttgctt     37500
     ttgaggaata tcgcctcggt aagcttgttt atatgtaacc gcaattttct ctattggttg     37560
     gctttgggca atgctttgtg cgcttgcact taagcaggct aagtaaatta atgagtactt     37620
     cataaaatgc tttttggtaa cgttatatta taactaaaac tatagcatgt gttactttat     37680
     aacaaaatgt ttttttgcgc tctatgtgtg cgtctaattt ttacactagc ggctatacag     37740
     ctatcacgtt aagatggata aaaataacac aataagaaca atataatgtt aacaaaaaca     37800
     aatgcattaa tttacttttt agcctttagc agtggcttta gtattatggg aatagagctg     37860
     ttaggtgggc gcattttagc gccttacttt ggcagtagcg tacatatctg gggcagtatt     37920
     attacggtat ttatgcttag cttatcattc gggtatttac tgggagggaa gctgtctatt     37980
     cgtcatcctt cgttgaccaa atatgggtta atctttttag ttgccagtat tatggtggtg     38040
     cccattgctt tgtttgctga gccaattatg gcatttattt tttcgcatat tgaagacagc     38100
     cgctacggct cgttactcgc ctcaaccgcg ttatttttta tacccaccat tattttaggc     38160
     atgatctcgc cctactctgt acgtttgctg gttaccaata gtgagcgcag cggccaagtg     38220
     gctggcggcc tttattttgt aagtacctta ggcagtgcgc tgggcaccat tattacctct     38280
     ttttatatgg tactggcgtt tgatgttaac accattattt taggttttgc tggtgtgtta     38340
     ggcacgcttg ggctaattgc tattagcttt gataaactta aagtgcgaga ggtcgtttat     38400
     gcacaagctt aaattattgt ttattagtat aatggcgctg ctattttcag ctcatagtat     38460
     gagtaatgtg gtgcataaag agcgctcttt atatcgaaat ttactcgttg aagaaactgg     38520
     cgatttacgc tgtttaaagt ttgatgaaaa aacccgacaa agcagccaaa gttgcatgta     38580
     cattagcgac cctaaaaaac tggtatttaa ttatactaag ttggcttttt ctagtttatt     38640
     actgattgat aaccctaaaa atgtgctcat tattggttta ggtggcggta cgctttctaa     38700
     tatgattcat gagctatacc caaaggcaca cattgaaaat gttgaaatag atccttcggt     38760
     aattaaagtg gcgcgcgatt attttaactt tatagaaacc gataacgtaa ctactaaagt     38820
     acaagatggg cgtattttta ttaaacgtgc ggcgcttaaa agtcagcaat ttgattggat     38880
     tattttagat gcgtttaatg gcgattacat tcctgagcac ttactcacaa aagagttttt     38940
     tgaagagata aaaagcgtat tagccgaagg cggaattgtg gctgctaaca cgttttcatc     39000
     aagtaaactc tatgagcatg agtcggcaac ctatcatgcg gtatttggcg attttattaa     39060
     tgtaacagcc aataataata gtaaccgtat tattttagcc ggttataaca aaacccctac     39120
     agagcaacaa atagcactgc gggttaagca actagctccg ttacttgccc cttatgatgt     39180
     cgatatagag gcaattagcc aacgtatgtt tttcactaaa gatggtaagg actggccaag     39240
     tgatactaag gtgctgactg atcaatactc tcccgctaat ttacttaact tttagcggct     39300
     gatatcacat ggtcacttat atccggtgac cctagggtat tattaaaaag ataatatttt     39360
     aaggaaacgg caatgcacat tcactttatt attcatgaac attttgaagc gccaggcgct     39420
     tatgaagctt gggctaaaat gaatggccat acgttgtctt atacccgtat ttatttagct     39480
     gaacccttac ctcagcatac cgatgatatc gattttttaa tcgtaatggg tgggccacaa     39540
     tcgcccgcta catcgcttgc agaatgccct tattttgata gcaaaaaaga acaagccttt     39600
     attgccagtg cgatcacggc aaacaaagtg gtgttaggcg tttgtttggg gtcgcaatta     39660
     attggtgaag cgttaggcgc gacttatcaa cctagtccag aaaaggaaat tggtaagttt     39720
     gcaattaccc tcaccgatgc aggcttgaat catccgttat ttagccattt tggcagtgag     39780
     tttaatgtgg ggcattggca taacgatatg cctgggctga ctgctacggc cagtattatt     39840
     gcctatagcg aaggttgtcc aaggcaaata gtcgcttata gcgatttagt atttggtttt     39900
     caatgccaca tggaattgac caccgaggtg gttaccctcc tcattgccaa cgatgattta     39960
     accaatgccc ataattaccg ctttgttgaa cagcccgaaa agctcttaag tcacgactat     40020
     aacgaaatga acaataagct ttatactttc ttagataagc ttgccgtaca ctatttatct     40080
     aaataatact tatttacgtg aagttaaaat gccaattatt tacttagcct gctaactaat     40140
     gctaaaattt gctgatattc acaagtaaga gttcctatga gtagcactat tccttttcat     40200
     gaaacactcg atttaacttt atgcggcaat atgggtcgag tgcaccgctt atgtcgagaa     40260
     gcggtgacac tggcggttga gccgctaggt ttaactcagt cgcgctggac ggcaatgatt     40320
     cacttacatc atttaccttt aggggcaaca cagcaagcgt tggcgaccag tttaggtatt     40380
     gaaatgccct cattaacgcg cacaattaag caattagagc agcaaaatct ggttattcga     40440
     caagttgatg aacacgataa acgcagtaaa aaattgtact ttaccgatga gggtataaag     40500
     ttattagaac atttaaaaga gctaacaagc gatattaaac agcgtttata tgccggttta     40560
     agtactgagc aacttgatgg tatggcgcac agtttagtgc aaatggaaga aaacgcgcgg     40620
     cgttgtattg caagcttatc tggagataaa taagtatgac acctgatcaa aaatttgccc     40680
     gctacgttaa agtttcgctt gttggtttta ttgttgtctt tttttattat attgttgccg     40740
     atgtgtggtt gccggttacg ccacaggcac gggtttatca tccggttgtg caaatatcac     40800
     cgcaaataaa tggccgtgtt accgatgtat tggtcagtaa taaccaagcg gttaaagcgg     40860
     gtgatgtatt atttgagata gataaaaata cttaccaact agcacttgag caagcacagc     40920
     ttgcccttga cgatgccaaa ctacaaaata aacgccttga taccaatgta aaagcgcttg     40980
     aggcacaaat aagtgcagct aacgctaaat tgcatgagca gcagctatta aaaaagcgtg     41040
     gcgaaacgct ttataaacaa aactctattt cggaacaaga gcttgaaagc attcgtgcaa     41100
     attttgcagc cagccaatct aatttagccg cctttgaagc acagcttgct gaagctgttc     41160
     tggcgcgagg cgactcgggg caaaataatt tagcgctgcg ccatgcggcc aatcagttag     41220
     cgcaagccga gcttaactta tcctatacgc aagtgcgtgc tttaagtgat ggtgtagtgg     41280
     ctaatttaca gttacttgag gggtcctatg ctgttgcggg taagccatta cttgctattg     41340
     tggcaaaaaa agccgattta gtggctgatt ttcgtgaaaa gtcactatca aatatgcagc     41400
     caggcagttt agcaaaagtg gtatttgata gccgaccagg tgaagtattc gacgctaaaa     41460
     ttgaaacctt cgaagcaggt gttagtgacg ggcaacttag tgcgaatgga ttacttagca     41520
     ccaccgaaac cagcaaccgc tgggttcgtg acgcgcagcg tcaacgtatt catttagtgc     41580
     tgccaaataa cactcagctt ataaataata tgcccagtgg tgcgcgtgcc actgtgcagt     41640
     tacttccaca atcggctata ggtcaatggt tgggatcagt acagatccgc tttattagtt     41700
     ggttacatta catttattag tggggcgagt aatgacacaa catgttagcc aagcgccaca     41760
     actcgattca aatggtttac gccaagcgct acggattgct ggcggctgca ctattggttt     41820
     tactttgtgc aagttaatga attggcccaa tggaatattt tttacagttt accctatgtt     41880
     attactcggt ttagtgccaa gtattaacaa aggcgtgatc cgtcaatttg ttgccagtgc     41940
     tgcctacagt gcgtttatag tgcttatttt acagggctta ttttcacact tgccggtgtt     42000
     aatgacgctc attatttttg ccagcttttg tatattgttt tacttaatga gctctggtgg     42060
     cgcattttta tttggtgctt tgggggcggt gagtttatcg attcagttgc actttgccag     42120
     ccatgttgat caaggaagca gcatttaccc gcttatttta agtaatggta tggctatttt     42180
     tattactatt attattgcgc tcttgatgca tggtttgttt cctgatgtga cagcgcggcc     42240
     catgcgggct gtgccacaca aggataaaga aagtattcgt cacgaggtgt tgctatgcgc     42300
     tagcgttgcg actttatcat tcgtggtttt tcaggtactt gacttacaag attcaatttc     42360
     ggcgcaagcg gcgtctattt taattttgtt ttcgttgtgt tttaaggctg cgggcaccgc     42420
     aagttggcaa cgtattattg gtacactgat aggctgtaat gctgctttag ttgcgcagtt     42480
     gtttttgtat aaccataccg acgttttgct ttttccggtg gctatattat ggattttatc     42540
     ttttatattt agtcgttttc atattttagg tggtggtcca ccgggggttg ggtttggggt     42600
     attaaccacg tttgggattt tatttggtca gtcgttaggc ccagggcaag atttaatata     42660
     cagcgccatg tatcgattta gctcggtggc tgttgcagta acagtaagct taagtgcagt     42720
     gtatgtagtg catcgaatcc tcaaccgatt tagcgtcacc cgccaccata cttatgatta     42780
     aattaaaggc tgcatccgca gcctttttat atacttaacc acagtacagg ttacttaagt     42840
     tatagcttga tattaccgcg tagggctttg gtttggccgt gtttggtttt tttgtccatg     42900
     cgtttacgct gtgagttacg gctaggtttg gtggcacggc gtgctttatt aaccttagtg     42960
     gcgcttaaaa ttaaatcttt tagccgtttt agtgcatctt ccctgttgag ctcttgagtg     43020
     cggtggctct gggctttaat tatcaatacc ccttctttgg tgatccttga atcttttaaa     43080
     gcaagtaatc gttctttata aaagtcaggt aatttagagc gattaatatc aaagcgtaaa     43140
     tgtatagcac tggctacttt attaacattt tgcccgcctg caccttgtga gcgaatagcg     43200
     ctgagctcta cttcccattc atctatggtt acggtatttg aaatagttaa catagtgccc     43260
     cgctcttttt gcaaaaaatg tattatatca tcagtacatt gacttgtggt gaatcaagcg     43320
     gtcattgcta tttacagtct aatatttgtt aaataaacac ataaaaacta atttattcta     43380
     cacttactat attgcttttt aattcgcttt aattatatga aacaaatatc tattttaatg     43440
     tttttggtgt gtatgctcgc tatttcatat gctgtttatg ctaaatcatc acaaacattt     43500
     agtgctggtg taattgcaca agaacaagtt tatccaatca aagtattagc tttgggtgat     43560
     tttcagcgtt gctttgttgt tgctgcgcaa aaagaagatg ctctgtattc tgcgtgttat     43620
     atcaaaaaga gcgcgcaatc gatttgggtt gctgaatctg cgggagcgcg ttgtgaaata     43680
     aaatgtgagt cgcatttaaa cagtgatggc aaaacacagg cgcagtactt tactactgat     43740
     ttatagtaaa aatgctgtgc caaggtttct ttatcgcggt ggtgagccct tttatttgtt     43800
     taatcacttg cgtatcacac gctgtttgct ttgcattatg aggtcctgac agcatcaaat     43860
     agtgggcttt accttttatt gctcgttctg ctatgaacag tgatgggttt tcccttagca     43920
     gttttttgtt aacggatttt ttagaggtat atgcgccata ctggcaaaaa taagtctcag     43980
     tatttttggt ttgcatatcg ctccactccc ctatttttcg ccactgtggt gaggcatatc     44040
     gccttgcatc aaccataaag ctaccatgaa gcgctggtat tgaataaaca tcattaatgg     44100
     tttgttgtgc tttagctgca ttgttatatg ggcctgcaac gaggtaatag ctatcacgac     44160
     gttcatgctt atataactgc aaagcatagg ctgctttatc aattttattc gcaacagtaa     44220
     gtgccgattg aaactttttg aatacgccta attgcacaaa ataaggtgtt tgttggtttg     44280
     attcagccgc tattgtagct tgttcagtta aggtatcagc gttatttgtg tatacaataa     44340
     tatcttgcaa tattatggta tcgccgcttt tttcagtgat gacctgctca ggaagatttt     44400
     ttatagttat gttttctgag agttgctcat ttttttctat ttcaagcata taatttcctt     44460
     gagaaacatt ggggaaataa taataaccat catattcagt gaccgttgaa taatgctttt     44520
     cgccgtcttt ttctttaagt acaaccgtga gtcctgcgat aggtttactc ttttcattgc     44580
     tcgatagata aatagtcccc tcaacctcgt tgtagaccac taaaggaata tttactttgg     44640
     tttgtccgcc tctatgagcc aatgttttaa tttttcctaa agagggctgc aagtaaggat     44700
     tagacaacga gcgtaaatta acatctaaaa cctggccacc gtaactgctt ggtagcaaga     44760
     cctttccgtc attattggtg tatttatctc gccataggta gttgccagta aaattaacgt     44820
     cttgaattgg ctcatcgcct tggtcaaaga tttcattttc attccaatct atgaacgaac     44880
     taacttctat ttgcccggaa tttaatgagc gaggagtgtc aaagttaaag tctgcttcta     44940
     aatgatcaaa actaaatgtg ccatttaaac ctaaagataa gcgccaatct ccttgattat     45000
     caacttgccc tgatacttgt atattaaata tctcatggcg gtaagtatat tgatgattta     45060
     aaagcgtact tgccgcagag ttagactgat acgtcagctg ggtttgatta aaggtgcttt     45120
     gtgtttgtgg ccagcgtaaa ctacttctca aacgagtgag ttctgcgcca ttattagcct     45180
     gccaatctaa ggtgttggtc catttccaag aggcaatatc tattgaagaa taaagccggt     45240
     ttatgaggtt atttgtatcg tcatcataaa atagttggct tgaccatgtt cctgcgacat     45300
     aacttttatt gatgcctaat gagaaccgat ttttagtgtt agtattttta cgtacttcat     45360
     tgttccacct catattccag ttaagggagt taaaaaaatc agtgcggcca ttgaggctca     45420
     gtgagagcct atttttgagt gagttctctt gtgctacaaa taaagcgcta gaaaagttat     45480
     taagggcact gtattcaaca ttaacattaa tatcgttata aagtttatta gaaagtaggc     45540
     ctctaaaacc ggcaaaataa gcatagccag catcgagttg ttttgtggct aaaaaacggt     45600
     aactgccgtg atctgtaagt gtgtttagcc cagatgatag gtagctgctg ttattttgtt     45660
     cagtttgcaa atgagtaatt tgagcgtcat aagtaataaa ctcactaatg ccataagaga     45720
     gattactttt aaaggcatta ctcatcgccg ttgaggagtt actggattga ttaaaaaagc     45780
     ttttatctgt ttctaaaaac tccacctgat agcttatttt tccgggcgat agtgcgtctt     45840
     gccctattgt atatttttga gtgcgtgtaa tttgctcacc ctgtgagcca aaaagtttaa     45900
     tttcaaagat attgttgccg taaaaagttt caacatcggt aaatcgaacc aaattttcgt     45960
     cgttagcttg agtcgtggca ataaattggc catttcgatg cagctctgct tgccagccag     46020
     gtagtgccgg ttcttcaatg gtgatagttg aaaaattttg tgccgaatgc gggttagcat     46080
     ttgaaatata aaatccccgg ccttggtttg agctagtaat aagctgatct gactgagatt     46140
     gaatatctcc caattggtag tgaatgcgtg ccagtgagtg atcttgttca cttaagttaa     46200
     agtctttagt tatttttaaa aaggtattag cggtgttttc gtttttgttg aatcgtagtt     46260
     cagctcgatg atgaaataag tcaaagtagc tattaagcct gagtagtccc ttataacgat     46320
     tattagacga tttatagctt gctgatagcg aatattcaga cacggggtag gttagcgctt     46380
     ggtattggtc gtctataaag tggtcgtatt gcagtgcttt ggacttaatt ttttttgtaa     46440
     taccactcgt tacttggttg ttattataag taagcaagtt actagaaaat gaaacctgca     46500
     tcagtgagta atcaaagcgc gagtcggtat ttaaaagtgt atttataaca gataaatcaa     46560
     catagtggtc gtagtcatcg acagcccaca atgaaacatt ttctgagggg gctaaagttg     46620
     aggaaagctc agcattcagc acctgctcac ttgagtcaac gttagcagac agtgtatttt     46680
     gtgacacgtt taagctaatt cccatggtcg atttcaggcc gcttatggga agtagcaact     46740
     tatttgattt tgagtagtaa gcttctaagt cggagacaac agaacggcca ttaactctta     46800
     catttataat cacaaaagac tcctcatcaa taggccattg ataaagagtc ggtaactgct     46860
     ttgcgatgat tgctttgggt acaattaaca gtaatgtaca aagtaacaag cgagccgtta     46920
     taccatagta taaggcatta atgtgtagca tttgttattt gatattaata gggatcgcta     46980
     actcgatttt accgccgtaa agctcgtttt ctttgtaatt gagtgtcaca ggccctgtca     47040
     caggggcctg taaagtgatg tataccttgc gacgtgataa aggggtataa acggccacat     47100
     tgactatttc accaatcatt acattattct catcgactaa ttcaaagttt ccatacacag     47160
     agcgattccc tgtgagtgtt tgccaaaatg ttagagtcgg acgcccattt tgagtaatta     47220
     attgcgggtt tattaattct gagtcagcct ctaattggcc atgacgaaca ataacaggca     47280
     cgctgtaagc aactttaggt ctaatgctta ttccatcaat gtcggggttt tgtgactcag     47340
     aggctatgat tttaagcacc gccctgtatt cgcctacagc aagctcagct tttttgcgaa     47400
     cggtcattct gatagcttgc atcccttttg gggcaatagt gccgcgacgt ggagaaaacc     47460
     gtagcatgtt tttggcagag cgtccttcaa cttgttgcgg agtaacatct ataagtgctc     47520
     cttcttcggt catatcttta tgggtaacaa caagtttaaa atcgagattt ttattagagg     47580
     tattgcggat aagtagtgaa ttatttttag tacgtccatc aaagtataaa cggtattcag     47640
     acagcgcaag gttggcacta caaatttcag gtagtaaaag agttaggcaa agggcggccc     47700
     aacaaaaaag tttaagaatc atgggacaac tcaacaacat gataataaaa agtggagcgc     47760
     gttgctccac acattttatt tttaatgcgc aattgcgcaa aaaaataaac tgaggctaac     47820
     ttagtaagtt agcctcagct ttcatagtct tattggaaag acacatctac agtataatct     47880
     acagtgtaag cagcgcccgc tgtcagtgta gaatcaactg tcatatcacc atatacacta     47940
     acagtaatat cggttgcact tgcatcagta gtgaaagcag acgcaacatt gtcagcagtt     48000
     gttacactgg ttgtgccatc tgtagccgtt gttactggag caaaagttaa gttagtgcct     48060
     gtgcttccag atacagtaat attcattgct gaatttggcg ctaaaccaga tacagtaatt     48120
     ccacctaatt gaatgtttgc atctgacgca tcacagtcac ccgatacagc gcctgcatta     48180
     tccatcgtac aggttgagct tgtagataag cgaattttac caaagtgcag tgggctatct     48240
     tctgcaaaag taggctcagt ccaaccattt acacttgctt gaaatgtttg gttagatgca     48300
     agtaaagaag ttgatgaaat tgctagcaaa gcggaagcag caaagatttt tttattcata     48360
     gtttttccat ttttaaaaat tattattttt ttacttccgt gcaaattagt tttgagggtt     48420
     atctcagtcc attgtttcgg atttaaacac aattgttatc aaaatgaaat cttttgttaa     48480
     catcaaggct ttttaaaaga gataattagt atgaagttat taattttgac cagcaaaatg     48540
     caacaagaaa aatagcaccg atgttaatta ttttttaacg ctagagggag ttattttaag     48600
     gcatagtcaa agcgacttaa ttgatgttga gcctatatga atgtttataa actattttta     48660
     atctttcata accactttgt agttttttat ggcagtcgct ctgtgcttaa gcggtgaaat     48720
     aaagtgactg caacatctat gcgaaatgtt tattttttga gcataattta cgcgttgtat     48780
     ctctattgtt accttcccag ttaaaatcat tacggattaa actgcattta tcaaagatca     48840
     gatttttact aacatgtcgg tttaaaagta taaaatttaa tttttcaagc ctgttttttc     48900
     attgttttgg ttgtttttta gctttctttg gtaataagtt agtaaaaaat cggtttatgc     48960
     cagcggtatt ttatgccttg ttggtaaaat actgatccag tgttatttga gagaaattta     49020
     tagcttaaaa ggtctctaat tattagcttc ttatatcaaa attacctgtt aaggctatgg     49080
     aaaaacttat taaatagagt gctttattta acttttaatt tcatacacgg acgtgtgttt     49140
     actgtgtctt tatgtattta gccggtaaca gcaacgcatc cagagtaagc attcacttag     49200
     ataggttatt ttatagctga cttttaatct ttatatagat cactatttaa ctaactcaat     49260
     taaatgccta ttactgcatt caaatacaaa taagaattac tatcttttgt atttgttggc     49320
     gttataatat cgccatcttt ttttagctat gtttaaaagg aatttgcagt ttatgcaggc     49380
     caccaaccgt cttttagact ttcccaaacc cgttttttct atgttatggc aatttatgca     49440
     acgctttagc tatgaattag cggttttatc gcgttttttt attgccattg ttggcgggta     49500
     tttttttaca gccgtgagtg tgtcgctatt aagtgcagta gtgcctgtgc ctaaagttga     49560
     cgcggttttg cttagtgtgt ctgcgagtat tttaatttat gccctagtgt ttatttatag     49620
     cttttatatt cattcattaa aaactgtttg gatcagtatt ttactaagta ttgcagcgca     49680
     acttgtcgtg ttatcgctat tgaaggaatg gttatgaaag ggagtttttt tcgttcaatg     49740
     acgtggttac atacatgggt gggtttactc gtgtgttggt tactgtattt aatatttttt     49800
     gcaggcacta ttagcttttt tagagatgaa gtgagcttat ggaatcagcc aagtgtccat     49860
     aatattgagc agcaggcaga tcgtattggc gcgcaaaagc aacaaatcgt gtcgggtgtt     49920
     gagtatttaa atgcgcaagc acctaatgcg cctaattggc gtataacgct tcctgaggag     49980
     cgtatacctt atttaacgta tggttatgca aaaccaaaag agcctggaca gcgcagagcc     50040
     cagttcgaaa atacccgttt aaatccaaat accatgcagc ctttagcacc ctttgtagat     50100
     accagagggg gtaatttctt ttatcgcctg cattttgatt tgcattatat cgatgtaaaa     50160
     acggcgcgtt ggattgtctg ttttgctagt ttatttatgc tcattgcgtt gatatctggt     50220
     gtagttattc acaaacgtat ttttaaagat atgtttgttt ttagggctaa taaaggcagc     50280
     cgtagctggt tagatgtgca taatttaagt tcggtatttg ccttaccgtt tcatttaatg     50340
     attacttata cgggcattat taccctgata tttatgattt tcccctaccc cgcgcaaacc     50400
     gtttatgagg atggaatacg tggctttttt aatgatgttt cgccaagtag tcctgcaaca     50460
     gagtcgttgc aaggcactgc gccgttagtg cctatcaata ctgttttgga tcaggtttat     50520
     actaagtggc cagaggctga tataactcgg gtgattataa ataagccgaa taaggccgct     50580
     gcgacaatta tggttttggt cagtcctgga aaaacattaa gggatcaagc accgcgtttg     50640
     atatttagtg gagcgagtgg tgagcttgtt gctcatactg atgatgaact caccggcagt     50700
     aaagcgctgt atgagtcact aaattcaatg cacactgggc gtttagcaga accattatta     50760
     cgtgttttat actttttagg cggcattgct ggctgcataa tgatagccac gggctgtatt     50820
     atgtgggcga agcgtattcg ggagcgaatg aaaaaaaatg cccagccatc atggggttta     50880
     aaactcgtcg aagcgcttaa tttaggaact ttaatggggt tacccttggc aacatctgcg     50940
     ttctttttag caaatcgatt aattagcaca cgcgcaatgg agcgcgcgga taaagagata     51000
     cttgccttct ttttaacttg gctgtgtgta cttattattg cttttgtaaa gcgtgacaag     51060
     ttgctgtggt gtgttatggc tgccataaac agcattgctt gttttagtgt gccagtggtt     51120
     aatgcgctca caacgcaagg taatataatt agttatttac gtaatgagca gtgggcttta     51180
     tttatgtttg atagtctctt tttactgttt ggtttgctgt ttttgttaca aaccgaaaaa     51240
     ttacgtactg cactgcaagc taaaaaacct agcccgataa acactcagga gcaaaaagta     51300
     tgattgcatt gctccctttt agtttatgtt tggtggcttt taactgcttt gcactggcta     51360
     agtttaatca ttttaaggat gtttttaaca agcgccctac tgatcagcag cgtttaatct     51420
     tactgagtgt tgcttggatc agtattttac taagtttact gctttgtgtt agcgaattac     51480
     acggctatgg tgctctacag ttttgcgggt ttatgtcgtt aagtgcttta attataatga     51540
     ttttttatag ttttttagtc aatttaacta agctttttaa cttgcttgta ttattgatat     51600
     tggctacgag tacgttattt tttggtttaa atgggcttta gttagtaaaa acctgatccc     51660
     aaagaatagg ctaaattgag gtaaaaaatg gcaagccatc aggcttgcca attaaaaagg     51720
     gggattgtca ttatgtcttg tacttgcctt tccttttgca agtggggcta atatagcccc     51780
     tctttattta gtttacctta cagtaaggtg aatgttttat tacaacctag gggcatgtaa     51840
     acccccttta cagcgatttt tgatttaccc aaataatctc atctgttgca aaaccaagcg     51900
     cttttacttg gcttaaaaag tgctgcttga gctctttact cactgtaggt tttctcgata     51960
     aaaaccataa gtaatttttg ctataactgg taataaaggc atattgataa tcaggttggt     52020
     cgagctcaaa aataatatag gcaccataaa acgggccaaa aaatgacact ttaaaatgcc     52080
     ctgtatcggc gttttctaca aatttagcta agccttcagc ttcgtcccat ttttgctctt     52140
     tactaataaa ccctttgttt aataccttta ccgttccatc atcgttaatt gaataagtgg     52200
     ctgttacttg ctccattcct tgttcaaaag agtggtctaa tcgtgctatt tcataccact     52260
     tgccttggta tttctctaaa tcaaagtttt taacaggggt tattccttcg ggtgcgctgg     52320
     tacaggcact gagtaaaaac acggtggtaa taaataatgc ggttttaaaa gcgagtttca     52380
     tgttgtttcc ttttctttag aaattgctat aggatcgcct taatactaaa gcaatttaaa     52440
     gaacttagca tgaaaatttg ggttgatgct gacgcttgtc cggtggtaat aaaagaaatt     52500
     ttatttagag ccgcagagcg tacgcaaaca gaaacaatac tggttgcaaa tcatgccatg     52560
     cgcatcccac cgtcaaaatt tattagccga ctacaagtgt catcgggctt tgatgtggct     52620
     gatgatgaaa tagtaaaacg gattgaaaaa ggcgatttag tgatcacagg agatattcca     52680
     ctggcaagtg aagtgattga taatggcggc caagcactta atccgcgcgg tgagctttac     52740
     accactgaaa acattcgttc attactaaat gtacgcgatt ttatggatac tatgcgctca     52800
     agtggtgtag aaatgagtgg tgggccgcct ccattaagcc aaagtgacag acaaaacttt     52860
     gctaacaatc ttgatcgtat tttagcgcaa aataagagca gttaaagtga gcagtcagtt     52920
     aatagggtta ggtgatgact cattcagtgt tgctgtgtat gtagcaaaag cgccccctat     52980
     gccttacttt gaaacacttg cgcagctaga gcctttagtt agtgggcaaa taaatagcat     53040
     aaaccagcac tgtggcaatg gctggcgaaa agtttttaat gtatacgcca aggtgttgtt     53100
     tgccctgccc agcgaatatt actcatttgc taaacaagca gtgagttggc aagcatatcg     53160
     agatgagctg ttgttacagc agcatagcgg gactgcatta ctctttagtg cgccggtgct     53220
     tactgagcat aaaaatcaat tgcacattat tgcaggaaga actcacgcta aaaacttgat     53280
     acaacaaggt aagttaaacg cccaacttga ttggcttgat gatgagtttg ctatagataa     53340
     aagccagaat attattgtat gcccctattt tgattatagg cagctgagta atattaaaat     53400
     tgcccgtttg agtgaattag tggctcagtt gcgaataatc taagccactt tcgtttttta     53460
     ggtaagtgtt acgctcagtg tgttagcgct atcaactagc atgagcgagc ccaaaataaa     53520
     taggatgcag gccgatgcac ggccaaattt tagtgagagc gccggattgt tgctgaggat     53580
     ttttctggca cttaccccta ttaaccaata taccagcgca cagccaacta aatgaataat     53640
     gctaagtacc agcaattgtt cagtaataga aaatgacagt gttggtaaaa caaactgcgg     53700
     caataaggct aaaaataaca gcatcacttt gggattcaag ccactaatta taaagccctt     53760
     tctcatccac tttaggggcg tgtctgaggt gtgttcttgg ccatcgttat aggctgcagg     53820
     cattggagga aatcggtaca gtgatacggc aatccaaatt atgtacaaag caccaaataa     53880
     ggttaacagc tttataaaaa tggcatgcga cgctaataac gcgcctaacc ctatcaccac     53940
     aatcaaacta gccattaaat gcccaagtat taatcctgac acggcaggaa tgattttatc     54000
     acccgctata cctgcactga ttgtataagc ccaatcggca ccgggggtaa gtacaaacaa     54060
     gattgatacc agccaaaaag aaaaaataat attaatatcc atacgtatcc atgcgctaaa     54120
     acccaaaata agtgagctgc tattttattt ctttctgatg agtaaaagtt actgtatttt     54180
     actgacataa gcgttcattt taggaaataa tcaactatgg ataccataga taggaaaatt     54240
     cttgctgagt tgcaagttga tggcaggctc accctttctg aattggctga tcgtgttggg     54300
     ctaagcgtgt caccttgtca tcgtcgtgta aaagagcttg agaaaagcaa agcaattgtt     54360
     ggctacagaa ctgaaatatc acctgaaaaa gtgggtttaa acttttctgc gttagtattt     54420
     attactatta aagaaggtga taaagcgtcg ttaagcaaat tagagcaagc ggtggatgct     54480
     attcctcaga tcaccaatgc acaacgctta tttggcaccc ctgattactt attacacgtc     54540
     gttactaaag atttagccgc gtttcagcaa ctctacgatg acaagctatc agccttaccg     54600
     ggtgtacaac gtttaacctc aaccattgtg atgaaagata ttgtaagagc gcgtaacttg     54660
     cacttttaac aggttatgtt tacacgaagt ttaaaaagtt aaaccgatga cgctgcaaag     54720
     cctatggcag cgggctttgc ctaaataggt aaaaataaag tgtaaataaa gcttgttata     54780
     aagtgtattg ctgttattct gcttgccatc gggttgatag aaagccctgt ttatttgtaa     54840
     gtacctcgtt gttattagta ataatccttc gcgatatcct caagttaaat gtttgttttc     54900
     ttcctgttaa acgcctattt taaggcaaat tttttattat ttttttagga tattattatg     54960
     tctaatacaa ctactggtac agtaaaattt ttcaatgaag caaaaggttt tggttttatt     55020
     gagcaagaat ctggcgcaga cgttttcgca catttcagtg ctatctctgg cgacggtttt     55080
     aaaacgctag ctgaaggcca acgtgtacag tttactgtta ctcaaggtca aaaaggcccg     55140
     caagctgaaa acatcgtttg catctaatta tagagggagt gggctttaaa gcgcactcac     55200
     tccgcttaaa ctagtgttaa gcaataaagc taatatcatt atgatattag cttttttttg     55260
     acaaaaattt atacaacgta accgctaaag ccaagtgctt taaaataaag ctttggaata     55320
     ccaaatccac attcattcag tagttcacta aagcgcatac gatctagggg gtaaaactct     55380
     ctttcgaggt tatgccccat ttgagttttg ccagcttcag ttaagcctaa ttgagcacag     55440
     gtgtttaatt gtgactcacg ctcaaatgtt gtttctgggc gcattaaatc agcaatgtaa     55500
     agattcgctc cttttttaag gttagtttta atgcttttaa gaatttgttt tttgtcgccg     55560
     ttatcttcta caaaatgcat caccagtaaa cataatacgg cgtctgcttt cgcttttact     55620
     ttatcaactg ggctacattc aatagtgaca cggctatcaa taccttgctc tgcaaagcgc     55680
     tgttttgcaa tatcgagcat atcactggag gtgtcttggg cagtaaactg ccatttagga     55740
     tttatttgtg ctaatgctaa tacttcctta cctgtgccgg caccaatcac taaaatgtgt     55800
     gcatcgtcgc ttaacgtggt ttgcagttgt gcattggtta gttgatgaag tagctcatag     55860
     cctgggacta aacgggtaat gcggttatca tattcttgtg cttcttcgcc tgtgaaagtg     55920
     ggcatgctgt ctccttaaat tacgtttatg gtggagtatc cacccggttt tttagcgaca     55980
     tgaatttgcg tagcaacgcg ttcgctcatt tcacttacat gtgaaattac accgaccttt     56040
     ctaccttgcg cttgcaatga atctagcgcg tccatggcaa tactgagtgt ttcactatct     56100
     agtgttccaa agccctcgtc aacaaataac gagttaattt gcactttgtt cgaagatagt     56160
     gaggcaagtc ccagtgctaa tgccaacgac actaaaaacg attcaccgcc agatagtgta     56220
     ttgaccgatc gttgttcatc ggccatatcg cggtcgataa tggctatatc aagtgactca     56280
     gcaattgcag tgagctcata acgcttgtta agggttttta aatggctatt agcataatgc     56340
     agcaatattt tgagtgtttg tgtttgcgct aaattacgca ttgttttacc tgtggcatca     56400
     cctagtactt tattaagtaa atgccattgg tcaacctgtt gcttgagctg gctcagttca     56460
     gcttgtttgc cctcaagcgc ttttgcattt tggttgtgct gctcaatcgc ggtgttgatg     56520
     gtgagtaagc tattttgcaa ttgtgtttgc tgggtattta agtggttttg ttgctcaatt     56580
     agctgtgctt cgctttgcgt tggctgatta ttttgttgat gctgttcatt agcttgttgc     56640
     tgttgcttta acgcggcact ggcatcaacg actgcttgcg atagttgctc gccttgtttt     56700
     aactgagttt taatatcgtc gttgctgata gttagtaaaa atgtgacttg ctcatgactg     56760
     atatcgccat gaaggatgtt aaattcttta aaccagtcgt tgtaacgcgt ttcaagcatc     56820
     actaactctt ggtggttatc tgccagacga tgctcaaggt ttttaagcgt gatggcgtgt     56880
     tcatcgcgct gttttacggc gctgtcgtgt gcttgttggc tggcacttaa ttggttttgg     56940
     cagtgctcta gctgtgctga cagtttagct tggtagtcat cggcgctaat agtttggtta     57000
     tcaaataagg ctaagcgctg ttgctgcgta ttattgtgct gttgctgtgt ttgagttaat     57060
     tcttcattga gcgtgttaac tcgctgctct gctttggtta taagcggtgt tagttgttgt     57120
     aactgtacat tggcgctgtc gaattgtttt tgactttgct caagctgtgc ttggatttgc     57180
     tgatattgtt ctacctgctg agctaaatcg ctaagcggta acgatcctgc ttgcaatgcg     57240
     tgccaaaaat cactgtattc aaaatgtaaa ttgagctcat ttataagcgc ttcgctttga     57300
     gttgctagtt catcgcattt gttattaagc tgagattgct gattgctcag ctcaacatgt     57360
     tgtgtgttta attgttgttg tgtcgcttgt tcttttttaa ctgtgctttg cagctggtta     57420
     acagtttctt gcaaattact gagctgtttt tgcgccgaaa aatactgtgt tttttgttca     57480
     cttaattgct tataagtttc atcaagctgc tcaactgtta actcattaag ctcggtttta     57540
     gccgcttgca tggtattttt aatttccagc attttggctt gtgcatcact aatggcttgg     57600
     ttgtgctgag tatgctctgc caccaaaacc gcgtgttgtg tttggtgctg atgaagctgt     57660
