(data stored in ACNUC7421 zone)

EMBL: CP001798

ID   CP001798; SV 1; circular; genomic DNA; STD; PRO; 4079427 BP.
XX
AC   CP001798;
XX
PR   Project:PRJNA36589;
XX
DT   01-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Nitrosococcus halophilus Nc4, complete genome.
XX
KW   .
XX
OS   Nitrosococcus halophilus Nc 4
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae;
OC   Nitrosococcus.
XX
RN   [1]
RP   1-4079427
RG   US DOE Joint Genome Institute
RA   Campbell M.A., Malfatti S.A., Chain P.S.G., Heidelberg J.F., Ward N.L.,
RA   Ward B.B., Klotz M.G.;
RT   "Complete genome sequence of Nitrosococcus halophilus Nc4, a salt-adapted,
RT   aerobic obligate ammonia-oxidizing sulfur purple bacterium";
RL   Unpublished.
XX
RN   [2]
RP   1-4079427
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ivanova N., Campbell M.A., Malfatti S.A., Chain P.S.G.,
RA   Heidelberg J.F., Ward B.B., Klotz M.G.;
RT   ;
RL   Submitted (15-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 86becd42c7da1681f1fb200791863a4e.
DR   BioSample; SAMN02598510.
DR   EnsemblGenomes-Gn; EBG00001022175.
DR   EnsemblGenomes-Gn; EBG00001022176.
DR   EnsemblGenomes-Gn; EBG00001022177.
DR   EnsemblGenomes-Gn; EBG00001022178.
DR   EnsemblGenomes-Gn; EBG00001022179.
DR   EnsemblGenomes-Gn; EBG00001022180.
DR   EnsemblGenomes-Gn; EBG00001022181.
DR   EnsemblGenomes-Gn; EBG00001022182.
DR   EnsemblGenomes-Gn; EBG00001022183.
DR   EnsemblGenomes-Gn; EBG00001022184.
DR   EnsemblGenomes-Gn; EBG00001022185.
DR   EnsemblGenomes-Gn; EBG00001022186.
DR   EnsemblGenomes-Gn; EBG00001022187.
DR   EnsemblGenomes-Gn; EBG00001022188.
DR   EnsemblGenomes-Gn; EBG00001022189.
DR   EnsemblGenomes-Gn; EBG00001022190.
DR   EnsemblGenomes-Gn; EBG00001022191.
DR   EnsemblGenomes-Gn; EBG00001022192.
DR   EnsemblGenomes-Gn; EBG00001022193.
DR   EnsemblGenomes-Gn; EBG00001022194.
DR   EnsemblGenomes-Gn; EBG00001022195.
DR   EnsemblGenomes-Gn; EBG00001022196.
DR   EnsemblGenomes-Gn; EBG00001022197.
DR   EnsemblGenomes-Gn; EBG00001022198.
DR   EnsemblGenomes-Gn; EBG00001022199.
DR   EnsemblGenomes-Gn; EBG00001022200.
DR   EnsemblGenomes-Gn; EBG00001022201.
DR   EnsemblGenomes-Gn; EBG00001022202.
DR   EnsemblGenomes-Gn; EBG00001022203.
DR   EnsemblGenomes-Gn; EBG00001022204.
DR   EnsemblGenomes-Gn; EBG00001022205.
DR   EnsemblGenomes-Gn; EBG00001022206.
DR   EnsemblGenomes-Gn; EBG00001022207.
DR   EnsemblGenomes-Gn; EBG00001022208.
DR   EnsemblGenomes-Gn; EBG00001022209.
DR   EnsemblGenomes-Gn; EBG00001022210.
DR   EnsemblGenomes-Gn; EBG00001022211.
DR   EnsemblGenomes-Gn; EBG00001022212.
DR   EnsemblGenomes-Gn; EBG00001022213.
DR   EnsemblGenomes-Gn; EBG00001022214.
DR   EnsemblGenomes-Gn; EBG00001022215.
DR   EnsemblGenomes-Gn; EBG00001022216.
DR   EnsemblGenomes-Gn; EBG00001022217.
DR   EnsemblGenomes-Gn; EBG00001022218.
DR   EnsemblGenomes-Gn; EBG00001022219.
DR   EnsemblGenomes-Gn; EBG00001022220.
DR   EnsemblGenomes-Gn; EBG00001022221.
DR   EnsemblGenomes-Gn; EBG00001022222.
DR   EnsemblGenomes-Gn; EBG00001022223.
DR   EnsemblGenomes-Gn; EBG00001022224.
DR   EnsemblGenomes-Gn; EBG00001022225.
DR   EnsemblGenomes-Gn; EBG00001022226.
DR   EnsemblGenomes-Gn; EBG00001022227.
DR   EnsemblGenomes-Gn; EBG00001022228.
DR   EnsemblGenomes-Gn; EBG00001022229.
DR   EnsemblGenomes-Gn; EBG00001022230.
DR   EnsemblGenomes-Gn; EBG00001022231.
DR   EnsemblGenomes-Gn; EBG00001022232.
DR   EnsemblGenomes-Gn; EBG00001022233.
DR   EnsemblGenomes-Gn; EBG00001022234.
DR   EnsemblGenomes-Gn; EBG00001022235.
DR   EnsemblGenomes-Gn; EBG00001022236.
DR   EnsemblGenomes-Gn; EBG00001022237.
DR   EnsemblGenomes-Gn; EBG00001022238.
DR   EnsemblGenomes-Gn; EBG00001022239.
DR   EnsemblGenomes-Gn; EBG00001022240.
DR   EnsemblGenomes-Gn; EBG00001022241.
DR   EnsemblGenomes-Gn; EBG00001022242.
DR   EnsemblGenomes-Gn; EBG00001022243.
DR   EnsemblGenomes-Gn; EBG00001022244.
DR   EnsemblGenomes-Gn; EBG00001022245.
DR   EnsemblGenomes-Gn; EBG00001022246.
DR   EnsemblGenomes-Gn; EBG00001022247.
DR   EnsemblGenomes-Gn; EBG00001022248.
DR   EnsemblGenomes-Gn; EBG00001022249.
DR   EnsemblGenomes-Gn; EBG00001022250.
DR   EnsemblGenomes-Gn; EBG00001022251.
DR   EnsemblGenomes-Gn; EBG00001022252.
DR   EnsemblGenomes-Gn; EBG00001022253.
DR   EnsemblGenomes-Gn; EBG00001022254.
DR   EnsemblGenomes-Gn; EBG00001022255.
DR   EnsemblGenomes-Gn; EBG00001022256.
DR   EnsemblGenomes-Gn; EBG00001022257.
DR   EnsemblGenomes-Gn; EBG00001022258.
DR   EnsemblGenomes-Gn; EBG00001022259.
DR   EnsemblGenomes-Gn; EBG00001022260.
DR   EnsemblGenomes-Gn; EBG00001022261.
DR   EnsemblGenomes-Gn; EBG00001022262.
DR   EnsemblGenomes-Gn; EBG00001022263.
DR   EnsemblGenomes-Gn; EBG00001022264.
DR   EnsemblGenomes-Gn; EBG00001022265.
DR   EnsemblGenomes-Gn; EBG00001022266.
DR   EnsemblGenomes-Gn; EBG00001022267.
DR   EnsemblGenomes-Gn; EBG00001022268.
DR   EnsemblGenomes-Gn; EBG00001022269.
DR   EnsemblGenomes-Gn; EBG00001022270.
DR   EnsemblGenomes-Gn; EBG00001022271.
DR   EnsemblGenomes-Gn; EBG00001022272.
DR   EnsemblGenomes-Gn; EBG00001022273.
DR   EnsemblGenomes-Gn; EBG00001022274.
DR   EnsemblGenomes-Gn; EBG00001022275.
DR   EnsemblGenomes-Gn; EBG00001022276.
DR   EnsemblGenomes-Gn; EBG00001022277.
DR   EnsemblGenomes-Gn; EBG00001022278.
DR   EnsemblGenomes-Gn; EBG00001022279.
DR   EnsemblGenomes-Gn; EBG00001022280.
DR   EnsemblGenomes-Gn; Nhal_R0001.
DR   EnsemblGenomes-Gn; Nhal_R0002.
DR   EnsemblGenomes-Gn; Nhal_R0003.
DR   EnsemblGenomes-Gn; Nhal_R0004.
DR   EnsemblGenomes-Gn; Nhal_R0005.
DR   EnsemblGenomes-Gn; Nhal_R0006.
DR   EnsemblGenomes-Gn; Nhal_R0007.
DR   EnsemblGenomes-Gn; Nhal_R0008.
DR   EnsemblGenomes-Gn; Nhal_R0009.
DR   EnsemblGenomes-Gn; Nhal_R0010.
DR   EnsemblGenomes-Gn; Nhal_R0011.
DR   EnsemblGenomes-Gn; Nhal_R0012.
DR   EnsemblGenomes-Gn; Nhal_R0013.
DR   EnsemblGenomes-Gn; Nhal_R0014.
DR   EnsemblGenomes-Gn; Nhal_R0015.
DR   EnsemblGenomes-Gn; Nhal_R0016.
DR   EnsemblGenomes-Gn; Nhal_R0017.
DR   EnsemblGenomes-Gn; Nhal_R0018.
DR   EnsemblGenomes-Gn; Nhal_R0019.
DR   EnsemblGenomes-Gn; Nhal_R0020.
DR   EnsemblGenomes-Gn; Nhal_R0021.
DR   EnsemblGenomes-Gn; Nhal_R0022.
DR   EnsemblGenomes-Gn; Nhal_R0023.
DR   EnsemblGenomes-Gn; Nhal_R0024.
DR   EnsemblGenomes-Gn; Nhal_R0025.
DR   EnsemblGenomes-Gn; Nhal_R0026.
DR   EnsemblGenomes-Gn; Nhal_R0027.
DR   EnsemblGenomes-Gn; Nhal_R0028.
DR   EnsemblGenomes-Gn; Nhal_R0029.
DR   EnsemblGenomes-Gn; Nhal_R0030.
DR   EnsemblGenomes-Gn; Nhal_R0031.
DR   EnsemblGenomes-Gn; Nhal_R0032.
DR   EnsemblGenomes-Gn; Nhal_R0033.
DR   EnsemblGenomes-Gn; Nhal_R0034.
DR   EnsemblGenomes-Gn; Nhal_R0035.
DR   EnsemblGenomes-Gn; Nhal_R0036.
DR   EnsemblGenomes-Gn; Nhal_R0037.
DR   EnsemblGenomes-Gn; Nhal_R0038.
DR   EnsemblGenomes-Gn; Nhal_R0039.
DR   EnsemblGenomes-Gn; Nhal_R0040.
DR   EnsemblGenomes-Gn; Nhal_R0041.
DR   EnsemblGenomes-Gn; Nhal_R0042.
DR   EnsemblGenomes-Gn; Nhal_R0043.
DR   EnsemblGenomes-Gn; Nhal_R0044.
DR   EnsemblGenomes-Gn; Nhal_R0045.
DR   EnsemblGenomes-Gn; Nhal_R0046.
DR   EnsemblGenomes-Gn; Nhal_R0047.
DR   EnsemblGenomes-Gn; Nhal_R0048.
DR   EnsemblGenomes-Gn; Nhal_R0049.
DR   EnsemblGenomes-Gn; Nhal_R0050.
DR   EnsemblGenomes-Gn; Nhal_R0051.
DR   EnsemblGenomes-Gn; Nhal_R0052.