     gtttgagcat cttggtgttg ctgcttttcg ttattatatg cattttcaaa gtcggttatt     57720
     aggtttgtaa aaggttggct ttgattgctc gcgaacgggt gctctgtagc cccacaaacg     57780
     gcacacgact catttggaac cagttgtgcg cgtaaatgct caacatgctc actggcacga     57840
     agcctcgctt gattaagcgc ttgctctgcg tgtttaagtg cctgctcttt gctggttaaa     57900
     tgcgtaagca gcgtagtttt agtgtgttca ctgtggctga gcttttctgc cacatcacgt     57960
     tgctgttgca ccgtgtgttt taattcttgg ttaaactgct tatagcgtgt gcgctgatct     58020
     tttaaataat caatgttttt aagcttaatg tcgcattgtt caatgttaaa ttgagcgtgc     58080
     tgctggttta gcttatttag gctttgctgc tgcgttgtaa gcgtttgctc tgcttgttcg     58140
     agttgtttat tttgctcgct aagttttgct gtgagtattg tttgttgctc tgcgtgagcc     58200
     tgagcttgct gctgggttgt ttttagttgt gtctgagtat taaaaaactg cttaaaacta     58260
     tgatgaaaat agttccaatc agttgccaat ggctttaatt gactctgctc gttcaaccag     58320
     tgctgatgcc ctgtgatttg agttgtggct tgctctgcac ttattttgtt ttgttgtagc     58380
     tgctgttgta aatcacttaa ttgttgctgc tctttggcgc tttgttgagt cagacttttt     58440
     atagtttggt tatatattgc taattggctg tcgagctctc gcgcttttgc aatcagaggc     58500
     tctgccgtta gcttttgttg ttttgctgta tctaattcgt tttgctgttt tttaacgtta     58560
     ctggcttgct cggtgatcag cgcgttgtga tcaagctcgt ttaattgttt tatttgtgta     58620
     tttaactggc tattttgcgc tgttaagctt tcacagcgct ggcggttatc tttaatttca     58680
     agcgcacttt gcgcttgttt tgcttgctca gtttgcgctt taacagcatt gagtgcggca     58740
     tgtgcttgtt gctcgttttg ctgagcattt tttaatgtca gctctaagct atgtgcttgc     58800
     ttataccaat taacgccttg ctctgtcgtt gctaaagttg ttttagtgtg ttcaatttgt     58860
     tgttttaaat cagccagcgt ttgttgtttt tcactcagct catcgtcaga caataacgta     58920
     taactggcta aacttgccgt tagtaattca aatttatctt taatagcttt gttgcgctca     58980
     aatatacgct gccctattcg actaaattta tcggtgccag tcaggcactc taaaagctgc     59040
     gcgcgctcat cgccagtggc ttttaaaaag gcggcaaact catgttgtgc tagtaacacc     59100
     gcacgcgaga actgctcaaa ggtcaaacct attttatttt ctatggcttt taaggtgcca     59160
     cttttgtcag caattaaggt ttcatcgggt aggctatgta aagtatgttc ggccacttta     59220
     agtttgccgg ttactttttt atgcgtacgt tgaatactat aacgtgctct gtaaagctgt     59280
     tggtcttggc cactaaaatc tacttcggcg tacccttccc atttgccacg gcgcaataaa     59340
     ttgcgggcat cgttaagctt aatgttatcg ccattaaaat caattaggtt acctttatcg     59400
     cctttcaaac gcgcagtttt agtataaagt gctaagcaga tagcatcgag tacggtgctt     59460
     tttcctgcgc cggtgtcacc tgtaatggca aagaggcctg cgtctttgag tggtgaggct     59520
     aaaaagtcga tttcggcatc ggcaatagag gctaaattat gaatacgaac agccgttatt     59580
     ttcatagcag ttgctcctgt tcaagttctt caattacgtc ggttaacagt gcttttaatt     59640
     cattgggcac ggttgctgcg gccatatctt tatcattatt aaatgcttgt tcgagtaagc     59700
     taattgggtt gagcatttca acaaagctta aatcttcaaa taccgtttct gaggaattac     59760
     tcatttgctg gtcacgaact cgctctatgc cacaaaaatt aacctgtttt cctttaagtg     59820
     cttgctcaat ttgttctcga aaggtggtat cgatatcact tgatttaagt tttactcgta     59880
     agtaaggagc aatgtcgtat tgctctgtat cgagtgcttt tatttgctca cacagctgcg     59940
     ctaaaggcac acactctcct tcaggaagta caatgacttc tgctaagcgc ggaatgtaaa     60000
     gggggtttac agcggtgttt aacggttggt ttttttgctc gctaaattca accacattta     60060
     cttgatgggt atactttctt tctgaaaacg acattggaat aggtgtgccg ctgtaacgta     60120
     tttgctcatt tttagccact agttgtgctt tatgtaagtg gcctagtgcg acgtaattgg     60180
     cttgcttacc aaataccgac gctgaaatag cttcttcacc gccaatgacc aaattacgtt     60240
     cagagtcacc ggaaatatta ccgccttttg catgcaaatg acccataaca attaaaggcg     60300
     tattttcagc gttaagtgtt agcgcatgtt caagagcaag ttcataggct tttgcaacgc     60360
     cctgtgcgta actggggcca ttttcggttt ggctaagcgt gcttatgtca ctggtgcgta     60420
     aaaaaggcat agcgagtacc acagcgcgtt tatcatcgtt attaatcgtt attacaacgt     60480
     cactgggttt agcaggatca aaccgcccta ccacatgagt atcaaactgg gctaataagg     60540
     gctgtgcagc caaaatacga ttagcggagt catgattacc cgcaataata acaacgtgta     60600
     attgtgggca ctgggctttg gcgtttttta taaattgata gagttggttt tcggcgttag     60660
     cactcggtgt ggcagtatga taaatgtcac ctgcaacaag caataaatcg atttgttggt     60720
     taacgagggt ggttaacagc caagagaaaa aagcatggtg ttcatgacgg cgatcatgtt     60780
     cataaaattg ctgacctagg tgccagtctg aagtgtgaag aactttcatt ttgcgctctt     60840
     aaaaaaccat aagagcgcca atatacccaa ggcaattaaa gatgcaagta tcgctttagg     60900
     ttaaagtata ccaagctata aaaataacgg gcaaagcagc gagcgcgatt gttaaaggcc     60960
     actttaatgc tttggctttt ttagcttgta atacttgcag tgcattagtt tcattacaag     61020
     cagcgacttt atcaatatac agataacccg agtttatata ctgcttacaa ttttgcacgt     61080
     ctgctggtat tgcaattagt ttttgctgct tttttaggac ataaaaatcc ataaactcac     61140
     cacacttgtt acgactagtt agaacaaaaa atatttgaga gaaacgctaa aaaaatgctc     61200
     tcaaattaaa aaagtgggcg attctaatta caaaccatag taaagatcaa cctaaaactg     61260
     cgttatttag cttttttaat gaaaatagct gtgttttttg cttttatctc tacttttaat     61320
     agggtctgat gatctttgcg gattaatatt tgttcaaact aggtgcggtt taatcgcggc     61380
     gcgaggtttg taacctagtg ggctaagtca aaaccgagta acaaagagta gatcgcccct     61440
     aggcagaacc cttcgggcag cgcctgtttg ttattgatgc tgcgttatcg cctatttatg     61500
     gggaacaacc acaccacata ggctccgcct tgcctaaata ccaaacaatc tgctgcaaat     61560
     ttaatcttga aaggtcaaca aaccctaata gccagtgtgt tttgtaaacc ccctttacag     61620
     ttttgtttag cgtattaatt gcttttgttt ttttattcaa tttctgacga aatgtccgtt     61680
     cttttttatt gtataaaacg ctatttattg tatttacaaa aaggtgggga atatcaccct     61740
     ataaaagcag ggttttatcg ctattttatt gaagctaagc tgtaaatttg tcacagtagc     61800
     gttactaaaa tcgatcagga ttaacaatga agaaaaattt atttacactc agtgcgtttg     61860
     tattgccttt ggcaatggca agcactgtgc ttgcctcatc tgttgagcaa actaaaggca     61920
     gctatgttga taagtttcgt caactagatg aagctttacc tacgcctaac gtttaccgca     61980
     gtgcagctgg tgcccctgct gaaaattatt ggcaacaacg cgttgattac gatattgatg     62040
     taaagcttga tgagctaaag cgtcgcttaa cggggagtca aacaattgaa tataaaaata     62100
     actctccgca tacattaaag tatttatggc ttcagcttga tcaaaatatt tttaaaaatg     62160
     actcaattgc agaaaccacg caaacattta aaagtaccct acaaaacgaa ccagatgcaa     62220
     aaccagctaa gttaagctta ggtgatttac gtcgtcagca atttatggac gataatgaac     62280
     tgggttacac catcagcaat gttaaagatg aagatggtaa agcgctgcgc gtgactgtgg     62340
     ttgatacctt aatgcgcatt gatttaaata cgccacttaa acccggtaaa gatgttgagt     62400
     ttagtatgga ctttgcgttt aacctcgttg aagaagacgc ggtaggcgca cgtgcaggtt     62460
     acgagcattt tgaagaagac ggtaacgata ttttcttagt tgcacagtgg tttcctcgct     62520
     tagcggctta caccgattac gaagcatgga caaacaaacc gtttttaggc agtggtgagt     62580
     tcactttaga gtttggtgac tacgatgttg aaattacggt tcctgcggat catattgtat     62640
     cggcaactgg taagcttgat aacccaagct cggtattgac cagcactcag cgcaagcgtt     62700
     taaaagaagc tgaaacagca aaacgccctg tgtttgttgt taccgaagaa gaagcgctcg     62760
     aaaacgaaaa agccggtaca gacaaaacaa aaacatggca ttttaaagca gaaaatgttc     62820
     gtgactttgc ttgggcatca tcacgtaaat ttatgtggga tgctaaaggt taccagcaag     62880
     gtggtgatga acaaccactc gttatggcga tgtcgttctt ccctaaagaa ggtggcgact     62940
     tatggaagaa atactcaact gaagcggttg tacacacgat ggaagtgtat tcacagtatt     63000
     catttgatta cccataccca actgcgcagt cagttaatgg ccctgtaggg gggatggaat     63060
     acccaatgat cacttttaat ggcccacgta cagatttaca agacgatggt acacgcactt     63120
     actctcaagc agaaaagcgc tttttaattg gtgttgttat tcatgaagtg ggtcatatct     63180
     actttccaat gattgtaaac tcagatgagc gccaatggac ttggatggat gaaggtttaa     63240
     atagcttttt agacggtgtt gctgggcgtg aatgggatcc aaccattcca tggggcgttg     63300
     aaccacgtga cattgttgct tacatgaagt cagagactca agtgcctatc atgacgcaat     63360
     cagacagcgt gctacgttta ggccctaacg cctacactaa accagctgcg gcattaaata     63420
     ttttacgtga agtgatttta gggcgtgaat tatttgattt tgcctttaaa gagtacgctc     63480
     agcgctggaa gtataaacgc cctactcccg ctgatttttt ccgtactatg gaagaagcct     63540
     caggtgttga tttagattgg ttttggcgtg gttggttcta caccacagac catgttgata     63600
     tctcgcttga taaagtatat caattacgtt tagacactaa aaatccagat atcgacttta     63660
     aacgtttacg tgatattgaa gctgataagc caagttcatt atttgttgag cgtaatcgcg     63720
     ctgaaggtaa aaaaacgtgg gttgaacaaa atccagatgt gacagacttt tatgacgaaa     63780
     acgaccgctt taccgttaca aacaaagagc gtaatacgta caacaagttt ttaaaaggct     63840
     taaagccgtg ggagcgtaaa acacttgatc gcgcgcttga agaagacaaa aactactacg     63900
     tgatggagtt ttcaaacctc ggtggcttag tgatgccaat tcttttagag ctaacgtatg     63960
     aagatggcac taaagaggaa cgttatattc ctgcagaaat ttggcgtcgt aatcacaaaa     64020
     acgtacaaaa gctgattatt accgacaaaa acaaaccgct tacctcagta acggttgatc     64080
     caggctggga aacagcggat gttgatgtag aaaataacca ctacccacgt cgtattattc     64140
     cttcgcgtat tgaagtgtat aaacgtgaaa agagtaaggc aaaagtaagc cgcgatatta     64200
     tgcaagatat caaaacagag ctgaaaaaag acgagccaaa agacgaaaaa aataacgacg     64260
     aggatcaata ataatgcgtt ttttgcttat tattgtttgt tttttaattg ctgcgccaag     64320
     tatggcgcat caattaaaat catccgttac aacggtgtta tttaatcagc gtacgcacaa     64380
     tattgaattg atgcatcgtt tttatttaca tgacacagag catgctgttg gtaacttgtt     64440
     tcaaggcaaa gtggatatta tgagtaacaa gcgtgaccaa aaacgctttg ccaagtatgt     64500
     tgaatctcat gttgccttac aaaccttgag cggtgagccc ctcaccctta attatgtagg     64560
     tgcacaagtg gatggtaagt ttttttgggt gtaccaagaa gctgctattc ccgatgagat     64620
     tgagggcatt agaatgagtc atggtgcact gcgtgatttg tggcctgcac aagtgaatat     64680
     ggtgaatgtt gaagggcgag gacagataaa aaccttaaac tttagccaag ccgatacctg     64740
     gcttgaagcg aaatttgagc cgaaataacc actattattg cgcaccttta gagggtgcgc     64800
     actttccttt atagctgatc gagttaatta attgcatcgt aaagtcttta ctataccagt     64860
     tatacaaacc caaactatta cgttatcaaa tgagctataa ttaaatttca atggactgag     64920
     ctgtttttta tatgtttatt gatatacttt ttattaaagg tttagataac ctaagccaaa     64980
     cctagcatac tgagctaatt atttagcgca aggaatgaaa tgaaaacgca aattgaggca     65040
     atcaaaggtg ttatttttga tttagacgga actttagtat cttcagaatt aaacttttca     65100
     ttgataaaag cccaagtagg ttgccctgca gagcaagact tactcgatta catagaacaa     65160
     ctgccttccc cctatatgcg tgaagaagca atgaatatag tgcatcagca tgagttgtta     65220
     gatgcacaat cggctaagct tctacctggc gttgtagagg ctgttaaagc gctacaagct     65280
     aaaaacatac ctatggccat tgttacacgt aattttgata aggcggcgac attaaagtta     65340
     cagaataacc cgctaccaat agaaacagta ctcacccgaa cagacgcacc agcaaaaccc     65400
     gatccgagcg ctttattaac ggttgcaact caatgggaaa tgccggttga taatgtgatt     65460
     tatgttggtg attatttata cgacatacaa gcggcgcaca atgctaatat gcgtgcctgt     65520
     ttgtatgcac ctgatgtgac ccccgggtat gccgaacaag ccgattttgt tattcatgca     65580
     tttgatgagt tggtgtcatt aattgacaat tacgctgaaa aagttgagtt atgttaaatt     65640
     gagcttcgtt ttatttattt aatgacatat gggtattatt taaattaata cccagctgct     65700
     tttgcacagc atagcatatt gaaccactag cccaatacgg tttgaattgg taaaatatcg     65760
     caaaccaaat gtattcaata gaggcacaag atgggcagag catttgaagt ccgcaaaagt     65820
     tcgatggcta aaacagccaa cgcaaaaact aaagtaaatt cgaagtacgg taaagaaatt     65880
     tacgttgcag ccaaaagtgg tgaacctgat cccgatgtaa atcaaacatt gcgccgctta     65940
     attgaaaaag caaaaaaaga ccaagttcct gcgcacgtaa tcgaaaaagc aattgaaaaa     66000
     gcagccggtg gggcagggga agattactct tcagcccgtt acgagggtta cggccctggt     66060
     aattgtatgg tgattgttga ctgtttaacc gacaacccaa atcgcacaat taaagatgta     66120
     cgtttaccgt ttactaaaac agattcaaaa ataggtacac ctgggtgtgt tgcacatatg     66180
     tttgatcacc ttgctgtttt aggatttgca ggcgatgacg acgaagttgt gttagaagcc     66240
     ctcatgatgg ctgacgttga tgtaaccgat gtagaagctg aagatggcaa agtatcggtg     66300
     tttgcaccgc atactgagta ttttaaagct aaaacggcac tggaagaggc atttgaaggc     66360
     attaactttg aggttgatga aattaccttt gtgccacaag tacatgttga aatcactgat     66420
     gaagaagtta ttgccaactt tgataaattt atcaatatgc ttgaagattg cgatgacgta     66480
     caaaatgttt atcataacgc gactattaaa aattaattcg tagtgatttg aatagtgatt     66540
     attcactagc gttattaaaa attagcttag ggtctgttga cctttgcgga ttaaaatttg     66600
     ttcaaactag gggcggttta atcgcggcgc gaggtttgta acctagtggg ctaagtaaaa     66660
     accgagcaaa gcttccgcgt cctgctcacg ccccttacct acatccatgt aggcaacaaa     66720
     gagtaaatcg cccctaggca gaacccaaag ggcagcgcct gtttggcatt gatgctgcgt     66780
     tatcgcctat ttatggggaa taaccacatt atacccaaat tgccttaata tacagaattc     66840
     agcgtttcac agggacttaa tatcaaggcg ttccctttgc aataatggtc ctccctttta     66900
     aaaaggaaca acgaagggag taagttcctg tgaaacgccc tacgggttgg tttaaaagct     66960
     atttatgctg cgttattgat tttaacaagg gaataaccat tattttcaat caatgccttg     67020
     tcaaaatagc ttttaattcc aactgaaact cgcagattaa ggtaatttgg gtatagatag     67080
     gctctgcctt gcctaaatac caaacagact gctgcaaatt taaccttgaa aggtcaacag     67140
     accctagtaa agctgatttt tttattttta ggttaagttt taagttagtg ctgtgcttta     67200
     tatttcaagc ggtagctgtg tagtagcggc tctgtgtaac cgctcggttg actaacccct     67260
     tcaaatacca gtgctaaagc agcttgatac gcaatacttt tagctaatgt ctgctcatta     67320
     gttgccattg gcgtgtaaag gctgtcatgc tcgttttggc catcaacaac cttagccatc     67380
     tttgccatca ctttttgtac ttgctctttg ctacatacac catgatgtag ccagttggcg     67440
     atatgttggc ttgaaatacg taaggtggct ctgtcttcca ttaaaccaat atgattaatg     67500
     tcaggcactt tagagcagcc tattccttgg tcaatccaac gtactacgta gcctaaaata     67560
     ccttgcgcgt tgttttcaag ctcgctttga atatcttctt ttgatagcgt ttcagggttt     67620
     ggcatgagcg gcggtgtaag taagctctct aggcttgcta tttgacgcgt ggcaatgctt     67680
     tgctgcaggc taaatacatc aacatcatga taatgcattg cgtgtaatgt ggcggcagta     67740
     ggggagggca cccaagcggt atttgcgcca gattgagggt gcgctatttt ttgctccatc     67800
     atcatcgcca ttttatctgg cattgcccac atacctttac caatttgcgc tttatggctt     67860
     aagccacagg ctaggccaat atcaacgttg cgatcttcgt aagcgctgat ccaaggctgt     67920
     gctttaatag ccgctttcgg cagcacaaca cccgcttgca ttgaggtatg aatttcatcg     67980
     ccagtgcggt ctaaaaagcc agtgttaata aacacaacac gcgcttttgc tgcatgaata     68040
     catgctttta agttggctga tgttcgacgt tcttcatcca taatacccat tttaagggtg     68100
     tttttaggca agctcagtgc ctcttcaacc ataccaaata aagtattagc aaaggcgact     68160
     tcatcagggc catgcatttt cggttttaca atattaatac tttgcgcggt tgaattttta     68220
     atcgtgtttt tagtgtttaa atcgtgcaaa gcagctgttg cggtgaacat ggcatccata     68280
     atgccttcaa acacatcatt gccgcttaca tcggtaatgg ctggatttgt cattaaatgt     68340
     cccacgttac gcacaaacat catactgcgc cctttgaggg acagtttttg gccatcaaga     68400
     cctgtatatt gtcggtcagc ttgtaacgtg cggtcgacca ttttgtcgcc ttttctaaac     68460
     gtttcaacca agttgccttg cattaaacca agccagtttt tgtaaacttg tactttatct     68520
     tctgcatcca ctgcggcaac cgagtcttca cagtccataa tggttgttag tgcggcttct     68580
     agctccacat cttttaaccc tgctttatca gcttgaccaa tagggtggtg atggtctatt     68640
     tgcagctcaa tatgcaatcc attgttttta agtaaaataa cactcgggtt ttgtgcttca     68700
     ccttgatagc caatcagttg ctcagggttt ttaagtgtgg tgtgcgaact gtcgcgcagg     68760
     gtaatagcaa gggcgccgtc aacaatagaa taatttgtac tttcaatgtg cgagccattt     68820
     tcaagcggta atgctttgtc taaaaactgc cttgcgtaag ccattacttt aaagcctcga     68880
     acagggttgt attggctgcc tttttcggcg ccgtcgtctt cgcttaatac atcggttcca     68940
     tataaagcat cgtacaacga cccccaacgt gcattagctg cattaagcgc aaagcgtgca     69000
     ttactaaccg gcaccactag ttgtggccct gcagtcagcg ctatttctgg ctctacattt     69060
     tgagtttcaa tactaaagtt ttcaggctca tcaactaggt agccaatatc ttttaaaaac     69120
     gcttgatact gagcttggtc agcattttta tttgcaaggt ggtagtcatc aatttgcttt     69180
     tgtagctgtt cacgcttagc cagtagtgac ttgttcaatg gtgtaagtgt ttgcactatg     69240
     ttggcaaagc ttttccaaaa ctggtgttca tcaagatggg taccaggtaa taattgtttt     69300
     ttaacaaatt cagcaagttg cttatcaacg ctgagtcctg aatgggtgag agtgtggctc     69360
     ataattaata tccttaaacg gtccgacagt gtgcaatttt ttatatgcgt acacctacca     69420
     tatcgcaaaa aagtggcttt gaatgctttt tagtcattca ctatatgtat agccgcaata     69480
     aaaactataa atttactaaa tctaaaaaat aagcctaatg tttaattaag cgctacagag     69540
     ctaacgtgat gtagtcactc tctcaacaat aaatattaat acccgttcga aggactttat     69600
     tatgacaaca tatcaaggcg aaacagatac actagcaaca ttatgccaat cacaaggcag     69660
     tgcatggaaa acaattaatc ctgaatacgc aacacgtatg cgtttacaaa atcgttttcg     69720
     ctctggtgtt gatattgcac aatttacagc agacatcatg cgtgaagaca tggctgcata     69780
     cgataaagac acaagccagt acacacagtc tttaggttgt tggcatggtt ttactgcgca     69840
     acaaatgatg atggcaatta agcgccatca aaaaacaact aagcgcagtt acgtatacct     69900
     aagcggttgg atggttgcag cgcttcgctc tgagtttggt cctcttccag atcaaagtat     69960
     gcatgaaaaa acatcagtac cggcacttat cgaagaaatc tataccttct taaagcaagc     70020
     ggatgcacgt gaacttgacc acttatttaa tgaactagac gacgcaaaag caaacggcgg     70080
     cgacgttcaa gcagtactta acaaaattga taactttgaa acgcacgttg taccaattat     70140
     tgctgacatt gatgccggtt ttggtaacga agaagcaact tacctactag ctaaaaagat     70200
     gattgaagcg ggtgcatgtg ctatccaaat cgaaaaccaa gtatcagatg ctaagcaatg     70260
     tggtcaccaa gcaggtaaag tgacggttcc acatgaagac tttttagcaa aaattaacgc     70320
     agtgcgttac gcgttcctag agctaggtat tgataacggt attatcgttg cgcgtaccga     70380
     ttcactaggt gcaagcctta cgcaaaaagt accggtttca aaaaaaccag gtgacttagc     70440
     aagccaatac aatgcatttt tagaaacaac cccagtaaac agtgttgatg acttaaatga     70500
     aggcgaaaca gcaatgaagc ttaatggtca gctttgtaag ccaacacgcc tagacaatgg     70560
     tttataccag ttccgcgaag gcactgaaaa agaccgtgta gtactagatt gtgtaacgag     70620
     cctacagtca ggtgctgatt tactgtggat tgaaacagaa aaaccacatg taaaacaaat     70680
     tgctgaactc gttaatcgcg taaaagagca agtaccagat gctaaattag tatacaacaa     70740
     ctcaccatcg ttcaactgga cgctgaagtt ccgtgagcaa gtataccaag aatggcagga     70800
     agaaggtcgt gacctgagcg cttacccaag tcttgatgat aacaaagcgc ttatggctcc     70860
     agaaatggat gcaacagagc ttgcagcagc cgctgactta ttagtacaaa acttccaacg     70920
     cgatggtgca cgtgaagcgg gtattttcca ccacctaatc acgttaccaa cgtaccacac     70980
     agcagcatta agcacagata ttctatctga aggttacttt ggtgacttag gtatgctggc     71040
     ttatgtacgt gatgtacagc gtcaagaaat ccgtcgtgag caagcgtctg ttaaacacca     71100
     agaccttgca ggctcaaaca ttggcgatac acacaaagag tacttctcag gtgagaatgc     71160
     actcaaagcc ggtggtgaag ctaacaccat gaaccaattt taattcaact agatagtgtt     71220
     acttaagggc cgcaaggccc tttttttatg cttgcataaa ggcaaaattt aatagatcag     71280
     tattttacta gccatttggt tagtgagatt tttcaatgca atgcaggtta aaagtgtaaa     71340
     taaaatttaa aggatgttta tgctcggctg gagggcttta tgttgattac gctttgacac     71400
     tggtaagcac aataaattac ccgcttttta ccacatatag atcagagttt aactaacata     71460
     ctgaaagcag atcacgattt aactagctag ttaaaataca gatcaggttt taactaacca     71520
     tgataaaaac agccattctc ttcatcatta agggtagatt tgcctttcta atcctcaatt     71580
     tgagcattta aatgcttaat ttaaagattt ttaactaggg tttagaaagt aataaaccga     71640
     ttttttacta actgctgcag cttataaaac ctttttttac taactgaggg cttataaaca     71700
     gtgactcaaa ccgatttttt actaactcac agcactattt cttctataaa ccgatttttt     71760
     accaactcag tctgaagcta agtccgatat ttagtttgag tatgtaaggg gttactcaca     71820
     ttattgctgt aaagggggtt tacacttgtg agcttcgagc aacgagctta tatagctcgt     71880
     cactcataac tctgcgtttt atttcgaatg cttatcaaac caccattgaa tataagccac     71940
     tttggtcatt aagttagatg gacgggcagt aataccatgt gaagcgtttg gaatacgcac     72000
     catcgcggta tcaaccccct gcaattttaa ggcttgataa aactgctctg tttctgaaat     72060
     aggcgtacgg tagtctgctt cacccgtgag taacatggtc ggggttttaa cattgccaac     72120
     ataactgatt ggtgagcgtt tcatgtaatg ctcaatatga tcccatggtt tacctgggaa     72180
     ccaatagtca gcaaagaatg gataaaaatc ggcagtgagt acaaagctga tccaatttat     72240
     caccggtttg gcaaccacgg ctgcagcaaa acgatctgta tgacctacaa tccacgctgt     72300
     taatacaccg ccgccagagc cacctgttac aaataactta gattcatcaa taaacccttt     72360
     tgcaataagc gcatcaaccc cagtcattaa atcatcgtaa tcattgcttg ggtaattatg     72420
     atgaatggtt tgcgcaaact ctttaccgta tgaatcacta ccacgtgggt tcatgtataa     72480
     aaccacgttc cctttagcgg caaatagttg tacttcggca ctaaagtgcg ggccataatt     72540
     agcgacaggg ccgccatgaa tctcaagcac tagtgggtat ttttttgatt tatcaaaacc     72600
     cggtgggtaa gcaacccagc cttgtattgg cagctcatcg tggcttgatt taagccataa     72660
     ttcttcaacc ttagcgagtt gcttggttgc aagtgcatca gaatttaaat ctgttaagcg     72720
     ctgcgcttta ccgcgcttta ttgtggctac atcagcaggg cgctgggtat cggccaatgt     72780
     aaatgcaaca tgaccatttt cactaatatc gaaatcgcca ccggaataag ggcgaccaaa     72840
     cgcaacactg cctatttttt cggtaatcac tttgcgtttg ccacttcgag gttgataagc     72900
     cagcgcagtt tgcccttcat cggcatagct aaaataaagc ccttttgagt tcgcactcca     72960
     cttaatttgg ccaacacttc tatcaaaatc ggtggttagg ctttgagtat tccctgtttt     73020
     taaatcgcga atatagagtt gggtgttttc gtaattagta cgcttgtcgt cataccctgt     73080
     ataggcaagg tatttgccat caggtgacac tttaggttgt tgatcaggcc cattacgctc     73140
     agttagaggg aaaatggcta gcgagtctaa atcgagttga tatacctcag tgttagtggg     73200
     cttcaattca ttattttcat tgcgattagc agaaaaatac aatgttttac cgtctttact     73260
     aaagctgact tccccaccat tattaaaatt atcgttggtg agttgttgag cattaccgcc     73320
     attggcatca agtgtaaata attgactaaa ccctttttca gtataacccc ctccatcggc     73380
     acgataataa acatcgtcaa tatatttagc aggctctgcc cacgtggcac cttttggttt     73440
     tccaggtaag ctgacaggcg cagacgccgc cattggaaca aacatactaa acaccagctg     73500
     gtttgaatca ggagtccaag ttagtgagct tggattgcta gttaaattac taaccttagc     73560
     gatagcccct gtttttaacc atttaatata tatttggttg ctaccatttc ggtttgatat     73620
     gaaagcaagt cgctgtccgt caggagagac tactggcgag taatccatat atacaccaga     73680
     agttaatggt tgtagttgcc cagtgctgta atcaacagac caaatattgc ctactttacg     73740
     gtcggtttta atatccatgc ggttgcggac aaaatacacg gttttaccgt cttctgttat     73800
     gtctatttgg ttggcatatt caagattgaa aatatcttga agttgtaatg tatcggtatt     73860
     ggcaacagct aattgactgc tgcccagtat aagactcata gctaaaagcg ttttcattat     73920
     ttatccctgt tttaaatcac tgctctattt atagggtagg agagggataa ttaacagtca     73980
     gatgcgacga agccagtatt taaaactacc aatgaatgaa ggtgataaaa gaaagtaaaa     74040
     gctgtaaagg gggtttacag cttagaggaa gttatacgct tgcgctgcaa agagccttta     74100
     tgtcttcaat aagcgcaaca ccttgggcgt tatcaccgtg cacacaaata ctatcggcgt     74160
     taagttttaa cgattttcct gactgggtag tcacactgtt actagttaaa agctgtttaa     74220
     cttgtgccaa taatgctgct ttatcatgca cactgcctgc tatatttctt gctacgaggt     74280
     gcccttgagc tgtatatagc ctgtctgcga acgcttctaa aacaagcgtt agtccaagat     74340
     gacgtgccat tgtatggtgg tgtttagcat cggccgtggc cagtatcatt aattttaggt     74400
     cagcagggta actggcaacc gcgcccatca cagcactaag tagtggctgg tgtttcatca     74460
     tgtcgttgta aagtgccccg tggggtttaa catagttaag ggttaatcct tgtgcctttg     74520
     ccataccatc aagggcagct atttggtagt gtaaacactg agtgagctcg gccacactca     74580
     ggttcattga gcgtctgcca aatccttgtt tatcggggta gcttgggtga gcgccaatca     74640
     taacattatg ctgtttagcg agcttaagag tattggccat aacactagga tcgcccgcat     74700
     gaaaaccaca ggcaatgttt gccatatcaa tatgcggcat tacttgatca tcaagcccca     74760
     ttttccacgc gccaaagctt tcacctaaat cacaattgag tttcatatta gtggctcttt     74820
     gattgtttaa tagttaccgg taagctgcct ttagcagggg cttgaccgag taatacttta     74880
     gcaagtgctg taaatgcagg cccagatact tgctcgtttt tgtctacgtc aatattataa     74940
     gcatatgaag ctaatactgc atcggcagag tcgccaaact gcgcaatatc ataaggagct     75000
     cgcaaactaa taaacacggt gggtatttgt tgcttgttag ccattttaag taatgattca     75060
     agtgctttag gttgctctgc gttattgagg gcaaagtctg ggttatcggc taaatcatcc     75120
     atcccgccaa tttccaccgc gctttgatta ggcgtggcat ttccggcaat aataatatca     75180
     gcttggttta tattacgctg agcctcaaca gggtcaaaac cttgtaaact gctacagcta     75240
     taaactaatg cgtgtgagct cagtgccatt atggcttgtt gtatggcaat acatttacgc     75300
     gtatcgggca taataatatg aatgtgttgg ccagcagtaa gcttaagtgg caaggtgttg     75360
     ttgttatttt ttatttgggt gatcgccgct aatgccagtg acgcttctaa ttcgcgatgt     75420
     gctttattac caataatgtg cttagcattg gctaatgctt taatgggatc aggaaaagcg     75480
     tttaatttaa atttactttt aagtgaggta atacgctgtg ctgaatgcgc aatttcctgt     75540
     gcgtttagtt gctctgattt aaccgcactg actaatgact caatgagagc atcgagcttt     75600
     ttaatgtcat ctggcgttct aatctctatt ggcataagcg caatatcaac cccagcggca     75660
     aaggtgttta taattgcttg agttggacta aaaaagtgac taatacctgc catatcaagt     75720
     gcatcggtta ccaccacacc ttgatagtta agttctttac gtagaatatc ggtcatgatt     75780
     ttacgcgaca ttgtcgcggg cttgatcatt tgtttgccat caacattagt caaggtactg     75840
     ctatcaagct cagggtattg aatatgcgca gtcattatca tgcccggact atgctgctca     75900
     ataatgtgtt taaagggcgc taaatcttgt gcgtaaatca cctcttttga atgcatcact     75960
     ttaggcaagc cggtatgact atctacattg gtgtcgccat gcccaggaaa atgctttagt     76020
     gcgctaataa tgccattttt ttcaaattca ctaacttgtg cggcacctaa tactgctaca     76080
     tcatttgggt tttcactaaa agagcggaca ttaatgacag gattgtctgg gttcatgttt     76140
     acatcaacgg ttggcgcgta atttacatta atccccaatg ctgaaagctc cgtggcaaga     76200
     acattcgcgg tttgagttgc gaaataagtg ccatgctcag ggtaggtggc gccaattgac     76260
     atattaccag taaatgaagt ggcaacatca cgtggcagtc gagctacgcg tccaccttct     76320
     tggtcaattg aaataaaaag cggtaagcct gatttagagt gagacgcagc ttgttgcagt     76380
     tgctgattaa ggctaattat ttgttcaata ctttgggtgt tttcagaaaa taaaataacc     76440
     ccgccaatat cataacggct aatcgctttg gttagtgtat ctggtaactc ggttaatgct     76500
     gttctgcagc gcttactgct gccttggtga caaaagtagc gtaaatcgag cataagtttt     76560
     tgcccaagtt gctgttcaag cgacagcgca gaatcggcaa aagaagattt tattggcatg     76620
     aaacatccga ttaaaaaaag agaagacgac aacaggtact tatttagcaa cacacacctc     76680
     aaggctaaat aaaaataaag tgcatgcagc ttaactatta ttgagcttaa ctgcaaaacc     76740
     cgacatatat aataaatgtc attttattat tccaaaaata acaaaaatta ggctacttag     76800
     tttaatttct gtattatatt taggatatat gtagtacata gcagtcgttt ttatttgctt     76860
     aggatgataa taagttgcgt tttcgatcac catttacttt taaacttagg caattaattc     76920
     tgttgttagc tatcactgct acagccgcta ttttgttcag tggtttatac attagttacc     76980
     aagtacaaaa agaacgggta atagaagata ctcttaaaag taaccatgta tttgctagta     77040
     agcttgcctc ggcgaccgat cactttttag cagctgcgat gcagcaactt gagttttcag     77100
     ccaaaattat tgctaaagac attaccaata ctgagttact ccaagctgaa accaaccgcc     77160
     ttttaaacca aacacatagc tttaattcgg tagcaattaa catgcaaggt gtcgttaaag     77220
     cggcctcacc tgtttcatta aatattatta ataaaaccgt taattcacct cattctaaac     77280
     aagcctttaa actacagcgt ccattggtta gtcgtcctta tgtatcgctt gcgaataact     77340
     taattgttgt actttcttat cctttatttg acgagattgg taactactat ggctatattg     77400
     gcggtagctt ttatttagaa caacagagca ttttaaacgc cttattaaaa cagcatagtt     77460
     acgatggcgg ggcatacttt tatgtggtgg ctgataataa aaccttactt tatcatcctg     77520
     agactgagcg gattggcgaa caagtcatta ataacccagt aatagagcgt gttttgcaaa     77580
     gcgaagatgg atacacccgg gttttaaata gccaaggcgt gtctatgctt gctggatatt     77640
     cgcccgttaa acttgctaat tggggcgtag ttgcccagcg tagtgaggtg gcaacacttg     77700
     ccacgttaga tacttttcaa gggctggtgc ttaagcgaat gctaccaatt gtattaatta     77760
     cttttgtatt gattggtgtg ttagcgcatt ttattgctaa gccccttagg ttactagctg     77820
     acagtgcaaa tttatcgact gatcaacaaa acgtggcgaa tcttaaaagt attaaatctt     77880
     ggtattttga aagtcagcaa cttaaagcag ccatgttaga aggagttaat atactgcagt     77940
     cgaaaatggg gcaattacgc caagatgcac tcaccgatcc gctaactggt gcgcataatc     78000
     ggcgaggttt gtatttattg ttagataaat taattcaaga acagatcccc tttgcggttc     78060
     tagaaataga tatcgacttt tttaaacggg ttaatgacac ctttggccat gatgtgggcg     78120
     atgaggtact aaaaacttta acgtgtgtga tcaagcaggt atctcgcaaa gatgatattg     78180
     tcgcgcgaac tggtggggag gaattcttac ttatattacc gaacgaaaat agcgatagtg     78240
     cgtttgttat tgctgagcgg ttacgtaatg aagtggcgaa tacaccgatg gccaaagttg     78300
     gttgtataaa tgtctccatc ggcattgcta catggccgca gcacagtgat gatattgatc     78360
     aagtatacaa atgtgccgac aaagcgctct atcatgcaaa agaaacgggc cgtaataaaa     78420
     ccgttattgc cagtctaaat taaatttttt aaaaaattaa tttaccttaa gttttattta     78480
     agtttcgcct attaaattct acctatagat ttaatacagg cgatgctttt atgcaattag     78540
     ctcaacaaca acagtcagca tcaacacttt ttcagtcgtt cacacagttt gtgagcgcca     78600
     gagaatgtga tgaacaccgt cagcgccttg aagatacagt aaaacaaggc tttttagctg     78660
     cgtacaatgc cagcctaact tcatttatgc cattactctg tcagtataaa actcagcaag     78720
     ggcattgcac tttagggctt agaaacgcca cttctccttt atttattgaa caatatttag     78780
     cagcgcccat tgagcagttt ttaccaatgg gcacacagcg cagtagagtg tttgagttag     78840
     gtaatctcta ttcaacacac agaaaagcca cgttatcgca ttttattatt gttaatgaag     78900
     ctttaagagc tattggtgct actaatttgg ttttttgtgc caccaaacat gtacgcgctt     78960
     tattgcgttt attaggggta acgtgtaatg aaattgcatt ggctaacagc agtgttgttg     79020
     agcaaccaaa aagctgggga agttactacg cgaaccagcc tacagtatgc attgttaatt     79080
     tagagcaagc acatctacaa gtacttaata cgccaatgct acttgatatt aaacaacaaa     79140
     atacacatgg cattacggca ttaatcaatg cgctggaggc ggtatgagta tgttaaatag     79200
     cttaaatgat ttagctattc agccggcggt agttgcgcat tttgcgaatc aaacacaaca     79260
     gttcacaggc actgagctgc ttcaagaaat taataaagta gtggaaattt ttgctaattc     79320
     agatgctgat gcaattgcat ttcaacttga taacacacct gcttggttgg tacttgatgc     79380
     tgcgaccagc gttgctaata aagtggctat accgatcgcc cattttttta gtcaacaaca     79440
     aacgcaatat gtgttggcac agtgtggtgc acagctgttt ataagtgata tgccaaggct     79500
     ttctttgggt gcgcatacat tgtctattac tttgtttgat cattacacct tatatattta     79560
     tcagctcaac gttaaagaat cgattagtta ctttgagggc acgcaaaaaa tcaccttcac     79620
     gtcaggctct acaggcgagc caaaaggggt gtgtttatca actcatagcc aaatgcaagt     79680
     tgcacaatcg ttatgtgagc aaataggtat aagtaaacca actcacttat gtttactgcc     79740
     attacctgta ttactggaaa atattgcagg tatttatgca ccattattaa gtggcggttg     79800
     tgtacattta atgccgttaa acgaattggg ttttgttggt tcagggttaa aaaatcctga     79860
     aaaacttatt agtgcaattg acagtgtaaa acctaacacc cttattttag tgcctgagtt     79920
     attaacgtgt ttaattgcgt ttgcaaaaca aggttggcag ccgccaaagt cattacagtt     79980
     tattgcagtt ggcggagcgc tcgtgagtga tgctttaatt gccaccgcca gagagcttaa     80040
     tttacctgtt tatcaggggt atggattatc agaggcggca tctgtcgtaa gtttaaatac     80100
     gcccaaaaat gatgatttaa agagtgccgg cactgtactg ccgcacatac aaaccaaaat     80160
     cgaaaaaggc cagttgtaca taaagggtga gctattttta gggtatttaa atcaagcgcc     80220
     gcataaccca aataactggt atgcaacagg cgatttagtg acccagcatg gcaataagct     80280
     cttcataaaa gggcgactta aaaacctgat tattaccagc atgggccgta atgtcagtgc     80340
     tgaatggcct gagtcattaa tattgagcca aagcgcgatt atacaagccg ttgtttttgg     80400
     tgaaggcaaa ccttttttaa ccgcgattat ttatgcaatc cctgagttga gtgagcaaca     80460
     actcagtgag catatgaaat ttataaatca acagttaccc gattatgcac aagttaaaaa     80520
     gtggcatcgg ttagctctgc ctttaagtgt tcagcaaggg ttactaacga ccaataatcg     80580
     tcctaagcgc caggctatta gccagcaatt taaccttatt tttgaacaat tttaccgact     80640
     tggagaagtg atccatgact gattttttta atacattaaa agcacaaact caaaacgagc     80700
     gtgagtactt attagctgcg ccaattatac agcgcgtttt taaaggccaa gcatcacttg     80760
     aagagtatgc gtcattttta gcgcaagcct accatcatgt aaaacatact gtgccattaa     80820
     tgatgtcgtt aggtgcccgt ttgaccgacg aacaagaatg gttacgtgaa gccgtagccg     80880
     aatacattga agaggaaatt ggccatcaag aatgggtgct taacgatatt gccgcgtgtg     80940
     gttttgataa agaaagtgtg cgccatagta agccacaatt tgctaccgaa atgatggtct     81000
     cgtatgcgta tgacagtatc gctcgtaaaa atccattaag cttttttggc atggttcatg     81060
     tactcgaagg gacttcaatt gccctggctg atggcgcagc ttcaaatatt gctgatgcag     81120
     ttggtttacc taaaaaagca tttagctatt taacctctca tggtgcgctt gatatagagc     81180
     acgtaaagtt ttttgaaaac ttgatgaaca aaattactaa tgaggccgat cagcaagcta     81240
     ttttacatgg cgcaaaatgt ttttatcgtt tgtacggtga tatttttcgc gctttagatg     81300
     acgagccgtt ctttaaagca ttagcacaag agcaacacgc atgaataccg gcttatgtgt     81360
     gttaacagga gccacagggg gaattggcca agcgattgcc aaaacactgc acgcacaagg     81420
     ttggcaatta ctattagtag ggcgtaatgg cgatgcgcta aatgcgctaa gtagccagtg     81480
     cccaggtagt atgacttttg tgggagattt aaccgttgca gaaaacatgc tggcattggc     81540
     aattaaagcc aaaaaattgg gcggtgctaa attactcata aacaatgcag gcattaatgt     81600
     tatgcaaagc ttaagtagtt gtagtagtga acaaattgat aatctactga gcactaattt     81660
     agccgtcccg atgaaactat gccagctgtt tttagagcag ctgcaagcga atagaggcac     81720
     catagttaat gttgggtcgt cttttggcag cataggttac ccatatcaaa cactttattg     81780
     tgccagtaaa tttggtttgc gtggttttag cgaagcgtta tcacgagagc tttcagacac     81840
     tggcgttaga gttacttatt tggcacctag agcaactgat accgacatta atgatgctca     81900
     aacgcgagca atgaacaaag cgcttggtaa tcaaatggac tctccgcagt tggtggctga     81960
     tgagttagtt gcgttattaa actcaaataa aaccagacga tttattggtt ttcctgagaa     82020
     actttttgca cgtatcaatg gcgtttttcc acgtattgta gataacgcaa ttgctaaaca     82080
     actccctaaa ataaaaagct ttttaggtta gttgttcact agggtctgtt gacctttgcg     82140
     gattgaaatt tgttcaaact aggggcgatt taatcgcggc gcgaggtttg taacctagtg     82200
     ggctaagtaa aaaccgagca acaaagagta aatcgcccct aggcagaacc cttcgggcag     82260
     cgcctgtttg gcattgatgc tgctttatcg ccaatttatg gggaataacc acaccacata     82320
     ggcgctgcct tgcctaaata ccaaacaggc tgctgcaaat tcaaccttga aaggtcagca     82380
     gaccctaaat aatagaggat ttattatgaa aaaatttact ttagcagctt atttaagcat     82440
     tgttagtgtg ttttcatcgc cggtatttgc agatgaacaa agcgacttac tcgctattca     82500
     acagcagtgg gcggtcgcta attatgagct taaagatgac gcacaaatca aagcctttac     82560
     tcaactgagt gagcaaagtg ctcaatttat cgaaaactat cctaattcag caaatagcta     82620
     cacatggaac ggcattgtgc tggcaagttt tgcgggtgca aaaggcggct taggggcgtt     82680
     gggttatgcc aaagatgcaa aggcatcatt agagcaagcc cttaaaatag acgacagtgc     82740
     tttaggtggc tcagcgtatg ccagcctggc aactttatac agtaaagtac cagggtggcc     82800
     aattggcttt ggtgatgatg acaccgccga taagtttttt aagcaagcac tcgcttttaa     82860
     tcaaaaaggc attgatacta attacttgta tggtgagttt ttatacgacg aacgtgaata     82920
     taagcaagcc aaagcccatt tgttagttgc acaagcggcc ggtattcgtg atactcgcgc     82980
     taaagcggac aaatatcgtc agcaagcaat tagccaatta ttagctaaag ttgataaaaa     83040
     actaaagaga taacaaaaca aacaatgcat ttattattag ttgaagatga tcatcttgtg     83100
     gcgcaagggc tttgccgctc attgcgccaa gaaggctaca gtgtagaaca cagcgcaacg     83160
     gttaagcatg cgttgcaatg tttaggcagt ggcgaaatag agttggttat acttgaccta     83220
     ggcttacctg atggtgatgg ttcgcaaatt ttaaagcaca taaaagcaca aaaaaaagtc     83280
     attccggtgg tgatactaac cgctcgcagt agcatagatg acaaagtgca agggcttgat     83340
     atgggggctg atgattattt agctaagcca tttgaaccag ccgaattatt tgctcgtttg     83400
     cgcgtagcga gccgacgtgt aaatcaagct cagtcgagct tattacaatg tggtgatgtt     83460
     actatggata cgtcagcgca cagtgtcaca cttaacgatg agctactttc tctgccgcga     83520
     aaagagtaca tgctgctaaa agcgttactg gaaaaccaag gtcgcgtgca atctaagcag     83580
     cagttagaaa ataaactcta tcaatggggt gaagaggttg gctctaacac cattgaggtg     83640
     catattcatc acctacgaaa aaaattcccc agcgatttta ttaaaactct ccgtggtatt     83700
     ggctatgttg tgggaaagag atagctcacg tgattaaaac gcccctagat tgcacaaact     83760
     tgaatttaca aaggtaacca tgctctatgt caattcgtaa gcgtttaaca cttatcttac     83820
     tgtcaatgat ggtgttaacc tgctttttag ctttagtaaa aggctatcaa aaaagtatga     83880
     gccatggtga gcaattactc gatagtgagc taaaagtagt ggctggagtc ttgatgcaac     83940
     agcctctatc tataaacgct atggcgccaa aaatgcaaga aagcgcccag ttactgtatc     84000
     aaatttggca aagtggtgag ctacttagcg gttctgacga attaaatctt gatttgagcc     84060
     aatatcaagc aggttttcaa acgcttaata ttgcagggca gcgaatgcgg gtattcgttt     84120
     ttgctacttc tttacgcacc gttattgttg ccgagccgat tgctaagcgg tttgagcttg     84180
     ccgaggcggt gattttatca gccatgttac ccatgttatg ggcggttcct ttgcttgcgc     84240
     tatttattag cttttttgtt aaatatgcac tggcaccgtt aactcgttta tcaaaacagt     84300
     tagccctgcg ccaagcaaat gatttcacag cgatcaattg gcaggtgacg gatgaagaaa     84360
     taaaaccagt gatcagccgc ttaaacgact tatttaaacg cgtagaaacg gcctatttac     84420
     gagagcgttt ttttgcctca gatgccgccc atgaattacg tacacccctg agcagtttaa     84480
     aaattaatgt gcataatttg gccgcccaac aaggcgataa ccaagaatta caagccatga     84540
     ctcaaggtat aaatcgactc accaatatag tggagcaaat gctaatacta ggacgtactc     84600
     agccagagca gtggcaaaag cagtttaaag aacagtcatt attagcgatc acgcaagaag     84660
     tagttagcca actatatgaa aaaatagagg ctaaaaatca cactattagc cttgagggag     84720
     atgactttac tattaacggt gatgagttta ccttagtgac gttgatttca aacctactga     84780
     gtaatgctat aaagtacgcg cctgcaaacg gacaaataaa aattacccta aagcagatgc     84840
     acaggcagcg tatttggcaa atagaagaca gcggtccagg tatgacggac gatcaaaaac     84900
     aacggatatt taaccgtttt atcgcgttgg cggtgaccaa catccttcgg gtgaacaagg     84960
     tgcgggctta ggcatggcaa tagtccagca cattattgct atttatagcg ctgaaattaa     85020
     tttaacagat agcgatttgg gcggcttaaa agtacaggta gtttttgcag gagctaaatg     85080
     tgattaaacg acttattcac ccctatttat attgttgcgt atttttatca tttaacgccg     85140
     ccagtaaaga ctatcttatt gtacttaaag atcatttgtt ttatcccgca gaaatcgtgg     85200
     tgccggccaa taaaaaggta cgcttgttaa tcgaaaatca agatagtacg cctgaagaat     85260
     tcgacagttt cgatctcaac cgagagaaag tactttaccc taatcgcaaa agcgttattt     85320
     atattgggcc gctaactcct gggcgttatg aattttttgg cgagttctcg cccaatacgg     85380
     cgcgtggtgt tgtaatagcg accgaaaagg agggttctga tgctaataac tagccttgtg     85440
     atgagcctca atcagttatt gccggtggcc attttactta ttttactcca agtgattgcc     85500
     aagcaaagtt tagtgaaggt actggggatg cttgttttag gtgtggggct atcattttta     85560
     tttgtaaaaa gtgctccgct aattagtccc ttgttcgact accagggttt agaatatacc     85620
     caaattgctt tatgtatttt agtgtttatc agtgcgctgt actacgccat taaacaagca     85680
     acgcctgcat ttatgattgc gattatcagt gtaatgactc tttatttaag tcattacatt     85740
     atttacctga ttggcttttg gcaaaacaac gaagcagcac aaagcttatt tattggcact     85800
     tttttaggtt tagggatatg cagtagcttt agtgtgttgt tgtatttttt attgagtgca     85860
     atcaaacagc gctttgggct tatcccttta ttggtattgt tagcattaaa cagtgcggca     85920
     aaactggttg tggcacttga tttggcgagc caaattgatt tgatagcaac aacggcaacc     85980
     gtatgggatt tacgtgctat tttaactgaa aactcagagt ttggacgggt tttgcgcgca     86040
     cttatcggtt atgaggctac gcctaattta accagtgttt taagttatgt gctgagcagc     86100
     gtgttatttt tatcagtttg ttattttatt cctaaatcaa taactaagga acaatcatga     86160
     aagcaataaa cctatttgca gccactgtat taattggttt ttgtttatta atacctaagc     86220
     tggcttatgc tgatggcata gtggttgata aagtttatca tccttatgtg ttgccgtttg     86280
     agcgcgagct agagtggcgg cttgtgtcac atcaaactga caatggtaat attttagcgc     86340
     agcgcgttgg cttaggcggc gcaattaacg acaccatggc attggaaggc tatttagtgg     86400
     gcgagcgcga tgataatggt gactttggct tgcaagcgta tgagttagaa cttcgttggc     86460
     agttaataga gcagggcagg ctatgggctg attggggcgc gttatttgaa tttgaaaaac     86520
     agcatgacgc cgacgcatac gaagcaacca ccggttttgt gattgaaaaa gagtttggtc     86580
     gtgcaagtct cactatgaat gcatttttag tgtatgagtg gggccaagat atacaaaatg     86640
     agtgggaaag cgaatttaga gcgcaatatc gctaccgcta tttgtctgct tttcagcccg     86700
     cggttgaggt ttaccttggc gaagactttg tcggtattgg ccccggattt atagggttac     86760
     atcgctttga tggacaaaaa caattaaagt gggaagccgg ttttattact gaaatcagcc     86820
     agtcagagaa aaatcatagc tttagaatgg cactagaatt tgaattttaa gctctttaaa     86880
     caagtactta atttataaag cgggctgctt aagctatttt ataaattaaa tcgcattaag     86940
     ggttgacttg agtctgtaac tctatatagt agtccgcagc tagaaagaaa gcatgataat     87000
     ttataaatct ccatttcgtt gttgtataag taatacttgt agtaccgtcc tgaagttttt     87060
     aagtaccatc tcattttttg ctacaccgcc cattagggca caatttaatt tttatatcag     87120
     gaataatact atgtctaaca tcgtatcagg tacagttaag tggttcaacg agtctaaagg     87180
     ttttggtttt atcgagcaag aaaatggtcc agacgttttc gcacatttct cagcaatcaa     87240
     aagcgaaggt ttcaaaactt tagctgaagg ccaacgtgta gagttcactc tttcacaagg     87300
     tcaaaaaggt cctcaagctg ataacatcac agctctataa ttttactttt aagtaaaatg     87360
     aaaaaaagcg cttaaggcgc ttttttttgt gtctaaaatt taagaatatc tccccaccat     87420
     ctgtaaattt ataccaattc gcttaattaa gcggtctatt ttgaggcagg aaaaacgggt     87480
     tgatagctag gcaaaaaatt cgctatttag ttgttctaaa tgagaatttt ttaacacaga     87540
     tagcgacacg tttagccccg caaaatgatt gagtattatt gcggattggt attattaacg     87600
     atagtcactc tcaaatcacc tgctattttt aacattataa aagtgctata aattaatagt     87660
     ttctgtacgc tttctaggtt aaggttatta cttaaattat agggggtgtt tatttttaaa     87720
     tttacattat tagcgttagg gttgctattt agccataata tccaggctaa tgcgcctaaa     87780
     ttggttattt ataccgaaag ctttgcccct tacaattttc aaaatgaagc tgggcagcta     87840
     gcgggtatta atcatgatat agtgaaagat gcttgtgctc gtgccgcact agagtgcgaa     87900
     tttatgatgt taccttggaa gcgtgcttac cagttagtgc aaaataaccc acactcagcc     87960
     atcatttctc tagcaaaaac gcaagaacgt attcctcttt ttgaatgggt gggacctttg     88020
     gtatcgagcc aaacctactt ttttaaatta aaaactagcg accatattgt gatgaatgat     88080
     atttcacaag ctaaaaacta ctcgttgggc atagtgcgag gcgacattta tgaaatgctg     88140
     gtgcgtcgac ttgggtttgt taccgataaa aacttactac tgtttagtga agcagactca     88200
     tttatgcgac tgttttttaa aaaacgcatc gatttaatta ttggctctga ctttactatt     88260
     gatcatcaaa ctgagccatt tgggtactct agggatgact tggtgaagct caagcaaatt     88320
     catgtggatg agcttaaagg caactatatt ggctttaaca aagccacttc acctgtggta     88380
     gtaaaacgct ttaatcaagc acttgagcag cttaaggctg agtctggcta tgaagcttac     88440
     attaaacgtt atgtaaaaaa ttaagcctat agacaataat aaacacgcct aagcacagaa     88500
     aaactcaaaa agttcccact caataatgcc tatattacct cttcacagcc attcattctt     88560
     gttaacttcg ctacctttta tactctcaag tgccttgtaa agggctaata agtaaatgct     88620
     cctacagcta cacagttgtt catatttttt agtaatacca attcgcttaa ttaagtggtc     88680
     tattttgagg ctggaaaaac gagttgatag ctaggcaaaa aattcgctat ttagttgttc     88740
     taaatgagaa ttttttaaca caggtagcga cacgtttagc cccgcaaaat gattaagtat     88800
     tattgcggat tggtataagt gcaatgatgg cttttgatgg cgtaaggagt gcgtgaatga     88860
     aagctttgct aggaattttt aggtatgaat tgctgaggat ttagaaaata gaggctataa     88920
     aaacgataaa agggccttgc ggcccttggt gaagtatcgt tcaagtcaga tagtgcttta     88980
     accccttaaa gcgctatcct attgttttgc aacagttgga tcgtctcatt aagtttctaa     89040
     gctagcgaga ggaaaaaccc agcaattgct gcgctcataa ggttagccat agatcctgct     89100
     aacactgctc tgagccctaa gcgtgcgata tcctttcgcc gactaggcgc cataccgcct     89160
     aatccaccta gtaaaatggc tatcgatgat aagttagcaa agccacacaa agcaaaggta     89220
     acaattgctt gtgtatgcgc acttaacgta tcgcgataat ttataaagtc taagtaagca     89280
     acaaactcat ttactactaa cttttgacca ataaagctgc cggctaaaat tgcctcattc     89340
     cacggtacac ctaataacca tgcaacaggg gcaaacaagt agcctaaaat ttcttgtagc     89400
     gttaatgtag ggtaatcaaa caacccacca ataccgccta ataaaccgtt taataacgca     89460
     atcagtgcaa caaatgctaa aagcatggca cctacgttta atgctaagtg cataccgttt     89520
     gctgcgcctg atgctgctgc atcaataaca ttaaccggtt tgtcgtcgcc taaatctata     89580
     tcggctaaat catctttagg tgtttctgtc tctggcacta tcatttttgc cattaagaaa     89640
     ccacctggtg ctgccataaa actggctgca attaaatatt taaggtctac accaataatt     89700
     acgtaaccag ccattacaga gcctgctacg gtggccaaac cacctaccat tacggcaaat     89760
     aactcagatt tggtcattgt cgcaataaac ggtttaacaa tgagtggcgc ttcagtttgg     89820
     ccaacaaaaa tatttgcggt ggctgaaagc gactcggtgc gagaggtttt caataatttt     89880
     tgtaaaccac cgcctaaaat tttaattatc caatccataa tgcctaagtg gtataacaca     89940
     gcaacaagtg ctgagaaaaa cacaatcact ggcaatactt gaatggcaaa aataaaccct     90000
     agcgtatctt gcgatgctaa tgggccaaat aaaaagccaa ttccatcgtt ggcataccca     90060
     ataaccgatg aaacggcgcg agacatactc gctaatacat ttttgccagc ttcaaaaaac     90120
     agtacaaaac cgccgataat gacttgcatt aaaaatgcga tacccacggt tcttagtttt     90180
     attgctttgc gatcagttga ggccgcaaaa gcgatgccta gtagcactag catgcctact     90240
     aagctcataa atgttgtcat acaaacgttt cccgttgtta ttcttgtaaa atgtacttta     90300
     ttttactttt tataatatca atcgcaacgc gattcatacc gcctcgagtc acaactaagt     90360
     cagcgttatg ctttgaaggc tcaataaatt gataaaacat cggtctaaca gttgcttgat     90420
     attgctcaac aacagattgt aatgttctgc ctctttgttc catgtcgcgt tgcattcggc     90480
     gcattaaaca aatatccaat ggcgtatcta taaacacctt gatatcaaat tctttattaa     90540
     gcgctttatc actcagtaat aaaatacctt ctacaatgag tattttagcc gaagccacac     90600
     ggcgcgtttt atcgctacgt gtatgctgag cataatcata agttggtact tcaacagagt     90660
     ggccattacg aagttgcgtt aaatgctcaa gcaatagctc gtgttcaaat gcatcaggat     90720
     ggtcgtaatt cgtttgcgta cgatgtgcca tcggcaaatg cgattgatcc ttgtaataag     90780
     catcttcttc aataatggcg atagcgcctg gttcaagctc atttaccaat tcattgtaaa     90840
     tagtttggct aaatagagat ttgccggacg ccgatgcgcc tgcaatagct ataatagttc     90900
     gtgtcactaa agttctcacc cacacagaag gatatattgt tggtagatca caatagcaaa     90960
     aaagacacga ttaatctctt ttgcttcgct taagagtgca aatttataat gtttaggttt     91020
     tatgaaacag gacttatgtc ctgtacggaa aattcgaaga gcagataaag taaccaccta     91080
     gaacagatgt gaggtcacaa tggcaagagc aattatctta atggcggata gtttaggaat     91140
     tggcgcagca cccgatgcag ataaatttgg tgatgttggt gctaatacat tcgcacattt     91200
     actcaaggca tattatgacg agactggcag taagctttcg cttcctaacc tttcaaaatt     91260
     agggttagtg gatgcatgtg aagccgctgg taaagaaccc tgtttagttg ctgagcgaca     91320
     tgaaccacaa ggtgcatggg gttacgcaaa agagctttca agcggtaaag acacgccatc     91380
     gggtcattgg gaaatggcag gcgtgccagt gttatttgat tggggttact tccctaaaac     91440
     acagccgagt ttcccacaag aatttgtaga cgagtttatt gctcgcacag gtattccggg     91500
     cattttaggc aattgccatg cctcaggaac cacgatttta gagcagctag gtgaagagca     91560
     cgtaaaaaca ggtaaaccaa tctgttacac ctcagctgat agtgtgtttc aaatagccgc     91620
     gcatgaagaa tcattcggcc tagagaagct ttatcaagtt tgcgaaatcg cacgggcgct     91680
     gcttgatgaa atgaatatag ggcgagtgat tgcgcggcca tttttgggtt ctaataatca     91740
     agattttgcc agaacaggta atcgtcgtga ttattcagta ttaccgccat cgccaacatt     91800
     gcttgatgta cttgcaaaag acggtggcga agttatcagt attggtaaaa tttcagatat     91860
     ttatgcgcat caaggcatta cccaaaagca taaagcgcca gggttaatta acttgctaga     91920
     aaaaaccagc gaagtggtgg cgactgcgcc ggatcacagt ttgattttta ccaatttagt     91980
     tgattttgat gaaaagtttg gtcaccgccg aaatcctgtt ggctatgcga aagcgctcaa     92040
     agagtttgat gattacttac ccactatttt agcgcaatta aagccggatg atttattaat     92100
     gatcaccgcc gatcatggct gtgacccgac ctttccaggg tctgagcaca cccgtgaata     92160
     tgtgccggtt attgcctatc agacagggat gaaaaacacc ccgctgggcg aacgcaatag     92220
     ctttgccgat attggccaaa cgcttgcaca atggtttaac cttaaagcgt tagaatatgg     92280
     tgatggcttt attgataagc tgaacacagt taagtaactt aaaaatacgc tcgctatttt     92340
     taaagtaata gggcttttag ccaaacaaaa ggaaaacaat cgatgagtac tccgcatatc     92400
     agtgcaaacg taggtgattt tgccgaaaca gtattaatgc caggcgatcc gctacgcgca     92460
     caatatattg ctgaaaactt tttagatgat gcagtgcaag taaccggcgt acgtaacatg     92520
     tacggcttta ctggaactta caaaggtaag ccagtgagca ttatgggttc tggcatgggc     92580
     attccttcaa tgtcaattta tgctcgtgag cttattgtca gttttggcgt taaaaatatt     92640
     attcgtatag gtacctgtgg tggtattggt agcgatatta aaattcgcga cgtaattttt     92700
     gcacaaggtg caagcacaga ttcaaacgta aatcgtgccc gcgttcgtgg tactgacttt     92760
     gctgctattg ctaactttga cctactttta aacggcgtaa atgcagctaa agatttaggt     92820
     attgatgcaa aagtaggtaa cgtatttact acggatactt tttatcaagc agacgacacg     92880
     ttttataaag atctagacaa actaggtgta ctcgctgttg atatggaaac agctggctta     92940
     tacggcgtag cagcagaata cggtgcaaaa gcaatggcat tatttaccgt cagtgatcat     93000
     gtaatcacag gcgaagcaac acctgcagat gagcgtcaaa ccacgttcaa cgaaatggtt     93060
     aaaattgccc tagagtcaat ttaataaata caacagttcc ttggtaacgt attcactaag     93120
     ttttggagac acgcccaaag tgaagtgaga ctaaaccccc aaagccgcat tttatgcggc     93180
     tttttttatg cctgaaattt aggtgtgaga ttcgagtctc ggggtgcggg ccacgggttt     93240
     cgagctacgg gctttaggtt tcaggttaaa ggtcaaaggt taaaggtttt agcagtagct     93300
     cgcagctcgt cacccgaagc ccgttgtctt ctcatttact ctcattcact tctctgtgtt     93360
     taaacaagaa attagacttt agatgtcaga ttaaaatgcg cgaggtaaac ttccgcctac     93420
     tgatatggtt accttctaaa tttattttag gcggggcttt atgccgcgta aggtcattaa     93480
     tttaaaaaat atttaccacc gagaacaccg agtttacaga gaaatgctta aaaaatacca     93540
     atctacctct gtgtagcgca aagcgcctcg gaaccctctg tggtgaaaaa ttgtttttag     93600
     cagtaagtgc cttgcgtagc agcgatttta tatcgcgtca ggtctaggat attaaacaca     93660
     aatgcgcgag gtaaactccc gcctactgat atggttaact tctgaattta ctgtaggcgg     93720
     agctttatgc tgcgcaaggt cattattcac aaagaggaca aagagacgct gcgctaaaag     93780
     agtagattaa aggtctcagg ttttagcact agctcgttgc tcgatactcg aaacccgtag     93840
     ctcgctgcct tctcatttat ttccctgtca gtatttataa cttaatgcta atgtttaagt     93900
     tataaaactt gcttttaaaa tgaaccactt taaagtttta gctgatagct gatagctgat     93960
     agctgatagc tgatagctga tagctgatag ctgatagctg atagctgata gctgatagct     94020
     gatagctgat agctgatagc tgatagctga tagctgatag ctaaaacacg ttttacactc     94080
     tggagtaatt atgtctaatt ggattgatgc cacagtaaag tcagttaaat ggtggaatga     94140
     atcgttattt agcttaacgg ttaacgccga tgtagaaccg tttaaagcag ggcaatttac     94200
     aaagctttct gttatggacg gtgaaaaacg cattgctcgt gcttactcgt atgttaacgc     94260
     accagatgat ccaaatttag aattttattt aattaatgta gtcgatggcc aattgtcatc     94320
     gcatttagca caacttaccc caggtgacac tgtactaata gagcgccgtg ctagcggttt     94380
     ttttaccctt gacgaagtgc cagcgagtga acaactttgg atgcttagca ccggcaccgc     94440
     tattggcccg tttttatcta tattgcagca aagtgaggta tggcaaaaat acaaacatat     94500
     caacttagtg catggggtgc gcctaaatag cgatttaagc tatcaggagc taattaataa     94560
     gttattaaag gctcatccag ggcagcttaa ttatgtgcca gtagttagcc gtgaggagcc     94620
     tttacaaggt ttagctgggc gaataaccac agtgatagaa aataacgcgc tatctgaaca     94680
     tgtggggctg tgtgctactc ccaataatgc gcagtttatg ttgtgtggta atccgcaaat     94740
     ggttaaagat accagtgagt tattagtggc tcaaaactat aagcgtaatc gtcgaaaaga     94800
     gccggggcat attacggttg agcagtattg gtaatgagct ataacgctat aataactatc     94860
     tcatgagggt aaaatttgct atgttgcgcg ttaattgcat tttgtctttg tacttaggaa     94920
     aaccatgaaa ccttcattca ttatatatgc gtgtttattc gccgctttca cattaaactg     94980
     tcatgccata gagcaatcgg catcatcaaa caatgctgaa ctgacacagc cagaaaaagt     95040
     acagccgcaa caagatgcac ttgatacgtt aactcaagag gttaacatac ctaaacaacc     95100
     cgatgtaaag aaagtgactg cagatgattc taaagtactt ggcagcgaat caacgaagcc     95160
     ggttgaacag cctaaaagta aagtagataa agcacaagcg gtcgtcgagg ctgagcaagc     95220
     agtaacgcaa gcaaaagagg cacttacagc aaggcaacaa gccaaagcaa aacagtctcg     95280
     tgagtcactt gctgttatag agcaattagt taaagcctac aacgcgcgta acattgaaga     95340
     atttattcgt atgtatgatg aagatgttga gttttatatt ttcccgaatg agctattatt     95400
     taaaggtaaa gaaaaattaa ttgcgcgtta tggcattatg tttaaaaagc taaagtgtct     95460
     tcactcatca cctattaagc gtattgtgca tggtgacatt gtgattgacc atgagctatc     95520
     agaaacctgc tctaacgatc cgaacgtgat agataaacgt tcagagctta tttcaagcta     95580
     tcaaattaaa gatggcaaag tggttagggt attatttttt aggtaattat taattatgca     95640
     gctaagtgac gagaaaaaaa ttcgtgtaat gtatcgtgta gagcctggct gtttaggccc     95700
     tgagggcgca gaccacattg aagacttttg tcgctttgcg aacaagcata ttaagtcgcc     95760
     ttattatgcg cagttattat ttttacctcg atacgataag caaaaagatg agcggcaata     95820
     cagcgttaaa aaccgcaact tatctcaagt gcaggctaaa gcgtatttaa atcattttga     95880
     aatcaacata gaagactttg aagagcagct cgacgagctg cttactaagt caatagactt     95940
     attctttaaa cgctaagctc tattgacctt tgtagattga tatttgttta atctagaggc     96000
     agtttaattg cggcgcgagc ttctaaccta gtggggtcga taactgcgcc taagttattc     96060
     tactggctta catccttgta ataataagta aaaactgagc aaaactttcg cgttctgctc     96120
     acgcttttta ccaccctccc tgtaggcaac gaagtttagg cttcgtttga aactatcgca     96180
     ttaaagctgt cgttatcatg cagactggca aaggcacttt catgaagtag ctcgtttcgt     96240
     aagttgggtg agtattcaag cgacattttt atatcggcta gagcatctgc atgctcatgc     96300
     gttaaagcat acgcacaggc gcgctgccag tatgcgtaac catagtcgct atctatatca     96360
     attgcttgat tacaaagctc aatagcttgc tcagtctcat ttaattctaa taaagcatcc     96420
     gctttgtagg caatggcttc tacatcttct ggtttacgtt ttaaaatttc atcgaatatt     96480
     tcaattttat tcgcaatatc actttcaagg ttggctcgca tccataacga atgaacttca     96540
     ttagtgattg atatgcgttc ttggttactg agtatttctt cagagcgtac tcgcagtttt     96600
     tcttctaata ttttcaagcg atcttcatac tcatcagtaa taacactcac tcgggtgttt     96660
     actatatctt ctactttgtt ctttacatca cgtaacgagt tccagcccac taataccaaa     96720
     atagacgcgg tggcggtaat aataaaaaat acattattaa tggtatctgt ggtgtaggta     96780
     agcgcccgat cggcggtgtc taactgtgca tgcgtaactt gtttggtcac gtcttcacgc     96840
     agtttttgtt gatcttggcg taccgacttt aattcgtcga gaatataacg ttcaagtaat     96900
     ggtttgtaca aaggggcttc tagctgtgct aattcacgct gttgttgctc gttgagtgct     96960
     gcggtgtttt tatcagcagc ttgcaccgca gatgaaaaaa caccaataaa tacaataaat     97020
     agtaaaaaat aaaaacgcat tgatatgcct agttaaaaaa ttagttaatc gctttgttaa     97080
     ctttaacatg cgcacatcat tggtactagg gtgaggatag ggaagctgga attaactcaa     97140
     aaatccttta ttacaggcaa aaaaaatcca gcccaagttg ggctggaaaa aactacatca     97200
     acatatcaag ggaacaatag gagataggtg ctattgtaag tttgcctacc tgaattttta     97260
     cttaactaaa ttcaaataga taaaaattag aaagaaataa aggtgcataa gtaacttata     97320
     caccttttat aactataatt tcatggcgaa ggggggtatt ccactgtgca cttaagaaaa     97380
     cctaagtcac tttcaaaccc ttcatcgtac attacgtggc tatttttaat aacgatcatc     97440
     tattttataa aaagttttaa tatttattta cgctaagcac aaacattggc tgcatcatca     97500
     tatttataaa tgagagtaat cgttttaaag cattactttg ccctagcgta tcaaagcagc     97560
     tacacgtata ttgaataagc agagaccata aacgtcatta gggtctgttg accttttaag     97620
     gttaaatttg cagtagtctg tttggtattt aggcaaggca gagcctatgt ggtgtggtta     97680
     ttccccataa ataggcgata acgcagcatc aattccaaac aggcgctgcc cgaagggttc     97740
     tgcccagggg cgatttactc tttgttgctc ggttttgact tagcccacta ggttacaaac     97800
     ctcgcgccgc gattaaaccg cccctagttt gaacgaattt taatccacaa aggtcaacag     97860
     accctaatat aatggcaata aaataacagc gctcccaatt ggtgaatacc aaaagcagta     97920
     agcatgggcg tttttattta tacttaaaaa ggagctcaat atggataatc ataaagcggg     97980