DR   EnsemblGenomes-Gn; Nhal_R0053.
DR   EnsemblGenomes-Gn; Nhal_R0054.
DR   EnsemblGenomes-Gn; Nhal_R0055.
DR   EnsemblGenomes-Tr; EBT00001624800.
DR   EnsemblGenomes-Tr; EBT00001624802.
DR   EnsemblGenomes-Tr; EBT00001624803.
DR   EnsemblGenomes-Tr; EBT00001624805.
DR   EnsemblGenomes-Tr; EBT00001624808.
DR   EnsemblGenomes-Tr; EBT00001624810.
DR   EnsemblGenomes-Tr; EBT00001624813.
DR   EnsemblGenomes-Tr; EBT00001624815.
DR   EnsemblGenomes-Tr; EBT00001624818.
DR   EnsemblGenomes-Tr; EBT00001624820.
DR   EnsemblGenomes-Tr; EBT00001624823.
DR   EnsemblGenomes-Tr; EBT00001624826.
DR   EnsemblGenomes-Tr; EBT00001624829.
DR   EnsemblGenomes-Tr; EBT00001624831.
DR   EnsemblGenomes-Tr; EBT00001624834.
DR   EnsemblGenomes-Tr; EBT00001624837.
DR   EnsemblGenomes-Tr; EBT00001624839.
DR   EnsemblGenomes-Tr; EBT00001624843.
DR   EnsemblGenomes-Tr; EBT00001624845.
DR   EnsemblGenomes-Tr; EBT00001624847.
DR   EnsemblGenomes-Tr; EBT00001624851.
DR   EnsemblGenomes-Tr; EBT00001624852.
DR   EnsemblGenomes-Tr; EBT00001624855.
DR   EnsemblGenomes-Tr; EBT00001624856.
DR   EnsemblGenomes-Tr; EBT00001624860.
DR   EnsemblGenomes-Tr; EBT00001624863.
DR   EnsemblGenomes-Tr; EBT00001624865.
DR   EnsemblGenomes-Tr; EBT00001624867.
DR   EnsemblGenomes-Tr; EBT00001624869.
DR   EnsemblGenomes-Tr; EBT00001624872.
DR   EnsemblGenomes-Tr; EBT00001624875.
DR   EnsemblGenomes-Tr; EBT00001624878.
DR   EnsemblGenomes-Tr; EBT00001624881.
DR   EnsemblGenomes-Tr; EBT00001624884.
DR   EnsemblGenomes-Tr; EBT00001624888.
DR   EnsemblGenomes-Tr; EBT00001624890.
DR   EnsemblGenomes-Tr; EBT00001624894.
DR   EnsemblGenomes-Tr; EBT00001624896.
DR   EnsemblGenomes-Tr; EBT00001624900.
DR   EnsemblGenomes-Tr; EBT00001624903.
DR   EnsemblGenomes-Tr; EBT00001624906.
DR   EnsemblGenomes-Tr; EBT00001624911.
DR   EnsemblGenomes-Tr; EBT00001624913.
DR   EnsemblGenomes-Tr; EBT00001624917.
DR   EnsemblGenomes-Tr; EBT00001624919.
DR   EnsemblGenomes-Tr; EBT00001624923.
DR   EnsemblGenomes-Tr; EBT00001624925.
DR   EnsemblGenomes-Tr; EBT00001624928.
DR   EnsemblGenomes-Tr; EBT00001624930.
DR   EnsemblGenomes-Tr; EBT00001624932.
DR   EnsemblGenomes-Tr; EBT00001624936.
DR   EnsemblGenomes-Tr; EBT00001624938.
DR   EnsemblGenomes-Tr; EBT00001624942.
DR   EnsemblGenomes-Tr; EBT00001624945.
DR   EnsemblGenomes-Tr; EBT00001624948.
DR   EnsemblGenomes-Tr; EBT00001624951.
DR   EnsemblGenomes-Tr; EBT00001624955.
DR   EnsemblGenomes-Tr; EBT00001624958.
DR   EnsemblGenomes-Tr; EBT00001624962.
DR   EnsemblGenomes-Tr; EBT00001624965.
DR   EnsemblGenomes-Tr; EBT00001624968.
DR   EnsemblGenomes-Tr; EBT00001624972.
DR   EnsemblGenomes-Tr; EBT00001624974.
DR   EnsemblGenomes-Tr; EBT00001624978.
DR   EnsemblGenomes-Tr; EBT00001624981.
DR   EnsemblGenomes-Tr; EBT00001624985.
DR   EnsemblGenomes-Tr; EBT00001624988.
DR   EnsemblGenomes-Tr; EBT00001624990.
DR   EnsemblGenomes-Tr; EBT00001624994.
DR   EnsemblGenomes-Tr; EBT00001624996.
DR   EnsemblGenomes-Tr; EBT00001624998.
DR   EnsemblGenomes-Tr; EBT00001625001.
DR   EnsemblGenomes-Tr; EBT00001625005.
DR   EnsemblGenomes-Tr; EBT00001625009.
DR   EnsemblGenomes-Tr; EBT00001625011.
DR   EnsemblGenomes-Tr; EBT00001625014.
DR   EnsemblGenomes-Tr; EBT00001625015.
DR   EnsemblGenomes-Tr; EBT00001625017.
DR   EnsemblGenomes-Tr; EBT00001625020.
DR   EnsemblGenomes-Tr; EBT00001625022.
DR   EnsemblGenomes-Tr; EBT00001625024.
DR   EnsemblGenomes-Tr; EBT00001625028.
DR   EnsemblGenomes-Tr; EBT00001625030.
DR   EnsemblGenomes-Tr; EBT00001625034.
DR   EnsemblGenomes-Tr; EBT00001625037.
DR   EnsemblGenomes-Tr; EBT00001625040.
DR   EnsemblGenomes-Tr; EBT00001625043.
DR   EnsemblGenomes-Tr; EBT00001625047.
DR   EnsemblGenomes-Tr; EBT00001625049.
DR   EnsemblGenomes-Tr; EBT00001625052.
DR   EnsemblGenomes-Tr; EBT00001625056.
DR   EnsemblGenomes-Tr; EBT00001625060.
DR   EnsemblGenomes-Tr; EBT00001625063.
DR   EnsemblGenomes-Tr; EBT00001625064.
DR   EnsemblGenomes-Tr; EBT00001625067.
DR   EnsemblGenomes-Tr; EBT00001625070.
DR   EnsemblGenomes-Tr; EBT00001625073.
DR   EnsemblGenomes-Tr; EBT00001625075.
DR   EnsemblGenomes-Tr; EBT00001625079.
DR   EnsemblGenomes-Tr; EBT00001625082.
DR   EnsemblGenomes-Tr; EBT00001625085.
DR   EnsemblGenomes-Tr; EBT00001625088.
DR   EnsemblGenomes-Tr; EBT00001625091.
DR   EnsemblGenomes-Tr; EBT00001625094.
DR   EnsemblGenomes-Tr; EBT00001625097.
DR   EnsemblGenomes-Tr; EBT00001625099.
DR   EnsemblGenomes-Tr; Nhal_R0001-1.
DR   EnsemblGenomes-Tr; Nhal_R0002-1.
DR   EnsemblGenomes-Tr; Nhal_R0003-1.
DR   EnsemblGenomes-Tr; Nhal_R0004-1.
DR   EnsemblGenomes-Tr; Nhal_R0005-1.
DR   EnsemblGenomes-Tr; Nhal_R0006-1.
DR   EnsemblGenomes-Tr; Nhal_R0007-1.
DR   EnsemblGenomes-Tr; Nhal_R0008-1.
DR   EnsemblGenomes-Tr; Nhal_R0009-1.
DR   EnsemblGenomes-Tr; Nhal_R0010-1.
DR   EnsemblGenomes-Tr; Nhal_R0011-1.
DR   EnsemblGenomes-Tr; Nhal_R0012-1.
DR   EnsemblGenomes-Tr; Nhal_R0013-1.
DR   EnsemblGenomes-Tr; Nhal_R0014-1.
DR   EnsemblGenomes-Tr; Nhal_R0015-1.
DR   EnsemblGenomes-Tr; Nhal_R0016-1.
DR   EnsemblGenomes-Tr; Nhal_R0017-1.
DR   EnsemblGenomes-Tr; Nhal_R0018-1.
DR   EnsemblGenomes-Tr; Nhal_R0019-1.
DR   EnsemblGenomes-Tr; Nhal_R0020-1.
DR   EnsemblGenomes-Tr; Nhal_R0021-1.
DR   EnsemblGenomes-Tr; Nhal_R0022-1.
DR   EnsemblGenomes-Tr; Nhal_R0023-1.
DR   EnsemblGenomes-Tr; Nhal_R0024-1.
DR   EnsemblGenomes-Tr; Nhal_R0025-1.
DR   EnsemblGenomes-Tr; Nhal_R0026-1.
DR   EnsemblGenomes-Tr; Nhal_R0027-1.
DR   EnsemblGenomes-Tr; Nhal_R0028-1.
DR   EnsemblGenomes-Tr; Nhal_R0029-1.
DR   EnsemblGenomes-Tr; Nhal_R0030-1.
DR   EnsemblGenomes-Tr; Nhal_R0031-1.
DR   EnsemblGenomes-Tr; Nhal_R0032-1.
DR   EnsemblGenomes-Tr; Nhal_R0033-1.
DR   EnsemblGenomes-Tr; Nhal_R0034-1.
DR   EnsemblGenomes-Tr; Nhal_R0035-1.
DR   EnsemblGenomes-Tr; Nhal_R0036-1.
DR   EnsemblGenomes-Tr; Nhal_R0037-1.
DR   EnsemblGenomes-Tr; Nhal_R0038-1.
DR   EnsemblGenomes-Tr; Nhal_R0039-1.
DR   EnsemblGenomes-Tr; Nhal_R0040-1.
DR   EnsemblGenomes-Tr; Nhal_R0041-1.
DR   EnsemblGenomes-Tr; Nhal_R0042-1.
DR   EnsemblGenomes-Tr; Nhal_R0043-1.
DR   EnsemblGenomes-Tr; Nhal_R0044-1.
DR   EnsemblGenomes-Tr; Nhal_R0045-1.
DR   EnsemblGenomes-Tr; Nhal_R0046-1.
DR   EnsemblGenomes-Tr; Nhal_R0047-1.
DR   EnsemblGenomes-Tr; Nhal_R0048-1.
DR   EnsemblGenomes-Tr; Nhal_R0049-1.
DR   EnsemblGenomes-Tr; Nhal_R0050-1.
DR   EnsemblGenomes-Tr; Nhal_R0051-1.
DR   EnsemblGenomes-Tr; Nhal_R0052-1.
DR   EnsemblGenomes-Tr; Nhal_R0053-1.
DR   EnsemblGenomes-Tr; Nhal_R0054-1.
DR   EnsemblGenomes-Tr; Nhal_R0055-1.
DR   EuropePMC; PMC4830845; 27148201.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02033; HEARO.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP001798.