     taaatgcccg gttatgcacg gcagtaatac tacaaccgaa aacaccaata cagattggtg     98040
     gccaaattca cttaatttag acattcttca tcagcacgat agcaaaacca gcccctacga     98100
     cagcgacttt aattacgccg acgcttttaa ttcactcgac ctagaagcac ttaaaaccga     98160
     tttaaaagat ttaatgactc aaagccaacc ttggtggcca gctgattggg ggcactatgg     98220
     aggcctgatg atccgtatgg catggcactc tgcgggctcg taccgtttag ctgatggtcg     98280
     aggcggtggt ggtaccggta atcaacgttt tgcaccactt aattcgtggc cagataatgc     98340
     caacctagat aaagcgcgcc gtttattatg gccaattaaa aagaaatatg gcaacaagct     98400
     ttcatgggcc gatttaatta ttttagccgg taatatggcg tacgaatcaa tgggattaaa     98460
     aacctttggt tttgccggtg gccgtgaaga tatttggcat ccagaaaaag acgtttattg     98520
     gggcgcagaa aaagaatggc ttgcgccaag tgatgagcga tatacccacg ttgataaacc     98580
     cgataccatg gaaaacccat tagcggcagt gcaaatgggt ttaatttacg taaacccaga     98640
     aggggtgaat ggtaaacccg atccacttaa aaccgcagaa caagtgcgcg aaacctttgc     98700
     acgtatggca atgaacgatg aagaaaccgc agcgctaacg gtaggtggcc atacagtagg     98760
     taaaacgcat ggtaacggca aagaagaaaa cttaggccca gagccagaag ccgccgatgt     98820
     gcacgagcaa ggccttggct ggaataacca taaaacccgt ggcattggcc gcgataccat     98880
     gacctcaggt attgaaggcg catggacaac ctacccaact aaatgggaca acggctactg     98940
     taaattgttg ctcaattacg agtgggagct aacaaaaagc cctgcagggg ctcatcagtg     99000
     ggagccggtt aatattaaag aagaagataa acccgttgat gtggaagacc cttcgattcg     99060
     tttaaaccca ataatgaccg atgccgacat ggcaatgaag ctcgacccag cgtaccgtaa     99120
     aattattgag cgttttaatg acgattttga gtactttact gacgtatttg cccgcgcatg     99180
     gtttaagtta acccaccgtg atttagggcc aaaatcacgt tatttgggcg ccgatgtacc     99240
     cagcgaagat ttaatttggc aagatcctat tcctgcagtt gattacaccc taagcgacgc     99300
     tgaaataacc gatttaaaag cgaagctact taattgtgga ttaagtgaaa ccgacttaat     99360
     taataccgca tgggatagcg cccgcactta tagaggctcc gatcaccgtg gtggtgcaaa     99420
     tggcgcccgt attcgcctag ctccgcaaaa tagctggcaa ggtaacgagc ctgcgcgttt     99480
     agctaaagta cttagcgcac ttgaaacact gcaagcgagt ttaactaagc ctgttagtat     99540
     ggccgattta attgtacttg gcggcaccgc tgcggttgag caagcggcta aaaaggcagg     99600
     agttgatata accgtaccgt ttgccccagg gcgtggcgat gctagtgatg acatgaccga     99660
     cgcagagtca ttcgagccat tagagccaat tcatgacggt tttagaaatt ggctgaaaaa     99720
     agactatgcc gtatcagccg aggagctatt actagagcgc agccaattaa tggggctaac     99780
     agcaccagaa atgagcgtat tactaggcgg tatgcgcgta ctaggcacta actatggcaa     99840
     tagtgaacat ggtgtattta ccgacaaggt aggcgtactg agtaacgact tttttgttaa     99900
     tttaaccgac atgaacaacc gctgggaacc tgcagctaaa ggcgagtaca acatagttga     99960
     ccgcgctagt ggtaaaacta agtacacggc tacgcgggtt gatttagtat ttggttcaaa    100020
     ctcaatactc cgtgcactgg cagagtttta tgctcaagac gataacaaaa ctcgttttgt    100080
     acacgacttt gttgccgcat gggtaaaagt gatgaacgcc gaccggtttg atattaaata    100140
     agcctaagta aaatttaaaa aggagcagca atgctccttt tttatattat ttaggttaaa    100200
     ggtcacgagc tgcgggctgc gggctgcgag gcgcgggtaa aatgcagtgt ctataaaaaa    100260
     gctgctacag gatagtagtt ggcttttttt atttcctcta aaagcgcagc gtctcattgc    100320
     cctctttgtg aataatggtc ttgcgcggca taaagcccca cctacgttaa atccagatgt    100380
     taatcatatc cgtaggcggg agtttacctc gcgcatttta tctaacgttt aaatctaatt    100440
     tcttgtttga gcacagagaa gcgagtaaga agataacggg cttcgcgtgg cgagcagcga    100500
     gcttgtacaa atagtttgta cacctagttg tatcagcaat gaacctttaa cctactcttt    100560
     cagcgcagcg cctcttaatc tctgtggtga ataaataact taaaacctat ttgcacaaag    100620
     tgcaaagaat gagaggcaaa tgagcaaata aaaatacagc ttttctttgc cttttttatt    100680
     aaataaatta ccaattgcgt ttgaattgat accaagcaaa attctgcaga accccgaacc    100740
     ccgaaccccg aaccccgaac cccgaacccc gaaccccgaa ccccgaaccc cgaaccccga    100800
     accccgaacc ccgaacccaa attacaggca caaaaaaacg gcgcttaaac acgcaccgct    100860
     tttaaatggt ttaggctatt tctttaacct ttaaccttta acctagctct taagctactt    100920
     tattttcttc gcagctcgct aggtattcgt caaacgtacc ttgaaagtca attacctgct    100980
     tgtctttaat atcaacaata cgggttgcca gtgacgatac aaactcacga tcgtggctta    101040
     caaaaataag cgtgccttta aagtctttta gcgcattgtt aagtgcttca atggcttcca    101100
     tatccatgtg gttagttggt tcatccatta tcagtacgtt aacgtcttgc atcattaact    101160
     tgccaaataa caaacggttt ttttcaccac ctgaacagtt acgcgctttt ttatttgaat    101220
     cgtctgcggt aaataataaa cgccctaaca taccacgtac cattaaatcg ttgtgcttag    101280
     cggtgcgcca ctgcgacatc caatcaaaca aggttaaatc gttatcaaag tctttggtgc    101340
     tgtcttgtgg gcaataacca aacgtggcgt tttctgacca cttaacttcg ccctcgttgc    101400
     ttttaagctc gttaactaaa cagcgtaaaa aggtggtttt acccacgccg ttttcgccga    101460
     taaccgccag tttagcaccg gcttcgagta gtaaatcacc accagtaaat aacgtttcac    101520
     cgtcaaaccc atggccgagc ttggttagct caagcgcttg gcgatacatt tttttgccct    101580
     catcaaagtt gagtgatggg ctcatacgac tcgatgattt aacttcatca agcttaattt    101640
     tatccatttt tttagcgcgc gagctggctt gtttcgcttt agaggcgtta gcaccaaaac    101700
     ggttaacaaa gtcttgtaac tcgtctattt cagcgctctt tttcgcgttt tcagcaagta    101760
     attgctcgcg ttgtaagcct gaagcttcaa ggtacttttc gtagttacct gggtaaatac    101820
     gcagctcacc gtaatcaata tcggccatgt gagtacatac cgagtttaaa aagtgacggt    101880
     catgggaaat aatgatcatg gtgcatttac gttggttaag ctcattggca agccacgtaa    101940
     tagtatgaat gtccaagtta ttagtaggct catcaagtag caaaatatca gggtttgcaa    102000
     ataacgcctg tgctaacagc actcgtaatt tccaacctgg ggctacgttt gccattaagc    102060
     cataatgaaa ctctttatcg atacccgcat caagcagaat ttcttctgcg cggctttctg    102120
     cggtgtaacc gtccatttca gcaaaaatgc tttcaagctc ggccactttc atgccgtctt    102180
     cttcgctcat ttcaggcaaa gagtaaatac ggtcgcgctc ttgttttact ttccaaagct    102240
     ccacatcacc cataattacc gcatcaacca cgctgtattg ctcaaacgca aactgatctt    102300
     ggcttaggtt acctaatttt agcccaggtg taatagacac attacctgca ctaggcgtaa    102360
     gcgcaccgct taaaattttc ataaatgtcg acttgccgca gccgttagcg ccaattaaac    102420
     cgtaacggtt accgttacca aatttagctg aaatgttttc aaacaacggc tctgcgccaa    102480
     actgcatcgt aatatttgcg gtggagatca aaaaaagtaa tcctagaaaa ataatggcag    102540
     ggttaagctg cagcaaggcg ccgcataaat aaacaagcaa tagagtaaat aataggccgc    102600
     gaattataca gatccgcgct tcaagatgaa aggtaaaaga ataatctacg ggttcagtaa    102660
     tgtgggtaaa tggcttgtat agcggattta ttttgcttaa ttaactcatt tatagcttgt    102720
     aactctattt ggctaatggt ttttttactt agcattaaat gaatagaact cttattgatg    102780
     gccgccatat tagtaaccgc ttctattgct gggtattggt ttataaaata ttgcgctgct    102840
     agttcgtctt caattgcgta atcaactcta tttttattga gcattgcaaa acgtttttcg    102900
     gccgtaggca tcataataac gttagcgggg tggttctgtt taaacagctc aaacgcaacg    102960
     ccataataac tgccacggtt aaccgccaag gttaaatctt tataaaaaat atcgctaatg    103020
     ttatttaaat caggcgattc ggtgtattta tacaggcgaa ctacttcatc acgataggca    103080
     tcgctaaaat aggcaaaatc agctcttgct aatgttttac tggcggcaaa aataacatca    103140
     atacggcctt cttttaattc ttcaaaagcg cgcgatgagg taggcagcaa cataaatttt    103200
     aaacaaaaag atgagccgtt aaaaatcgtg tttaacacgt caatttcaac gcccgtcagg    103260
     ttaccgttaa cggcaattac atagggtggc caattgtttt catttgtgcc tactttaagt    103320
     gttttaaagc aagcaaatac gttacagctg ctaagcagta atacaacaaa agcgatttta    103380
     agcattttat tactcgaggc tacagcgtta tcattactaa agtataaacc agactacaaa    103440
     tttagcccgt tttacatcaa ttaaagcagc gatgttagct acctatgttt tatttaatag    103500
     ttggcaaata taggaaatta gctcttgtta ttcacgaatt taggaatcgt gtttggtata    103560
     ggcataccgc atagccaata agttaaataa cactatcact aaggggtcgg tactaatcct    103620
     aacgacgccc tataagcttt tagctgtttg tcgcggccaa tttcatcggt tagtttattc    103680
     cagccttgtt ctatattaat cacggtttgc tcaacagact gggtgtgcct taggtattta    103740
     gccacttcag tgtcgagtat gtctctaaag tagcggttgt tttcaaaaat tctcaaatca    103800
     agaataatat tggcgttatt aacggtttta gaaatagagc ccaagtaaaa atgcagcgta    103860
     cttttactca tgccttgttt aagccagttt ttgtggttaa ctaattgaga ggtgcgatac    103920
     gggttcatac cggtggcacc tatggtcaca tcttcattcg attgcaaagg ctgagtaaca    103980
     tacgacaagt agttataagc gaggtttttt ttgtgttttg agctggcatt attaattgag    104040
     cctacccaac caccaaaagc tgcataagga gcataattaa tatcgccaat ggcaaacggg    104100
     cataagttag cattgcaacg ttcaagctgg cctgttttac ggtttaatac ctcagtagct    104160
     ccgggcaata tactcacccc tgttttgttt tttactttag attcaggtaa cacggccata    104220
     gtaccaatgt cgccccattc aatggctaag gcgcagcgcc cacttataaa cgcatacctt    104280
     acatcattgg tatcaaaatt aagctcatca gcagagccaa attcagtggt ttttttataa    104340
     atttttaagg cttttttaaa ggcatcgtta ttcactaatg gcgccatagt tcttgtatta    104400
     aaaaatatgc cttgagaagt gcctttgctt tgcaaaaaac tgcccgcaat cgaaagcaaa    104460
     gaccaatacg attgctcatt ggctttttta gaaatgcacg aaccaaaatc gccctcgcca    104520
     tccccgttca tatcaacgcc atttaattgc ttagcaatag caaggtaatc atcccaggtt    104580
     ctaggtggag ccaaaccata tttttctaaa atatcgaggc ggtaataaag taaatgtata    104640
     tcaccatcga gcggaatcga gtaaatttgg ccgttatatt tagagctaaa gtctctaaaa    104700
     aaacgcgata catcattcca ttcaattaaa gggtcggagg ctatgtaatt atctaaacgc    104760
     gctaagtaat tattttctgc aaaatccacc atccagagtg aggcgtaggc aataatatcg    104820
     tattggctcg ttggcgagct taaatctttg tttatttcgt tatataactg gccaaaaggc    104880
     actttggtga cattaacttt aataccagtt tgttgttcaa actctaagcc tcgttgaatt    104940
     aaaggtttac taatgagggt gcctaaatca actgtaagca cattgagctg ggtagtggct    105000
     tgttgtggtg tgcttggttg gctttctatt ttagagtggg gcagggtaat ttgtgcaacg    105060
     cattgaaaag ccaacattaa gcttataact aaagcaaata caactctcat aaaaaactca    105120
     accacagcaa tatgtaatta ctactctagt ctatattttg cggaaaggga aaaggcaggt    105180
     aattgtaagc aataaacaac gcctctaact caccactggc aagtaatttt gcaaatccgg    105240
     cgtcaaaaat ttgtgctaac tcgcggcctt tggcgttatc ggtaaaggca atgtattgtt    105300
     ttacaggcac aatgttttcg atttgatact gctgtgggtc aaaattcatt tttgataact    105360
     tagtggcgtt agcaatcagg gtttgctgca gcgctttacg gttatctaaa aagaaatcaa    105420
     gcctatcgag cttaagcatt ttaacgcctt caattcgctg ggtaacctgc tgcaaatcaa    105480
     tcggcacata caaataatta ttgtagttag caccccttaa cgtacccacc gatctgtttt    105540
     gtaacgagta ttcgccttgc caatctttaa accgatcttt tttaaacatc gccgacacaa    105600
     aagtaatatc gtaatgccac accggaaagt acaagccttc tacctcattt tgccttgcgc    105660
     ttaacattgc atcggcattg ccattggccg tccataaata agcacgagac tgaggcacaa    105720
     tcataatatt gagttcaatc gactgcgcag caaaaatttt gctaagaata tcaacataaa    105780
     gcccagagcc gtctttttct accagcccgt caatggtgtc ggtagccagt ataatttttt    105840
     taatatcgct cgacgcccaa ccactgctag gcacgcctaa acaaagcgct aaaagtacag    105900
     ctaataacca cctaaaccta acattcattg taagtaacac ctcggtactt aaacacagca    105960
     acaccaacag tatattcata ctagaaaaag ttgaataacg atcttatggg taaacatagc    106020
     acactataat gaccaataag tgaacggtgt aaaatagcat cattttaacc ctaaagcatt    106080
     taattaatac ccctgttttt aaggggatta aagcaagtgt tcgtaaagtt ttacaagcga    106140
     taatgattta aacagctgcg ggtgtttttt atacaaccta aacattttca aaggtgtaga    106200
     gctattaggt aaaagtgtaa ataacatgaa tttataaggt taaacagtgc ttttttgtaa    106260
     tgaaaacata ctacttaggg cgtatatatt gttgtagctc tatattttta aatgttgata    106320
     ctgtagatta gttataaatg aatgccagat taataaataa accaaggagc ggtgaattta    106380
     gtgctcacta aaacactcag ttactacaat caaaacgcac aaagctttag cgactcaacg    106440
     ctcaatgttg atatgtcggc gctttacgtt gattttttac cgcttatccc taaacacggc    106500
     catatattag atgcaggctg cggtagcgcc cgcgatgcca tgtattttaa acagcaaggt    106560
     tttactgtta gcgcatttga cgcaagtccc gagcttgcaa agttagccag taattactta    106620
     caacaagccg tagaggttaa aacctttcag cagctaaatt gtaccaataa gtacgacggc    106680
     atttggtgtt gcgccagttt attgcacgta ccaaaagtag agttaccaca ggtgttttta    106740
     aaactacaaa atgccctaaa accaaacggt gttttgtatg tgtcgtttaa atacggcacg    106800
     caagagcgtg tgcacaatgg ccgcgaattt accgatttaa atgaagatgg cctaaccgca    106860
     ttaattgccc accacaccga gcttaaaata ctaaaacaat ggcaaacggt cgaccaacga    106920
     gcagagcgcg aaagcgaagt gtggcttaat gccctaatta aagcagtgcc tgttttatga    106980
     tgagcacaat gcaacaacaa ctcgacttta ttgcgtatat tcaacgcatg ctggttgagg    107040
     gcgattttag tgcaacctac aaatttgcat tgctgcatgc tttggctgat gtatgtgttg    107100
     aacagccact tcaatcagag caaagtgaat tggtcataga actgccaacg cttgctgaca    107160
     aactcattac cttgtattgg catcatgcaa tgccgtttcc ctcagaacat actggtgaaa    107220
     gtgcattgct tttacaaaat accggtgcgc aatcaaaagt aattagcgta ttgtttgaat    107280
     gccaacaaaa caatattcgt aacttacgcc agctaaagca aagtggtttt tacaagccga    107340
     cttttaatgc cgctatggca accttaaaaa gtggcccact ttggcgctta caaatacttg    107400
     ccaagcaaga agagtgcttt ttatatccgc atactaaaaa ccctaaatac attactttga    107460
     atgcaggcat tgctagttgt tttaggcgtt tttacgatct agtaacgtat ttagctaaaa    107520
     atgcgtggct acaaaaaatt caaagcataa agcacaacca aacacttatt ggcccgcaaa    107580
     gccaactgca tgatttttta tttggctttg accgtaacgc actcaccaaa gcaaaacctg    107640
     ttttggtaga gctgcaatca aacagctgtt tttattgcca aaagccaatg aaaaacgatg    107700
     ttgaagtcga tcattttata ccgtttgccc gctacgcaaa cgacttaggc cataattttg    107760
     tggcagcgca tcgcacatgt aataacaata aacgtgactt tttagctgca cagcagcacc    107820
     gcgagcgttg gcaaaagcaa aacttggttg ttaacagcca aattattagt aacgagctaa    107880
     gtgcgtattt tcactgcgat gcagataaat ctctcgcagt aagcaattgg gcctatcagg    107940
     tggcacaagc caacaacgca aaattatggc ttgggaataa agaccatttt gaacaagcaa    108000
     aaccaactgc tgagttgttt acgtttccaa atgcaccaca acctgaatta gatcaagtcg    108060
     ctgagcccga agttaactta aaatcaattg atgatgcgct aaagctgccg tacttcccca    108120
     atataaaaat agcctgtggg cattttaaaa caggggatga aagcgatatg gaattgatgg    108180
     acgcaccact tggcgcgggc aagctcgacc cgcaagtgca tttttttgca cacgcatcgg    108240
     gtaactcaat gaatggtggt aaacacccaa tacttgatgg tgatttacta ctacttgagc    108300
     ttataacttc cgataaagca ggatcgctac gcggccaaat agtggcgata gagcgggatg    108360
     atataggcgg ggaagggcaa tatttactgc gtaaagttaa taaattacca aacgggcaat    108420
     atgagctaat tgctcaaaac ccagattatg aggtaatgat tgctgatgaa agcatgcgaa    108480
     cattcgcacg gtttaaacaa gtggttgcag gttagtttgt agtcgcgttt tagtttgtag    108540
     gcgcagagct tgctcacgcg aaaagcgcag cttttaaatt tgtaggatgt gccgtaggcg    108600
     tgagtttgcc tagcgctttt aaagtgtagg aattggcttg agccgtgatt tatatatgat    108660
     tttgggaaag ggattaaaaa cctctattcg aggttttatc gcgttggcga tggcaaccaa    108720
     agagaggcta ccgccgacct ctctctggac tctctcggcg cacccgagga tcacactgtg    108780
     tcctcaagtt aaaaattgat gtgaacgtaa gcgccgtgta aggcacatcc atgtgccagt    108840
     cacggcttaa cttgcatcca tgcaagtgat tactcatcaa ttgataactt tcgggtgtgc    108900
     tcacggggag ttggagtatg ttggtagatt ggtgtttatg aatgtaggcg ggagtttacc    108960
     tcgcgcttta acttgtaggc gcagagcttg ctcgcgcgaa aagcgaagct tttaaatgtt    109020
     gcgaaatttt ggtgtttaaa agtagtaatt tagtgttttt aaaattctta aataaataac    109080
     gaactgctta gctaaggcga aaggatgtta gaaaaaaaga aaccaaggga gcaaagcggg    109140
     cgtcattcat ttgctgcata tagagcacag gtgagatcag ctgcgatggc atcactatct    109200
     attctagaaa acgatggtat cgatagggtt tactgtgact tgcacgatga ttttgttatt    109260
     cgtaaaaaag atgacgatgg atttagttat gttttttacc aagttaaaac taatggcaag    109320
     caaaaccaca attggacttt aaatgaatta tttggcctta aagccagaac taaagaccag    109380
     aaaaagcagt gtacagagaa aataaaaaat agctttattg gtaagctgct tttacatacc    109440
     gtagttttcg ataattactg caattcagtt gtctttcaga ccaacatcaa taatggagat    109500
     gacgttgaaa aagtaataga agacattgaa gcggggactt ttcaaaataa gttctcggaa    109560
     gtgttaattg ataggttcaa caaatgtttc ccagaagaag tctctaatga actatccgaa    109620
     gatgaaatca aattaagatt atcaaagctc aagtttgaaa ctgatgtaca gcatttaaaa    109680
     agtggtgatg ataatttcga acctattgca aagaatgcga tttacaaatt tagcgaagta    109740
     gatttaggcc acactgaaac tcgtgaaata ctgatgaaac tgcttgaact agtagaaaat    109800
     aaatcaagtg gtgtaatagc tgagctaact caagaaagta ttgagcaata tgcaggaata    109860
     gctattgaag acttactatc gatactaagt atatcaaagg acgcatacaa taacttgctt    109920
     gaaagcggag atagtaaagt tataaaaagc gcatcaatca ttcaacgaac gctgtcctcg    109980
     gctggggcta gcattgagga agttgagtat atatcaagat gcaaaactaa ttgggatcta    110040
     tggcacagaa aaaaccgcca tgtgctttta gagttcgact tacagtctat caatagcatg    110100
     gtaagagaac ttttaaatag ctccattcgt agtgatggct cacttcattt agctagccta    110160
     agatctccaa taaaagattt agtcagtaag cttgagtctg agggcttaat gtatgatcta    110220
     aaccctgagc tcattctcgg aggcatattt gcggaattag ttaaggggaa atcatgaatt    110280
     tcgatacatt ttttgaaaag attgcacaat ctggtaccga aattcgcgtt gatagctcca    110340
     gttataacaa gccaaatttg ttaaataacg aagcactatt tcagctccca ctgatcagtt    110400
     tgatagtgct acttatggct aaagataaac gaaaacccaa agtatcagaa atcggccaac    110460
     ttgttggtga aagcttagaa acaagcatgc ccggctttaa aggctcggct caacacgttg    110520
     gttggtcagc aaacttacga gttagaaccg tgaaagcagt tagctttttg gaatattcaa    110580
     acttgataga aatcccgaat aataaagggc gaattaaaat cacaacttta ggtaagaagg    110640
     tgattgataa agcctttaat gaagaggata tcctcgcttg taacctagct gagatagcta    110700
     aagcatacag aaacctatgt gtttctaagc aattagacat ggagttggaa tgaagttaat    110760
     tagtatacaa attttttcaa atggtctttc tggttggcaa tcagatttac taaagtttgg    110820
     cgacaatatt actcagctat ttggtaagaa tggttgtggt aaaactccta tagtacagtc    110880
     aattgctttt tgcttaggct atcctagcgt atttagaaat gatatttatg aacgatgcaa    110940
     tcacgctatt ttagaagttt catctcctat cggaaatttg caattaaaga gaatttacag    111000
     caaaggtata gatattcagg ttacagagcc taatggcgag aaacagaggt tttatgatga    111060
     aaaggagtat tcggcatatc tgtttgaaac gctgggtctg acagtagata acctagtaac    111120
     caataataac aaaagcacta gtccctattt agcatcaatg ttgccaatct actacctaga    111180
     tcaagatgac ggttataaca agttttatag cccaccaagt aactttatca aagaccagtt    111240
     ctcagaaatg atgagaatga tatttgattt gccagtcaaa cactcattcg accaaaagaa    111300
     agaaaaattt aaggctaaag aacgtttaga ttatttagat aagcaagtag agctgcattc    111360
     acgccatgct gaaattgcta agcaggaagc cgcattaata tctaaaagct cagaagaatt    111420
     agaagatgaa attagcacgt tagaaagtga aatagagcaa ctcaagagtt caggcgcaaa    111480
     ccatgatgac tcgattaatg ttttagatcg tttaatttca aaacataaag cttcgataag    111540
     agacttaacg cttgaaatcg ctgaaattaa taagagaaca agcggtattg cacagatagt    111600
     agatgagatt aacacagaag ttgaaacact taacttgaac gaagaagcta ggcgagtatt    111660
     cctatcattt aatgaaattt gtggctctag taattgccat ttgttttctt caagctcaga    111720
     tgcctacagt aaaaatttat tgtatttaaa agaccaaatt aaagatctcg aaagaaatgc    111780
     agatatagat aagattaaaa tcgagcaaat catgaaacaa cgtgaaagct tagaaggttt    111840
     aatccaaacg attatcgatg agagaaatca atctttagaa aaaagtgaga tatcggctct    111900
     ggtagatgca atatcagcac taaaaaatca aatatttgaa ctgcaaagcc aaaagagtga    111960
     tatcgaaaaa gttgaattac tggaaaataa acattttcaa actatcgctg agcgtaataa    112020
     agctctagaa aagtatcagt cttttggtac ggataaaaac tcaataccag cattagtaaa    112080
     gctcaaagct gatcttcgag agttcttttt aaactggcta gaagtactaa ataccaacaa    112140
     cattagccga aatattactt ttaaagacga ttttactcct tacctcggta cagaaactat    112200
     atctcaactt aagggaagta ccagaactag agctgtatta gcgtaccacg cagctttaat    112260
     tgagttaatg gcactgcata attcgttctg ttttaaattc ttaattttag atacgcctaa    112320
     gcaacacgaa attcacaatg atgacctaaa ccaatacatc aaagcactta aagtattatg    112380
     tgctcagcat tctgttcaag ttgttttctc tactaccgag tatcattatc agggtgataa    112440
     tcaagacata gagtggaacc cgaaatacca aggtgagaaa caattgatgt ttttaaaaat    112500
     gaatgataac gatcgaatca tttaaattaa aaattaggcg gcaaataact taccttataa    112560
     cctatataat acagataaaa aataaactgg tagttatcca accgctaatt tcccagcctc    112620
     gtgccacatt tcacttggca tggggttggt tagttcccac gttatattca tcggctggct    112680
     gccgttgtgg ctttggtatt taacctcgcc gtagtttaca aatcccatag ttcggccgtt    112740
     ttcgtctttg ccctgttcgc gcacaaataa caggatggtt ttgcctgttt gttggtgttg    112800
     aatgtaactc aggccgcgac cgtgttctgg acgggcgctg ttttgcgttt gccaatgaaa    112860
     cagggtgggg ctgattgcgt aatcgtgata cagcgtggtg ggcgagtagg ttttttcgca    112920
     cttgttgagt gttacaaata acagctcgag gttttggttt ttaaattcta gtacgccttc    112980
     gcgagcggtc gattttttat caaacgagtg cgccccaaat gcggcgagta tttgctggcg    113040
     cgtgtagcgg ctgtgtaatt ttattgcgtg attaggtaag cacgctaaat cgctttcttg    113100
     ctggtgaata cggtttatta acagagcgat cacttgcgcg agttcctgct gtagctcttt    113160
     gtgtttaagt gcctgtaagc tttgatcaag cgttttaaac cctaaacttg tgcctgtgtt    113220
     atcccaaaag ttgtaatgcg ccataagcgc gtactgttgg ttttgtggcg taggggtaaa    113280
     gttaaagtcg ttattacata aatcacgtaa aaagcataag tagctgagcg agttgcagcc    113340
     aagtaattgt gtgtttatag cgcggtaata cgcggcgtaa atatcggctt gctctgcggg    113400
     tatttcatcg ccttttagcc agtgccagcc accgagcttt ttatcttttg gtttgtatat    113460
     atcttcaagc gtgacttgcg ggtttatgcg taaaaaatta ctgagcgtaa gcgcatcatt    113520
     agtatgttgt ggatagctat ttatcagctg ctgtaaacgg cgtttagagt ttattgcttg    113580
     ctgaatattt tttaatattg tttgttgtgt gcgtttttgt agctcaatac ggcaacccag    113640
     cggtaaatgc gggaaattgt tttcaatctc ggtttttatt ggttggttgc ttttaccaat    113700
     cagcgcgcgg aacttactgg caaagtcgta ttctgggcgg gagttgccta caaaatcgag    113760
     cacggtacag cattgctttt ggctgttgtc gggcaggcgc aggccacggc cgagttgctg    113820
     taaaaacagc gttaggcttt cagttgggcg taaaaataaa agtgtatcga cctctggaat    113880
     atcgacccct tcgttaaaaa tatctaccac gcaaagtatt tgtatctcac cttgacgaag    113940
     tgcttgttgt ttggctgcgc gctcattagt gtttttactg gttagcacat cggcgcttat    114000
     gcctgctaag ttaaacttag atgccataaa ctctgcgtgt ttttggctta cgcaaaatgc    114060
     gagtgcttta atggtttgaa cgttagtcgc tatattaaca aggctggata taattttgtt    114120
     agcgcggttg ttctcgcctg tataaaggtt acttagctcg cttatatcgt aacggccgcc    114180
     gcgccatgtt atttggctta ggtctgtgtc atcatctagc ccaaagtact gaaatgggca    114240
     taaatggcgt tgatttattg cctctggcaa gcgaatttca gtggctatta cgccgcaaaa    114300
     atcatcgagt atatttgcac cgtcttgacg ctctggtgtg gcggttaagc caattaatat    114360
     tgtgggcgta aagtgattta atatagcgcg ataactagct gcgcttacgt gatgaacttc    114420
     gtcaataact atgtagtcgt agtaatcgtg ggttagatta agcgattcaa tttggctgtt    114480
     taatgtttgg attgacgcaa ataattggtt gtagtgttgt ggcttatagt tacctaccca    114540
     cagctcacca aaatcgttgt ttttaagcac gccacggtaa gcgctttgcg cttgtttaag    114600
     tatttcttcg cggtgggcta caaacaaaaa gtgtgcgttt gggtttttat cgtaaacagt    114660
     tttaaagtcg aacgccgata taatggtttt acccgtgccc gttgcagcaa ccactaagtt    114720
     tttaaagcga ttatgcacgc tacgttcaac gcttagtttt tctaaaatag cgagttgatg    114780
     ggtttttggc gtgatatcaa aataaaactg gctgcttgct tggccaatac cacgttgctc    114840
     attaagtgaa tttatgagct tttctttaca ttcagctttg ccagtaaaca gctcgaaatc    114900
     tggcgactgc caataggttt caaaggtact tttggtttta gctatgatgt gcggaatttc    114960
     ttgcgcggta atttttaagt tccactcaag gccgctggta agcgccgaat gcgataaatt    115020
     agacgagcca atataaccgg tatgaaaacc tgtattacgc ataaacaagt atgactttgc    115080
     gtgtaagcgc tcttgctgat tgttgtaact aagctttacc tcggtatttg gcaggcttgc    115140
     taaaaactca accgctttag catccgttgc acccatgtac gaggtggtaa ttactttgag    115200
     tttattgccg cttttagtaa acgcttcaag ttcgttttta aatatgcgca gccccgtcca    115260
     ttttataaat gagacaagcc agtaaatagt gtcggacgat ttaatctcgc gttttagctc    115320
     ggtttcgagc gatattcccg cattggcgcc gctaaacaat tcactttgtg taagccctgt    115380
     tagcggaaaa atatcgtgag agtaatcttt aagattggcg gcaatggggt tttgggtatt    115440
     aaacagtgcg gtaagtattc tgccttggct gtcgataagg ttttcattga tcagctcgtc    115500
     atcgcgaata tgatctttaa gccaaagcac aaggctgttt gctaggttaa tttgctcgtg    115560
     caaacgctcg cttgaattgg ggattgcatc aatggcatgt tcaaccagcc tgcctaaaaa    115620
     acgcgaaagc cacgtagccg cctcagccga ttctagttgg cgttcgccca cataaaattg    115680
     gtcacgattt aagttttgct taattacttg tgtaattaac tgctcgtaaa taccaatctg    115740
     ttgcattaaa tcgctccctg tttgcgagca ctcagtttac taaaaaatgc aatgtaaaca    115800
     agcattaact cattattgaa ttaaagaccg ctgccaagac aatttccccg tgatcacacc    115860
     cgaaattaaa ttaatgatga gtaatagcag cgcatggatg cgcgttaagt gatgcttaca    115920
     cacggacgtg tttcatcgcg tttacgttca tatgattaaa ttgaattgag gaaatagtgt    115980
     gatcctcggg gcgccgtggg gttccaaggg gcggtcggcg gtatctgccc cttggttgcc    116040
     gtcgccaacg cgacatgtat aaattactct aaaagcttcg cttttcgcgt gagcaagctg    116100
     ggcgcctaca ggtgtttcgg tgatctttgt agtgtgagtt tgaataatga gacatgtaac    116160
     tgtttttaat gtataaagta caagttgtta ttataggaac tcgtcatgga tgatttatta    116220
     aaccaaggtt taagtctttt agttattgtt ggtagtgttt actcattact tggcgtttta    116280
     ttttttcgca tttggtcaca tcaacgcagt gctaaacttc ctatcgagcg tcataaatta    116340
     aaacgtgttg ccgcgcaaac tcttcaagag caagtgaatg acaagattgt tgatgttatt    116400
     ggcctaatat ttttagctgc actcattgtt ataatgcctt ttgcaattaa agggattgct    116460
     gaaatgtttg ctagcggtaa ttttaattac ttcctaattg ttttgattat tttaggttta    116520
     gcttatgtag caagaaagct gtgggttaaa tctaattatt taataaaact aaagctcggc    116580
     cgtgatgctg aacttgctgt tgcctctgaa cttatagaat tacagtcaca tggatatcaa    116640
     gtatttcatg atatacaagc tgatggtttt aacattgatc acttagttgt tggggcaaat    116700
     ggcatttttg ctattgaaac taaaggcaga cacaagcgaa taaaagacga cacaaactac    116760
     aaagttaaat ttgagaataa tcatctagca tttccctctt ggtttgaaag taagccgcta    116820
     gaacaagccc aaaagcaggc taattgggtg aacaaatggc tacaagaggc aacgggtttt    116880
     aacacgcagg ttttccctgt tttgtgcttt cctggttggt ttgtcgaatt aaaacagcgc    116940
     ccactctttc cgattgtttc acataaacaa ttagtgaaaa cgattctttc gatgcgacaa    117000
     gtaaatttaa atcaagagca gcaacgtgct atttgttatc aagtagttca gcgttcactg    117060
     catgaaagta aagcaattta aaagctgcgc ttttcgcgtc agcaagctgc acgtctacgt    117120
     tgataaaaag cgctaggttg tattttctgc ccgtcgctcg ctgctcgaaa cccgttgtct    117180
     tctctttgtg caaatatagt tttaagtgat ttattcgcaa agaggttatg aggcgctgcg    117240
     ctgaagaggt aatgcaaaag ggactaggcg ctttaagctc gaacctcgaa cctcgaagct    117300
     cgaagctcga agctcgaagc tcgaagctcg aagctcgaag ctcgaagctc gaagctcgaa    117360
     gctcgaaact cgaaactcga aactcatttc gtatctattt aaataatatt gcaatcatat    117420
     taaataccgc taaactaatc attagtatat taatgaccga ttaggtagtc atttatgaga    117480
     tctgaacaag cattaaaact ggcgcgtcga ttgggtgatt taattcgcca gcatcgtact    117540
     ttactttata cccagagcac gttcgctaag atgattggtg tatctcgctc cacggtacaa    117600
     aagcttgagc aaggggaggt agtaaaaagc gatatattgt ttgaagctct tgttgtactt    117660
     caattgcaag gctcattgtt ggatgaaatt aacgagcttg ccgcagatgt gggcggttat    117720
     aatgcaagac agcgtaaaag caataagact caggtgatta acgatgactt ctgaagccta    117780
     tgtatttatt gacggtttag aagacagccc ggtaatttgt ggctttttta agttaaatac    117840
     acaaacaggc cgaggtgagt ttaattatgg taaaagttac cttgcgcgct ctgatgcgtt    117900
     tgcgctcgat ccgctgcatt taccattaca gcctggcatc gttagttatt ctgccaataa    117960
     aggtgtgttt ggggtgttaa gtgatgcggg agctgattcg tgggggcgta agcttatact    118020
     gtcgctgcat aataccaaac caaaaaatga gctagaattt ttactcgcag ggtctgggta    118080
     tggtgttggc gccttggtat ttagtttgtc gcgcagcgca tcaaaacata aagcgaataa    118140
     aaatacttta gccgatttag ccttattgga tcaagcaaag gacgatttgc tcgccaataa    118200
     aacgatttca caggaagcaa aaaaagcctt tgaatttggc caaagtatgg ggggagcaag    118260
     acctaaaacc tctgtgaaaa ttgaccaaaa actttatttg gcaaagttta atcgtcaaga    118320
     cgatttgttt aatttagcta gggctgagca tggcgctatg tgtatggcta atgaattggg    118380
     gattcgcact gcaaataccc gtattcatga aacagaaaat ggcgatgttc tgttagttga    118440
     acgttttgat gtaagcgatg acttaccaac tcatcacttt ttaagcgcca atagcttatt    118500
     acaaaaacca aaagtcgcga taagcgactt agcaacatac tatagctacg gtgaactggc    118560
     tgaatttatt cgccaccaca caggtgagtt cgctgctgat gctacagagc tctacaagcg    118620
     aatggtattt aacgtattta ttggtaatac cgatgatcac agccgaaatc atgcattttt    118680
     gtatcacttt gcagggcaaa cgtggcgtat gagccccgct tatgatatta cccctattaa    118740
     taactcaaag cagcatggca tagggcttgg tgatgatggc cgatatgcta gtatcgataa    118800
     tttactgtcg caagccaaac gcttcggcct caacaaggct caagcgacaa aaataattac    118860
     agaggttgag agttatactc gccagtggcc aacgcacttt aaacgttttg ctaatatcag    118920
     tgatattgac ataaaacgct tagaaagcgt gataccttct ataagttaaa ggctaataaa    118980
     gtagtcatta gttgattaat gactgattaa gtagtcattt attaattggc gcttatatga    119040
     accttaaagc gggaatgaga aggctgcggg cttcgagtga cgagcagcga gcttttgcta    119100
     ttacctaaaa cccaaaaccc aaaacccaaa acctaaaacc taaaacctag ctcgtagccc    119160
     gaaacccgcg ttccaaacat aaaacgcgct gcataaagcc ctgcctacag gttagtcggc    119220
     cagggcgcta tttgtgggtt gataagcgcc attatctaac gcatcaaagt aggcttgata    119280
     acggccgttt tgtttaaatt taagtaattg ctggttaaat atttcaagcc gctgttcact    119340
     gcgtgggtta tttttaggga acatcataaa gctttggttt accaacaaag ctttggggtg    119400
     gtgattaata gcgctgaata ggtcaggtaa tttactcgct aatgtgaaat agcctacgct    119460
     ttgctcttcg gcaaaggcgt cgattctgcc catagctaag cgtttaaagt tttgctctgt    119520
     ggtacttact cgcgacatat cgaataagcc ttcatcggct gctttatcaa agtctttgcc    119580
     gtagctgtag gcaagcccac caccgagtaa taagcctttt aaatcgttta gattttgcca    119640
     atcaaaaggg cgttgtttat gataaaaaaa tacaaaacgc tcgtttaaca ctggctcact    119700
     gtaaaaataa tcctcagtac gttgttgttc aaacatccat acggcagtgg ctgcgtattt    119760
     atcattaatg gtgtcgtggt aagcacgcgg ccacggtaaa aaggtaaagt taactttaat    119820
     gttagcttgt gcaaatatat cggtaattaa atgcgcaacc acgcctttgt gaggcagcga    119880
     ttcacttaaa aaaggcggcc attcgcctgt acttatattt aaagtagcat ggtgattagg    119940
     cgctttgctt gagggttgta ttgcttcaat tgcgtgcgtg taatgactgg taaaagccat    120000
     cagcaaaaaa gatgcgatat aaatacggta tcttaattta gctgataaca taacatgcat    120060
     gtgtataagt ctctccttct attaaatata cccttttggg atataaagcg gctttgagcg    120120
     ttgcttaaaa aacaggctat tttaaaggcg ttaactgaat gtaggcttaa gggctatacc    120180
     gtcgctttac agacttattt taagtatttt tatgttaccg cgttattctt ttgtttgcat    120240
     gttttttgcg cgttcttctg catcgatgag tgcttgtgat ttaggtgcgc gttttttttc    120300
     ttctattttt ggtttttgtg gtgaatttgg atcccagctt tcatcaagcg ataaattagc    120360
     aaatggattg ctgctttgtg gtgagttatc gggcttactt ggctcttcag ggacaacctt    120420
     tacttgctca ggcattactt ttattttttt agttggtagt ggcgcgtcgg gatcgaaagt    120480
     gcgtacttct ggctctttaa agtcgtgttc agtggttgag cttaatgatg aacgctgcgt    120540
     ttttgcagga tggaaatcag cttgtggctg atggggtaca atgggttcag gtgcgctgtg    120600
     tgaaggcttt ataggcgctt cttgttgtac ctttttgatt ggctgattta taggattacg    120660
     ctgaattttg gtttgtttgg cttcggggtc aaaatctctt acttgtggct cggcaaactc    120720
     tgttgcattt tttatccgct ctaaggttgc tttagcagct gcttcaaact ctgccgtgtt    120780
     aggctccggc tttattttca cggtattaac tcgactagaa tcaggctctt tacccttgct    120840
     ttcgacggct gggttttgca gatcagagcc agtcaccatc ggctcagtaa caacactgtg    120900
     agtttgatca ttgtcgtgac ttgcgggcat ttgcaatggt atgccagtat cagccacttg    120960
     tttattttgc ttaatattgc gcaggcgcat taataccaca accgtaatta ccacaattaa    121020
     caatagtgcc acacttggta atactagcga gattatatta gcccctttgg gcattgaaga    121080
     ggcaataacg gctgtttgct cgctggcttt tatagtgata ggtacggcgg tttgtgcagg    121140
     ctcaacggtg gcttttttta cctctggttg cgtattttcc tcagtgtttg ataattcact    121200
     ggccggtatt ttgctgggct gtgcattttt ttcagaagcg ccgctttgtt cagccgctgc    121260
     tgttacattg acttgtgact cattaggtgc tgttgtggtt gatgctactg gggcattgtt    121320
     tttagcttgc tctatagttt gagtggcgct tttttcgatt acattatttt gaggtccagt    121380
     tgcactttgc tcagttgcag cgtctggcaa cgttggctgt aaagtgggtt ctgtttgttg    121440
     tggttttaca acctccgggg tcgattgttc aataaccggc tgcggtttag gctttggtac    121500
     tggcaaagtg cgtgccgctt gcggatcact gcagtttttt tcaaagtctc gcgcagcatt    121560
     acggtattta cggctggctt tattattgct gtgttgctgc atttcttgtt ttataagaat    121620
     acacatagct tcgttataag cggcactgct ggcactataa aacaaagcaa aacaaaaaag    121680
     taagcaactc agtaacggtt tcataaaact caaaagtggt taagcatcaa tgccctaatc    121740
     ttaagcgtaa agtgaaaaat tatctagaag cgcctagcgt taattagggt ctgttgacct    121800
     ttgcggatta caatttgttc aaactagggg cggtttaatc gcggcgcgag gtttgtaacc    121860
     tagtggacta agtaaaaacc gagcaacaaa gagtaaatcg ctcctaggca gaacccgaag    121920
     ggcagcgcct gtttggcatt gatgctgcgt tatcgcctat ttatggggaa aaaccacacc    121980
     acataggctc tgccttgcct aaataccaaa cagactgctg caaatttaac cttgaaaggt    122040
     caacagaccc tagtcaatta ccattaagct tcggtactcg tcgtaagcaa attggtcggt    122100
     cataccgcta atgtagtctt gaattaaccg acagcgataa taaaattcat aggcggcaaa    122160
     atgatcgggc tcttcttgca tcgcatttat agcatgctga tagctactta aatgcttttt    122220
     agagagcttt ttaacgagtc tcgattctat taataagcgg ttgtcgccat gcaatgcacg    122280
     tttaaagtca tcgctactca aaagcagcaa aggtttataa caatcgagta ggccattaat    122340
     aatacggtag ccttgcagtt cgagtttttc gacttctttg tgcgaaaata catgctcaag    122400
     cgcgacttgt ttgagcgctt gggttgctgc atgcaggtag ctacgatctt ctaataatgc    122460
     atggttaaag tcgccatgat aaattggctc tatgttttca ataaagcgtt ttgcggcatg    122520
     gtttactagc gggtgcagta atgacacgcg taaataaata aaaaactcac tattaaaatt    122580
     aaagggctgt gcttgtgccc gttctatggc gtagtttatg gcgtcgtcca caaagctttg    122640
     gtgttgagtg tcgttgagag cgaggttaat taatgctttt tgatactgct tttttagttg    122700
     ctcgcataat aactgtgtgg tgataatgtc tttttctacg gcgtcttcta tgtcggcaag    122760
     gcaataagaa atatcgtcag cggcttccat aatataactg gcagggtgac ggcaataggg    122820
     ctccattttc agctcagttt gcagtgcttc aacaaagctt ttttcactgt agtaataccc    122880
     cacttttttc ataatgtagt ttttattttg aggaatatct tgcttcgcta aactagctgg    122940
     acaggtgtac tttaaaatag cggcagtttg gctataggtt aaatttaggc tcagcaaaga    123000
     gtgaataatg cgtatgcctt gagcgttgcc ttcaaagcta caaatatctt gggctaaatg    123060
     tttaaaaata acgccaatgc tgctgtttgt ggtttggcaa cgctcaggcg taatgctggc    123120
     taaattagca ttaaaccaat tattaatagc cgcttcgcca aagtgaccaa acggcgggtt    123180
     acctatatcg tgcattaggc aggccatttc tactagggtt tctagtgggc gctctaaacc    123240
     cgataaacca tattcttttt gttgctggta atttaaattg gcaaagatgc gctgcacaat    123300
     aaagcggcca acttgctgaa cttctaatga gtgagttagg cgcgaacgca cagccgcgtt    123360
     gcgctccagc ggaaatactt gggttttttg ttgcagccga cgaatggctg cactattaat    123420
     aattcggcca cgatcgctct caagcgccat ttgtaaattg gcagtggtgc gctgcatacg    123480
     tgcaggggtt actttgctac tgaagttgat catggtaatc cttttttatg tgaattaagc    123540
     acttattaaa cgcacgatta tttattttta atagtttgct ttaatttatc agcatgtatc    123600
     ataaagtaac aacttgcttt agtattattt tttataaaat taacatacat ctaggtattt    123660
     aaaatgaagt tgtggatcac taaggtaatg tgtttttgcc ttttattggg tgtgaatagt    123720
     gcgtttgctg ctaaagagca aacggttgtt atgatctcta ttgatggctt acgttgggat    123780
     tacattgaaa agcacggtgc gcctaattta aaagcaatgg gtgagcaagg cgtaagagcg    123840
     caaaaaatgc agcctgttta tcctactaaa acgtttccaa atcatatttc ggtgatcacc    123900
     ggtttactgc cagttaacca tggcattgta gataataagt tttgtgacaa agcgcgcaat    123960
     aatgaatgct acagcatggg gaaaggacaa aaagacagta cctgggtacg cggcacacca    124020
     ctgtggaatt tagttaaaat gcatgggctt aaatcggcgg tatacttttg gcctgagtcg    124080
     gatgcgcgct ttaatggtat gacgcctgac tattactttc actactctaa acaaggtgac    124140
     taccaagacc gaattgatca aatcattcaa tggttaagct tacctaaagc acagcgccca    124200
     cgttttgtgg cgagttattt ttcgttagtg gatagcatgg ggcatgaata tggccctgat    124260
     gcggtgcaaa cgcgtgatgc cgttaaacag ctagatgcgc tgatggggca attaaaaacc    124320
     cgcttgagta agttagagca agaggtaaat ctggtgattg tgtctgatca tggtatggca    124380
     caagttgagc ctgagcagag cattgttgtg agcagcttac ctaaagatga taattttatg    124440
     gttgttaata ccggtcctcg attacttatt tatactaaaa gcgatgctaa aaatgcagat    124500
     gttgaggctt ataaagcccg tttacaacat gcagcaaaag gacgctacac ggtactaaca    124560
     gaggagcagc ttgcaggata tcactataat aaaggcactc gtgtgggcga tattgtggta    124620
     caaacgacag cgcctgcggt atttagcaat agtgctaaag tgccttactt aggaacgcat    124680
     ggctatgcct ataccgatga tatggcagca acatttattg ctaccgggcc agcgtttaaa    124740
     aaaggggtga gcattgagcg agtgaataat ttagatattt accctgtgct tgctaaggtg    124800
     atgggtttaa agctaatgag taaagtggat agcgatggtg aaaccttact ccctgccata    124860
     aaacagaaaa tgattaatca ttaaaaaaga gcgccgaggc gctccgcaag ggaaacttaa    124920
     ttggtcagca tgggttatta acccatgttt acattgttat ttaagctgaa ttttgagaat    124980
     aaatttatta ttcagcattg agcttattta aagttagcga tactggtttt tgtgtcggta    125040
     acggtacgaa tggcgtacga ctgattggtc accccaaatg gaataccgtt tacgctccag    125100
     ttagggtttg agaaatagtc gtactgcgtt gcactgccaa atacaaatgg gtaggccata    125160
     atactggcaa attcattttg tacaccgtgc cccataccat caacgtatac accaccggct    125220
     gtatcgcctt gcttacgtga atgcgctaaa ccttggttat gaccaagctc atgaacaaag    125280
     gttgtggctc cacaatcgat tgcggtgatt gagtacatgc ggctgctcat tgagctgtat    125340
     aaattaccat ttgtgccttg gccaacccat gctaagccac atgaaattaa accgttacct    125400
     gcactttggc ctgtacccag tacggcaacc atgtcggctt tccaatcatt gcgtaaacca    125460
     tctacgtaac tactatttgt gactgcattt aaccaatctt cagaaggggt tactgcatag    125520
     tcacctaaat tttgagtccc agctaaacgt agcgtaatgt caacgccatt ttggctgtat    125580
     acctggttac taaaagcaat aagctgatta attttggtat tgatattact ggtagctgct    125640
     gcagattgat cggtatataa aataccgata tcaatggttt ctgctgacac tgtgctggcc    125700
     gcacatagcg ccgttgcaat agcggctgtt gaaattactt ttttcattgt tgtatttcct    125760
     tactttttac gattgcagtg tttactgcta ggtcttgttg cctgcgttga caggtttgtt    125820
     taaaaagagg gcgtgttttc agcacgaggt gcaaatgggt ctgtgtcatc cgcatttttt    125880
     ggtgcaggtt caccaacctg atgctctata tgtgttttat ataggtcacg cttagctgca    125940
     atccagccat attgaccttt actttcaaaa acataattac cacttggggc tgtaaattga    126000
     ccgtaaaccg catcattgcc aacggttaat atggtggtgt gcattgcgcc attggcccca    126060
     ataacctgac caacaatgct tttatcgccg ttactggcat gggttacatt ggttatttca    126120
     gcgctgtagg tttctgcggt ttgcggtatt gcaaggtcaa aattatcacc cgttttgagg    126180
     gtttttagcg ccgctagatc aaattctatg taggcttcat tttgtaaatc ggttggcagt    126240
     acttttgccg ctttaagtat ttctttagcc tttgctgaag gtttattaat tgcgtcaaat    126300
     gagtttgaag gtacgtttga ttcaatgtta gcgggttttg ctgcaatagg gtctttactc    126360
     atatcaatgg gcgatgggtt atgtgttttt tttgcaaact cagaatcaac aggaacgata    126420
     tcaatagcaa tgggcgcttc tacctcatcg gtttttttct gatcattaag cagcgtatac    126480
     aaggcaaata cagataaagg aatagcgata gttaaaacaa tgtaacgttt catctgtttc    126540
     tcttttaggt taaatggtga actaattgtt aagttttatc ttaaaaaaag aattagatca    126600
     aatttaaatt gtaatcataa agtggtaatt gattttttta taacttattg taagtatttg    126660
     ctttaccttt tttaggtatg cttttttggt ttaataggat ggcttttttg tagtaatggc    126720
     gcaccctgtg gcatgttttt gggtacgtgt gtgtttttta aatcacaccg attttgacaa    126780
     gcaaaactga ccaataaaat tttttagtaa cgtgatcatt tttcattatt caaagggcta    126840
     attgcaaagt ataaataggc aaagtatgtt gtatcgttaa acacctatta aaagagggaa    126900
     ttatggcagg gactgatcag ttacttagtc gaattatggc aggacttgtt gcggtcatta    126960
     ttggtttttc aagttctatt gcattgattt atcaagtggt gatcacctta ggtggtacac    127020
     ctgaacttgt ggcaagctgg atattaatgc tggggctagt aatgggcggt acgtctattg    127080
     tgctgtcgtt ttattataag gtgcccattt taattgcatg gtcgactacc ggtgcagcat    127140
     tactgatctc aagtgcccag ggctacagct tacatgaagc gataggcgca tttatgctat    127200
     cagccttatt ggtattggtg tctggcatta ccggttggtt tgaaaaaatc atgaaccgta    127260
     ttcccagtga actggcctgt gctatgttag cgggggtatt agtcacattt ggtattgatg    127320
     tgtttaactt tatgaacgac ttgccattgg tgattggttt aatggtggtg gtgtacttta    127380
     ttggcaagcg cttttttgct cggtttgcaa tgctaagtgt attgttagcg ggtatatttt    127440
     tagcctggta tatgggaaat atcgatacca gcaccgtgca gtggcaggca agcagctttg    127500
     cttatattgc accaagcttt agtttgcagg catttataag tattagtatt cctttgtata    127560
     tagtaactat gacttcacaa aacttacctg ggtttgcaat tttaaaagcg cataactata    127620
     aagcgccaat atcatcgtca ttaactgtga ccgggttaat aaatttagta accgcgccat    127680
     ttggcactta ttcaattaat ttagcggcca ttacggctgc tatttgtatg agcgaagagg    127740
     ccgataaaaa ccccgataaa cgctactggg cgagcattgc tggtgggatg ttttacatta    127800
     ttatggcgct gtgtgctgca atgctagtgg cgattgtagc aagcctgccg caagcactgg    127860
     tattggcgtt agcgggtatt gcactgtttg ggaccatcgc taatagtttg cagcagtctt    127920
     tgcacagccc cgaatatact gaggcggcca ttattacctt tttagttacg gcttctgatt    127980
     taacattatg gtcagtcggc tctgcatgct gggggataat agcaggagca ctcacgttaa    128040
     tggtgacacg taagagctaa gagcagattt taggtgttag gtgcggggat cgggtgtcga    128100
     gcaacgggtt tggtactgtg cgcgcgaggt aaactcacgc ctacagtcga tcaccgcact    128160
     tggctaatct cttgctgatc gctgacagct aaaacctaac cgctgctctt cccgttttta    128220
     tagcattggt tttaacacat caaacatggc gtctatgtga tcgtcacggt cgttaagcgc    128280
     tgctatataa cggtattttt cgccgccggc ttcttcaaaa atctctcggt tttcaccttc    128340
     taattcttca agtgtttcta ggcagtcggc gctaaaggct gggctgataa tagccacatc    128400
     tttaattcct tcgccaggta agctctcaag agttgcatct gtgtaaggtt ttaaccattc    128460
     agctttacca aaacggcttt ggaaggtggt gatcactttg tttttatcta ggcctagctt    128520
     ttctaccact aaacgggtgg tttgttggca taggcagtga taggggtcgc cattatctaa    128580
     aaactgttta ggcataccat gatatgaaaa caccattttt tgtggcatgc cgtgtttttc    128640
     taaatcttcg ctaatgctgt tagcaagcga ctctaggtag gttgggtttt tgtgataccc    128700
     atttacaaag tgtagctctg gcacccagcg ccattttttt aatacatttg ccacggcatc    128760
     aaatgttgag cctgtggttg gacttgaata ttgtgggtaa agtggtaaca caataatgcg    128820
     ggttaagcct ttatctctga gctcttcaag gcccgcttcg attgatgggt taccatagcg    128880
     catcgccata accacttcgg tgttggtata gccgtgctgt tttaataagg catttaattt    128940
     aatgctttgt tgacgtgtaa tgtgggtcag tggtgagcca ttttcagtcc atatgctttt    129000
     atacaattta gctgagcgct ttgggcgtat acgcaaaatg atgccatgca gaataagcat    129060
     ccacacaata cgcggtattt ctacgatacg agggtctgac aaaaactcac gtaagtaaat    129120
     acgcaatgca cttgctgttg gggcatcggg gctacctaag ttggtcagaa gtattcccgt    129180
     tttttggtta aaacgcccgt cgtggggatt gtcggtaacg gcagaaaatc gcgacacgtt    129240
     gtgctccttc aagcaatgga tttagaggta tctatttagg cttagtataa cgaataaaag    129300
     agtattttag atcaatcatt tagccatttt aaccataatt ctaaatgggg tcggcttttt    129360
     agcttcgagt tgttgtagct taacaatcga tttcgtattg aaaatatgtc ctttaggcaa    129420
     aagcataata cctgtatggc tgtgcagtga gtttgccaat atcatatttt cttcgagttc    129480
     ttgtgcgctc atcaccttta ttgaaccaat agagctgtca gaggcaatga gtttagcgtg    129540
     gctggcttca agtgcatcaa caatacgcgg gtggtataag ctgccactgt ttgatttaat    129600
     actattgagc gcaaattgat ggcgttgttt tgttgtaagt aacggctcac tttgctcgta    129660
     accctcccaa tagtcacgag caacactgag caccatagct ccaatgggaa tatcgttttt    129720
     agcaagtcct ttgggaatac cttggccatt gtagcgttcg aattggtggt aaattgcatc    129780
     agacacatcg cttaaatgag tcgcaggcat gagcattaat tgtgaaatac ttgggtgggt    129840
     gtaaaacgtt tttctttgaa cttcattaag ctcgttaatg ggtttgttgt aaagctcagg    129900
     gtccatagca agtaaaccaa tttgagccaa ataccccgca ataggcgcaa gttcaatgct    129960
     tttttgcgat acgttaaggt aacgcgctat ttgagtacat gtaccggcta tattttctgc    130020
     tcttttacca tcgagataag gattcgcatt gataaaatta taaagcagtt caacagtaga    130080
     ttggtgctct cgtttttcac tttcattagc gacttcaagt ttttttaata cgcttctaat    130140
     ttgttttgtc cgcttttcga cgagttgctc taggttagta ttcagctctt ttaattgttc    130200
     attttgctga tttacatggc gctgtaaaat ctcattttgc tttttgagtc taaacttttc    130260
     gacgcctgat tggataacgc taattaagtg atcgttttgc caaggctttt gcacgtaggc    130320
     gtgaatgcct ccttcattaa ccgcactaat tgttgactct aaatcagaaa aaccagttaa    130380
     caaaatacgc tggctatcgg gggcaacttt tcttgcttta gctaaaaact cagcaccgct    130440
     cattagtggc atacgcatgt cgctaattac gacatcaaac tgtttttttt gcattttttc    130500
     aagtgcatca tggccactgg ttgaaacact cacatcaaat ttatactggc gtaaaagtcg    130560
     tactaaagat ttgagtacat tagcctcatc atccaggcat aaaatgctcg gcggctgttc    130620
     atttaattgc tctaatacat caatgtccgt cattttttta ccaataagaa agtgagtttt    130680
     atagctaaat ttagtctaag ctttggttgt aaacaactga tttatttaag ccgtttccaa    130740
     gtatactatt tgaacaatac gcaaatcatt gttgttagga ttaaataagg taacgctgtg    130800
     ttgtagtttg catctatttt tactgtaatt ctctgtaatt tagatgagta cttatttaaa    130860
     taaaatcgaa tctaagcaaa atcgagagtg tgacatagct tactcaattt gtttgttggc    130920
     atgtaatatg gtcagtacgt cgtcagttaa tgtgggcttt ttaggtaacg taatataaaa    130980
     agcagtgcct tggtttaact ggctttcaac tcgaatttgg ccactatgtt gctctataat    131040
     tgctttactt atagctagcc ctaaccctgt gccttggcct attggttttg tagtatagaa    131100
     agggtcaaaa attttattta atttgtcctc atcaattcca ctgccattat cggcaatagt    131160
     tatataggca ttttttttat cggctttagt ggtaatactg atgacaccga ctttgtcgca    131220
     aatggcttga gcggcgttaa aaaataaatt taaaaatacc tgagagagct gggtcgaacg    131280
     tcctgtgatg ataacgggtt ctgtgtcgta gtgtttttca acgttggcgt tgtatttaat    131340
     ttcattccaa gcaacacgta atgtattatc aatgagctcg gttatatcaa tatcgccaat    131400
     ttgggtttga tccggatgag caaattgcct taatccttga acaatctcct taacacgatc    131460
     agccccttca gtcatttcag caatgatatc gcttgagtct gtttctaatt catcaaattg    131520
     ataatgttgc agcgtatctg ctaatggttg ctgcgctatg gctttttcag ctttgagtgc    131580
     gttaattaaa tgactaaatt gctcaaggtt gtaagccaaa ttttggatat tactgacaat    131640
     gtagcttaaa gggttgttta tttcgtgtgc aacgcctgcc gccatttgcc ctaacgaagc    131700
     cattttttca gagttgatta acacttgttc aatgttactt tgtttttctt ccatttcttt    131760
     ttgtttaaca agtaaatttc gtttttcaaa ttgtgaaatt gtattccctg caaagctgac    131820
     aaagcgttgc attaaagtaa tatcgtgctg attaaatgcg ccaattgttt ctgaaaaaat    131880
     atagagctgg tagctttctg tactggtact tactggggtg gtgagcattg catgctgcga    131940
     atgccaaaaa ggatcagtta cttgccaatc aggaagttgg tgtaagttaa atacattttt    132000
     aatgtctcta ttgggtttat ttagtgcttt gagttgggta attatttcat cactttgtgg    132060
     gtgcgatgct gtaattaacg tcgtggtttc attgctgggg tttattttaa ttaaaatagc    132120
     cgcagaaaaa gcaatggctt gctgcaaaat atcaaaaaac tcagtgagta aggtttcagt    132180
     tttgtcgttc tttaaaatgg catctaagcc atttaagatc aggctattaa aggcacggtt    132240
     ttcttcaagt gctaaattat gaacttgtaa taagtgtagc ttttctaaca gtatttcatt    132300
     gctactcatt cagggccacc aaagatttcg catgaaatca ttaaattacc atgtttactt    132360
     gttgaatcgc tgaatgtgcc gagctcccca aaagtaaagc ccataataaa tggggtgttg    132420
     ggtagttgtg ctgcaataga ctcttttact tcttgcatgg cgtctttaat tgacagcata    132480
     cagcctccgc aaaaaataat aatagcgccg gtaatatttt ttatggcatg gagttctgcc    132540
     aatttagtta atgaggtgac aaccacatca cctcgtttaa ttagttgctc tgggcttccc    132600
     gaagctaaat aaatagtatc gccaacgctt aaatttgaaa ataattctag cgtgccattt    132660
     tcagctaccg ctggatgact taacagtaat cgagggattt catcatttaa agaaagggcg    132720
     cttgccaatg gggtcattgt tgattgagca aggatatttc ctgaagttaa ggcgtttaaa    132780
     cctatgtttt ttcgccactg attataaaca tcaaacgcgg gctggttatc aattgttttt    132840
     aataaacgac catccacgtc tgtcactgta ccttgctggt cagttttatc gtagcctgaa    132900
     ctataaaagc cgaatgtttc tacactgggg tataacaccg caataataaa accttgttgg    132960
     tatacatttt cagtatcgct aaaacaccat tttgctgaaa tatcgttgtc ggcgcaactt    133020
     cctccaaaaa caggtatacg ctgcccgata gcatcttgaa ttccctgcaa aaccagctcc    133080
     tcattacctg ggacttgaaa gcaccagacc atttttgggg cgaggcctgc ttggcctgca    133140
     ttagcaatgg ctttaagtac ggtttgagca gcattttctc ttagattatc ggttgcatta    133200
     caacttgcaa caccataatg cccatttgag tctttaatcg agaataaact aatactttgc    133260
     tcatttaatg atagggtttg gtcggttgat gacccaagac acgaagagat gattaaacaa    133320
     ttgtgagtgt tttttaaaga gcgtggctgg ttattaaaaa ggtatttaat ggtatcggtt    133380
     gtagcaaacc caagcagtaa atctgggctg ttgttcgtaa actgactaac aggttggata    133440
     aatttatcta tatcgctgcc gtgagtgtga aaagtatcaa tggcgaacat agatgcccct    133500
     tggtgataac aatagccaca accgtggatg ttttaattat taataatcgc ttaggattta    133560
     ttctagacta ttcttgaata aggtgtgtta ctgaatttac gattagtaaa tgtcacttat    133620
     gtcttgagtg tcttatttgt cgtcttgtta ttaaatttat gttaatgtaa atttaaaatc    133680
     aagctgaata ttattaacat gctaaaaaca ttaaagccaa gtgagattgc tcgttactgc    133740
     gatgttcatc aacgcacggt aagccgttgg attaacgcgg gtgacctgaa agggcataag    133800
     ctgactggtc gtggtaatta tagagtgcag gtaattgact ttattgattt tttagtcaga    133860
     cataaaatgc cagttccaca aagtttgtcg cacaagccac aggtcttaat tattgatgat    133920
     gaggctaatg tccgttctgt aattaagcgt gttttaaaac gaagcggttt tgatgtcgta    133980
     gaagccgcag gcgggtttga ggcgggtacg ttaatgcatc aacgaaagcc agagctgatc    134040
     actgtggatt tatctatgcc agggcttagt ggtatagagg taattcgttt tattcgctct    134100
     tgtgaagagt ttaaagatat taaggtgtta gtgatttcag ggatgcctga aactcaacta    134160
     atcgatgcag ttaatgccgg tgctgatggg tatatttgta agccatttag taacgataca    134220
     ttgataaaca gtgtaaatat tttatttggt aaaaatagaa ctcttcttgg ggtgtaaata    134280
     gtggctttgc gaattttatt ggtagacgat gaacttaatg tattgaaatc tttaaaacga    134340
     gtacttgttc gttcaggtta tgatgtaatg acggcatcca gtggttttga ggcacttgaa    134400
     atattagcgg ctaatcaagt tgagataatc attactgact ttagaatgcc agaaatgaac    134460
     ggagctgatt tattacgcca agttaaaatt aattggcccg attgcgtaaa tttagtgctc    134520
     agcgggtatg ctgattttaa gtctgtggtt gagttattaa atcagggatt ggtatttcgt    134580
     tttttagaaa agccatgggt tgatagtgag ctacttgaaa acattagcga ggcgaaagta    134640
     aaatatgaac agcgccgagc taaaagagta agagatcagt tattaatggg cagtatgtcg    134700
     gcattaatag aaatagacaa tgacggcatt attaatcgtt ttaatgcacc tgccgctgaa    134760
     atcatttcag atattcattt atacgaaaac aaacacctcg ccaatttaga tacagctcaa    134820
     aacaaagcgg taagtcagtc gtttgttgat aagcaaagca gtacactttt tattaattat    134880
     acttgcactt ctgatctagc taaaagcgaa gaagttatga ttgagcgttg tttacatgac    134940
     ggtttttgcc agcttttaaa gttatcaatt aactcaaata gtatgagtaa tatttttcaa    135000
     cttaccagaa caccatcagt ggtgactaac gagtctgatt tttatcatca tttagccctg    135060
     tgtgaagcga ataaagaatg ttatgccctc gtttatatag gtattgcgca gtttcaatta    135120
     atcaatgatc tgttaggcgc agaagatggc agccacctta taaaattggt tttggaggtg    135180
     ctaaaaggcg tatcaaagca accggtgaaa gttcttcata agagcgccga tcggtttgta    135240
     ttatttgttc ctgaaattaa atctgatagt gaaattttaa ccgatttaaa taaggcgatg    135300
     aatgatctga aaaaactact ccctagtaaa tataacgatg cccatgtgca gctttatggc    135360
     gtgtatgggt tgtttcctga ggatagtttg gaaggaaaag aactcgttaa tcaaatgcag    135420
     ttgacgatga attaccaagt aagtgaacaa cagcgtattt gttctcggtt tgatcctcag    135480
     ctggtagccg attataaaaa gaactttgag ttaagccgtt tattattaac agcggtaagt    135540
     aatgatgaac tatcgttgcg ttttcagcca aaagttgaca ctaaaacagg gcaaatattg    135600
     attgctgaga cgcttattcg ctggtatgag ccgagtaaac atggctgggt accgccagct    135660
     cattttatcc cgattgctga atgtgatggc caaattatat caataggacg ctgggttatt    135720
     tctcaaagtt gtaaaacgtt aaaatattgg acagagaata atacaggcgt gcgtgtattg    135780
     gcaattaact tatctgctag acaattaaaa gatgatcccg attggattga ctttatgctc    135840
     gagtgtttaa gtcgcaataa tttagagtca tcacagttgg tttttgagtt aacagaaacc    135900
     tatttaatag aagattttgc tatttgcgaa caacagttaa taaggttaag aacgttggga    135960
     tttaagttat tgattgatga ctttggtgtg ggttactcat cacttggcta cctttctaag    136020
     ctgccagtag atggtgttaa actagataga gcccttattg ctgatataga gtcgtcttta    136080
     gcgatgcaaa gtatgattcg taatattacg cgtatgtcac atgatctaaa tcttaaagtt    136140
     gttgctgagg gggtagaaac agcctatcaa tgtgaattaa ttaaaaagtt agggtgtgac    136200
     tacatacaag gctattacta tagtgagcct ttagagcagg atgatttttg taattactta    136260
     agccatttca attctcaagg tgcgcaatga gttcaatagc ggtagtcata ctagatgacg    136320
     atgctttttt attaaaagta ttacaaagaa ctattcatcg agcctttcca gaggttgata    136380
     taatgacaac ctctgatatt gatgaatttt ggcagctgct aaacactaag caagacttag    136440
     atttagtatt aagtgattat ttaatgccgc aaatgaatgg attggatgtt ttagagcaat    136500
     gctcttcaca aaacccctac ccagtcagag cattacttac tggtgatatg acactgagta    136560
     ccatgatgcg acaacctaat gttgtgcatg cttaccttgc taaaccgttt aatgaggcag    136620
     acataaccgc actttttaac aatgtggcgg cgttaaagtc gttacccttt gcttttaatg    136680
     tgcgcaggca gttaggggct atgatcagct ttcctgttta tcctcttatt ttgaaagaac    136740
     tcagggagtt agtacaaagc gatgaatttg atttgcatga tattgcccat gttgtttctc    136800
     aagagccaat aataactgct aaattgttgc aacttgcaaa ctcatcttat cttgggtttg    136860
     taaggccaac atcgtcaatt gatgaagctg tgtcgaggct cggaacaacg atattaatgg    136920
     ctatcaccac ttctttatta gttgccaaaa attttgaatc gtctattcct tcggctatcc    136980
     atgagaaaca attggatata gcggcgaatt acgctagttg tgttaagcgt tttgctaagc    137040
     aggcaggttt taacttacat gatcaagaac tattattttc agtggcgtta ttgagttttg    137100
     ttggcaaaat tattttgctg tctcaagggg aaagtgaagc gtcttttgag catgaaaaag    137160
     ccgtgagtga agaatatgct agttctaact ttatttcggc ctatgtttta aagttatggg    137220
     gatacgacac gaaaatgtgt agcttattaa tgagttgcca tgatttagcc gccactgatg    137280
     ataatgagtt aattccgctt aatcatacgt tatttattgt taggcaaatt ctttttgata    137340
     aacactcccc catgcagtta cgcgcatact gtgactcaaa aggtgtagac cctatacttt    137400
     gccatctaat tagtgaattt gattggcata gttatacctc ttaaataggc ctgtataaaa    137460
     tattgtttaa aaatggacag tactacataa ctacctatgt atagtttttt ctgagtaccc    137520
     tttcttacct ttagtatcta ctttagtctt ataaaaaccg cataaaacct catttggggt    137580
     gtgttttttg ctcatttcag agtgaaaaat atacaaaacc gttattttca ctaattatga    137640
     ataaaacctc aatattaaca ttgtattaac tttgggcggt gtgatattaa attgctactt    137700
     tggttgtatt ttgatacgac cccgataaag tagacacggg tttttaattc attaactcgt    137760
     attgcatggg actcacattt cctagcgtgc catgcattct tactgagttg tagtagtttt    137820
     cgatataaaa gcgactttgt actgtcattt cactacgact cagttcattt aaattgttca    137880
     tccattcttt tttatactgg gcaaaaaagc tttctgagca ggcattatcc cagcaattcc    137940
     cttttctcga catgctaatt gttacctgtc ggttgttcaa ccacgatatt gtttcttttg    138000
     cacgatactg gctgccttgg tctgagtgaa ataataagcg acttccatca ggtttacgtg    138060
     catcccatgt tttttttaac gctctaatca ccaagtctgc gctgttaact cgacttgttg    138120
     cccaaccaac gactttgcgt gagtataaat ctaaaattac acataaatac tgccaaccct    138180
     ctctgcaacg aacttgcgtt atgtctgaca cccataccgt attgggttca tcaacactaa    138240
     actcacgacc caataagttt tctgcagtga tatgcccctg cttttttccg ctaccggtat    138300
     atcggcgttt acccgcggct gagcggtaac ccatactctg cagtaatcgc tgcacacggc    138360