DR   SILVA-SSU; CP001798.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082953
CC   Source DNA and bacteria available from Martin Klotz
CC   (martin.klotz@louisville.edu)
CC   Contacts: Martin Klotz (martin.klotz@louisville.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Nitrosococcus halophilus Nc4
CC   GOLD Stamp ID         :: Gi04229
CC   Oxygen Requirement    :: Aerobic
CC   Motility              :: Motile, chemotactic
CC   Temperature Range     :: Mesophilic
CC   Gram Staining         :: Gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Marine
CC   Phenotypes            :: Obligate ammonia-oxidizing, Nitrifying,
CC                            aerobic Denitrifying
CC   Energy Source         :: Chemolithotrophic
CC   Carbon Source         :: Autotrophic (Calvin Benson Basham cycle)
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4079427
FT                   /organism="Nitrosococcus halophilus Nc 4"
FT                   /strain="Nc 4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:472759"
FT   gene            244..1596
FT                   /locus_tag="Nhal_0001"
FT   CDS_pept        244..1596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: noc:Noc_0001 chromosomal replication initiator
FT                   protein, DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13223"
FT                   /db_xref="GOA:D5C435"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D5C435"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADE13223.1"
FT                   /translation="MPFSLWEHCLNHLEGELDLQEFNTYIRPLQAIQQDSNLRLYAPNQ
FT                   FVVDWVQDCAESRINALLSHYSDGRIEKAILEVGSCNPQPQAPSPVPELPSESPFAPSP
FT                   RGIDRIPESRLNKNYTFNNFVEGKSNQLPRAASYQVAENPGSAYNPLFIYGGVGLGKTH
FT                   LMHAVGNYIRTRSPDARVAYLHSEQFVAEMIKALQLNAINEFKARYRSVDVLLIDDIQF
FT                   FAGKERSQEEFFYTFNTLLEVQHQIILTCDRFPKEVNGLEERLKSRFGWGLTVAVEPPE
FT                   LETRVAILMNKANIESVALSDDVAFFLGRLIYSNVRELEGALRRVIAYSRFTRRPITME
FT                   LTREALKDLLALQEKLVTIENIQKTVAEYYKIRVSDLPSKRRSRAIARPRQIAMTLSKE
FT                   LTDHSLTEIGKSFGGRDHTTVLHACRKIDELKRTDRRVAEDYQNLLKRLST"
FT   gene            1893..2996
FT                   /locus_tag="Nhal_0002"
FT   CDS_pept        1893..2996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: noc:Noc_0002 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13224"
FT                   /db_xref="GOA:D5C436"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5C436"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADE13224.1"
FT                   /translation="MQFSIEREEIVRHLATVCGVVERRHTLPILFNVLLSVEEDRLSLT
FT                   ATDLEVEIRTTLEVLHPKGGKTTVSARKFLDICRALPARAELEVQHEKGQFHVHSGHSR
FT                   FTLSTLPAEDFPSTDSLEEVVELELTQAELKQLLHRTVFCMAHQDVRYYLNGLLLELGE
FT                   ETVYAVATDGHRLAVASLEKGPRREGVQIQSIIPRKAVLELVRLLEESNEPVRLKFGTN
FT                   QMGAEFQGLSFSTKLIDGQFPDYKRVIPVGCEKRFVADREQFKQALGRVNILTNDKYRG
FT                   VRLHLSNLKLQATVTNLEQESAEEELEVEYQGESFEIAFNNSYLIDVLNIINTEQVKLE
FT                   FTNANSSCLITPIGEVGSKYVVMPMRL"
FT   gene            3055..4143
FT                   /locus_tag="Nhal_0003"
FT   CDS_pept        3055..4143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: noc:Noc_0018 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13225"
FT                   /db_xref="GOA:D5C437"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D5C437"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADE13225.1"
FT                   /translation="MHIAHLDIRNFRNLEHIEFYPAKGLNIFTGANGSGKTSLLEAIYL
FT                   LGLGRSFRSSQLASVVRGNMKSLRVVARVKQTTDAFQIVGVEFSSTGFRARINGNAVKR
FT                   RSQLAAQLPLLYMSSYSHLILDGGPRYRRQWLDWGLFHLESNFRDLWWRYHRALKQRNH
FT                   ALRTQMPSWRREIDAWDRELATYGEQVTSFREAILSQLQESVSQLFAVLAHQVGPVTME
FT                   FKRGWSRTIALGEVLKATLDYDRAAGYTRYGPHRAEVAFYASGKDVRDILSRGQQKVFC
FT                   YSLALGQVELLCKIKEQHCIFLIDDFTSELDADHRRRVLALLNQLGIQVFVTTVETLDN
FT                   ELKAYPDSQQFHVELGKLRKMV"
FT   gene            4168..6585
FT                   /locus_tag="Nhal_0004"
FT   CDS_pept        4168..6585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: noc:Noc_0019 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13226"
FT                   /db_xref="GOA:D5C438"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D5C438"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADE13226.1"
FT                   /translation="MKASTAYDSSHIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGFCNEVSVIVHSNDTVTISDNGRGIPTDIHHEEGRSAAEVIMTVLHAGG
FT                   KFDHNSYKVSGGLHGVGVSVVNALSSTLFLEIHRDGQVYQQHYRDGVPQAPLTTVGSTK
FT                   HSGTTIRFSPSPKIFSNIVFNFDIFAKRLRELAFLNAGVRILLEDERVGRKEEFLYEGG
FT                   IQAFVEHLNKNKTPLHDNVFYFQGERDDVVVELAMQWNDSYQEHFFCFTNNIPQRDGGT
FT                   HLAGFRSALTRTLNQYIEREALAKKTKVSTTGDDAREGLTAVLSIKVRDPKFSSQTKEK
FT                   LVSSEVKPVVDALVSEYFQSFLLEHPADAKAIGSKMIDAARAREAARKARELTRRKGAL
FT                   DMAGLPGKLADCQERDPTLSELFVVEGDSAGGSAKQGRDRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSAEVATLITALGCGVGREEYNPDKLRYHRIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPELVERGHIYIAQPPLYKVKRGKQERYIRDDAEMERYLINLAIDNAKIYSEPGATPI
FT                   EGETLLTLVTDYFQLKGAIERLSQRYDPLLLDQTLYLDTVSTELVTEVKRLEVWAAQLE
FT                   SRANSAARDGVRYEIEVTTPVENQVPILQVKITRHGVTTYQRFSMDFFASPDYQHIQKL
FT                   GKPLVKLITTESYVQRNDKQQPVSSIQGAVNWLMEEARRGQAVQRYKGLGEMNPDQLWE
FT                   TTMNPATRRLSQVRIEDAIAADEIFTTLMGDHVEPRRDFIEANALNVAHLDV"
FT   gene            complement(6687..8009)
FT                   /locus_tag="Nhal_0005"
FT   CDS_pept        complement(6687..8009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0005"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mca:MCA1918 NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13227"
FT                   /db_xref="GOA:D5C439"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5C439"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ADE13227.1"
FT                   /translation="MATEKAGNSKHKIIVVGGGAGGLQLATKLGKKLGKTGLAEIILIE
FT                   VSPTHIWKPLLHEVAAGTLDSHEDEIEYLAQAAWSHFRYRRGRMDGLDRQKREISVAPT
FT                   YNQKGEEIIPRRNFNYDTLIIAVGSVSNDFGITGVQEHCLFLDTTQQAEYFQRQIIESY
FT                   LRAHARGKPMASGELDVAIVGGGATGIELAAQLHAVSRLFTAYGLEVKPADIKLSIIEA
FT                   APRLLPGLPSRISGSTEKQLGKLGVEILVNERVIEVTEKGIQTQSGRFIPARIKVWAAG
FT                   IKAPDFLKDINGLETNKLNQLVLRPTLQTTRDENIFALGDCAACPWKNHEGVVPPRAQA
FT                   AHQQAQLLYKNIRNQLEGKPLQEYHYRDYGSLVSLGGYSTVGNLMGNITGSIMIEGLIA
FT                   RLVYLSLYKMHQMALFGPFRTTMLTISHLFRRSVHPKIKLH"
FT   gene            8150..9562
FT                   /locus_tag="Nhal_0006"
FT   CDS_pept        8150..9562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0006"
FT                   /product="dihydropteroate synthase DHPS"
FT                   /note="PFAM: dihydropteroate synthase DHPS; KEGG:
FT                   mca:MCA1245 pterin-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13228"
FT                   /db_xref="GOA:D5C440"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D5C440"
FT                   /inference="protein motif:PFAM:PF00809"
FT                   /protein_id="ADE13228.1"
FT                   /translation="MREHILFLTGKLAEPSLCKILKAMEPVDFDYTVKQLGLSVAALMT
FT                   AEMVERRLTETGEATRILVPGRCRGDLEKLSKKLGLPVERGPNELKDLPAYFGRSGPAP
FT                   DLSRYKVCLFAEIVDAPQQSVQGILDRAAYYRSCGADVIDLGFLPSEPFDHLEEAIQAL
FT                   KAEGYCLSADSLEPEDLIRAGKAGVDYLLSLTEKTLYIADEVGSTPILVPAARGDLPSL
FT                   ERAMESLDKQGRAWLADPILEPIHFGFMDSLARYHELRRRYPQAPLLMGVGNLTELTDA
FT                   DTTGINAILFGIISELGISAILTTEVSSHARRAVREADLARRIMYAARENNALPQNIDD
FT                   GLLCLHERRPFPDSSKEIAELAARVRDPSYRIRISQEGIHIFNRDGIHRAQDPFDLFPH
FT                   LAVAGDAGHAFYLGIELARAQIAWQLGKRYSQDEELDWGCAYEQETEDLMEQKPPGTTL
FT                   QNSKRGEGNGKA"
FT   gene            9549..10133
FT                   /locus_tag="Nhal_0007"
FT   CDS_pept        9549..10133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0007"
FT                   /product="protein of unknown function DUF447"
FT                   /note="PFAM: protein of unknown function DUF447; KEGG:
FT                   mfa:Mfla_1580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13229"
FT                   /db_xref="GOA:D5C441"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5C441"
FT                   /inference="protein motif:PFAM:PF04289"
FT                   /protein_id="ADE13229.1"
FT                   /translation="MARLESKIHEVILTTLSEDGQIHAAPMGIWEEKGNFIVAPFKPST
FT                   TYNNLSRYPECVVNYTDDVRVFAGSVTGRRHWPTQAATRVYGGVLVQALAHSELRVTQL
FT                   QDTDPRAHFYCRVIYEANHRPFRGFNRAQGAVIEAAVLVSRLHLLPFDKIERELKYLQI
FT                   AVDKTGGPREWEAWEWLMEQVQHYRGEEMKS"
FT   gene            10130..10810
FT                   /locus_tag="Nhal_0008"
FT   CDS_pept        10130..10810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0008"
FT                   /product="protein of unknown function DUF556"
FT                   /note="PFAM: protein of unknown function DUF556; KEGG:
FT                   noc:Noc_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13230"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="UniProtKB/TrEMBL:D5C442"
FT                   /inference="protein motif:PFAM:PF04476"
FT                   /protein_id="ADE13230.1"
FT                   /translation="MNRWLASVRNLEEVSSLLAEGPDIIDLKEPKEGALGALSSETICQ
FT                   AVALIGGRCPTSATIGDLPMEPAPICHAVEQIAATGVNYVKIGLFPDDRVPDCLIALQP
FT                   LAVQGISLVGVMFADKRPDFSWISLMEKVGFTGAMLDTAAKDGHNLLSHLSLAELSGFV
FT                   QTARSGGLVSGLAGSLSFEDIPKLLPLGADYLGFRSALCCAGQRQSSLDPKAIALLKRA
FT                   LNRR"
FT   gene            complement(10929..12113)
FT                   /locus_tag="Nhal_0009"
FT   CDS_pept        complement(10929..12113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A1535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13231"
FT                   /db_xref="GOA:D5C443"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:D5C443"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A1535"
FT                   /protein_id="ADE13231.1"
FT                   /translation="MSQPGIPSATAPRIVSVDLLRGIVMVIMAIDHVRNFFSPFPYPPE
FT                   DLSQASAGLFLTRWITHFCAPVFIFLAGTSAYLYRHNRSCSHHELARFLVTRGLWLIFI