     ctttactaca ctcataccca ttatctatag cggctttcca caactttctg tagcccggaa    138420
     tacagtgctc atcactactt acttttttca aaaactcaag caatgagtcg ttttctgacg    138480
     cacgttgact taatgattgc tttagccatt tataatatcc agcttttgat actgacaacc    138540
     atgtgcataa tttttttatc gttttcttag ctgtcgcagc ttggtgaata tactcaaatc    138600
     ttattctttt cggctgtcca agtaggcctt cgcctttttt aacacatcgt tctccaactg    138660
     cgcatcttcc aattgctttt caagcttacg cacttggcgc tccaaatctt tatatgactt    138720
     atcagggcct tggtttttaa ttgggttaga tgtacttttt gacgtcattt ttcgtctcca    138780
     tttagataat aagacagggt taatgcccag ccgatgagct attacattaa ccagtatctg    138840
     gagagtctaa cgattgttca actgcttttg ttttaaattc aattgaatga ctacgcctag    138900
     ttttgatttt cataacactt attccttaaa taagtgtcca cttttataga gtcgtatcaa    138960
     ttttgagctt ttataggtgt tattttcctg tttttaaagt tatttgcatt cttatgctaa    139020
     ttttatcaaa ttttttgttt ctttttgttt gtgtatgttg ctaggatgtt ggcaatggga    139080
     tacaggaata taccccacac acattataag aatacacaaa acagggtcat cattatgtca    139140
     acatatcgtt taaacacctt ggctgtagcg gttgcttttg ctttcagtgc gccaagtatg    139200
     gttaatgcac aagaagcgcc tgctaaagct gaaaaaaata tcgaacaaat atctgtgtta    139260
     gggtcgcgag tttctaaccg aacagcaaca gagtcgtcat cacctattga tttaattgac    139320
     gcggatgatt taaacaaagg cggctttacc gagcttgggc aaagcttaca agcgacagcg    139380
     ccatcgttta acttttctcg tacacaagtt tctgacggtt ccgatttatt tcgcccagca    139440
     acattacgcg gtttacagcc agatcaaacg ctggttttag tcaacggtaa gcgccgccat    139500
     aatcaatcta tttttggttt aactagtacc gtgggcggtg gctctgcggg gactgatatg    139560
     aatgcgatcc cgcttattgc cttaaaaggg gttgaggttt tacgtgatgg tgcggcggcg    139620
     cagtacggct cagatgcgat tgcgggggtt atcaatttat cacttaataa ctcaacagat    139680
     ttaaccacag gttatgtgca atacggtgaa acggcagaag gcgatgggga aacaatttct    139740
     gcaggtttaa atcgtggttt tgaactaggc aacgaaggtg gatttattaa tttatcgctt    139800
     gagtatcgcg atgcagataa aaccaatcgt gccgagcgag ataccggtgg ttcacttaat    139860
     gtcgcaccag gtactttatc ggacgaagtt cgttggggac aaggtaatgc agagagtgaa    139920
     tttacttcgg tattttacaa tatggcattg ccaatgagtg agggcgagct ttactcattt    139980
     ggtggttatt ctgagcgtac tgcactaggt aacggctttt atcgtaactt taacgaagca    140040
     tctaaaaacg tgattcaagt ctatagcgat ggatttttac cgcaaataga caatgaagca    140100
     caggatatct ctgtttcaat cggttttaga ggtgatatta actctgattg gaattacgat    140160
     gtatcggcgg tatatggtga aaaccaatac gactttacct cacgcaatac attaaatgcc    140220
     tcttatgctg ctgagtactt atttaataac ccaggtgcaa gtgatgccga tattgctgct    140280
     aatgcagggc caattgaggg gtattcgggt ggctttaggt ttgaccaaac aacattcaac    140340
     gcggatgtga acgggattgt tgatattggc cgcagtgagc ctgtgtacgt gtcaattggt    140400
     gctgaatacc gtaaagaaaa ctatgaaatt gtacccggtg aagaagcctc atacgcgtgt    140460
     ggcactgcta acacagatac ttcataccca tcagtgaacg atccgaatca atttgcacaa    140520
     tgtggttttc aagcctacaa cggccttcgc cctgaagcat caaataaaag tgatcgcgat    140580
     agctacgccg tttatattga cgcagaaact atggttaccg atgcgtggaa tgttagcggt    140640
     gcacttcgtt acgaagattt ctctaatgcg ggtgacgaca taattggtaa agtagccacg    140700
     cgttatgaat ttaacgatga ttttgcggta cgtggtgcgt tatcaacggg ttttagagcg    140760
     ccatcattac agcaaagcgg ttacactgcg tttaccacta acttaggttc tgacggcacg    140820
     ttaagccagt cgtttacagc aacaacgggc tcagcatttc cagctgcatt aggcgttgat    140880
     aacttaaagc ttgaaacatc aacgaactac agtgcaggct ttgtttatga tgtgacgagt    140940
     gatttatcgt taacggtgga tttttaccgt gtagaaattg aagaccgtat tacactgggc    141000
     agcttgttat cggctgatga tgtggcattt agtcctgatg cagttgccgc gctacaggca    141060
     acgggggcag tacaagcgaa ttacttttca aactcagtga attcgacaac gcagggtgtt    141120
     gacattattg cgtcctatcg cactgattta tatgagggta atttctctgc tacgtttgcc    141180
     ggtaatttaa acgaaactaa aattgacagt gttaatgcag caccgggtat tcctgaaaat    141240
     gtagcacttg atgatatcca aagtagtttt ttaactgatg ggcagccggg cgaacgtgca    141300
     acgcttacgt ttgattatga gcgtgacgcg tatagctcaa tgatccgctt taattacttt    141360
     ggcgaaaccg atgtgaagta ctttggtaat gaccatattg aacttgcaac agatggctca    141420
     tttaaagcaa ccagtacggt agaatcagcc gtattagtgg atttaaatgt aagttatcaa    141480
     attaacgata tgtttgctct atcggtaggt gcagacaatg tatttgatga aacaccggat    141540
     gagttaggcg atgatgaagt attaaacgct atttcaaatg gggcatttaa atacccgtta    141600
     cgtgccgtac cctatggctt tgatggtcgt acttactacg caaaagtaag ctttagtttt    141660
     taattttata agctaaatag gcgccgttat aaacggcgct ttttttatgg ctaaaatata    141720
     tttaaaacag cattaaaaat gattgcatgt ttgaaaatta agcatacaat cgccatcaat    141780
     aacacagtgg gatatatatc cctcgttata ctcattttat taataggaaa aaataaatgg    141840
     cgaaaaaaag caaagcaaaa gcggttaaca aatccgcagt agacactggg cgcggtgtga    141900
     taaaacacaa cgcattggca gcactggtaa cctctaaagt atttaaaccg caagtggtta    141960
     aagccaaaaa aggcaaaggc tcgtttaaac gcagtaacaa acatgcagga caagagtcct    142020
     atttaatcgc ggcttaaata gcaccgatca aatagggatt ttgttgcgag ttagctaagt    142080
     gtttgctgaa ataaggcggg cttcgggctt cgggcttcgg gcttcgagca tagagctatg    142140
     cttcataatt ttaatcctgg ggcgatgtaa aatcgctgct atcggcctat gtttggcttt    142200
     ttacttcctc taaagcgcag cgcctcataa cctctttgtg aataaatcag ttagaagatg    142260
     tttgcacaaa gagaagagaa tgaggagaaa atgagcagac aaaaaatacg gacttttgat    142320
     tgtatgcatc taattatact taataatttt aattctgacg cgatataaaa tcgctgttac    142380
     cgctttatat atggctttat atttcctctt tcagcgcagc gtctcataac ctctttgtaa    142440
     ataaatcact taaaacatgt ttgcacaaag aaaagtgagt gagggttaat gtgaaaatat    142500
     aaaaacagga atgctcttcc cgtagctctt agctcgctat caaaacatga agggcgcggt    142560
     aggttttaaa cctatcgcgc ctttttatta tttaactagc atccagatac cggctgctat    142620
     cataaatagg ttttcggtta gtgaaataaa gccaagcggt acattgctat cgccgccaac    142680
     acaggcacat ttaagttcgc gtttgtctat atacacggct ttaatcacgg atattgcgcc    142740
     gacactacca atcaacaaag agataggtgc aaccaagtaa accggaagtg ctgcaatcat    142800
     ggccacgcca acaaaggctt ctaaaaatgg atatacataa gcgtaaggaa tcactttcat    142860
     ggcaagtaag tcgtaagtga taaaggaatt tgaaaaactg tttaaatctt gcagcttttg    142920
     aatggccagt accgccatgg ttaatgccac gaaaagctca agtgtataca tgcttagccc    142980
     tgcaccactt aacgaaaaag ctaaactgag caacaaggta accgcaaaaa tcgctatcac    143040
     aggggtatag gttgtacctt gctgaccggc aggcgattta ttaaagaaac ttctaagctc    143100
     atcgtagcca ccgatgcgct tatcatctat aaacgtttgt ggtgttgttt ctacgtcgtg    143160
     ttgctgttta aacgcatcgg tttgcgctct tgaggtgagt aagtgatcgt ttacttcaaa    143220
     gccttgacgt tcaagtaaat ctttagattt taaaccaaat gggcaaatat gttcatcggt    143280
     tgccattcta tacaattggg ctgacttggc catattttac tcctgtatat ttataccaat    143340
     ttgcaataat acttaatcat tttgaggggg caaaccagac gctcacagac gttaaaaacg    143400
     tctcatttag aacaactaaa taacgaaatt ttttgccttg ctatcgacac gattttcctc    143460
     cctcaaaata gctcagttaa ttaagcgaat tggtattgga aaggttaact gagttatata    143520
     accttgaaag atcaacaggc cctaagtgta aaatttacaa catgtgccgt tttattgtta    143580
     ataaactcag tggtacaggc tatacgttca aaaatcaagc cgcttttaat gctttaagcg    143640
     ctgaaggggg acttgcagcg cgtgccagct aattaattat aaagctatgg gaggggctgt    143700
     tgaatctctg acaaccagtt ctggtgtgta tagtttaata atatcgcggt cattgccatt    143760
     acgaatttgc gctatcagta agctggctgc atcttcagca attttattat ttggctgatg    143820
     cgctgtagtg agctttggcc atgtttggcg tgagaatggg ctatcctcaa accctgtaat    143880
     agaaagctcg ctgggtatat caatgttcat taatctggct gcaaataacg caccggcggc    143940
     tatttcatcg ttacatgaga cgatagcggt tggcctgttt tgttgattaa tgagtgtttt    144000
     agcaccctca accccggatt caaatgagta ttcgccatca ataattaagc tagggtctat    144060
     agtaatgtcg tattgtttta aagccgcttt gtagccctct aagcgctctt tggtggagtt    144120
     atgttcgctg cccccagcta aaaagccgat gcgtgtgtgg ccattattta taaggtgttc    144180
     ggtaattgat ttagaggcga ggttatcgtc aatcataata cagggcgtta atgtatcggg    144240
     ggcgtcgtgc cccgataaaa tacgcacaac ttttaggtca agctgtgtca gcttttcaac    144300
     aaaatgtggc atctctgaaa atggcggcgt gagtaaaata ccggcaattc gggtgcgttt    144360
     tatcatgctg gttatttcgt caataatatg tgcttctttg gcatcgcatg ggtggataag    144420
     tagttcaaac ccttgctttt tacacgtatc taaaatgccg ttttgcatat ctataatata    144480
     gtaggcattt ggattgtcgt aaatgtaagc aatgctgtaa gcttttgttc ctgcgagact    144540
     tcttgcagca aggttaggct gaaagttcaa ctttttaacc gacgccatga ctttctcacg    144600
     ggtgttgtca cgcaccgagg tttcgttatt tattactcgt gataccgttt ttattgatac    144660
     cccggcatct tttgccacgt cgtttattgt tgttctcata ggcttaatag acctttacat    144720
     atcattttgg gtactaattt atctttatcg gttaacaact acagcaaaag cagttaacag    144780
     tgctcggttt ttattatttg acggctaaat tataaagaca tcattgaata ttaacagtta    144840
     atttatacgc ctttcttgtg agaatggtag ataaagtttt aggtaataat ttagtcatat    144900
     ttaaatttaa tttaaataca atagtttaaa agaatattaa gcacatacat gtaaattttt    144960
     tgtatctttt ttgcccttct gtgtagctat aaaagaaaaa aaaggataca ttaacaactt    145020
     aatgacagcg ttgtcataaa ttggtgcgcg ctgttaatta ttatttaaac cctagggtag    145080
     cggattgtgt gcgctaaggt ggcaattgct agatgtgaat agtgattgat ttaaaagcgg    145140
     gattaattta agtatctgaa agagatactt gagtgactaa gttaataaca atagagggaa    145200
     agtagcgaat gaagattaaa tcattactga cagcatgctg cttagcactg ggtttgagtg    145260
     cgtgtcaggg caatgttgat gaacaaaata cggtatcggt tcagctaagc cctgcaaacg    145320
     atagcgccgt agagttactt gctaaaacct tacaaataaa atatcagcag gttgataacc    145380
     gtccatcagc acagtgcgat ccagatatag aaaacggtca ctgttttaaa gcgtatttac    145440
     atttaaccgc caactcggcg attaactttg accaatggaa aatttacttt agtcaaatta    145500
     cacctattca aacggcggtt agcgatgaat ttactattaa acgtgttaat ggcgatattc    145560
     atgtcattga gcttaaagac gggtttactg gctttaaagc gggtgagact aaaacgatta    145620
     ctttttatgc gcacttttgg tcattatcgc aaagcgacgc aattcctaat tatatagttg    145680
     ttaataataa tgacaccgct aaagtgattg aaagcacaaa acctaaaatt gacccagaga    145740
     cagggttaga ggtgttgcca catgttatgc cttacaccga ttatgaacgt cagtttaaac    145800
     gtaccgcgaa tgataaaacg cagtggctta gcgctgagcg cttgtttgag cgcaatgaaa    145860
     aatatgactt ttctgcttat ttaacgtcgc aaaatcaagt gagcaatgtg attgctcaac    145920
     aaattattcc gtccccacgt tttagcgaat ttagccaaac tcaaacgcta gatataagcc    145980
     aagggcttaa tattaactac tcaggaatag ataaaacaca cttatctgcc gcaacacaaa    146040
     ggttagcact actaggtatt aatataagcg atgatgcagc ggccattaag gtcacactta    146100
     atacagtaac taaaaatgat gaatttgaag gcagctataa gttagcgatt aaagctgatg    146160
     aaattgtgat taatgccgct gatgaagcgg gcatttttta tgctttgcaa agcttagcga    146220
     gtttgtatca ggttaacagt aatatgttac ctgtgggaga agtaattgat gcaccgcatt    146280
     atcagtttag aggtgtgttg gtggatgtag cacggaactt tcgcgacaaa ggctttattt    146340
     taaagctgct tgatcaaatg gcggcttata aacttaataa gctgcattta catttaagtg    146400
     atgatgaagg ttggcgtata gaaatcccat cacttcctga acttacggat ataggggcga    146460
     agcgttgttt tgatcaaagc gagcaacaat gtttaatgcc acagttgggc gcagggcttg    146520
     atacttcaag tgcagcaaac ggctattatt cggtggctga ttatcaagaa atacttaaag    146580
     cggcgagtgc gcgtcatatt caagtgatcc catcacttga tatgccaggg cattctcgcg    146640
     ctgcaattaa agccatgcaa gcgcgttata ataaatacat aaaacaaggc gataaacaaa    146700
     aagccgagca gtttttactt tatgatccgc ttgatacaac cgtgtattcg tcggtacagc    146760
     actataacga caataccatt aatgtgtgtt tagactcatc gtatgcgttt attcgtgaag    146820
     taatggaaca ggtaaaaggc atacacagtg atgcacagca tccgttaacc cgttatcaca    146880
     taggcgccga tgaaaccgcc ggagcgtggg ttgactcacc agcttgtgct gattttatta    146940
     aacaaaataa gttagaaatt actgaagcga gtcagctggg cagctatttt attgaacgta    147000
     ttgcgaatat gttggctgat atgaatattg aaaccgctgc atggagcgat ggtttatcgc    147060
     atactaatcc agagaatatg ccagaggttg tacaaggtaa tagctgggat ttattaatgt    147120
     ggaacggcca tcaacgtgcc catgaatttg ctaatagaaa ttggcaagtg gtactctcgt    147180
     cgccagatgt gctgtatttt gactttccgt atgaagcaga cccacaagag cacggctatt    147240
     actgggcttc aaggcatata aataccgaaa aaatatttca gtttatgcca gataatttac    147300
     ctattcatgc tgaattttgg ctcgatagag aagataagcc ttatgtagct gatgacacgt    147360
     taaagcatga tgagcaaggc aaggtagtat cagcgccttt ggcaaaagat aaacgcttta    147420
     ttggtattca agggcagtta tggagtgaaa atacgcgcac caataatatg gccgaatata    147480
     agctcttccc acggttatta tcgttggcac aaagagcatg gcataaggca gattgggcgg    147540
     ttccgtatga tcacaatggc tttgtttata gccaacaaac aaatcgcttt agctcagcat    147600
     taaaacagca gcgcgatcag caatggcaga cttttgcagc cacaatggga ttaaaagaat    147660
     ttcctaagct agaaatggct gatgtgcatt atcgtcttgc aaatgcgggc gcaaaaattg    147720
     agaacggcat gttgtacgcc aatattgcct accctggttt ggtaattgaa tacaaacaag    147780
     gaagcggcca atggcaaacc tataaacaac ccgtcaaagt aacacaagat gtatggattc    147840
     gctctaagac tccatcagca agtcgtgtaa gcagaaagct caaagtaacg caccgataaa    147900
     gtgcgttttc ctttaaatta ttgaagatga aagaagttat ttatttgtaa ataaaaataa    147960
     tgacaacgct gtcatttgtg ctagtataag attcatacag tatgacagtc cggttttatt    148020
     ttcagtgttt tgcaaaacgg tcgaacaaat taagaggcaa aaatgatcac caacaatatt    148080
     aataacaatc aactctttgt ggggatcgat ggcggtggca ctaaatgtaa agcaattatc    148140
     gtcaatagct gtaatgaaat agtaggcacc ggtgtggcag gccctggtaa cccgttacat    148200
     ggatttagcc aagcaacgca ttccattgag caatcagcgc gtttagcctt gcaagatgca    148260
     ggactcaaag agacgccttt atctgcatta atcgcagggg ttggcctggc gggagttaac    148320
     ttaccaagtt tgcataatca aatgacccag tggcaacacc catttaaaac tatgcattta    148380
     acgactgatt tactcattgc ttgtatgggc gctcatcaag gtagtgatgg cgcagtgatg    148440
     attgcaggta ctggctcgtg tggattttca tacgttaatg gtcaatcgtt tatgattggt    148500
     ggtcatggtt tcccgcatgg cgataaaggc agcggtgcat ggataggctt tactgcttgt    148560
     cagcaggtgt tgttaagcct agacaagtta atcccaagtg gtgcgcttac taatttgatt    148620
     atgaagtatt tagaagtgcg tgatgcaatg caacttgttg aagtaattgc gaataaaccc    148680
     gccgcctttt ttgcgcaact tgcaggttgt gtttttcaat cagcacaagc aaacgatgcc    148740
     attgcgattg ccattttaaa agaaggtggc gcgtacttaa gcgatattgc acgtcaacta    148800
     ttagataaaa acccaccaag gctttcgttt atcggtggct tattagccgt gatgacaaca    148860
     tggttagatc cagacattca agctatttta tcagccccat tatcgtcacc agaaatgggg    148920
     tctgtacttt acgctaaaca acagcacgtt aattacagca gccaggagtt atgatgttta    148980
     acaccctaat ggaaaaagaa gcggcgcaaa cgccaaatgt tattgaaaag caaattattg    149040
     ccaaccaacc tttagtggaa aaaattggtc ataagcttcg cgatatggcc cctaaggtgg    149100
     tgatgatgat tggtcgcggt tcatcagatc atgctggcgt ttttggtaag tacttaattg    149160
     aaattgaagc cggtgtaccg gtcagttcag cagcgccatc agtggcgagt gtatatggta    149220
     aaacattaaa gcttgaaggc gctgtggtga ttgtaatttc tcaatcagga cgcagcccag    149280
     atattctcgc tcaagcaaaa atggcgaaag aggcgggcgc ttattgtatt gcactggtta    149340
     acgatgaagc gtcaccattg caagacatag tagatgattt tgtccccctt aaagccggtg    149400
     atgaaatttc ggtggcggca acaaaaagtt acttagccac gttatcggca ttggtacata    149460
     ttgttgctaa ttggacgcaa aatgagtcat tattacaagg gcttaaagag ctgcctagcg    149520
     cgcttgatgc aatgatagac tcgccaactc agttacagcc tagtgagttt gcaaacatta    149580
     agaacatggt ggtattagcc cgtggtttag ggttttctat ctcaaaagaa atggcactta    149640
     agcttaaaga agtgtgtgct attcatgctg agtcattcag tagtgcagaa tttttacatg    149700
     gtccggtaac cttagttgag caagggttag tgattttaga ttgctcggtt gatgatgaaa    149760
     ctaaagagtc acatcagcag caaattgctg aggttaaaaa acgcggtgca cacgtgatta    149820
     gccttaatca aaacggtatt aacgtacacc ctcgattagc gccattttta gtattgcagc    149880
     gtttttatct tgatgtggca aaagtagcgt taagccgtgg ttttaaccct gatgagccta    149940
     aggggcttaa aaaagtaaca aggacattat aaatgtcagt aaaacgtatt catgtagcag    150000
     agttttttga tggcgagcaa tttgttaacg acaaagtgtt gagcattgat gcgggtatta    150060
     ttacggcaat agatgataac gtgcaacagg cagatgagca cctaacgggg ttagttgcgc    150120
     caggctttat tgacttgcaa gtgaatggtg gcggtggtgt attgtttaat cgtactagca    150180
     gtgttgctgg ggttaaacaa atgctgctgg cacatgccaa gtatggcaca actgccatgt    150240
     tgccgacttt aattactgac acggttgaag tgatgcacca agcagccgat gtcattgctg    150300
     atgctattgc tttgcagact cccggtatta ttggcattca ctttgaaggc ccgcacttat    150360
     ctgttgcaaa aaaaggcgct catagtgctg attatattcg ccctatttct gaacaagaat    150420
     ggcaggtatt atctcgccaa gatttaggta aagtggtggt aacagttgca cctgaaaatg    150480
     ttctgccaag tgatatcgct aaaatgcgtg aggtaggcat acacgtttgt ttaggtcata    150540
     ccaatgcaag ctttgctcaa gctcagcgcg cggttgatgc tggcgcaacc ggatttacgc    150600
     atttatataa tgctatgtcg ccattacagg ggcgtgagcc aggtgttgta ggctgtgcat    150660
     tattaaacga tgacacctat tgcggcctaa ttgttgatgg gcatcatgtt gattacgctg    150720
     catgtcagct tgcgttaaaa gcaaagccaa tgggtcgtgt ttttttagtc actgatgcga    150780
     tgccaccagt gggtacgaat gacaccgaat ttgctttttt tgaccgtacc gtcaccttag    150840
     ataatggtaa gctcacctct accacgggtg aactggcagg atctgcgctt gatatggcaa    150900
     ccgcagtaag aaatacagta acccatttaa agcagccatt agcgcaagcg cttaatatgg    150960
     caagtttata tcctgctcag tatttacagt tgcccgccac acacgggcga ttaataccgg    151020
     gcagtccagc agattttgta caattaaaca cacaacaaca agtcattagc acgtggattg    151080
     gcggcgctca ggtttgttaa caacataata aatataaata aaggaaaata acatgacaac    151140
     caatgttatg gatacgtcca aaaatagtag cgtggttcca atggccattg ttgcggtatt    151200
     attttttata ctgggctttg ctacttggct aaatggctca ttaatgccgt atttaagtca    151260
     aattttacag ttaactccgt ttcaagggtc gttaatttta ttttcctttt atattgccgt    151320
     cacctttact gcgcttccct cggccgtgtt aattaaaaaa gttggctata agaacgggat    151380
     ggcgcttggc atggggtgta tgatgttagc gggtttactg tttattcctg ccgctatgtc    151440
     acagtttttt cctctgtttt tattagccca gttagtgatg ggggcaggtc aaactctatt    151500
     acaaactgcg gttaacccgt acgtagtgcg tttagggcca gaagagtcgg ctgctgtgcg    151560
     tattagtatt atgggtattt taaataaagg cgcaggggtt atttctccga tggtatttac    151620
     ggccttaatt ttaagcaact ttaccggtac ggtaggcaca gagcttagcc aagagcaagt    151680
     tgatgatatg gccaacggcc ttattttacc ttacttaggc atggccatat ttattggttt    151740
     attagctttt gcggttaaaa agtcgccgct acctgaactt attaatgatg aagttgacgc    151800
     aataaacgat aagggtgaaa ttcgtgaaac actctctcat ccaaacttag tgttaggcgc    151860
     tattgcgata ttcttgtacg tggcggttga ggttattgca ggcgatacca taggtacttt    151920
     tgcactatcg ctgggagtcg aaaaatatgg ggtaatgacc tcatacacta tgatgtttat    151980
     ggtgtttggt tatattttag gtattttact tatccctaaa tttatttctc agcagagcgc    152040
     tttaaccgca tcgtctgtat tagggattgt tattacatta tgtattttac tgctcgatgc    152100
     acagtcgttt gttattgcca atgcgttatt ggtgccttta ggcggcgcta atttgcctga    152160
     tgttttactg ctgattgcct ttttaggctt agcaaacgcg attgtttggc ctgcggtgtt    152220
     cccactagca ttatcaggat tgggtaaact tactagtact ggttctgcgc ttttaatcat    152280
     ggggattgcc ggaggtgcat ttggtcccgt tttatggggg ctactgagtg gctttacctc    152340
     gttacaaaca ggctactcgg tgttgttacc ttgttatcta ttcatattat tttatgccgt    152400
     gaaaggccat aaaatgaaaa agcaataacc tccaccagct atccctagct cagtgcactt    152460
     tgcagtataa agtgcactga ttatcagctt aatcgcgtta ctttaagttt tatcctaccg    152520
     gcattcgcac cataaaaacg acttaaatca ttagcaaatg ggcaaaattc tcccgatttt    152580
     ttaatggtta tttcaacgcc ttcagcaatt tcaaaggcat gttcatcgct ttgaccaatc    152640
     gtgccgatca agctaaacca ctgcgctgta gctaaacgtc taaatggctc aagtaatgcc    152700
     atggggattt ctttaacgcc gagttgcacg ttatcgcgat gccacccaga aggagagcac    152760
     tttataccat cgtcatacca atattgatta ggataaggtg taaaacggta ggtcgcacct    152820
     tgggcaagca ttaagccggt ggcgttgtag gcttcactgg catatgccat cacatcttgg    152880
     ctttggttta tgctaagtaa actcatattt tggttggcta gcattatatg ggcactgagt    152940
     cccataaagt ttaacgtgct gtcgtcgctg taaatcattt tataatgtaa gttttttaac    153000
     gattcggggc gatagctggt tagtttatta attcgctgtg caacactgtg atgtattaat    153060
     ggggcgacgt ggctgatttc atcgtcaatt aatacacagc actgcctatc aacaagttta    153120
     aaaaatgggt ttagccaaaa gtaattttgc tgatgactta acgccagtgg atcgggaata    153180
     acagtcacat cgtcttgggc aaccaagtta ctctcaggta aaaggttttc gtaatcgatg    153240
     tcatgactgg ttagcaatga aactgacagt ggctgagcaa tgagccactc aagtgcataa    153300
     cgcaagcaaa tatcggcaag tccatcgcga tagtagccgc ctcccacatc ggaatgggct    153360
     cctgcaaacc acagctcggt aatgttagct tgctggttca ttaacgtcgg ttcaaacgcg    153420
     cgacgttttt catcaagcgc tacacagtgc agcgcctcaa agacattact ggcaatggtg    153480
     tgattttcaa aaataacatg ctctgcaccc caagtggctt tactcacttt tgacatgcca    153540
     attgaggcca ctgtatcaaa cacacataaa tacacctttt catgtatgag tggctctaag    153600
     cactttgcaa atcgccgcgc taatgcagcg cctctgctaa agccggtgag tagtagggta    153660
     tcgccgcttt ggtaatgctg tttaaaatca ttaatagctt gatttaaaat gctggctaca    153720
     tcgtctgaac gtggggcgag tgcttgattt aaaattcgtt ttaaacgact gcctttagtg    153780
     cctatgcctt ggtaataaaa acttaactgt ttggaaaatg gggtggtggg agaatcatca    153840
     agtttaccac cgagcaataa gtgtagtttt aaaatattag aaatactggc gtcttcttta    153900
     aaatgctctg tactaaactg atctgcgtct cggggttcac tgccggtacc atcaaaatta    153960
     aaaataagcg ttttatccga catagcctgt ttccttaaaa tttttgtgta ctttatatag    154020
     ctaatattaa aaattaaaga cagtggtaat ttaaattacc actgtcttta attttggcta    154080
     gtgcagcttc attttaggac gcacaacacg cagcactttt tcgctgatcc acaaagcaaa    154140
     ggttttggca ctgccatgaa tagcgcgctg atgcattcta tataatgaaa tatacataaa    154200
     gcgggcaatt ttaccttcaa taaaaaagct attactggtt aggttaccca ttaagctgcc    154260
     tactgtgctg tagcgcgata aattaaccag tgagccatgg tcgttatact cgaatttttt    154320
     aaggggctgc tcacgtaatg tggcgattaa gtttttttca acgcattgtg ccatttgatg    154380
     tgccgattgt gcgcgtggcg gcacttgcgt accatcatct tgcgtaaacg cgcagcaatc    154440
     accgagcaca tatatttgtg ggtcaaggtt gctttgtaag tactcgttta cttttatttg    154500
     gttattacga gtcagctcaa aaatacccag ctctttaata aagtcaggtg cttttacgcc    154560
     cgccgcccac accataatat ccgcatttat ttgctcatca tcattggtga taaagccatg    154620
     ttcggttgct tgtttaactt gggtattttc ccgaacggtg acgcctaatc ttaataactc    154680
     acgcttggcc gaactggcaa ttcgctcaga cagcgccgga agaatcctgg ggcccgcttc    154740
     aatcagatga atatgtaaac gcttagccga catattggtt aaaccgtata tttttagtaa    154800
     atcagaaaca tgatacagct cagccgagag ctcaacccca gttgctccac cgccaacaat    154860
     ggcgatattt aatgagtgta atgggtcatc gtcttgatga aggcgagtaa agttatccag    154920
     cagcgcgtgt tgaaagcgct ctgcttgttg atttgaatct aggtaaaaac aatgctcttt    154980
     aatgcctggc gtattaaagt cgttactcac actgccaata gcaataacta aatgatcata    155040
     gtgaacggtg cgtttaggta aaatttgatg ccctaactcg tcatatagag ggcttaaggt    155100
     gatggtttta ttgttgttat cgaggttgca aaaggtacca agttgaaagt tatagtgatg    155160
     tttggcagca tgcgcggagt aaacaacccc atctaaatcg gcatcaatag agccagttgc    155220
     aacctcgtgc aataacggtt tccatatatg agtgcgattt ttatcgatga gtaatatatt    155280
     tgcgtgttgt ttctttccta gtttgtgccc taattgagtt gctagctcca gcccaccagc    155340
     gccaccgccg atgatgacga tttttggtat ggttatatcc atgactatgc ccttaaaaag    155400
     aatataccga agcaatttct gtacgttgat ttttaaaatg acttgggtat caaaaaatta    155460
     ttttggcaaa gcacgttttt atggggctat agtgtgcgcc taattaaagg atatgtcagc    155520
     aataaatcac gtcatttgat gtatactgat atgcaaatat ttcatctact gcgcatttac    155580
     agcatttatg ggcaccgaca taaaaaggac gcttttatga gtacctcgct agttcagtct    155640
     cttgagcaac attttggttt taatcagttt agaacagggc aacaacaaac catagagcag    155700
     ctgctaaatg gccaatcatc attggcaata tttcctacag gatcgggtaa gtcgttgtgc    155760
     tatcaactca ccgcgttaca tttaccgcat ttaacgctgg tggtatcgcc gttattggcc    155820
     ttgatgaaag atcaaattag ctttttaaat agcaaaggca tctatgccgc cagcctcgac    155880
     tcaagccaag accaaatgca aagtagcact gtaatgaacg acgtacgaag tggtaaagtt    155940
     aaagtgttaa tggtgtcggt tgagcgcttt aaaaacgaac gctttaggga gtttataagc    156000
     caagtggcgc tttctatgtt ggttgttgac gaagcgcatt gtatatctga atgggggcat    156060
     aactttagac ccgattactt aaaactacct cgttaccgtg aagagctaaa tattccgtta    156120
     gtgctactat taaccgctac cgccactaaa aaagtaaaac gcgatatggc cgagcgcttt    156180
     gctattgagc cacaatgtat tgtgcaaacg gggttttatc gcgctaattt agatttaaat    156240
     gtgctgagtg ttaaaacggc ggataaaaac aatgagctta ctaaaattgt ccgtgcgcaa    156300
     accggccccg gtattgtgta tgtcacgctg cagcaaagtg ctgagcaagt ggccaatatg    156360
     ttaagcgcgc agggcctgca cgcggtggcg tatcatgcag ggcttgaaga caccctacgc    156420
     gggcaaattc aagacgattt tatggcaggc aaaataaatg tagtggttgc taccattgcc    156480
     tttggtatgg gggttgataa atcagacata cgctttgtaa ttcactacga tttacctaaa    156540
     tcaatagaaa actacagcca agaaattggc cgcgcagggc gtgacggcaa cccatcaaat    156600
     tgttataccc tggctaattt agatggctta aatacagtag aaaactttat ttacggcgat    156660
     actccagagc tcagcggtat tgaatatgtt attaacgata ttcgccaagc tcaacagcaa    156720
     tgggaaatgc aagaatatag cctttcaagc gagagtaata ttcgccaact tgcccttaaa    156780
     accttgctgg tacagcttga aatgcaaggc gcaataaccc cgcagtatgc ttattatgcc    156840
     gattttaagt ataaattttt ggttgataaa aatgagttac ttagccagtt tgatgagcag    156900
     cgccaagctt ttttaaaaca aatatttagt cataccgact ttaaaaaaat atggggcaca    156960
     cttaattttg actccctaac gcaagccgcg caggttgacc gtaaacgtgt ggtagccgcg    157020
     cttgactatt tggctgaaaa aaaccttatc acccttgaaa ccaaacgtat tactcacgtg    157080
     tacaaagtgc atagcgaggt gattaataat cctgcacttg cccagcagtt acacgattat    157140
     tttactgata aagagcaagc ggaaataaaa cggattgctg ctttagtacg cttttttgag    157200
     ctgcaatctt gcttaagcta taacttagcc cgttactttg atgatgcgaa tgcgccacag    157260
     cagtgtggac attgctcggt gtgtcgtggg cattcagtta agcttgaata ttcaattccc    157320
     cctgcaacga ttgatacagc gcttatttat caaaaggtcg atgagttttt agcgcacatg    157380
     gcaactaaag gtgtacacaa tgtaggtatt gaaacccaat gccggttttt agcgggaatg    157440
     agcgtgccac tgtttgcgcg taataaagta cgtcaactaa gtggttttgc actgtgcgag    157500
     caacagcgct acagcgaaat taaagggaca ttgctatcaa ggtcgatggc taaataatat    157560
     tagaaatcag tataaaaata aaagagtgtt aattttttgt ttctttttct tgctttacta    157620
     tactcaattt ggctatgaca gccattataa taatgaggtg atcaatgaaa ctgcaaaaaa    157680
     ttatactatt gggagcattt atatcagcaa gtagttatgc tgaaattaat atttcgggtt    157740
     ttgcaagtat taatgcaggt aaggtactga gcggtacagg tgtcccgcaa tatggcgttg    157800
     aaccaacatt tcttgcggac tatccaaatg ttagtgcata cactgaagat ttatcctttt    157860
     cgccagagtc tttgattgga ttacaggtat caggcgattt gggtgaaggt ctttctgtaa    157920
     caggtcagct agttgccaga ggagtcaacg actttgaggc aaactttgaa tgggcttata    157980
     tttcttacga tattaatgat aattggacta ttcaagcagg taaaaagcgt ttaccactat    158040
     tttactactc agactttttc gatgtaggtt atgcatatgt atggatgcga gcccctgcag    158100
     ataactatac atggcaagta tttaactacg agggcgttaa tttactctac tcaggttcta    158160
     taggtgactg gggagtgtct gcgaatattt ataccggtaa agaggacgat gacgataaca    158220
     agctattatc agacttcttc tttcaagagc caacaagaga aatttgggaa gatatgttag    158280
     gcggcgtact gttactaaat cgtgactggc tcgaactaag agtgacccac atgcaataca    158340
     ccaataagcg ttttcgtgcg ggtgaaccgg ttttgtggga cggcaaagat agcagagatg    158400
     gtaaatttta tggtttagct gcaaatcttg attttggtga ttttttcgtt ttaagtgagc    158460
     ttaaccgctt agacttagat ggtaatctcg acacttatat gatcagtgcg ggctatcgtt    158520