FT                   ELSVINLSWTFGWYPYLFVQVIWAIGWSMIFLAGMLYLPFWVSMGSALTMIVGHNLLDP
FT                   IQAQQFGDWSIFWNILHEMGGQPVPIINYFFVAYPLIPWLGVMVAGYGFGRLVTLPADH
FT                   RNPLLYKLGLGLVAAFIILRGFNLYGDPEPWQPSERGLLFSVLEILNTEKYPPSLAYLL
FT                   MTLSPAIALLPLIEKWRGRLADGVKIFGQVPFFYYLVHLLLIHILAMLWIRWTFGTWDR
FT                   LRYLSQSGGFPESYEPSLLRVYLVWIMVVGALYPLCRWYAHLKKRSQSWWLSYL"
FT   gene            12577..14280
FT                   /locus_tag="Nhal_0010"
FT   CDS_pept        12577..14280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0010"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 1; multicopper oxidase type 2; KEGG:
FT                   noc:Noc_2506 multicopper oxidase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13232"
FT                   /db_xref="GOA:D5C444"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:D5C444"
FT                   /inference="protein motif:PFAM:PF07732"
FT                   /protein_id="ADE13232.1"
FT                   /translation="MSWPNLYEVKSKMVPRRFLVVFFLVVILFGAGLLAFPIGKNAYQP
FT                   PPPTAKFDLSKLETEPVCPEVDPLWRKSQVIDGVLIEESPLCHPDNPALVAAFVKGTNN
FT                   ISHDTLMESGLAMDAVTKGEDLDGDGDPDVIEIRLEVAELNGRSPDYAEPIPGYFIAPG
FT                   IQPGFWAFVPKTHGMSTENFESLKANPLLRLPSPTIRVEAGDRIRIILENTHYLPHTIH
FT                   FHGVDHPYMNGMGKGNDGVPETSHRPVMPGESFIYEMKPRQTGTMLYHCHEQAPVHVML
FT                   GLMGMFVVEENRPNNWVQTLNVGAGQVRHPSVAVKENYDREYDLIYQEVDQDLNNLIRT
FT                   ANDPRLIAKATTRGYDMTEGTPDYFLLNGQSFPYTLRESLIVVNANERVKLRLANGGDD
FT                   KYIAIHSHGHRMRITHYDGIEHNPEAQVTRDVADLSPAQRLDLVLTTIDDGLHSFGEGV
FT                   WMFHDHQEKALTSDGMYPGGGITLIVYRSYLGENYMPLLHGVDIKPFFSKAFYERKVPA
FT                   WSSYDEAGMLGDPELVTGFVSIRSLSLTFLAGLLLGGIVIVMGALKRRAS"
FT   sig_peptide     12577..12684
FT                   /locus_tag="Nhal_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.891 at
FT                   residue 36"
FT   gene            complement(14406..15413)
FT                   /locus_tag="Nhal_0011"
FT   CDS_pept        complement(14406..15413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0011"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: noc:Noc_0021
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13233"
FT                   /db_xref="GOA:D5C445"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D5C445"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ADE13233.1"
FT                   /translation="MHSGTFLTQFIIEEQRSIPNATGDFTGLLNDIVTACKTISHLVNR
FT                   GGLIDILGAAGTENVQGEGQKKLDVISNEVMVKSLEWTGHLAAMASEEVEGIISIPSQY
FT                   PKGKYLLLFDPLDGSSNIDVNISVGTIFSILRCPDGVPEPTEKDFLQPGTQQVCAGFCI
FT                   YGPTTMMVLTTGHGVNGFTLDQDIGEFILTHPNMTIPEDTGEFAINMSNQRFWEAPVQR
FT                   YIEECIQGKEGPRGKNFNMRWVASMVAEVYRILTRGGIFMYPWDSRDPSKPGRLRLMYE
FT                   ANPMSFIVEQAGGASSTSQQRILEVDPEGIHQRVPVILGSKNEVERVVAYHQEA"
FT   gene            complement(15773..16597)
FT                   /locus_tag="Nhal_0012"
FT   CDS_pept        complement(15773..16597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0012"
FT                   /product="formylmethanofuran dehydrogenase subunit C"
FT                   /EC_number="1.2.99.5"
FT                   /note="KEGG: noc:Noc_0022 formylmethanofuran dehydrogenase;
FT                   TIGRFAM: formylmethanofuran dehydrogenase subunit C; PFAM:
FT                   glutamate synthase alpha subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13234"
FT                   /db_xref="GOA:D5C446"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D5C446"
FT                   /inference="protein motif:TFAM:TIGR03122"
FT                   /protein_id="ADE13234.1"
FT                   /translation="MNTLTLTLKTAPPQGVDVSPLTPENLAGLSKAEIGSIALVTGNRR
FT                   LRVDELFEISGDNTKHLVFTGETALLDYLGKNLSGGQIEVQGPCGAYAGMGMNAGQINV
FT                   RGNSGAFAGCEMGGGLLRIEGNSGDFLGAARPGNKIGMAGGTVIVSGNVGARAGDHMRR
FT                   GTLLIEGNAGDYLGSRMLAGTIAVLGKTGNYPGYGMKRGTLLLWQAPAKLSATFNDCGR
FT                   HTLGFLPLMLKSYQNLETRFTTLTKTGRVHRFCGDMATLGHGEILIQIQETA"
FT   gene            complement(16689..17585)
FT                   /locus_tag="Nhal_0013"
FT   CDS_pept        complement(16689..17585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0013"
FT                   /product="formylmethanofuran/tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /EC_number="2.3.1.101"
FT                   /note="KEGG: mca:MCA2858 tetrahydromethanopterin
FT                   formyltransferase; TIGRFAM:
FT                   formylmethanofuran/tetrahydromethanopterin
FT                   N-formyltransferase; PFAM: formylmethanofuran:
FT                   tetrahydromethanopterin formyltransferase (Ftr)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13235"
FT                   /db_xref="GOA:D5C447"
FT                   /db_xref="InterPro:IPR002770"
FT                   /db_xref="InterPro:IPR014053"
FT                   /db_xref="InterPro:IPR022667"
FT                   /db_xref="InterPro:IPR023447"
FT                   /db_xref="UniProtKB/TrEMBL:D5C447"
FT                   /inference="protein motif:TFAM:TIGR03119"
FT                   /protein_id="ADE13235.1"
FT                   /translation="MIINGVKIDPSFAEAFPMKATRVIITAQNLKWAHHSAQAMTGFAT
FT                   SVIACGCEAGIERELDPSETPDGRPGVAVLVFAMGGKGLAKQLETRAGQCVLTSPTSAL
FT                   FAGIHEGEALPLGKNLRFFGDGFQISKLINGRRYWRVPVMDGEFLTEETVGMIPAIGGG
FT                   NFLVLAQSQPQALAACEAAIAAMEKIPNVIMPFPGGVVRSGSKVGSKYKGLNASTNEAF
FT                   CPTLKGQTRTELSAEIESVMEIVIDGLSEEDIQKAMRAGISAACSLGAQNGISRISAGN
FT                   YGGKLGPFHFHLQEIMA"
FT   gene            complement(17582..19249)
FT                   /locus_tag="Nhal_0014"
FT   CDS_pept        complement(17582..19249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0014"
FT                   /product="formylmethanofuran dehydrogenase subunit A"
FT                   /note="TIGRFAM: formylmethanofuran dehydrogenase subunit A;
FT                   PFAM: Amidohydrolase 3; KEGG: noc:Noc_0024 DNA/RNA
FT                   non-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13236"
FT                   /db_xref="GOA:D5C448"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5C448"
FT                   /inference="protein motif:TFAM:TIGR03121"
FT                   /protein_id="ADE13236.1"
FT                   /translation="MLIKLTGGTVYDPMHGINGEVRDIYVRDGRIVDSPGDLPIDQNYN
FT                   LSNKIVMAGAIDMHTHIGGGKINIARTLLPEDHRADPLARTDLLRAGCGHAVPSTFTTG
FT                   YRYAEMGYTAAFEPAVLPTNARQAHMEMGDIPIVDKGGYVLLGSDDYVLRMLAANKDQK
FT                   AFNDYVAWTLKASQCLGIKVVNPGGISAFKFNQRKLDLDEPGPHYGATPRQVLLHLARA
FT                   VHELGVPHPLHVHGCNLGVPGNIETTLNTIQGIEGLPMHLTHVQFHSYGTEGDRKFSSG
FT                   AAQIAEAVKEHPNITIDVGQILFGQTVTASGDNMRQYAGHRHAHPKKWVCMDIECDAGC
FT                   GIVPFKYRDKSFVNALQWAIGLEIFLLVDDPWRVFLTTDHPNGAPFVTYPHLIRLLMDR
FT                   SFRNDMLATIHPDSAQASTLGAIDREYSLYEIAVITRAGAAKLLGLSDRGHLGVGAAAD
FT                   ITVYTEHEDKEKMFSKPDYVFKDGELVVKNGEVVKVTWGTTHVVRPEFDNNIEKELASY
FT                   FDRYLSIKLSNFKIDDEEIVHPGRGRIQVHPCHGGAFR"
FT   gene            complement(19284..20561)
FT                   /locus_tag="Nhal_0015"
FT   CDS_pept        complement(19284..20561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0015"
FT                   /product="formylmethanofuran dehydrogenase subunit B"
FT                   /EC_number="1.2.99.5"
FT                   /note="TIGRFAM: formylmethanofuran dehydrogenase subunit B;
FT                   KEGG: noc:Noc_0025 formylmethanofuran dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13237"
FT                   /db_xref="GOA:D5C449"
FT                   /db_xref="InterPro:IPR016457"
FT                   /db_xref="UniProtKB/TrEMBL:D5C449"
FT                   /inference="protein motif:TFAM:TIGR03129"
FT                   /protein_id="ADE13237.1"
FT                   /translation="MTRQIQPGVWDEVPSPFCGIAADDLKVKVEGNRLTVLENGCPVTQ
FT                   PAFEQKIGESTPQIQGKATRLETAIARAVEILSQAKLPLISGLATDVEGIRAALALADR
FT                   YGAVVDHMDSEAALRNILALQDSGWITTTLSEVKNRVDLLLVVGSDIETHFPRFFERYI
FT                   WNPETLFNQDTAQREIIYLGKSPSGQAAYGPDGRAPLVIHCKQEELPEVVAALRAQVAG
FT                   HLLQAEAVAGIAMEELAALADRLKQAQYGVVTWAAGQWTFPHAELTIQMLCELIMALNK
FT                   TTRCSGLPLGGQNGQITANQVCTWQTGYPVRTSFARGYPDYDPYHCSSERLLESGAADA
FT                   LVWISAFDQGRTPPATSIPTVVLGRAGMDFNQAPEVFIPIGTPGIDHPGHTYRSDNVVA
FT                   VPLRQLRQSGLPSTAEIVNAMLQYNR"
FT   gene            complement(20570..20947)
FT                   /locus_tag="Nhal_0016"
FT   CDS_pept        complement(20570..20947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0016"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: msl:Msil_2406 transcriptional
FT                   coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13238"
FT                   /db_xref="GOA:D5C450"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:D5C450"
FT                   /inference="protein motif:PFAM:PF01329"
FT                   /protein_id="ADE13238.1"
FT                   /translation="MTEQVKERTYTEEEIEERLKKELPHWYYEKGWIRRKYRTNSWKGT
FT                   LMVINAVGHLAEAAWHHPDLTASYAWVEVRLVNHHAKGVTDKDFTLAKKIEEVIQWQPG
FT                   KEEGPLEGTPDDPRFKYIKYD"
FT   gene            complement(21012..21623)
FT                   /locus_tag="Nhal_0017"
FT   CDS_pept        complement(21012..21623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0017"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: noc:Noc_0026
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13239"
FT                   /db_xref="GOA:D5C451"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D5C451"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADE13239.1"
FT                   /translation="MPPNKRRRRTSSGQTSKPWSWLIAGLLVGALVMFLPSLQNWLPWI
FT                   GKSADNTPPVENAIEAQKASTEQSTTPRFEFYTLLPKMEVAVPEPKPLSSQQQPKPQPK
FT                   APPEPSPKPTPKPSPSKSVPSQVYVLQAGSFRSYAQADKRKADLALMGVEATIQTVTIG
FT                   NSKTWHRVRIGPSSNLPNLQRIRQQLRKNQIECQMFKVKS"
FT   sig_peptide     complement(21504..21623)
FT                   /locus_tag="Nhal_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.763 at
FT                   residue 40"
FT   gene            complement(21627..23384)
FT                   /locus_tag="Nhal_0018"
FT   CDS_pept        complement(21627..23384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0018"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: noc:Noc_0027 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13240"
FT                   /db_xref="GOA:D5C452"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D5C452"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADE13240.1"
FT                   /translation="MKEQLRKLIVTALSSLQQEGMLPHWDTHNIQVKRTRDKRHGDFAS
FT                   NITMMLAKEARQKPRDLAGLIVSRLPEHPWVEKVEIAGPGFINFTLALPAFQAVVSLVL
FT                   DQREDFGCSNLGQNKPVHLEFVSANPTGPLHVGHGRGAAYGDALARLLTTVGYKIHREY
FT                   YVNDAGRQMDILAASVWLRYLELCGETLPFPANGYRGSYVRDIAQVLKTEKDDIFHRPG
FT                   QEILDGLPPDAPTGDKEQYIDALIQKCKDLLGERGYRQVFDQGLNSILADIREDLAEFG
FT                   VTYDEWFSERHLMETGAVEQAVEQLKTSSHLYQKEGAWWFRSTDFGDEKDRVVIRENGQ
FT                   PTYFASDIAYHLNKLERGYPKIIDVWGADHHGYVQRVKSSLQALGADPQQLEIRLVQFA
FT                   ILYRGKEKVQMSTRSGEFVTLRELRQEVGKDAARFFYVMRSAEQHMDFDLELAKSQSNE
FT                   NPVYYVQYAHARISSVFRQLEERGLAWDPKQGRKQLQKLNESHEVALLDRLSCYSEVVE
FT                   DAATQSAPHLLAYYLMDLARDFHTYYNAHTFLVDTPELRDARLTLIAATQQVIKNGLTL
FT                   LGVSAPEAM"
FT   gene            complement(23489..25702)
FT                   /locus_tag="Nhal_0019"
FT   CDS_pept        complement(23489..25702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0019"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: noc:Noc_0028 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13241"
FT                   /db_xref="GOA:D5C453"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D5C453"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ADE13241.1"
FT                   /translation="MVTPPTILRLAIPSPLRRYFDYLPPAGVPRQQLQPGIRLQVPFGR
FT                   RTVVGILARVVSQSPITADKLRQAQYCLDKTPIIPPSLLQLLTWATEYYHHPPGEVFFS
FT                   ALPQHLRQGKPAAPPVYRRWFLSPKGRAAELATLNRAPRQQQLVELLRPYPEGLTSSQI
FT                   KEQLGACQSSLRSLIAKGWVHSQEELLCKDKEPLKEQLRHQLNDDQKAAVTTLLAAQQQ
FT                   FQPFLLEGVTGSGKTEVYLQAIEKIITHNRQALVLIPEIGLTPQIVERFRRQLQAPIAV
FT                   LHSALSDRERLAAWLAAYEGRAAVVIGTRSAIWTPLQHLGIIIIDEEHDPSFKQQEGFR
FT                   YHARDLAIMRAYQAKIPVVLGSATPSLESLDNVKRRRYSLLRLSQRAGPAQTPRIQLID
FT                   VRSRPLEAGISPSMLAALKHHLGQGNQALLFLNRRGFAPTLICHECGFVVPCRRCDAYM
FT                   TVHQRTDRLLCHHCGAEYPLPTSCPQCENPLLRPRGLGTEQVETGLKTFFPEVEIARID
FT                   RDTTRRVGTLNEMLEGVHSGKYRLLIGTQMLAKGHHYPNITLVGILDADQGLFGSDFRA
FT                   GEHMAQLILQVMGRAGRGNKPGEVLIQTHHPGHPLLTALVDHGYRHVAEILLEERRQIG
FT                   FPPLGYLVLLRARAVSPAAPMIFLEAARKLATEFNSQGITLLGPVPAPMERRAGRYRAQ
FT                   LLLQGNSRTHLQRLLAAWVPELEHLKAARKVQWSLDVDPVDLM"
FT   gene            complement(25798..26358)
FT                   /locus_tag="Nhal_0020"
FT   CDS_pept        complement(25798..26358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0020"
FT                   /product="DJ-1 family protein"
FT                   /note="TIGRFAM: DJ-1 family protein; PFAM: ThiJ/PfpI domain
FT                   protein; KEGG: noc:Noc_0029 DJ-1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13242"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5C454"
FT                   /inference="protein motif:TFAM:TIGR01383"
FT                   /protein_id="ADE13242.1"
FT                   /translation="MINVLIPLAQGCEELEAITLIDLLRRAGIQVVTAGLDEQVVTASR
FT                   GTRLIPDTSLDKVVQQEFDMVVLPGGQPGADNLNADPRIHALLKHTVERGKLTAAICAA
FT                   PTVLAKAGLLDSKRATGYPGFLDKLNLPTTTLEDQAVVVDGPVVTSKGPGTAMDFALTL
FT                   IELLVGKETRDEVEKALQRPVGS"
FT   gene            complement(26481..27794)
FT                   /locus_tag="Nhal_0021"
FT   CDS_pept        complement(26481..27794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0021"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: noc:Noc_0030 peptidase S41A; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13243"
FT                   /db_xref="GOA:D5C455"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D5C455"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADE13243.1"
FT                   /translation="MPFSKRDLLIMTLGLVLGVSLVFGQMVLAERSENESKSLPLEELR
FT                   IFSEVFGQIKRSYVELVDDKTLIEDSIRGMLAGLDPHSAYLDPEAYKELRIGTSGKFGG
FT                   LGIEVGMEDGFVRVVAPIDDTPAQKAGIKAGDLIIRIDDTPVKGMSLSEAVQRMRGKPG
FT                   TDIILTIIREGEEQPLKFTITRAVIKVKSVKNRTLEEGYGYIRVSQFQTQTASNVQNAI
FT                   EKLKEENSGKLKGLILDLRNNPGGVLSAAVEVSDAFLEKGVIVYTEGRDLESKQRFRAT
FT                   SGDILDNSPIVILVNGGSASASEIVSGALQDHRRAIVVGSRTFGKGSVQTILPLTENTA
FT                   LKLTTARYYTPSGRSIQAEGIVPDIELESVKVSASNPAEFNPVRESDLSRHLSNGNKAE
FT                   ETKDNPQEDNKNSLATEDYPLYEALNLLKGLSILAAEQ"
FT   sig_peptide     complement(27705..27794)
FT                   /locus_tag="Nhal_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.703 at
FT                   residue 30"
FT   gene            complement(27992..28156)
FT                   /pseudo
FT                   /locus_tag="Nhal_0022"
FT   gene            complement(28315..29868)
FT                   /locus_tag="Nhal_0023"
FT   CDS_pept        complement(28315..29868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0023"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: BPG-independent
FT                   PGAM domain protein; metalloenzyme domain protein; KEGG:
FT                   noc:Noc_0031 phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13244"
FT                   /db_xref="GOA:D5C456"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:D5C456"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ADE13244.1"
FT                   /translation="MSISPRPLTLVILDGWGYSEETTSNAIQAAHTPVWDTLWNHYPHT
FT                   VIRASGAEVGLPNEQMGNSEVGHLNLGAGRVVYQEYTRVNRAIRTGSFFTNRTLTEAVD
FT                   KAVQSGKAVHILGLLSPSGVHSHEEHIHAMVELAVKRHCHQVYLHAFLDGRDTAPKSAQ
FT                   TSILAMQDKFTELGHGRFASLIGRYYGMDRDHRWPRIQAAYDLIAAGQAEYEAENAEQA
FT                   LAMAYERGETDEFVRATRIASPSKPPVRVEDGDVIIFMNFRSDRARQITRAFIEPNFTG
FT                   FERTYWPKLAQFVSLTEYSKDFDIPVVFPSEKPKNTLGQVLAETGLHQLRIAETEKYAH
FT                   VTFFFNGGREQPFEGEDRILIPSPQVATYDQKPEMSAVEITDSLVEAIDSGKYDVIICN
FT                   YANPDMVGHTGNFNAAVKAIEALDECLGRVWAALQSAGGELIITADHGNAEKMYDAQSD
FT                   QPHTAHTHNGVPLIFASKRSAIVSANGSLADVSPTMLYLMGIEPPPEMSEHRLIELRST
FT                   "
FT   gene            30657..31388
FT                   /locus_tag="Nhal_0024"
FT   CDS_pept        30657..31388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0024"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: noc:Noc_0032 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13245"
FT                   /db_xref="GOA:D5C457"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5C457"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADE13245.1"
FT                   /translation="MDTNRLFEFLTNHWMLSLLLVVILLALVIDPLLRRLRGIKTVSAV
FT                   EATRLINQENAQVVDIREEKEFDKEHVLDSINLPFSNFLKRLDSLDKFKGRPLLVIWGT
FT                   GQRAFYVATQLSLQGHKTIYVLQGGIETWKEAKMPLFSGNTKAHKAKAKVQAQAEAPAQ
FT                   AETPAQAETPAQAETPAQAETPAQAETPAQAETPAQAETPAQAEAPAQTKMSDQPRASK
FT                   RARGGKGKKARGSKKAKARRS"
FT   gene            31392..31649
FT                   /locus_tag="Nhal_0025"
FT   CDS_pept        31392..31649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0025"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   noc:Noc_0033 glutaredoxin GrxC"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13246"
FT                   /db_xref="GOA:D5C458"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5C458"
FT                   /inference="protein motif:TFAM:TIGR02181"
FT                   /protein_id="ADE13246.1"
FT                   /translation="MPKVVMYTTAWCPYCIGARRLLDDKGIGYKEIRVDLEPEQRAIMI
FT                   DRSRRRTVPQIFIDDQSIGGFDDLVRLDRARELDTLLGLA"
FT   gene            31710..32213
FT                   /locus_tag="Nhal_0026"
FT   CDS_pept        31710..32213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0026"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: noc:Noc_0034 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13247"
FT                   /db_xref="GOA:D5C459"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:D5C459"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ADE13247.1"
FT                   /translation="MAEESANQQSNEQNQQTQFVIQKIYVKDISFETPNSPQVFTQEWK
FT                   PEVNLQLSNENKRIAENVYEVILSLTVTAKLGDQTAFLAEVQQAGIFTLNGYSDQNLGP
FT                   LLSSYCPNILFPFAREVVADLVTKGGFPPLLLAPINFDALYAQRLKQQQQQQRQSAEAA
FT                   EVRH"
FT   gene            32236..33258
FT                   /locus_tag="Nhal_0027"
FT   CDS_pept        32236..33258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0027"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: noc:Noc_0035
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13248"
FT                   /db_xref="GOA:D5C460"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5C460"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ADE13248.1"
FT                   /translation="MGPQNGNECLKTLVVGAGSWGTALAILLARNQVPTLLWARDSAQV
FT                   AAMVHARHNDHYLPQVFFPPSLEPIADLEAALPQVTQVLVVVPSHSFRSVLERLAGHLP
FT                   DGIPLSWATKGLEPGTGRLLHEVVAEVLGPGWPMAVVSGPTFAQEVAAGLPTAVTIAAT
FT                   QSVVAARLASCLHGDNFRVYTSDDLIGVQLGGAVKNVLAIAAGIGDGLGFGANTRAALI
FT                   TRGLAELMRFALAYGAQRETLMGLSGLGDLVLTCTDDQSRNRRLGLALAQGKQLDEAQA
FT                   FIGQAVEGITAAKVVVAKARQLNVEMPIAEQVYQVLYAGRSPRQAVEALCSREQKPEYV
FT                   "
FT   gene            33276..34238
FT                   /locus_tag="Nhal_0028"
FT   CDS_pept        33276..34238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13249"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D5C461"
FT                   /inference="similar to AA sequence:KEGG:Noc_0036"
FT                   /protein_id="ADE13249.1"
FT                   /translation="MKSDDCHRSSWLRLPFFLFLALCLVACGGGSATKEEVEGSEEGRV
FT                   LWEAGEQYVRLNSSDRAVDNQHPAAVTAEEMRAALESLFVPERRFIRKKLNPIFSPGEV
FT                   QVLSAALAQGLALARPDQDITFVSIGIHQGTFAKVRKANTGRVFFKDDKLHIIFGMLHH
FT                   EVRDQDRETGAQIDRRLHPFVVGSRLYETKLSHTVALEEGQAFYLDPESGEEREDWLVL