     ttgactctat tacaccttat gtcatgtttt cagacttcga acaagaaggt gaaggtgata    158580
     cagaacagca taatacattt gctgttggtg tgaggtggga ctttcatccg tcagctgcat    158640
     ttaaagtgca atacgataga gtcaaagatg actcgtttga tttagctgtg gccggtgata    158700
     gtaaagctat cacgcttggt gtcgatgttg tattttaagg agaggtaaaa tgaaaaaatt    158760
     aatattaagt gtaatattcc tgtttacgaa cttcgcctat gcagattttg ctattatcgt    158820
     gcatccttca aatgaaagta gctttgatga gtctgttatc agccgaattt atacaggaaa    158880
     agaaaagtca tttagcaatg gcaataagat cattccaata tctcaagaac caagtagtgc    158940
     tgcaaccgag caatttaata gtaaattact taataaaacg tcttctcagt taaaagcata    159000
     ttggtcaaaa ctaattttta caggaaaggg cacaccacct aaagagttag aaaatgacag    159060
     tgaagtaatc aaaatggtcg cagctaaccc tgacaccatt ggctttgtct cttcatcagc    159120
     tgtatcggat aacgttaaag tggttttcaa tttttaatct taaataagcg tgctggttaa    159180
     tcagcacgct tttttagtga ttagttaatt acaatataac gatgtttaat atctgacgtt    159240
     attttactgt cacccttgcc tcgctcgtgt atcctatagc ttgtatatca tttatcaaaa    159300
     gtctgtatgc caaactcaat cattgctgtt gaaaatatca atacccaacc agtcacttgc    159360
     gctaactgcc aagcgtgttg ctgccaatta gaagtgcgta ttgtcactga taccggtgtt    159420
     ccttttcgat atattgatta cgacaaatgg ggcagtgagg tcatgaagcg cggcgacgat    159480
     ggctggtgcg aagcacttga tagaaatacc ctcatgtgta ctatttacga aaatcgccca    159540
     ttaacgtgtc gagaatttga aatggcatcg ggtgagtgta ttactgagcg ggagctagcg    159600
     ggtatttaaa acgcgggctg attaacccgc gtgaatgttt gttagccaat agagagttgc    159660
     gcgcttgggt atcttagctt tttagtgcgt ggacttgcta aaaaataggc gatagtgagc    159720
     ggacctattc tgcccatgaa cattaaaaac ataataataa actctcccag tggtgatagc    159780
     gaggatgtta aaccacgtga aagccctacc gtccccagtg cagataccgc ttcaaaagca    159840
     acatctaaaa aaggcgcatc ttcgacgact agtaaggtaa aaatagctaa ccaagtgact    159900
     cctgctgaaa taatggttaa agctaatgct ttatacacag attctttgtc tatttctcgg    159960
     cgtaacacag tgacgccttt gtcacgtctt aggtagctat aggttgctaa aattaaaacg    160020
     ataaacgtaa cgactttaat gccacttgcg gtacttaaag agccgccacc aataaacata    160080
     agcatcatag ttaaagcggt gctggcattt tttaattctt caatagcaat ggtattgaat    160140
     cccgcagtac ggggtgtgac agcttgaaac caagcagcta accatttacc tacttcagac    160200
     agtggttgca gtgtttttgg attatcgtat tcaatcgcgt aaataagcaa taatgcaata    160260
     acgttaataa taactgtgct gatcaacatt aatttactgt agggactgag ctttgcccaa    160320
     cgctttgatt tatataaatc cattaatacg gtaaagccaa gcccaccaat aataaacaaa    160380
     ccggtaatag ttaaattcac aacggggtct tcaacatact gcattaagct gttaggactc    160440
     aatgcaaacc ctgcattgtt gaaagcgcta atggtataaa aaagagcatg aaaaaagctt    160500
     ttctgtaaac ccatttcagg tagccaatac agcgttaaaa taacaacgcc tatagattct    160560
     acgattagtg caaacagtaa aacagactta gcggtattga ccaacgtaga tgtatctgtt    160620
     tgattaaaag cagctttggt gactgttttt tgaataaagc caactttatt acccagtgcc    160680
     attaaagtta caaccgcaaa ggtcattaac cccagaccac ccagttgaat taataacgca    160740
     ataacgcctt gtccaaaagg ggtaaacact gaaccggtat ccactacaac cagtccagtt    160800
     acagtcaccg cagaggttgc cgtaaacgca ctttgtatcc atgaaatagg ctcataggtt    160860
     gcgaaaggca gttttaatgc taatgctcct agcgttatta atattaaaaa actgcaacat    160920
     aaaataagag gcggagccgc attgattttt ttatgcccac tgactttgcg ctcaataggc    160980
     gttttgagag ggtgccataa aaccatgatt ataagagcct tggagctaga tagtttaatt    161040
     cgactcggct acctgatagc agtaaggtgt cgtgggtatg taactcaaag tcgtcatcaa    161100
     gtttgacaaa cgtttgcttg gcgcgcttta ccaatagagg gtctacagtg ccttttattt    161160
     ctctgagtag atgccctagt tttgttttat gtaggtgagc ttttatactt acttcaacaa    161220
     cgtataagcc attgcctaat gaaatatagt cgttcactat cgggtaatta agcgcttgtg    161280
     caacgcgcac ccccatttct tcctcagggt gaataatgcg tgttacacct aatttagaga    161340
     taatagtgtg atgggcttta gtactcgctt ttacccatat ttgctcaaca gctaagtttt    161400
     ttaatgcaag cgtgcacaga atgctcgatt gcatatcttc cccaatcgcc actaaaacag    161460
     cctgactact cgctaaatca agctctttaa gtgcggcttc atcggtggag tcgcaaacga    161520
     tggtttcaga taaatgctca acatactttt cggcgagttt tgggttacta tctacgccag    161580
     tcactgtgtg tcctaaatga attaactcaa gacttgctgc aatgccgaag cgacctaaac    161640
     caatcactgt aaaatgtgcc atattattcc tcgttatttt ttccaaaagc tatgagtaaa    161700
     aagtgcaaaa acagtaaaat attctaaccg gcccacgatc atagcgaccg agagtatcca    161760
     aataccggta tctgaaacgg gttgaaagtt agcgccaact tcaccaaacc cagggccaag    161820
     tacattgacg caagcagcta ccgcagtaaa tgcactccaa aaatcaagac ccgttgccat    161880
     aagtaacatt gtaaacagta agcttgtacc aacagcaaag gtcataaatg ccataattgc    161940
     atggcgtaca tcttctttaa cgggcgaacc ttgatattta agtgtaaata tcgctcttgg    162000
     atgaagtagc tgtttaatat tgttattaat cattctgcca acaataatgt tacgaattat    162060
     tttatttccg ccagcggttg aacctgcgca accaccaaga tagccagcaa ttaccagtaa    162120
     aaacccagcc tcagctggcc agtcagtaaa gcctgctgcg ccataaccgg tgctggtaat    162180
     aaaagaaata atatggaatg tggagaaact aaatgcttca agtacatttg agtagctgtc    162240
     tttaagcagc aacatagtgg ttaaaagaac tgataaaaac acgacgatat aaataaaata    162300
     acgtgtttct tcatcgtgat aataactagt aatggctctt ttgtgcgcca ctttgaagtg    162360
     caaggcaaag ttaatcgcac ctgcaagcat aaagacatta gctatccaca gcagtaaatg    162420
     gctgcggtaa taccacatac tggcatcatg cgttgaaaac cccccagttg aaactgtggt    162480
     aaaggcatgt gcaatcgcat cgtataaact cattccacca gcataatagg ctaaaataca    162540
     aagtaccgtg attgcaaaat aaacacccca taaataatgc gcggtactgg caacgcgcgg    162600
     agttaatttt tcgtctttaa tggggcctgg ggtttctgct tttaataatt tcatgccacc    162660
     aatattcagc ataggtaaaa tagccactac aaaaattact atgcctaaac cgcccatcca    162720
     ttgtaaaaat tgtcgataca ataaaaagct agcaggcatg ttatcgagcc ctgatagcac    162780
     ggttgcacca gtagtagtta aggcgctaat tgactcaaat actgcatcgc taaagttaac    162840
     gccagtgata accaaaatgg gaatagcgcc taacacaccg gctataatcc acgttactgt    162900
     ggcgtaaatg agtgcatctc tgaatgttgc gccggtataa tctgttttac gtaaattgat    162960
     aagtagcact aaagcgactg agatcatcgt tgcgccagaa ataagaaacg cactaataac    163020
     gcgatcttta aaaataaata atgaaagcgc tgcgaatgct agttgcacca ctcccatcca    163080
     aataatagga aaggcgagta gtcttaaggt gattttccaa tttatcatca atacgcctta    163140
     tcaaatacct attgcaggta acacgcaatc actaaagttg agttgaatat acgggatcaa    163200
     atactaaagt cagcgctgca ctgcaaagct ttataaagat ttaacgaacg agataaaaaa    163260
     ctttataaaa actttataga ggcaatatcg aaaaggcagt aacctaagtg ctcaaatgtt    163320
     agaggaataa ttaatgaatc aggtcgaggc caaaccaagg tggtataaag catttttttt    163380
     ggcgttaata atgccattaa ttgtggttat ggccattttc cctgtacgta actggtttac    163440
     tactaccgat attgtaatgc ttcagttatt gtgggtgact tgggttgctg tacgtagtaa    163500
     ccgtcgcctt gcgatactga ccaccttagt aagtgtcgca tgtacagatt ggttttttgt    163560
     tgcccctaat tttacttttc atattgaaaa catagaatat ttagtaactt ttattgttat    163620
     gctaattgtt ggttttgtga tcagtcaatt ggcgggggag ctcagtacta aagtcagaga    163680
     tgtgcaatta cacgcaagta atagccgcac cttgtatgaa ctggccaaag acctaaatag    163740
     cctagatacg ctggacgaac aaaaaaagta ctttgtacag cggatcggta agcatttaaa    163800
     tgcatcttgc acatttatgc ctgcagcacc gcgaggcaac agtgaattta tattacttag    163860
     tgaggctaac ccgagcaggg gcgggtttaa ttttactaaa cggttaacgc aagggcaaaa    163920
     agcttttgct gataccgcta tctcgctgct ttatcaagta catgaaaaaa cgttattacg    163980
     ccagcagtcg gctgctattt cggtgcaagc ggaattagaa cgcgctaaaa atgcactttt    164040
     acgtagtttg tcacatgatt tacgcacacc attggcaact attatgggcg catccagcat    164100
     gcttgcagat gatgaaatta ccctcagcga cagcgtgata aaagagcaag cgagtaatat    164160
     ttatgagcaa agtaaaatac ttaatcaaca ctttgataaa gtcatggagt taagccgagt    164220
     taataaaatg ggtgaaaatc tatgttggca aacaataaac ttacaagcat tactcagtga    164280
     agccaaagct cgcagacagc agcaactcac ccattttgtt atagatacca atatagacgc    164340
     tcagtcaaaa tgcatagggg atgtgacttt attagaaatt gcgctagcta atatgctcga    164400
     aaatgcatgg cgttatggtg atgggaaggt gagcgttgaa tttactcaaa gtagcaatca    164460
     gcaaaaggta tgttatcagt tacttctcac taataacgtg atcactaaag cgcaaacaag    164520
     tagcgatgaa ggcgttgggc tgggcagtat tatttgtgat gtggtggcta aatttcacca    164580
     aggtacattt acattaacaa ttaacaacga gacacagatg gcgtacgcaa aattgatctg    164640
     ggaaaaagac aatgactaaa atcttaatat tggaagactc tcccccttta caaagctttt    164700
     taaaaacctt gttgcaagcc agtggttacg agctaagtat ttgtgataaa ggcttagatg    164760
     gttttgcacg tttaagtgag caaagttatg atcttgtgtt attagactta ggcttgttag    164820
     atatggacgg tcaagactgg ctgattgagt ttcgacaatg gagtgcctta cctgttttgg    164880
     tgctgtcagc gcgagatggc gaagttgaaa aggtaaccgc gcttgataat ggagcaaatg    164940
     actatattac caaaccgttt agcgcgaatg agttactcgc cagaattcgg gtgttattgc    165000
     gcacccaaag tcagccgagt gtggcgttta cctgtgggaa tataaaaata gatccacaaa    165060
     agcacatagt aaccacctcg gggaatgaga taaaactgac taaaaaagag tacgcaatat    165120
     tattattgct gtttcaaaat aaagataaag tactcactca taatgcaatt ttaagccata    165180
     tttggggagc gcagtacata gaccgtcctg aatatgtgcg ggtacatgta gcgcagctca    165240
     gacaaaaact agaagctaac cctgctagtc caaaatacat attaactgaa cccgctgtgg    165300
     gttatcggtt ggtcgattaa acaataagaa ctttacagtc tgctctacaa ctcagcgagt    165360
     ctgataaatt atataaataa cgcttttgtt tccaagcgat actctattta acaaccttgt    165420
     ccgttatata gcgggtattt taataccccg cttttgcatt aatttctaca caattgattt    165480
     gcctagaaag tttttatagt ctaattttta agcttaatac ttcagatcct caggatgttg    165540
     gcttgcttgt ttaagcctaa aattatgcga ctaccactca tacactcttt gcaaggaaag    165600
     atgctgctgt atttggcatt gcccgtcatg ctcattattg ccagtatctt gagttattgg    165660
     tattcaacta gccttaatca ggctgttata caagcaaaac taaatttaag ccagacggca    165720
     gatacgattg ccgcgaaggt aaatgaagaa acgcaattag cggtacgcac tacagagatt    165780
     atggccttag cacagcaaaa tgggttgttt ggtgatagag aggcaagtat taattttgtt    165840
     cgtgcagtgc ttaaaatgac cccttcattt gtgggggctt cgtttggtta tgagcctaat    165900
     gccgataatc aagatcaagc ctatattaat gctccaccgt taaaagaggg cgtttatgta    165960
     gaccaaactg gccgtttttt accttattgg catcgtgatt ttaatgactc tgaacgtttg    166020
     ttacttgagc ccttggtcga tatggaatca agtctttatt atgagggagt acgtcaacag    166080
     tttttacgtg atggtaatac cgagacgatg atcactgagc cctatgttta cgagggaaga    166140
     atgctggttg aacaaagttc gccaattatt attaatggcg aatttgtcgg tatggcaagt    166200
     gtagatagag cacttgctga tataacggaa ttcttacaaa ccataaagca gcaactaaaa    166260
     attgatgttt tgttactcag ccaacgtgac aacgtgattg ccacgacatt aaatcattca    166320
     ggactaaaaa cgaaagccat tttagacaca gattatgcaa gtatagccaa acagctaaaa    166380
     tcacaggggc aagcaagaga aatattatct gctaacgatc cttttgattc tggaatattc    166440
     tattttgata aagccaaggt tgccactggg cattggacag tgatagtgcg tcgctctgaa    166500
     accgatatta ttgggcctat tcaagcgcaa tttagcccat tattggcagc ggcttttgca    166560
     agtgtattac tggtgttttt actcttttgg tattttatta accgaacaac caagcgtatt    166620
     aatattgcga ttaaatctgt tgaacagcta gctaatggag atttatctat tcatgttcaa    166680
     aagtatatga ctcaaaagga tgagcttggc accatgttta gaagctttga gcgtttaatt    166740
     aaagccagta aagatattga tcaggtttgc tctgcgattg cagctgggga tttttctcaa    166800
     acagtttcta agcgcagccc ttatgacagt ttaagtgatt ctattaattt aatgtcgagt    166860
     aaacgccatg aggcagagca ggctctactt gagcaaacca tagagcttcg tcgcactcag    166920
     caggaacttg ttgaagcaga gaaaatgtct tcacttggaa gtttagtcag tggtgtggca    166980
     catgaggtga atacaccgtt aggtgtttgt gtgacagcga catctcattt gcgagaaatg    167040
     ttaatcgaaa ctaaaaacaa agtggcttct ggcaccttaa gtaaaacgca gtttagtgag    167100
     tttattagtg aagttgattt aagctgtgac attttgctaa aaaacatgca acgtgccgct    167160
     gatttaataa gcagttttaa acgtgtagcg gttgatcaaa caaccgaaga attacgtaat    167220
     ttgtatgtaa gtagttattt taatgaggtg ctaaaaagcc tctatcatac ccttaaagca    167280
     acaccggttg atattaccat tagtgcaacg gagcctgagc cagaagtgta ttctgatccc    167340
     ggtgccttag cgcaaatttt cactaattta gtaatgaatt caattattca cggttttcaa    167400
     aatggtagca aaaaagggca gataagtgtt catattgagt actcagactc tgtctgtatt    167460
     cattatcaag acagtggtca aggcatgaca gatgaagttc agaaaaaagt gtttgacccg    167520
     ttttacacca caaatagagc gggtggcggc agtggcttgg ggatgaatat tgtttataac    167580
     ctcgtagttc accgcctgaa agggcaaatt gcagtaaagc aaaaagaatc cacaggcgtt    167640
     tattttttca ttcaatttcc ggtaacgcca ccgaattaat taatagcagg gtgtgtttat    167700
     ggagtggtta caagatgatg tagtgtcaga taaagcggtt gccaacagca atgctaagcc    167760
     atggaaaatc ttaattgttg atgacgatga ctcggtgcat caggtaactc aacttgcaat    167820
     gaagcgcttt gaatttgagc aacgccctgt tgaactacac agtgtttaca gtgcatctga    167880
     ggcgaaagag aaactacaaa gctcagaacg ttacgcatta attttactag atgtcgtaat    167940
     ggaaacagaa catgcaggat tagatcttgc gcgatttatt cgccaagact tacaaaatgg    168000
     ttatagtcga attattttgc gaacaggtca gcctggggtt gcgcctgagc gcagtgttat    168060
     tcgcgattat gatattgatg gctataaagc gaagagccaa ctgcaaagcc aagatcttga    168120
     attgattttt tatacctctt tacgagccta ccgcgatatt tgtatgctac aaactcaccg    168180
     ctataattta aaaagactaa taaaagctat ctctaccatt actcaaattg gtgacttggt    168240
     agagtttacc tctgttgtca tggaagagtt aaaacttgta ctgaatatga gctcggccaa    168300
     tttatatatt gatgcgccta aagtatttgg tatttgtcag ttagatgaaa agttgcaaat    168360
     gattgaaggg gaggtctcag gtatacatct gttcacggga agtggtattg atagtattcc    168420
     gaaaaagcat caagagtact ttttaagggc gaaacaaacc aagcagaatt ttattgcaga    168480
     agatcattat gtttattttc atcattcaca aaaaggtcta gattcaatac tcgcatttca    168540
     atcattgcaa ccggttaaaa aagaagcgca acagcttgtt gacttgtttt tgggcaatgt    168600
     tgttctcaca tttgaaagtt tattattagc taactcaatt gaagaaaccc agcagctggc    168660
     tatttcacta atgggaggtg ccatggagtc gcgctccaag gaaacgggat ctcacgtaat    168720
     tagggttggc ttatatgcaa aattactcgc gcagctgcat aatcaaaatc aagcgtactg    168780
     cgataaaatt agtctagctg cgcagttaca tgatgtagga aaggtaggtg taccagatct    168840
     cattttaaac aagccggcaa aattagatgc tgacgagtgg gaaattatga aacagcatac    168900
     cactaagggc tgggaaattc tcaaagggac aactaatcct gttattaata tggctgcaaa    168960
     cattgcgatt gatcatcacg agcgttggga tggagccggt tatccgcacg caaaaaaaca    169020
     gcaagaaatc agtttagagg gacgaattac tgcgattgct gatgtgtttg atgcgttatg    169080
     ttgtcgccgt tgttataaag agccttggag tatggatgac gcaaaagcgg aaataattaa    169140
     aggtgcaggt aatcattttg atccaaactt agttgcactt tttgaagcac attttaatga    169200
     ttttaaacaa atctacctgg ataggcctga gtagaaaagc gggtatcgct ttgactgtga    169260
     aaccacaatc aaagcgaaag gtaagttagt cgtacttggc ttctaactcg ttagcggtat    169320
     gaaatttttc atgagattgt aattgctcat cgtatttaac caggttttta aagtgctcta    169380
     actggcctgc atttttaacg atttcaacaa taaacgacat cataaaatcg gcaccggtta    169440
     gggtctcgcc cactaaataa tgcttgcctt caagacgact gttaaaatag ctaatcactt    169500
     tagcggtttc tgcatcagca tagccctcta aaaactgggt tttagcacca tctttttgca    169560
     caaacatttt gagtaaaagc ggtaaaattg ctgagctttc tgcaaaatgt agccattgct    169620
     ggtagtcaac gtaatcaggg gtgcctgctt ttggggcaaa tttacctttg ccatatttag    169680
     tgatcaggta atctgtgata gcgccagact cggcaatcac taagccatca tcttctataa    169740
     ctggcgattt acccagcgga tgcacatttt taagctcatc aggggctaaa aaagtctcag    169800
     tgttacgttg gtaagcaaca atttcgtaat cgacctcaag ctcttctagt aaccaaataa    169860
     tacgtttaga gcgagattta tttaaatggt gtagtttaat cattttcttc cttattgagc    169920
     tgtgttgaat tacaacacag cctgaatgtt attatagtgg gctgttaatc tttactacgg    169980
     ttttaccaaa gttcttccca ctgatcatgt cgttaaatgc actgatggtg ttttcaatgc    170040
     cttctaccag atgttcgcgg tattgaattt ttccgtcttg tagccatttt tgcatgtctt    170100
     gtgcaaattc gtcatagcgg tggccataat catcaaaaat aataaagcct tgcattttga    170160
     tgcgcttagt tagtaattgt cccattaaca tgcccattcg gtctgggccc tcaggcaaac    170220
     tggtcgcatt atattgcgat accaaaccac agataggcac gcgcgctgag gtattaagca    170280
     aaggtaatac ggcgtcaaac acttttccgc ccacattttc ataataaaca tcaatgcctt    170340
     ggtcacatgc tttttctaat tgttcggcaa agtcatcggc tttgtgatca atacaggcat    170400
     caaagcctag cttttcaacg gcatgagcac atttttcgct gccaccggca actccaacca    170460
     ctttacagcc tttaatttta gcaatttggc caaccgttgc accaacaggt cccgttgctg    170520
     ctgcaacgac cacggtttca cctgctttag gggcgccaat atcgagtaaa cccatgtagg    170580
     cggtaaagcc aggcataccc ataataccca atgcgtatga agggtttgtt ggttctttac    170640
     ctaatgacat taagccttcg ccatttgaga tggcgtaagt ttgccaacct gtgtacgcta    170700
     atacccattc gccttcgcta aatttatcgt ttttagatgt ttctacttgg cacaccgttg    170760
     caccaaccat tacatcacca atttcgacag ggtcggcata cgatttagca tcgctcatac    170820
     ggccacgcat gtaggggtct aatgataagt aaattgtacg caacagtact tcgccctctt    170880
     ttaacgatgg aagctctttg cttttaaatt caaagttgtc attggtaggg gcgccatgtg    170940
     ggcgcgaggc taaagtaaat tgacggctag ttgtagacat aaaaatctcc aaaataaagt    171000
     gaaaaaacca cctattaccg aatgtttaag ctttaaaaca atacacggct caacaataat    171060
     gcgcggatag gcagataaaa tttgtacctt gatacacgag ctttgggcga gagggggtta    171120
     attcaacctt tgcaaacatt taattagaat aattactctg tttttagcat gctaaatata    171180
     tggctatcaa aatagtgacc atttttataa attgcttgtt ttaaaatagc ctcggtatta    171240
     aagccacttt taagcagcgc ctttattgag cccgcattac cagcaaatac agccgcataa    171300
     atacggttta aattagtact tttaaacact tctttagggt ctgttgacct ttgcggatta    171360
     caatttgttc aaactagggg gggtttaatc gcggcgcgag gtttgtaacc tagtgggcta    171420
     agtcaaaacc gagcaacaaa gagtaaatag cccctaggca gaacccgaag ggcagcgcct    171480
     gtttagcatt aatactgcgt tatcgcctat ttatttggaa taaccacacc tcataggctc    171540
     tgccttgcct aaataccaaa cagactgttg caaatttaac cttgaaaggt caacagaccc    171600
     taataatcaa cccaatggct tgggtgataa taccttgccc ccaatattgc tgactaagcc    171660
     aatagccaat ttcgccactg cggctatact caaattcacc aggaataaca ccaatacaac    171720
     caacacacag gccatcaact tcgatggctt taatgatgcc acattttgct ccctcgttta    171780
     tccaccaatt cgcatctgcc tgcgtatacg gaaatggaat tttagaggac aaatagcgag    171840
     ctacttgttg attgttcaaa atggttacga tttgaaaggt atcgtgttgc ttgaactcac    171900
     gtaaaatcat catatggtaa ataagtttat tattatcaac caataaccta gcaagcttta    171960
     ggcgtttaaa caatgaaact atctttttaa aattaaagtg tatacagcta taactttgct    172020
     ttaaactctt ttaaaatata ataaaaagta cctacacaga gtcactatgc acccacacat    172080
     tgccgccctt tataatagcg ctaaaaagcc tagtcgttta attattggcc taatgagtgg    172140
     cacctcttta gatggtttag atgtggcgct atgtaaaata accggagcgg gtttgcatac    172200
     ccaaatagag gtattaaaat tcaccacggt tgagtacaac gatgagtata aaactaaaat    172260
     aaaacaggtg tttgctaagc gcgaatgcga tttagaagtg ctgactttgt tacatccgtg    172320
     ggtaggtaaa ctccatggtg ctatggttaa tcagtgttta gcactgtggc aagtaaatcc    172380
     agccgatatt gatgtaatag ccagtcacgg gcaaactatt tatcactgcc cgcaatccca    172440
     acataaccac cacgatttta aaaatggcac gctacaaatt ggcgacagcg atcaaatagc    172500
     ggttactaca ggcattacca cgataggtga ctttaggcaa aagcatattg ctgctggtgg    172560
     tgaaggcgca ccattagctg tgtatggaga ttatttgttt tttgccagcc caaatgaaaa    172620
     tcgtatttta ctcaacatgg ggggcattgc taatttaaca tttttaccta aaaacggcga    172680
     tactggagcg gtctttagct ctgacattgg ccctggcaat actattatgg atgcttatgt    172740
     acagcattat tttaaagggc tccattatga tgagggagct aaacttgcca aagctggtaa    172800
     agtgaataca aagcttcttg ctgcgcttac cgataacgcg ttttttaaat taccactgcc    172860
     taaaacaacc ggacctgagg tgtttaattt agcttattta cgggcggcac aaatgcattc    172920
     aacgacacaa agactaaacc acgaagatgt tttagcgact ttaaatgccc tttctgccac    172980
     tacgattgcc aaggcgttaa atgactgtgc tcaacatact caagactgtg tagtatatgc    173040
     cagtggtgga ggtattcata atccattatt aatggagcaa ttactgatgc actgcccaaa    173100
     cattaaggcg tttaaaaaca ccgagaattt aggcgtaaat cctgatgcca aagaggccgt    173160
     gctgtttgct attttggcaa atgaatgttt ggcagggcaa cgtcaaggct taaataataa    173220
     caaccaaggg attttagata tcactatggg taaagtgagc tttgctgatt gagtaataaa    173280
     aaaccagtgg aaaagtgtgc gccaataact aaaaaagcga aagtaaagct gttcccatat    173340
     tagcgaaata ctgacgtact cgatgcggcc taggcggcgc tatataagtt gcaggtgcag    173400
     tataaccact accaaattgg ttaatatgca tatcaaactg caaactattt tttaacgtgc    173460
     cgtgcttacc atgcaaaatc atttgcatca caaaatcatg actatgtgct atttgactca    173520
     aagttaggtt gactcgccct tgttctagat cagataggtt gagtgttttt tctgtgtagt    173580
     attgagccgc tcgtgcattt ggctcagttg cgctgagtga aataatatca ctttcatgag    173640
     cagcctcagg taaaacgcat tgcagtgtga tttgatgctg actgttagca tcctgcgata    173700
     gcgtttcaaa ttccatgctg tgactcattg ccgcagacat aggatcttca aatgacggaa    173760
     gtgcaaaggt aagttgcact atagattcgc tcatgagggg cttcaaatgc tatttttgat    173820
     taataatgca gctattatta ccgatcatta ttgcaaaatt atgactaaac aaaacgactt    173880
     catacatgag ctggtttaaa ttacatttta caactaaagc tattgtttta aatcaatatt    173940
     atatttaata aataaactac aatggtcgct taataatatc gtttattaaa tgcaaggaca    174000
     caacgaggcc ttagcttagc aataacaata atgcttttat cgagcttgct ggttgttaat    174060
     taatgttgcc tttattgtta attaaaggtg tttatttgtg tgtgttttct taattttgca    174120
     ataaaatagc ttgaaaaaaa accaagctag ccataaagtg cttttaagag cccaaataca    174180
     taacacacta ccaaacaggt tgtggcgggg ttgtgagaat tagatggcac taataaaaaa    174240
     taatttatgg aaactcttct gttttttgct gttgggtggc ttaattttat taagcgtgct    174300
     tttggtttac gagtggaaaa acatcaaaaa agattaccgc acgagctccc aaaatcgtgt    174360
     ggaattttct gcgcaagcac ttaaaagcac ccttagaaat aaagagctga tgctagattt    174420
     aattggtaga gatattctct ctaataataa tttacatgaa aaaacgtcga caattaaact    174480
     tcttgataat attttgctag aaaatcccgt gttattaggc tttggactgt ttaatccgca    174540
     aggcgagatt atttattaca gctcaaactt aaacgcttca accatgatca acctgaaaga    174600
     aaataaaaat acacgccaaa gctttgcgca aaccctcgta tcagacaaaa tggtattagg    174660
     acagacttac tttaatgaat ctttacaaga gtgggtcatc ccaataagaa aagcattacg    174720
     cgataagagc ggcacagtaa tcgcggttat gacggcaggt atggcggtgt cgagagggac    174780
     taagtactta aatattttgc aaagtaatcg tgatgattac atcatgctag caagagaaat    174840
     agatggcttt attcaataca gctcggttag agatgcagat atagcaagtt atataaaaac    174900
     ccagactaaa gaggcattgg ggttatcggg taatgctttg atagagcaaa caggtaaaac    174960
     aaagcaaaca cttaaatctt ccgaggaagt gtttagcata gaaacgacgg taaaaggcaa    175020
     accgtatatc acctcagcaa aatttgataa ccgttatcag ttgtggactc tgtcacaaat    175080
     ggcgatgcaa ccaataaaaa atctgtatta ttggaaagtt ggcttgtatg tcctagttta    175140
     tgtgtttatt tgtatggtgc tattttttgg ttttaggctt attgcacgtg ctgaaaaaaa    175200
     gcgtattgat gagctattcc atctttcaag acatgatgat ttgaccaaac tcccaaatcg    175260
     aaaagcgtta cgtgatagct ttgaagagaa aaaagaaaca tcgtttagct tagcaatcat    175320
     taacattacc aacttgcgtt ctatgaataa tcgctttggc atggagtttg gcgataaagc    175380
     gataaaaacc tttgctggct ttttaaaaac aacattttta tcaccctatt tagtatttag    175440
     aaatagtggg aatgaatttt gtattattgc acctcacact tttgatgagc aaaacagacg    175500
     tgcattcgag catattttag agtcagcaat ccagcaatat gaaaccaaca atagtgaacg    175560
     attacttaat ataagtgtgg gcatagcctg ttatccagag catggtataa caaagagtaa    175620
     gctcgtacga agtgcgcatt tagctaacca gtgggcaaaa gataccggcc aatggctgtg    175680
     tcattatcat gctgatatta aacaagctta cttacgtcgt ttaaaagtag aagagcggct    175740
     taatatggcg ttaaacgagc agtcattgtc tatggcgtat cagtgccaag taaatgaaca    175800
     gggtaaaatc catgctatgg aggcgctcat tcgttggcaa gatggtgagc ttggtatggt    175860
     atcacccgct gagtttattg ctattgcaga gcaaagtgat ttaattttta aaattggtga    175920
     ctttgtttta gcgcgatcta ttggtgagtt tgcaaaaatg cagcaacaca gcgatacccc    175980
     tcttgaattg gcaataaaca tttcagtaat gcaatttcaa agtagtgtat ttattcctac    176040
     attattacac agtttagaga cgcacaatgt tactgcgcaa agtatcattt tagaaataac    176100
     agaatccctc tttatggata atcttgaaca tgtgattgat acgattaaga gcttaaagtc    176160
     acgtggaata cgcttttcaa tggatgattt tggcacaggc tattcatcac tgagtctttt    176220
     gagacgctta ccgatagatg aactgaaaat agataagagc tttgttgatg atattttggt    176280
     ggactctaaa tcaaatagta tggtgcaaag tattattgcc attgccaaca gccataactt    176340
     aagtgttata gctgagggcg tggaagaaca ggcacagttt gatatgttag ttgatattgg    176400
     ctgtaaacgt tttcaggggt attactttta taaaccagtg gcagcagcaa cggttattga    176460
     atacctaacg gttaattaac ttatcctgca aatactgtgg tggcacggct aaggcggtca    176520
     ttcacagccc cccacttact gcttactggc ggcttttcga tataaatatt catcggtgtt    176580
     gtctcatcga tatgatgcag cgttttatac atgtttttag catactcaac agggcaagca    176640
     cttagcttag taatgtactg aggcgaaatg tgattagcta ataactgttg ctctgccttg    176700
     gttgaataga ttaaataatg tgtttgcaaa tggggagtgt tactcaaaac acttggaaaa    176760
     tctgcgctat taataagtat tgcaggagca tgtggctgat aatgcgcttt tacattgcca    176820
     ggcactgcct cattatgtga aagcggtgta gtgacattca gtccggtttt ctgcaaaata    176880
     tctgcagcgg atataggtcc tgggcgtaaa atgcgaagct gctcagtggt ggcatcaaca    176940
     atcgttgatt caatacccac atcacattgc ccgccctcta atactgcgct aattcggcca    177000
     tttaaatcgc gcataacatg ggctgtgttt attgggctta gttgtttgta gcgattagct    177060
     gagggagctg caagtccagt atttaattgt tttaaaactg ctaaaaattg cggatgtgct    177120
     ggtacgcgta aaccaatgct attcaagcca cctgttacag ggctatttaa attatctttt    177180
     gcatttaaaa taagtgtgag cggccctggc caaaaggctt cagcaagtgt aatcgctgcc    177240
     ttatttacat tttttgccca gtggtgcaca tgtgatagtt caggaatatg cacaattaac    177300
     gggtggtttg tcgggcgtcc tttcgcggca aatatttttg ctacagcatc actattgctc    177360
     gcatcggcag caaggccgta cacagtttct gtgggtaagg caacgcattc gcccgctttt    177420
     aatagtgcca cggcttggtt aatacgctct tcagtattca ataattgagt gggttgtaat    177480
     gatgtcataa taactcttaa ggattacaaa actggcaata tgttgcatca gcaacgcgtt    177540
     ttttattcgt ttcaatgtgg ctaaagccgc aactatcaca cactgaagta gttgatttca    177600
     tttgttctgt tggcatattg catagctcac agggcaagcc ttttgtaact tgtttagcaa    177660
     caaagttagg gttttggcac tgtgggcatg ttgatgatag tcgccttgca agatcttctg    177720
     cagctcggct aataattact tggcgttgcg ggctatacat ggccctcaga tcaggcgtga    177780
     ttgtacctgt gcttggcgtt ttttctgtat acaaagcaat aagcgcttct atgctaagcc    177840
     ctttatgaag cgtttgggtg tcgtcaagta tccaatgctg gttttcatag cgctgacatg    177900
     cagtagtgat tgattcagca ctggtttcac tgctaatgct taagctgctg ggcgaaaatg    177960
     gcccaccagc gtatccataa atagcattgt tattgtgttt atcataaaaa caaataactt    178020
     cttcgtccca gttcattaaa cccggatacg gcccaccccc aaaactgcct tcactgccaa    178080
     gcccaaattg ctcgcctgtg agttcacatg cgcgctgagc ttttgtcagt gccgctgtat    178140
     tggcactaca atgacgttgt acttcgtgac taaacatccc aagtgtatcg gtatcaaata    178200
     aatcagtagt gaatacctca aaaccaagtg gctccaaagc gggagctact aaaggcgcct    178260
     ttttatgttt agtagcaatg actatctttg gcatagctta tattggctca ttagaggctg    178320
     aaatagttga gaaatgtcca ttttcgaact gctctagggt attatcatcg ccccagcgaa    178380
     tgagagtgag ccaatggtta tcaatcagct ccttcaccat gacatgtttg ttataaattg    178440
     ccgcgattgc cgattgcggc gcagcaatat atacattaag gcgaattggt tcgtgcatcc    178500
     atttttcccc attgtgcagt gactgcatgg ctaagccaat acgaaggtca ccgccattac    178560
     cttcaaataa tccaatatta ccgccgactg cattgtggag tattttatta ccactgccgt    178620
     atttatggtt gtcggtaacc gaggcattat attgactatt gatccaatgg gttactatca    178680
     tgggtgcggt cataatcagt tctaataccg caaattcgtt atcgttttcc cattcataat    178740
     catgtaaaaa acagcgtcct tgtaagttaa cactgcgagt ccaggctcgt ggtgcaacaa    178800
     taaaggcggc gttattagca agcccccatt ctgggcgtac ttgcgaccaa tcgcgggcac    178860
     gctgttgata agcatggtta atttcatccg cggttttatt aactaactgc gggtcgatat    178920
     ttactaagcg ttcttgctga gcggtttgcg tggcaacggt tagccatttt tttagattgt    178980
     cattaagctc ggtatcgtaa gcggtgatga catccgtggt tgtgttatga atagcggcaa    179040
     taaattgcgt gctctgtgcc agtgttagcc ctcgctcttt aagcgcttgg cgcacttggg    179100
     tatcgtttag taagttagcc agcacgcgta cattaacttc gccactttgc cctccacagg    179160
     ctccacattc taggccagcg ctgtgcaagt tattagttgt atgactggcg tgacctacca    179220
     acataacatg cggcgcaaac tcttttattc ctaaggtgtt aagcactttt tgagctaagt    179280
     cggttttgtc ttttagggtc agtttttgct gattttgtgt taattgccag tcggtggttg    179340
     cgcacttttt agctttacct ttaggtaaaa aggtattttt tattaattta aatgcataca    179400
     gccagcctgc tgattcaacc atagaaaacg atgagggggc tgattttgac caactttgcc    179460
     atgtagcact attttgacga gatgcttcaa gcgccgcgtc tttgtgtgtt tgtgtggcat    179520
     gtatggctgg tttgagtagc cctggtagtt gaggacgagt aattgcacta ccattttctt    179580
     gatattctag tggcaagcca aaaaaaccgg caaagccgaa ggtttctata tttttacttt    179640
     gcgattcaag cgcgcggcga ataacctctg agcgtacatc aatacaaaac actgcttgta    179700
     attgagcgtt gttcactggc gttttagtgg cgttttgtag cgcatgatta agcgggtatt    179760
     gatagctcag ctccagtgct tttgcccaca cccataatgg cttttgtgcc aatttgtgtg    179820
     catgcaggcg ctcaattacg agtgactttt cttgctgcca ctgactttgt agttgtttaa    179880
     atgaagcact atcatgatct gccagatact gccaaataac caagtcccat gccattcgca    179940
     tggccagtag ctgtttcata tcatctttgg gtttagcgta aagttggcct tggaatcgta    180000
     aatacgccaa ccacgatgcc caaccattaa tatctaaaag cagcgaatga gcatataact    180060
     ctaacgagtc gttatctata ttaagggttg agagtgttag tgcaatcagt tcatcagcgc    180120
     aagtgggcag tcgcttaaag tagccattta aatgcttttc atccattaca atactaatgc    180180
     ctttatccgc ttgaataacg gttaaccaat ggcgatataa aggtgattgt gatgatgtgt    180240
     catcaccatg aagcataggg ccaagctgct gataatgcgc ggcacaaaac tggctcaatt    180300
     gatgggtgat ttcatcatgc caagccattt tatgtttatt gcgctgctgg tcgagtaaat    180360
     ctgcaatgtt gtgccaatcc actaaaggaa catcaatgtg aagggttttt atgagttgct    180420
     catgcgtaaa gtcactgtta agtaacttgg ctgcatcggc taagtggtta tcagtaataa    180480
     tgccgttgtc gtacttgtgc tgataaaagt ctttaggcat tagcatattg gcattacata    180540
     aggtatcaat gcgtgcgctt acatcttcaa taggaaggtg gcgcatttcc caaaatgggt    180600
     taacggcaat catctgatct aaaggccagt ttggtgctat gtaaccgcat actttattaa    180660
     gtatgttgtt ttcagtgtca cttaacgata atgccgtgtg atttgaatgc gtttgattgc    180720
     tcattttgat tcctcaacgg tgattccagc tgcatgattt tttaaatcgg tgtggccatt    180780
     attaggtaaa tttatcggcc atatttttag ggttaaccgc gtaaaccact catctaaata    180840
     caaacctgca aataataggg tggaaagtga tttaacctgt ggtcgccaag actggtagcg    180900
     taaaaagtag ctggcaatca ttaacgttaa aataagggct attacccagc tatcggcgag    180960
     gctaaatgca gcttcgcgcc actgctcaag ctctagtgct aaagtaaata tatttttagc    181020
     aaccacataa ctaataacaa ctaatagtgc gactagcagt tttttactgt gagtttgcac    181080
     gctagaagcg ccatgttggt tggccagtaa aatagttaaa gccgatgcta aaagtagcca    181140
     cacactgacc gcgccttgat agccactaat ggtccatgca gcgctaacta gggtaatcga    181200
     caccaatgcc cccgttaacc aagcaaagca cgtgggtgat tgttttggaa tgtggcggcg    181260
     aatcagatct tcgtttacac cgttgcctga gtttaaaaat gcaaaggctt tataggttga    181320
     atgagtaaca aggtgaagca gagccagttc aaataatccc agcgcacatt ctatgagcat    181380
     taatcccatt tgcgcactgg tagaccaagc aagccttact ttaacgctta ttcgggtagt    181440
     cattatcaaa gcgctgatca ccgtagttaa accagcaata attaaaatta accactgtgc    181500
     agccgcagct tgaataaaca aaggcgcaaa taaaattaat aaaaagccac ctaaatttat    181560
     caccccagca tgcaataagg cactgacggg tgtaggcacc tcaaccactt tgattagcca    181620
     gccatgcata ggcaactgag cacatttgat taaagctgca aaagcgatta aaaaggccgc    181680
     gagttgttca gccaaagata gcggtagtgt ggtggtgtga taaaaagtag tgatatcgct    181740
     aatgtatagg ctattgtgag taaccgataa aataataaat gcgacgagta ataaggattc    181800
     ggctacgcgt gccacaataa actttttatg agcggcgagt accgcacgag ggcgctcagg    181860
     ataaaacatt aatagcttgt gcagtgctaa actaattgcc acccagccta gccaaaatag    181920
     cgctaagtga ttgctcataa ctacaatcat cactgcggtt acggttaata gcagccagcg    181980
     ccaaaagtag tttacacgtg gctcaccttg catatagtgt ttgcaaaacc gaattaatat    182040
     tagcgttatg aacaggatta gtcctagcat aatagcgcgg gtcactgaga gcgataagaa    182100
     actcagtaaa tcaaaggcat aaatacgata aagtgcaacg gcactgataa atgcaacact    182160
     attaaatagc atcactttaa acagtacatt gccatttgag gcacaaggtt gtcggccaat    182220
     tagccacgcc gctaaaaatg tgcttaatgg catcattagt aataacaacg aaataatata    182280
     ctcgctcatt cagtgctcct tatttagtta ttggagtatg acaaactaga taactaaata    182340
     aaaatagata taatgcatat aaacgttcta taaaagagaa ctacaatgag ccgtttgaac    182400
     taccatcact tgtattattt ttggtctgtt gcccgaattg gtaacttaac ccaagcagct    182460
     aaagagctgc atttatcgca gtcagcgctc tccactcaaa ttaaacagct agagcacacc    182520
     attaatattc agttatttga acgtaaagga cgtaccttgg cattaaccga tatgggaaag    182580
     cgggtgcaaa tgtacgctaa cgatatattc actaagggcg aagaactgtc gtcttttatt    182640
     cataaaggga tgatttccca aactcagcat ttatcaatcg gggtgcttaa tacgctctct    182700
     cgtaacttta tcgaggaatt tattaaccct ttaatgagta acgacgaagt acgcttttcg    182760
     cttactgcag ggcgtatgga tgggctatta aatggtttgg cagagcacga actggattta    182820
     gttttaacca ataaacccat cggacttgag cactacgatc aactgtggca aagccagttg    182880
     gtatctcgtc agccattagc catagtgggc cctgcagata aaaaaacacg cggtcaattt    182940
     cctaccggtt acacagatgc acaatgggtg ctacccagta aaacctccgc gattagagac    183000
     tcatttaatg ctttgtgtgc ccgctggcaa tatcagccaa aaataaaagc agaggctgat    183060
     gatatggcta tgctgcgatt acttgctcgt gatagtggtg cactatcggt attgccatca    183120
     gttgtagtaa aggatgaaat agaacaaggc ctattagttg aataccaacg tttacctgat    183180
     gcatttgagc acttttatgc cattaccgca cagcgcaaat ttgtacctga tatactcaaa    183240
     tcattgctcg ccaaaacgtg ttaattactt ttaaactaac gtttttatta aaatatttta    183300
     tgcttgaata ataaaaaaga attaaaggtt ttaattagat ggccgacaaa gtacttaatt    183360
     gtactgaaga ttaaggataa tcatggttaa taaactacaa ggcaattatg ctaacctaaa    183420
     tgcgttgctt gcccaatcag tcaataattc aaaccaaacc agtatgccca caggtttgca    183480
     atcgcgtgct cacttagcgc caagcacggc aataatcacc gatgaaatgc tcagtcagtt    183540
     tagtgacgaa caagtcgatg aaatacttaa tcagcaatta tcctctttac tcacgatttc    183600
     cagcgcaccc agtggctcaa attataaact ctccagtgaa gaggttgcgc tgcgaacggt    183660
     tataagttct cagcaagagg gcctattaaa aaatgaacgt agtgatcagt taattgagcg    183720
     tttaaacagc tcggtaaaaa atattcaggg cgcttatgct aacactagcg atattttatc    183780
     aaacttgggg cagcttgggt tcaatcaaaa aacgttttta gcgtctagtc agcagcgtgt    183840
     tgaacgctcg ctagacccct ttatggaaag ttttaaccgc gagcgatatg aggatgatga    183900
     taactatgga tttgagctgt cggtaaaaac caaagaaggt gatgttatta aaatcacttt    183960
     tcattctgcg caaggttacg atgaggaaac aggcgaaacc actgacgaat ttagcgtaag    184020
     ttatgaagta gatggcgact tatttgaggc tgaacaccaa gcattaacgc aagtattttc    184080
     tggtgtaggc gaaatggcag atgaattttt taaagctaaa caaagcgctt acagtcgtta    184140
     tgtacccgca aaccaaactg atttagattt aagcttttta agcaattttg ataataaaca    184200
     gctttcgggt tttgatttgt atttttcaac gtcagaggga aatactgccg atgctgatgg    184260
     agcgctactt ggaaaagaca atgagcttaa tttaagttat acccttgatg aagattcaga    184320
     gcagcaaata ctcgagtttg aatcggtaaa tggtcagaac aacattgatt tttcgctcga    184380
     tatgtcaacc attggcgcgc aagacaaaag ccaaatgcag caatacataa aagcgctcga    184440
     taaaagttta gaagatagcc agctcaatag ctcagagaaa agtacgcgtt cggcgtttgg    184500
     ccaaaaaagt gatgaagtaa tgaaacaagg gttggctgta tttaaaagtg cgtttagtag    184560
     tatgtcatca gccgctgagc gctatagtca aatagagtca gtagctacac agcagtttac    184620
     taacggacgc gagctagtag ctgatttggt tgacaatatg atcacccgtg atccacgcta    184680
     tcaagggcta ggaagcagta ataaaaattc cctaggcgat gggatttcta agttagctga    184740
     ttttgatgca aaattctctt ttgcaatgga tcaaggtgat tacatagcaa caagcaccac    184800
     aaagctgagc caaaatacag aataccaaaa gtcagcagga ttaactgggg ttactcaaga    184860
     taaagcggcg agcacacgtt ttaattatga agaaggtaac cgctctgaca tcccccctga    184920
     ttattatgat aaacaagaaa attacactgt tggtaccgct gtaaaaaata acgaattggt    184980
     tgcccttgat caggctcatg aggtggatgt agataaaaaa gtgtatcagt ttaatcccga    185040
     aatatctcaa tacgagctaa aaaaggaatt aaaagaaaca accaccagtg agagcaatat    185100
     tcgtcttatt aacgatattt ggctcgagaa aaatgaagat agtcatcgta tggatgaaag    185160
     aaaacgactt agtggtgtgg gggcaacgaa tgagtttaga acaacatcga gttattcaca    185220
     tacgcaatta gtgacgttaa tcggtgattt agaaaaatta gaacaaaaca aagaagctaa    185280
     acgtgagtac ttagccgttt tatcacaagt ggatgatttt atggataaaa gtaagtaagt    185340
     gtattcactt aagctcgatt gtgggtatag tagctaaaac actatttaag tataaggtta    185400
     tgttaaaaca attaatttta ctctttattt tgactctacc actggcagcg aatgcaacgt    185460
     tcaaaccaca ctcagacgct gttactgcta agcgtttatt aagcgagcac gataaatttg    185520
     ctaagcaata ccaaacattc tcgcctacac cgcaagacgt tgtattgatg caaaaattag    185580
     caggtaaaga gttgttagtg cttttaggta gctggtgtca tgacagtgct cgcgaagtac    185640
     ctcgattaat aaagttactt gatgagtcta aggttgaact ttcgaaaata acctttgtta    185700
     ctgtaggtta tgacaaacgt gatgaggcag gtattgcgct agcgcatgac ttacaatata    185760
     cccccacttt tattattaag cataacgggg ttgaagttaa ccgcgtagta gaaaaaccca    185820
     gcggcactct cgcccaagat ttgaccttgg gcttatagcc agtattatgt tcgaggtttt    185880
     attattacac aggccagtcg gcggcgtcta aatcatctaa ctgtgcatcg cagtgctcat    185940
     tcccttgcca tttggcaata tattcaccgt gtgggtcgta ttgctgggtt tgttttgcca    186000
     aattaaagtg tcgcccaccg cgcggatcga ccccaacccc agcaatatat tgccagttgc    186060
     cccaattagc ggctacatcg taatcaataa gttgttgttc aaagtaagca gcgccatagc    186120
     gccagtctag ttgtagttcg ttgaccaaac agctggctgc aatttgtcgt gaacggttag    186180
     tgataaagcc cgttgcgtta agctctttca taatagcgtt aactagcgga aatggggtac    186240
     tgccttggca ccattttgca aaacggttcg ggctaaacgt ggtcagtggc gagctttgtt    186300
     ttttaccttt aaaagtaaat aactgatgct tcacattaat tgcatgccac ttaaaatact    186360
     cacgccagag caattcaaac ttgatccagt atgttgattc attttcccca tgctgcgctt    186420
     cataagcatc gactgcacaa aaaatttgct tggcactaat acaaccaaaa gccagccagc    186480
     tactaaattt agtcgagtta tcaaagccac ccagctcatt acgggtgatt ttatagctgc    186540
     ttggtaaagc tgatgaaaag tactgtagac aatgcgcaag gccggctttg tgtccacctt    186600
     ggagtaaagg gtttcctgtt ggcggctctg atataggctg tttagcacat aaaataatag    186660
     gcggtggaag tctttttgct gagaacggca ctgaggataa actgatacca gtggcttcga    186720
     ttttttttct aaaaggggta aagccggttg gtaaatcagc aagttcaaag ggcagttgtt    186780
     gctgttgata taaggtatct tgcatcacag atttaaatac cacagtagcg catttcgatt    186840
     taagcgcggt aatttggcgt tgctcataaa cgcctatttg ctcgctataa acaacttcat    186900
     caatgccaag ctcattaata cgctgtgtta atacccttac cggatcgcct tctaaaatat    186960
     gcaaggtttg gccaagccct aaaacagact cctgtagctc gtataggctt tgcattagaa    187020
     agcgttgttt atgtacacca tagggttttt gttgatagtt attgctttta aaccaagcag    187080
     gattgatcac aaatacgata tcaagttcac attgttgttg tgataaatca ttgagtatgg    187140
     ggttgtcatc aatgcgcaaa tcattttgca gccaatacag aatacgtttt ttcatactta    187200
     agctctggtt tttaaaatca ttaactttac gaaacaaaag cgggtaggga ttagttttga    187260
     ggtgtttaat agggctttaa aaagaggcgg taacaatacc gcctctcaat ttgttctagc    187320
     tttattttaa atagctgatt tttgctgtgc tatccagtca ttaattacat cttcaagtac    187380
     cgccataggg agtgaacctt gaccaataac ggtatcgtgg aagctgcgta tatcaaattg    187440
     tgcgcctagc tgtttttctg ctttggcacg tagttcgcgt attttaattt cgcccatttt    187500
     gtatgaaagc gcttggcctg gccaagaaat atagcggtct atttgatctt ccactgcgct    187560
     ttgtggcaaa gcggtatgat cagccaaata atcaatcgcc ttttggcggc tccagccaaa    187620
     ggcatgaata ccggtatcaa ccactaagcg cacagcgcgc cacatttcgt agcctaaacg    187680
     gccaaagtca ctgtatgggc tttggtaaaa gcccgcttct ttacctaaac gctctgtata    187740
     aagtgcccag ccttcgccaa aagcagagtg actaagggtg cgtctaaatt caggaacgtc    187800
     taattccata gcaatggcgt tttgtaaatg atgcccaggt atggcttcgt gtaggctaag    187860
     tgcttctaaa ttatataaag gctgcagttt tggagttgag gctaaaaagt aagtccccgg    187920
     tgagcgatta tctggcggtg gcatataaaa tgcgccacga ctagcagagc ctttaatggt    187980
     aaaagtattg cgcggtaagt ggccaaagta agtagggagt ttgccgtaca ttttttgggt    188040
     tataaaggcg gttttttcga gcaagtcttg aggatcggtt gcgtaaaatt gctcatcggt    188100
     tgccaaaaat tctaaaaact cgctatagct gccatcaaag ccaacttcat caataatact    188160
     ttgcatttgc gctttgatgc gtgccacttc tttaaggcca agctcatgga tttgcttggg    188220
     ggtcgcattt gttgtggtgt aataatttac tgtatatttg taataatcaa ggcccccttt    188280
     gatgcttgca ataccgggct gcgctctaca atgtgacata tattcgtttt caaaaaagtc    188340
     gtaaaagtgc tcgtaagcag gcacgacttt tgaggcaatt aacgctttag ctttattttg    188400
     gtaagtttct ttttgcgctg cgctaaatgt attagggata cgagtaaatg gctcatataa    188460
     ggcgctattc tcaggttgtt taactatatg ggcgctaata ctttggccat aatttttaaa    188520
     tgtttcgcag tagtgggtaa aaccagtttg aatgccttgc ttcagtaaat taatgttttg    188580
     ctgattaaag cgcgggtaat caccaaggct cactaaaaag gcatcgtaat cctcggcggt    188640
     taaaaaggcc atgttagccg gcgcttctgc aaagtaagta tgccagccac ttaaaaaatt    188700
     aaccggaaag tatttatctt ggtaaaggta gctttgctgc tcggtttctc gctcatattt    188760
     aaataagcgg tagttcatta gctgctcgct attgagcgtt ttaggatcaa tgctggctaa    188820
     gctttttagt acgctgttgt tataagcttg gcgcttagca atggcttgct cgctccaatt    188880
     tggtaatgtg ccgtttggtt tccaaccatc tggatcggtt ctaaaaaata ttttctcagc    188940
     tttggcgttt tgccagtggt tatcaataat ggtttttaaa tcgctgttac tgtcggctaa    189000
     gcttggcagc gaggtggctg ctaaggcaat agctaaaatt gtttttttta gcatgttgaa    189060
     tttcactttt taaaatttta attattattt atgcgcgctg attttatgat aataacaagt    189120
     tcactcaatt aatgcgttgg tttttaacag cagtctagct tattgtttta ctggtgttta    189180
     aaataaaaca tattggggtg gcgatattta ataacgtatt ttgctaaccg ataaggcgaa    189240
     tagccaacac ccaaatattt attgagcatt tcatgcttag ctttgcaggt tcgaaatccg    189300
     attatgatga agaaaaatgg attgggatta ctcgctgtac ttggaaaaaa atgtcagata    189360
     atgcacatga gtttgtattg gcaggtcaca caccattaat tggcctgata cacaaagcgt    189420
     tagaataact atttaacttt aggtattaaa ataaaaagga tttttgaaaa tgttgtgccc    189480
     tcgaacaaat acaccattgg agcctatatt agttggcggt atcactgttt atacatcgtc    189540
     gttaggcggc gtttttttcg ataacagcca aatttttaaa tttagctcgc cagagttaaa    189600
     acatggtcag gttttactta agtatttgag taattatgcc gaaggtgagg gtgaagtcgc    189660
     aatgcgagta aattgcccta aatgcccaag catagtgatg atgcgtaggt atttttcacc    189720
     gctaaaagca gttgaaatag atgaatgccc aagctgtgca ggaatatggc ttgatagtgg    189780
     cgaattaagc aaaatacacg aaaaccattt aacacccaaa gaacgaaaac tgctagccca    189840
     tgaaatggcc accaatcatg ggtttataac tattaagccg ccaaaatcga aatattatcc    189900
     taaagcgcct aaaaacgttc aaggcactac agttgaacgg ctggtgcaat tggcattact    189960
     taattttgaa tcataaaaaa cggcgtccta taaagtacgc cgtttttttc aattgactaa    190020
     attaaagcca ttacgattta ttgcggtttt ctttactaaa cgcgcgaatt ttacgttttt    190080
     gcgacaacgt tactttatta gtacgccctg caaatgggtt atcgccttct ctaaattcaa    190140
     ttttgattgg ggtgcccata atcttaagtg ctttacggta gtagttcatt aggtagcgtt    190200
     tgtagctatc aggtaaatca tgaacttggt taccatgaat gacgatacgc ggtgggttat    190260
     aacccccagc atgcgcatat ttaagcttaa cacgacgacc gcgaacaagc ggtggctggt    190320
     gatctgcttg tgccatatcc atgatacgac gtaacatagc ggtgcttata cgtttagttg    190380
     ccgactcata cgcttcgtca actgattcaa ataaatgacc aacacccgta ccatgtagcg    190440
     cagagataaa gtgcaagcgg gcaaaatcaa taaagcctaa gcgacgatca agctcagttt    190500
     taatacgatc tttaacgtag ttatctaggc catcccactt gttcacggca ataaccaatg    190560
     agcgccctga gttaagggca aagcctaata agcttaaatc ttgatctgaa ataccatcgc    190620
     gggcatcaac cactaatagc accacgttac aatcttcgat tgcttgtagt gttttaatga    190680
     ctgagaactt ctcaaccacg tcacttactt ttttgcgttt acgcacaccg gctgtatcga    190740
     taagaatata ttctttatca ttacgggtca tcggaatata gatagagtcg cgcgttgtac    190800
     ctggcatatc gtatacaata acgcgatctt cacccagtat acggttagtc agggttgact    190860
     taccaacgtt aggacgacca ataatagcca gctttaccgg cttgtcggca aacgcttggt    190920
     gatctgtgtc atcttcttca ccttcttgat ataagtcgat aagctcttca tcgtcatcgg    190980
     ctacatcttc atcaagtgcg gcaagttcag caataactgg ctgaagtgtt tgttcgagca    191040
     gtaaagtgat accacgacca tgtgcagcag cgatatgatg aacttcacca agtgaaagtt    191100
     gataaaactc agcacagttc gagtcagcat caatgccgtc tgttttattg gctaccacaa    191160
     agcacttttt ctcttgctta cgtaagtgat tagcaatggc ttgatcagcg actgtcatac    191220
     ccacacgggc atcaactaaa aataaaacaa tatccgcttc ttcaatggct agtaatgact    191280
     gatcagccat ttcggtttcg ataccttctt ctgagccatc aataccaccc gtatctacca    191340
     cgataaattc aaagccgtcg taatttgctt ggccatattt tctatcacgc gttaagccag    191400
     gaaaatcggc aacgagtgca tcacgagtac gtgttaaacg gttaaataat gtggatttgc    191460
     ccacattggg tcgccctaca agagcgatca cgggaagcat aaactacctc tttaaaaaac    191520
     aacaaaaggc ttcgcagtgc gaagccttac aaaaaataat taactattag tgccttacac    191580
     taatagtaga cagttagttc ggtattttta ccgcgctaac ttcaccatca cgggtgtata    191640
     aaatcaactt atcgtcagca acaacaggct caacaaaaaa acctgagctg tcaaagtctt    191700
     cacgagatac tagctcgcca gtgtctttat ttaaccaatg caaattgcct tcttggtcac    191760
     ctaacgctaa ataattaccg gcaaccgctg ggcctgttaa gtaccagcca cgaagagcag    191820
     gttggctcca acgctcaatg cctgaatctt tatcaagtgc ataaacaacg ccgttactat    191880
     caacaacgta aattgtttgc aaatccatgg caatttcacg gtagctgctg tattcacgtt    191940
     tccatacaac attaccagaa cgaatatcaa ctgctgataa gttcccattg tatgcaatcg    192000
     cataagcaaa cgggccacta ataagtggtt gtgtatcaac atcaactaaa cgctcaaact    192060
     ctgatgcgcc ttttgctact gcaatttctg cgctccacgc tgagtagccg ctctcagaaa    192120
     ttaaaacact gagcttacct gtttcaaggc caaccaacac accaccatta gcgacggttg    192180
     gtgaactttg accgcgtaag gtaagtgctg gcacttcttg ctcaaagctc cagcgctctt    192240
     cacccgtatc aggatgcagg gccagtaact tacctgatgc taaattaaca aacactaaac    192300
     catcgcctgc agcaggttta gacagtgatt cgcctggtac ttttttacgc catacctctt    192360
     tacctgtctc acgatcaagg gcaatgacat agccatgttc tgaacctaaa tagattttac    192420
     cataagcttg taatattccg cctgataatt ttgcactatc gttatcgctc caaggccaaa    192480
     acgataaatc atgacgaaca tcggtttccc aaagcgtatc accattggca agtgataacg    192540
     cttctacttg gccttcgcga ctcgctacat acacagtatc tttataaaca gctggtgata    192600
     ggcgtgagaa gtaatgctct acaccgctac ctattgattc ttgccaaaca acttctgttt    192660
     caaactgatt ggctatttca ggaagtacca gttcttcatc atcatcactt gatgaacagc    192720
     ccataagtgt tgctatacaa agggcgagcg ttgctgttgt tatttttctc atgcctaaaa    192780
     ccttatgccg ctgggctagt tactgctagg tcatctaact taatttgtaa tagaggattg    192840
     ctggttaatc caccggcatc aaccgcagct tggtaggcta cgcgtgcttg ttctttattg    192900
     ccttgctgag tgtaaatatc gccttttaac tcagcaatat ttgcattaaa tgcctctggc    192960
     aatggtgaat ttaatgtagt taatgcgtca tcgtattgtt gttgagcaat ttgcacacgc    193020
     gctaaacgcg tagtggcaat ggcttttagc tgcgcgttat cgacatttga tacaatccag    193080
     cttagctttt cattcgctac atctaatttt tgtgcatcta ccgcttcttt tgcagcaaca    193140
     aatgccgcta aagttgcgta ctgagtgtct ttattttcac tgatgaaggc atcagcagag    193200
     gctaatacgt catcactttc aacaagctta gtgtaggcat cagatgcttg ctctgctgtt    193260
     gttatttggt tttggttgta ggccttccaa ccgtacaaac cacctaagcc aacaattaca    193320
     cctaacgcaa gtgataggcc gttttcacga aaaaagcgtt taatcgcttc tgcttgttgt    193380
     tcttcagttg aataaatttc catgcttacc tctattaaag cgctttactc gctgcgcttt    193440
     atgtaatttt aactattaat tagttctgca agtagcgctt tagcttgttc tagttctaat    193500
     gtgacttgtt ctttacgctc acgtaaatac tttatggtca caacgccttg ctctaattca    193560
     tcttcaccga taataaccgc gactaatgca tcgcttttat cagcacgttt taattgtttt    193620
     ttaaagttac caccgccagc atgcaccata acgcgtaatc caggtacgtc tcgacgtaac    193680
     gtagatgcaa taataggcgc ttgaatgctg gctttgtcgc ccatggctgc taaatataca    193740
     tcagtactac ggcgtatgtc acctacacat tcaagtgctt gaagtagtaa aactaggcgc    193800
     tctaatccca tcgcaaaacc aactgccggg gttgatttac cgcctaattg ctcaactaag    193860
     ccatcataac gaccaccggc acatactgta ccctgtgcac ctaagctatc ggttacccat    193920
     tcaaatacag tacggttgta ataatctaag ccacgaacta gcttttcatt aaccgtgtat    193980
     ttgacgcctg cggcatctaa tcgttcacat aaattttcaa aatgttcttt tgattcagta    194040
     tctaaatgtt cagataattt tggcgcatcc actaatattg cctgtatatc tgggttttta    194100
     gtatccaaaa cgcgcagcgg gttagagtac atacgacgct tagagtcttc atctagtaca    194160
     tcggtatgtt gttctaagaa ggcaattaag gcatcacggt actgcgcgcg cgcttcattt    194220
     gagcctaatg agttaagctc taagcgtaca tggtcgctta tgccaaatgc ttcccaaagt    194280
     tgcgccgtga gtaatataac ttcagcgtct atatcggcgc tggcaatacc aaaggtttct    194340
     aaaccaaatt ggtgaaattg acggtaacga cctttttgtg ggcgttcatg gcgaaacata    194400
     gggcccatgt accaaaggcg ttgttcttga ttgtataaca ggccattttc gttacctgca    194460
     cgtacacaca ccgcggtacc ctcagggcgc agagttaaat tatcaccgtt acgatcggca    194520
     aaggtgtaca tttctttttc tacaatatcg gttacttcac caatagagcg tttaaatagg    194580
     tcggttgatt ctacaattgg aaaacgaatt tcttgataac caaacgatga tacggtctcg    194640
     cgtaaaatgt gctctacttt ctgccaaact tgcgtatcgc ctggcaggca atcgttcata    194700
     ccgcgaactg cctgaatttg ttttgccact gataaatcct aaatctgttt atgtgcagtc    194760
     ttagactgca accacgtaaa actaaaaaaa tcgaccgcgc attataaccc taactacaag    194820
     gtaattgcga gtatagcggt gtgtatgtaa tttgtactgc gctgtgaatg ccgctactaa    194880
     aaaagtcaat tgaatgcata ttgctggcgt ttaaatcact ctacgatttt tatatcgatt    194940
     ggtgtttgtt gctgcttttg ctcgataaaa tcgcgcacat agccttcgag ctgatcaaca    195000
     atattattgt tatcaatacg ggctttttgg cgttcgccat ttatgtataa gcctgagcga    195060
     cggtttgcac cggcaaggcc aatatcactg actagcgctt cgcctgggcc gttaacaaca    195120
     cagccaatta cagacactga aaccggttca ataatgtctt ctaaacgttc ttcaagttgg    195180
     ttcatggtgc tcaccacatc aaactcttgg cgtgaacagc ttgggcaagc aataaagtta    195240
     atcccgcgcg agcgaatacg cagtgatttt aatatatcaa agccaacttt tatttcttgt    195300
     actgggtctg cagcgagaga tacgcgcagc gtatcaccaa tgccttctgc taataacatc    195360
     cctaaaccaa cggccgattt aacagagcca gagcgcatgc cgccagcttc agttattcct    195420
     aaatgcagtg gttggtcgat ttctttagcg agcaagcgat acgcgcctac cgctaaaaat    195480
     acgtctgatg cttttactga aattttaaat tgatcaaagt ctaagcggcg taatatatct    195540
     acgtggcgca tagccgattc taatagggct tctggagtgg gttcgccgta tttttcttgt    195600
     agatcgcgct caagtgaacc gccatttacc cctattcgaa taggaatatt atgctcacgc    195660
     gctgaatcaa ctaccgctct aatacgctct tcactgccaa tgttgcctgg gttgatacgc    195720
     aaacaatcaa caccgtattt tgctactttt aatgcaatgc gatagtcaaa gtggatatcg    195780
     gcgacaaggg gtatcgacac ttgctcttta atacttttaa atgcctcagc ggcatccatg    195840
     gtcggtactg acacgcgaac aatatctgca ccggcatctt gaatagcttg aatttgggct    195900
     acagtggcat caacgtccat cgtatctgtg ttggtcatcg actgcacggc aataggtgca    195960
     ccatcaccaa taggaacatt acccacattt atgcgtgtgg attttctgcg ttttatagga    196020
     gattctgaaa acatagcgac tactctgcta agggtaattt aaatttagct aaacggtttt    196080
     taggaaaggc cgaaatatca actggctcac catttagggt aatacgaaca acatcatgct    196140
     tgcctaatac cactgaaaaa ggcgctactc cggttagggt catttcgtag cctgcttttt    196200
     ttacaccaaa agcaattttt tcatcattgg catcgtgaat ttctacccag ctctcatcgt    196260
     taaacatcat aaaaatggtg cttaaatcac tgttttttgg ctcactggtg ctctgtgcat    196320
     tattaactgg cgcagcttga attgtttgtt gttcattttg taatgcagaa tctacttctt    196380
     ctgtagattc aatgtcattt aatagtgcct cgtcggcggc ttcagctaac agcttggtgt    196440
     tttcttgttg ttgagttatg agcgagttat tagcattaat agttttagtt tgttcatcaa    196500
     taggcattgc attttgccac caccacactg cagaagaacc aataacgata gctaaaatta    196560
     agtaacttac ggtcataagt cggctgtcat gggcttcttt ttctgtgcgc cttgaaaagc    196620
     tttgcatatc gaccggttta tctgatgtgc taaaagccgg cagcatcgct aagatagctg    196680
     tgctatcaat gtttagtgtg cggcagtagt tttttatata gcctttaacg aacgtttttg    196740
     caccgagtaa atgatactcg tcgctttcaa tatgctcaac ttgtgattct gttagcttta    196800
     atagcgaggc gatttcagca atgctgatat ttgcattttc tctatgcgat tttagtattt    196860
     gtcctacaga gggttcgtcg ctctgcggtt gtgtattatc ttcattcata atatgtatga    196920
     gtctggatcc acgagtaaaa gttaatgttt tggcttaata accagagtaa gactttgttt    196980
     ttatttttta gtgttcgttt attcttgcta ctagaatgca cgcttttaaa gggtatcatc    197040
     agctgcggtt ttataaaaac gttagtatcg cccttttaaa atttttgctg tttttatttt    197100
     taaagccctt taatgcacct aacatatagc agtttagcat tgaatcacac tgaaatgcta    197160
     aattggttta cagtaaaacg agcgatatca accgatacac tcgtttttac tcttatttat    197220
     actaatttaa aaaggtattt gtgtctctgt tgtattttat gcagcttact ttactgaatc    197280
     atcagagttt acagcagatg ttgggctttt tttacgaata atttttattt ttggctccac    197340
     aataatttga ttgttattac tgctttcttg caattcatca agttgtgctt ggcggtactt    197400
     ttcgcgcagc acttcaaact ctgtttgcct taattggttg tcacgaatgg cgttagcttg    197460
     aacactattt gggtacgttt gcaaaatggt agctgcaatt ttttcagcat cttctattct    197520
     acccatgcgt tgtttaacca agtagctgag taacaatgct cgcgaagaaa cctgtgcagt    197580
     atcgtcataa cgttttatta aagtactggc tttatataag tcacttttgg cgtaatacaa    197640
     agccgctaag cttattaatg tagaggcgcg ttgcgagctg tggtttagcg cttgttgaaa    197700
     gtagctttct gcattggtaa agtcattaaa ttcaatggcg cataaggcta aattttcata    197760
     gctttgtgct acacgaatat agctaggaat ttcaatcgct tttaaaaatt gatcggtcgc    197820
     gcgatcatac tcatcaatac tacataaaaa cgtaccgtag ttatttaggg tgttcggatc    197880
     gtcaggctta atcgccaacg ctttttgata ggctttgtcg gctaatgcat tttcgccaac    197940
     ttgttggtag taataggcta aagaataatg aacttcggga agatttggtg catattcgct    198000
     cgcacgctca aggttgtatt ttgcttggga attattaccg gtgtttaaat attgtaatgc    198060
     caaagcaatg cgggtacgtg ctgcgcctgc gttgtttatt ttattttcga cgacgggttt    198120
     gtcactgccg ttgtaactat tttcagtcac acaaccgctt aaaagtagtg ttgatagtgc    198180
     taaagcaagt aaagatcgca ttaccttgtc tctttattta tttccatagc ctctatctta    198240
     cctcaaagcc tttgtgttgc atcatttatt taaaaataaa caatttatca caaaggcaca    198300
     gagttactta gttaggcttg gtgaatattt actgcaattg cattgtcatc acgcattttc    198360
     tttttagcca tacgttttgt tctatcaacc acatcgccag ctaactgacc acaggcagcg    198420
     tcaatgtcgt cccctcgtgt acgacgaaca atacaggtaa tccccgcagc ttgtaatacc    198480
     tttgaaaaac ggtcaattcg gctgttgctt gaacgcgtat actcattacc tgggaacggg    198540
     ttaaacggaa taaggtttac cttagatggc gtacctttta gcgttttaac cagttcatgt    198600
     gcttggtcgg tactgtcgtt tacgccatta agcataacgt attcaatggt gacatcttta    198660
     ttggcttttg agccatcaat ataacgacga caggccgcta aaaattcttc aattgggtac    198720
     tttttattga tcggtactaa aatatcacgc agtgcgttat caggagcgtg aagtgaaata    198780
     gccagtgcta cgtctatttt ttcttttaat aaatcaaggg caggtactac acccgaggta    198840
     cttaatgtaa cgcggcgctt