FT                   DIPTLVAKPDQNTPDEHIDPTLLEDIARSKQETQNLKEDLANVKEVLFELKEDLLELQQ
FT                   GGGYATIEARLQSLKKLYDNGLINRDEYQVKRRELLNEL"
FT   sig_peptide     33276..33380
FT                   /locus_tag="Nhal_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.693 at
FT                   residue 35"
FT   gene            complement(34233..35420)
FT                   /locus_tag="Nhal_0029"
FT   CDS_pept        complement(34233..35420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0029"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   noc:Noc_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13250"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:D5C462"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ADE13250.1"
FT                   /translation="MISPHHHKDPLPLPNPAALAHSQKLQSIIREDIEQNGGQISFARF
FT                   MELALYKPGLGYYMSGLHKLGAAGDFITAPELSPLFARCLSRQCQQVLELLGSGEILEF
FT                   GAGSGRMAADLLAELDRRGQLPERYFILELSAELRQRQQQTLQQQVPHLAPKVSWLDRL
FT                   PDNIQGLVLANEVCDAMPVHCFQLEDEHSWERYVGYEGDSFVWKKGPLSHARLKERITE
FT                   IRLLLKQVNRYESEVNLAMENWVAEIAHRLQQGMLLIIDYGFPRQEYYHPDRTTGTLMC
FT                   HYRHRAHPDPLILPGLQDITAHVDFTALAEAGHNSGLRVAGYCSQTDFLLACGLDELAA
FT                   AEIAAGGYHALEISNQIKRLTLPSEMGELFKILALTRGIDPPLLGFSLRDRRTRL"
FT   gene            complement(35517..36005)
FT                   /locus_tag="Nhal_0030"
FT   CDS_pept        complement(35517..36005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0030"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   KEGG: noc:Noc_0038
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13251"
FT                   /db_xref="GOA:D5C463"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D5C463"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADE13251.1"
FT                   /translation="MARAYVSIGSNINRENNIRAGVDALRRRYGPLIISRVFESESVGF
FT                   QGDNFYNLVVGFDTNEPPQTIAHALHEIERACGRKRGGPRFAPRALDLDLLLYNDLVID
FT                   EPGLQIPRDDILNYAFVLQPLAEIAPRCHHPVLGKSYAELWATFDKSSNRLWPTDLKL"
FT   gene            complement(36011..36382)
FT                   /locus_tag="Nhal_0031"
FT   CDS_pept        complement(36011..36382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0031"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: noc:Noc_0039
FT                   dihydroneopterin aldolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13252"
FT                   /db_xref="GOA:D5C464"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D5C464"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADE13252.1"
FT                   /translation="MDIVYLNDLRIDTVIGIYDWERRIKQTISLDLEMATDVAKAAVSD
FT                   NIEDALDYKAVAKRMIDFIGNSEFLLVETLAERAAQIILNEFGVSWLRLKVDKQGAVRG
FT                   ARGVGVIIERCQPKEPAQP"
FT   gene            36465..37070
FT                   /locus_tag="Nhal_0032"
FT   CDS_pept        36465..37070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0032"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   noc:Noc_0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13253"
FT                   /db_xref="GOA:D5C465"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D5C465"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ADE13253.1"
FT                   /translation="MEKTTNNNMLTTLILLLIGYVVGSLSSAIIVARLAGLGDPRTQGS
FT                   GNPGATNILRLGSKRLAAVVLLGDTLKGILPVWLAWGIGVEAWVIAGVGLAAFWGHLYP
FT                   VFFGFHGGKGVATGLGVLLGFSWPLALAVLSIWLLVFWRWRISSLSALCAAALAPFLAW
FT                   WLVPETAIRVAVAVLAVFLLWRHQDNIRRLFSGQEGRV"
FT   sig_peptide     36465..36548
FT                   /locus_tag="Nhal_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.314 at
FT                   residue 28"
FT   gene            complement(37081..38088)
FT                   /locus_tag="Nhal_0033"
FT   CDS_pept        complement(37081..38088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0033"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: noc:Noc_0041 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13254"
FT                   /db_xref="GOA:D5C466"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D5C466"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADE13254.1"
FT                   /translation="MRVLGIETSCDETGVAVFDSKRGLLAHILYSQAELHADYGGIVPE
FT                   LASRDHIRKLLPLLRQVLGQADLSKQDIDGVAYTAGPGLIGALLVGAAVGRSLAWAWGK
FT                   PALAVHHMEGHLLSPLLEADSPDFPFCALLVSGGHTMLIAVSHIGAYRVLGESLDDAVG
FT                   EAFDKTAKLLGLGYPGGPALAKLAERGNPDRFHFPRPMLDRPGLDFSFSGLKTYALNTL
FT                   YEKGPEASADIARAFQDAVVETLTVKCRRALQQTGLKRLVVAGGVSANQALRERLKSMG
FT                   AQENAQVYYPRLAFCTDNGAMVAFAGCQRLLAGEQVGLGFKARARWSLDSLPEI"
FT   gene            38360..38575
FT                   /locus_tag="Nhal_0034"
FT   CDS_pept        38360..38575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0034"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; PFAM: ribosomal
FT                   protein S21; KEGG: noc:Noc_0042 ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13255"
FT                   /db_xref="GOA:D5C467"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D5C467"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ADE13255.1"
FT                   /translation="MPSIRVKENEPFDVAIRRFKRTCEKAGVLSEVRRREFYEKPTAVR
FT                   KRKAAAAVKRSMKKLARERARRTRLY"
FT   gene            38615..39085
FT                   /locus_tag="Nhal_0035"
FT   CDS_pept        38615..39085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13256"
FT                   /db_xref="GOA:D5C468"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D5C468"
FT                   /inference="similar to AA sequence:KEGG:Noc_0043"
FT                   /protein_id="ADE13256.1"
FT                   /translation="MVTEMGSLKARLQEEVKAAMRAKDKARLGVLRMIMATLKQFEVDT
FT                   RESLEDAQIIALLDKMMKQRREALEQYEAAGREDLAEKERFELDVIQSYMPTPLSEAEI
FT                   EQLIKEAIAQSQAVTIKDMGKVMGILKPRIQGRADMAVVSAKVKSQLTTAPS"
FT   gene            39193..40908
FT                   /locus_tag="Nhal_0036"
FT   CDS_pept        39193..40908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0036"
FT                   /product="DNA primase"
FT                   /note="KEGG: noc:Noc_0044 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: DNA primase catalytic core domain; zinc
FT                   finger CHC2-family protein; TOPRIM domain protein; DNA
FT                   primase DnaG DnaB-binding; SMART: zinc finger CHC2-family
FT                   protein; DNA primase DnaG DnaB-binding; Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13257"
FT                   /db_xref="GOA:D5C469"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D5C469"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ADE13257.1"
FT                   /translation="MGERFPQEFIDELVARTDIVELIDSRIPLRKAGREYVACCPFHNE
FT                   KTPSFTVSPQKQFYHCFGCGVHGTVIGFLIAFDRLSFIEAVEELAQRVGMTIPQGSDSA
FT                   HRNHHQGLYEVLSYTAEFYQQQLKTGTHQGRVKAYLQGRGLSHPIITEFGLGFAPSRWD
FT                   ALLRHTPLPLRSRLQTAGLVVDKGDGRCYDRFRDRVMFPIHDYRGRVVGFGGRLLGEGS
FT                   PKYLNSPETPLFHKGRELYGLYQVRQSVRHCDRLLVVEGYMDVLALAEHNIRYAVATLG
FT                   TATTPDHLTRLFRMTPVVVFCFDGDRAGYRAAWRALETALPLLSQGRQVQFMFLPQGED
FT                   PDTVVRAEGQAAFEARLEKATPLSDFLLSSLQRKVNLGSMDGRARLVELARPLVSKIPP
FT                   GVYRDMLLARLAEVAQVEQAALTRHLDQGKSPPVVPRQRLERGMAPLARKAVAILLQRP
FT                   NLIQSVDESFSLRGLDGRGAKLLQELIELLQSSPHLSTAALLERWRDSEMGRYLEQLAS
FT                   WELFLTDEDMGLELQAALRRLQAQAAEQRMTMLSNQPSLTAAERQELLALLAAK"
FT   gene            41043..42851
FT                   /locus_tag="Nhal_0037"
FT   CDS_pept        41043..42851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0037"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   non-essential domain protein; sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   1.2; sigma-70 1.1 domain protein; sigma-70 region 4 domain
FT                   protein; KEGG: noc:Noc_0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13258"
FT                   /db_xref="GOA:D5C470"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:D5C470"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ADE13258.1"
FT                   /translation="MEQDRQSQLKLLIARGKDRGYLSYSEVNDHLPDDVIDPEQIEDII
FT                   TMFNDMGISVHEDMAEADALAIMDTAVADDEAAEEAAAALVSVDGEFARTSDPVRMYMR
FT                   EMGSVELLTREGEIRIAKRIEEGMRQVHTALSLFPGSVAELLRQYERVEAGDARLADMI
FT                   SGFHEPEEEDIKEAVAEEEAVADSAEDSEEEENGGGPDPERAREQFVQLRELYRLRQEA
FT                   ASKDDGKALAELSEAMSECFLRFKLVPRLSLQLIEGLRAVVAGIRVLERTIMQIAVNEA
FT                   HMPRQDFLSSFQGQETNLNWVEKHIRAKKHYSSVLRKKGEAIRQAQEKLIALEQGAGMS
FT                   VAEIKEANRSLSIGEARARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLM
FT                   KAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRVSRQMLQ
FT                   EMGREPTPDELAERVDMPKDKVRKVLKIAKEPISMETPIGDDEDSHLGDFVEDAEVVSP
FT                   PDAAIFSGLRETTQQILAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQI
FT                   EAKALRKLRHPSRSEQLRSFLDMESQ"
FT   gene            42870..42945
FT                   /locus_tag="Nhal_R0001"
FT                   /note="tRNA-Met1"
FT   tRNA            42870..42945
FT                   /locus_tag="Nhal_R0001"
FT                   /product="tRNA-Met"
FT   gene            43607..43987
FT                   /locus_tag="Nhal_0038"
FT   CDS_pept        43607..43987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13259"
FT                   /db_xref="GOA:D5C471"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5C471"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13259.1"
FT                   /translation="MREGVKVTHASVARRMGVKVGSVTQDLNEKYPVGQSAAERWAKFL
FT                   DMEPWDIHPGIKKPAVTNEKLMRTTIREVLDAADTMEADIDAETIGMIASKIYVDCEKN
FT                   EIYDVERIREKARTAIMFTTNK"
FT   gene            complement(44156..44359)
FT                   /locus_tag="Nhal_0039"
FT   CDS_pept        complement(44156..44359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0039"
FT                   /product="putative nuclease"
FT                   /note="KEGG: mpt:Mpe_B0143 putative nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13260"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D5C472"
FT                   /inference="similar to AA sequence:KEGG:Mpe_B0143"
FT                   /protein_id="ADE13260.1"
FT                   /translation="MKVIFFLSALLLTLANTTHIGKVVGISDGDTLTLLTSAKEQVKVR
FT                   LAEIDTTREGATLRQPGKAGSL"
FT   gene            45124..45558
FT                   /locus_tag="Nhal_0040"
FT   CDS_pept        45124..45558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tau:Tola_2854 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13261"
FT                   /db_xref="GOA:D5C473"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5C473"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13261.1"
FT                   /translation="MSDFLERWASEAESNRKICAREDLVVDVTEDLLIVMEDKGVSKSD
FT                   LAQSLSKSKSFVTQILSGSRNMTLHTLSDICFALNIKPKISFSNLNNGRCINGENRRFD
FT                   WERDEEYQESADILKLTEKRPREERKVTLNGHREDGLKYA"
FT   gene            45562..46086
FT                   /locus_tag="Nhal_0041"
FT   CDS_pept        45562..46086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tau:Tola_2853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13262"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:D5C474"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13262.1"
FT                   /translation="MSQELLNEAANHLVLGAIYLKGSQTFKEDNFSTSRKGQRIQHQSF
FT                   RGLLHCDIQSKEKNNKQVFLYKYIFSVGVRLVDSGLEEGDKGFVLVSIEAEFETNYLSD
FT                   KLLEEECIEAFGKLNVGYHVWPYWREYVQSTCARMGINPIVVPLYTDLQKKQKKGNYPK
FT                   KSKESSRKASD"
FT   gene            complement(46354..48051)
FT                   /locus_tag="Nhal_0042"
FT   CDS_pept        complement(46354..48051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0042"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; KEGG: noc:Noc_3064 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13263"
FT                   /db_xref="GOA:D5C475"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5C475"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADE13263.1"
FT                   /translation="MPHSVPLITTLAVALGLALALGFLTERIKLPALVGYLLAGILIGP
FT                   FTPGFVANVEIAAQLAEIGVMLLMFGVGLHLSLEELLAVRKIALPGAILQMAVATGLGM
FT                   GVATAWGWELGGAVVFGLALSVASTVVLLKALETHGVLESINGRIAIGWLVVEDIAMVL
FT                   VLVLLPPLAGWLGGNTPYAGETGLWWPLVVTLGKVAAFVALMLIVGRRFFPWLLWQIAD
FT                   TGSRELFTLCVVAAAVSIAYGATALFGVSFALGAFFAGMVLRESELSHRAAAESLPLRD
FT                   AFAVLFFVSVGMLFDPAVLIEQPLEVLAVVTIIIVGKSLAAAVLVSTFRYPLNTVLTVS
FT                   ASLAQIGEFSFILAGFGVSLGLLSVEGQSLILAGALISIALNPMVFKAIEPLQRWIRSR
FT                   SALARILERPDDPLAELPLSTEQKYLSKQVVLVGYGRVGRRIGDMLTKKGIPYVVAEQN
FT                   RELVEALREQGLPAVSGDASDPAVLIQAHIARARMLVVATPDTLNVRQMIKTARTLNPG
FT                   IETVVRTHNEEEARLLEQEEAGQVFLGESELATGMARHVLERLGKGKH"
FT   sig_peptide     complement(47989..48051)
FT                   /locus_tag="Nhal_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.715 at
FT                   residue 21"
FT   gene            complement(48447..49853)
FT                   /locus_tag="Nhal_0043"
FT   CDS_pept        complement(48447..49853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0043"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   noc:Noc_3063 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13264"
FT                   /db_xref="GOA:D5C476"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5C476"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADE13264.1"
FT                   /translation="MKLFRTKPIETDLAKDTGLKKVLGAFDLVLLGIGAIIGAGIFVLT
FT                   GIAAANHAGPAVVLSFVVAGMAVTFAALSYAELAASIGGAGSAYGYGYAGLGEFVAWVI
FT                   GWMLILEYSVAISAVSAGWAGYVDNVLAAMEIHLPEVLTKTPSQGGWINLPAMLIILAL
FT                   GTLLATGAKVSAQFNAIMVFVKVATILLFIGVAFFHVDINHWTPFMPFGWEGVMTGAAS
FT                   IFFAYIGFDAVSTAAEETRNPQKDLPIGILGSLAICTLLYMLVAALLTGIVPYPSLDVP
FT                   SPVSDALLQVGEKWASGMIAIGAIAGLTTVMLVLYFGLTRILFAISRDGLLPPFFSHIN
FT                   EKTGSPARVILLAGVAMATIAGFAPLNDIVELTNIGTLGAFVVVCAGVAVLRYTKPDLH
FT                   RPFRTPFSPIVPILGIAFCVYLMTNLGAETWTRFSLWLTAGLIIYFTYSYRHSKLAAPE
FT                   KSEPAHAPLE"
FT   gene            complement(49932..51530)
FT                   /locus_tag="Nhal_0044"
FT   CDS_pept        complement(49932..51530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0044"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; KEGG: maq:Maqu_3453 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13265"
FT                   /db_xref="GOA:D5C477"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5C477"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADE13265.1"
FT                   /translation="MEIIWIAVAYVLGLGASYFGLPPLVGYLIGGFVLGGWGISGGPVI
FT                   HTITELGVLLLLFGIGLKLDLKSLLQWEVLGIGATHLIALGIGFTLLFLTAKIAQSPAL
FT                   FLSLGLAFSSTVFAAKVLEEKGELGAFHGRLAIGILILQDLVAVGMLVAAENGALSLWT
FT                   PIFLLCTPLLRLPLKQALTWSGHSELLLLYGLLVALGGAHTFQALGLGTELGALVAGML
FT                   LADHSRSEELSKTLWGLKEAFLVGFFLQIGLEGLPNLQDSKWLLPLIIFLPLKAVLYFF
FT                   LGTLFGLRARTAFLTSLALFSYSEFLLIAAAVGAKNGILPSTWLPSLALLVTISFIIAA
FT                   PLSRASHTLFAYFERWLVRFERQVPHPDEEPQNVGQAKWLIVGMGRTGTAAYDLLTQRH
FT                   QRALGLDSDLVIVRQHLEEKRRVVYGDAEDPNLLEKISVNSLVGVILGMPDLEAKLRLS
FT                   KDLRQNGFQGMLAAMSFYPEEDAKLYENGINLIFHPFNEAGERLAERALAEANSITLKP
FT                   LPLNPMEKAPIRPPP"
FT   gene            complement(52257..52469)
FT                   /locus_tag="Nhal_0045"
FT   CDS_pept        complement(52257..52469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13266"
FT                   /db_xref="UniProtKB/TrEMBL:D5C478"
FT                   /inference="similar to AA sequence:KEGG:Noc_3062"
FT                   /protein_id="ADE13266.1"
FT                   /translation="MYLKHKPSSDLVEILDIKELVDPCRENITGRFHVGEEMQEPAPFQ
FT                   KADLIFPSGEQLPQCWIDPDYKQKV"
FT   gene            52651..52998
FT                   /locus_tag="Nhal_0046"
FT   CDS_pept        52651..52998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0046"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   noc:Noc_3061 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13267"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR016933"
FT                   /db_xref="UniProtKB/TrEMBL:D5C479"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADE13267.1"
FT                   /translation="MTEPQIKSDPLYLLLRNGEIEEFNRRVASGETYDLTHCDFRRADL
FT                   RGLVADGLDFSGSYFRQADLRGIDFSRSRLEGSSIHGAHIAGVYFPSELRPEEISLSLL
FT                   YGTRMRYLKAD"
FT   gene            complement(52995..53747)
FT                   /locus_tag="Nhal_0047"
FT   CDS_pept        complement(52995..53747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0047"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: noc:Noc_3060 sec-independent periplasmic
FT                   protein translocase, TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13268"
FT                   /db_xref="GOA:D5C480"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D5C480"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ADE13268.1"
FT                   /translation="MTAPESSDNEEQPLVSHLLELRNRLLRGIAAVLVMAVVLMPFAND
FT                   LYRLLARPLMAHLPETNSMIATEVAAPFLTPFKLTLVTAIMLSVPMLLYQIWAFVAPGL
FT                   YKNERRIILPLLASSTLLFFLGVAFAYFVAFPLMFGFFTQAAPEDIAVMTDISKYLDFV
FT                   LTMFFAFGIAFEVPVATVLLVWAGVTEVERLREKRPYIIVAAFVFGMLLTPPDIISQTL
FT                   LALPMWILFEAGLWFSRLFVPKNSVEES"
FT   gene            complement(53734..54045)
FT                   /locus_tag="Nhal_0048"
FT   CDS_pept        complement(53734..54045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0048"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: noc:Noc_3059 twin-arginine translocation
FT                   protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13269"
FT                   /db_xref="GOA:D5C481"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D5C481"
FT                   /inference="protein motif:TFAM:TIGR01410"
FT                   /protein_id="ADE13269.1"
FT                   /translation="MFDIGFWEILVILVILLVVVGPERLPTVARTTALWIRKARRFVSQ
FT                   IKQEVEEELRAEELRQSLKEDKDFLDLNETIGEAPPRKPNPPQDQGKHSPPKASNDGA"
FT   gene            complement(54065..54340)
FT                   /locus_tag="Nhal_0049"
FT   CDS_pept        complement(54065..54340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0049"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: noc:Noc_3058 twin-arginine translocation
FT                   protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13270"
FT                   /db_xref="GOA:D5C482"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D5C482"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ADE13270.1"
FT                   /translation="MGASGISIWQLLIILAIILLLFGTKKLRSIGADLGSAVKGFRNSL
FT                   RDEESHDTEEVQTIEDKQGQTKKTEGFSQKDHRDADFKVKSDNDLK"
FT   gene            complement(54422..54763)
FT                   /locus_tag="Nhal_0050"
FT   CDS_pept        complement(54422..54763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0050"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   noc:Noc_3057 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13271"
FT                   /db_xref="GOA:D5C483"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D5C483"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADE13271.1"
FT                   /translation="MGNTDCIFCKIIEGKIPATLVYEDDQVIAFKDIHPKAEVHLLLVP
FT                   RTHIPSLNELEIKHEGLISHMLLLLPHLAHRQGLQAGFRTIINTGRGGGQEVDHLHLHL
FT                   LGGNRMPGF"
FT   gene            complement(54756..55088)
FT                   /locus_tag="Nhal_0051"
FT   CDS_pept        complement(54756..55088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0051"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG: noc:Noc_3056
FT                   phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13272"
FT                   /db_xref="GOA:D5C484"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:D5C484"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADE13272.1"
FT                   /translation="MNDILERLAIILEERKNADPKHSYVANLYQAGQDKILKKLGEEAI
FT                   ETILAAKSMERDAIIHETADLWFHSLVMLADYGLRPEQVLNELDRRFGLSGLEEKANRG
FT                   KDNDDG"
FT   gene            complement(55085..55477)
FT                   /locus_tag="Nhal_0052"
FT   CDS_pept        complement(55085..55477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0052"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   noc:Noc_3055 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13273"
FT                   /db_xref="GOA:D5C485"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D5C485"
FT                   /inference="protein motif:PRIAM:3.5.4.19"
FT                   /protein_id="ADE13273.1"
FT                   /translation="MSSWLEEIAWNEEGLVPAIAQEVHTGQVLMLAWMNREALETTLQS
FT                   GHAVYWSRSRQRLWHKGEQSGHEQVIKAIHLDCDNDAVLLLVEQKGGIACHTGRHRCFF
FT                   KRLERDNWTSVEPVLKHPDSIYGKSG"
FT   gene            complement(55480..56253)
FT                   /locus_tag="Nhal_0053"
FT   CDS_pept        complement(55480..56253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0053"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: noc:Noc_3054 imidazole glycerol phosphate synthase
FT                   subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13274"
FT                   /db_xref="GOA:D5C486"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5C486"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADE13274.1"
FT                   /translation="MGLAKRIIPCLDVDNGRVVKGVRFVDIRDAGDPVEIARRYDEQGA
FT                   DEITFLDITASSDNRNTMVHVVEAIAAQVFIPLTVGGGIRSLEDIRRMLIAGADKVGIN
FT                   TAAVQRPEFVREAAERFGSQCIVVAVDAKRVSRADEPPRWEVFTHGGRKETGIDAVTWA
FT                   RRMVEFGAGEILLTSMDRDGTREGFDLLLTRTISEAVPVPVIASGGVGTLEHLAAGILE
FT                   GKADAVLAASIFHFGQHTIEEAKRHLLAHGIEMRL"
FT   gene            complement(56263..57003)
FT                   /locus_tag="Nhal_0054"
FT   CDS_pept        complement(56263..57003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0054"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: noc:Noc_3053 1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13275"
FT                   /db_xref="GOA:D5C487"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D5C487"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADE13275.1"
FT                   /translation="MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAMALHWAEAGIE
FT                   RLHLVDLDGAFAGQPVNADIIYNIAQALPDMDIQVGGGIRDGDTIQTYLDAGVRYVIIG
FT                   TKAINTPHFVADACLEFPGHVILGLDAREGKIAINGWSKLSRHNVVDIARHFEKDGVEA
FT                   IIYTDIQRDGMMKGVNIEATRELAEAVNIPVIASGGVSSLADIEALYRHEQDGIAGAII
FT                   GRALYEGQIQLTEALALVKRLSAE"
FT   gene            complement(57059..57688)
FT                   /locus_tag="Nhal_0055"
FT   CDS_pept        complement(57059..57688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0055"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: noc:Noc_3052 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13276"
FT                   /db_xref="GOA:D5C488"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5C488"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADE13276.1"
FT                   /translation="MSSIAVIDYGMGNLRSVSKALEQVADKVRVEVTSDPQRIRAADRV
FT                   VFPGVGAIRDCMNELRHLNLDTIVAQCAADRPFLGICLGMQALLELSEENQGTSCLGIL
FT                   PGQVKHFDAAEEHLKVPHMGWNQVHQAHAHPLWRDIPQDCRFYFVHSYYTVPDEPSLIA
FT                   GRTDYSTSFASALARDNIFAVQFHPEKSQKYGLQLLANFLTWNGVS"
FT   gene            complement(57710..58303)
FT                   /locus_tag="Nhal_0056"
FT   CDS_pept        complement(57710..58303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0056"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   noc:Noc_3051 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13277"
FT                   /db_xref="GOA:D5C489"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D5C489"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADE13277.1"
FT                   /translation="MSSYTATVYRETLETRVEVALNLAGEGYFSAETGVPFLEHMMDQV
FT                   ARHGLFDLTVKASGDLHIDAHHTVEDIGITLGQALKQAIGDKTGIQRYGHAYVPLDEAL
FT                   SRVVLDLSGRPSLHYRVDYPRARIGDFDVDLFQEFFQGLVNHAAMTLHIDNLQGRNTHH
FT                   IAETIFKAFGRALRVAVEQDPRRKGQLASTKGTL"
FT   gene            complement(58471..58683)
FT                   /locus_tag="Nhal_0057"
FT   CDS_pept        complement(58471..58683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_3109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13278"
FT                   /db_xref="GOA:D5C490"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:D5C490"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_3109"
FT                   /protein_id="ADE13278.1"
FT                   /translation="MQSNDTPPTLVQVFKSVFSAMIGVQNRRNHERDFNHGRPTSFIFA
FT                   GIVAVTLFVLTLVGLVQLILHLAST"
FT   gene            58978..59298
FT                   /locus_tag="Nhal_0058"
FT   CDS_pept        58978..59298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0058"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: noc:Noc_3050 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13279"
FT                   /db_xref="GOA:D5C491"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5C491"
FT                   /inference="similar to AA sequence:KEGG:Noc_3050"
FT                   /protein_id="ADE13279.1"
FT                   /translation="MGKKNLFILLSAGVALLGSFTVQAAGDPEAGRQKAELCAGCHGIP
FT                   GWRNAYPAYSVPKLGGQHAEYLVAALKAYKSGDRNHPPMQGSAASLTEQDMLDIAAFLS
FT                   GQ"
FT   sig_peptide     58978..59052
FT                   /locus_tag="Nhal_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            59353..59691
FT                   /locus_tag="Nhal_0059"
FT   CDS_pept        59353..59691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0059"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: noc:Noc_3049
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13280"
FT                   /db_xref="GOA:D5C492"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5C492"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADE13280.1"
FT                   /translation="MLRRWLLLFVSVFAVLMSGSLLAAGDPAAGKQKSQACAACHGPDG
FT                   NSPAPQFPKLAGQHSDYLVHALTAYQTGERKNPMMQQMAAPLSEQDKEDLAAYYSSQKG
FT                   LSLGWKLK"
FT   sig_peptide     59353..59424
FT                   /locus_tag="Nhal_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 24"
FT   gene            59767..60327
FT                   /locus_tag="Nhal_0060"
FT   CDS_pept        59767..60327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13281"
FT                   /db_xref="GOA:D5C493"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:D5C493"
FT                   /inference="similar to AA sequence:KEGG:Noc_3048"
FT                   /protein_id="ADE13281.1"
FT                   /translation="MVLLAQSFDLNRLNTYNSAGLARAQGCNVISKQIEPHKNTLQFIL
FT                   QPNSSLSWQKMKLVFYAVAGVLGIISGAFSLLGLWLIFPFAGLELVVLGSAFYLCARRA
FT                   QRCEVITIDQNGIEIFRGRKANGERWRFHRQWVRVRVESAPHAWHMSHLMIGSHGHEVE
FT                   IGIFLTEEERLYLAKELRKVCSP"
FT   gene            61063..61893
FT                   /locus_tag="Nhal_0061"
FT   CDS_pept        61063..61893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0061"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; KEGG: noc:Noc_3047
FT                   cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13282"
FT                   /db_xref="GOA:D5C494"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D5C494"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ADE13282.1"
FT                   /translation="MGVSDKRSLFTVIAGAIGLFLMSGNASAELAVNLTEGITPSSKEI
FT                   YDLHMLIFWVCVGIGLLVYGIMAWSIYHHRKSKGVVASQFHENTTLEVLWTVIPFVILI
FT                   SIAVPATSAMIRLYDASDSELTIKVTGYQWRWRYDYVDHGFGFMSSLSTPFDQITNKSP
FT                   KGENYLLEVDNPLVLPVNKKVRFVITADDVIHAWWVPALGFKQDAIPGFINEAWAVIEE
FT                   PGIYRGQCTELCGRGHGYMPIVVEAKTQEEFDKWVSSQKAAQSSDTNGDSTESS"
FT   sig_peptide     61063..61149
FT                   /locus_tag="Nhal_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            62061..63650
FT                   /locus_tag="Nhal_0062"
FT   CDS_pept        62061..63650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0062"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: noc:Noc_3046 cytochrome c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit I; PFAM: cytochrome c oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13283"
FT                   /db_xref="GOA:D5C495"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5C495"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ADE13283.1"
FT                   /translation="MSTAVAHDDHAHHPTGIARWLFTTNHKDIGTLYLWFSLIMFFVGG
FT                   AMALVFRAELYSPGMQIVDPQKFNELVTLHGLVMIFGALMPALAGLANWQIPLMIGAPD
FT                   MALPRMNNWSFWILPFAAALLLGSMFVPGGGPAGGWTMYPPLFAQGGAGIDMTIFSVHL
FT                   LGISSILASINIIATILNMRAPGMTLMRMPMFVWGWLITSFLLIAVVPVLAGAVTMVLT
FT                   DRHFGTSFFNAAGGGDPVMFQHIFWFFGHPEVYVLVLPIFGVISEIIPTFARKPLFGYS
FT                   SMVYAMASIAFLSFIVWAHHMFTVGMPVSGELYFMYATILISVPTGVKIFNWLTTMWRG
FT                   SMTFEVPMLWCQAFIALFTIGGLTGLMMGVAPVDFQYHDTYFIVSHFHYVVLPVTVFGT
FT                   FAAVYYWIPKWTGNMYDEGLAKLHFWLSVISMNIIFLPQAFLGLAGMPRRIPDYALQFV
FT                   EFNTISTVGAFIFGISQLIFVYVIVKTIRGGVGVKVSDQVWEGAKGLEWTLSSPPPYHS
FT                   FTTPPQVTSKPY"
FT   gene            63748..64377
FT                   /locus_tag="Nhal_0063"
FT   CDS_pept        63748..64377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0063"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: noc:Noc_3045 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13284"
FT                   /db_xref="GOA:D5C496"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:D5C496"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="ADE13284.1"
FT                   /translation="MDPFWDCLGYLFLIYLSDCDKVSTVMREANKRRLVLRLTLVVVAM
FT                   FGFGYAMVPLYNVFCDITGLNGKPDNVAVSAAKAGTVDTSRTVTVELLANVNSQLSWEI
FT                   KPEVSKISIHPGEVTKVSYYASNLADHSVTGQAIPSISPGLAAKHLHKTECFCFNEQVL
FT                   QAGEKKEMPVVFFIDPKLPNDYSVVTLSYTFFDVGASAQAQTAAAG"
FT   gene            64461..65327
FT                   /locus_tag="Nhal_0064"
FT   CDS_pept        64461..65327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0064"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   noc:Noc_3044 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13285"
FT                   /db_xref="GOA:D5C497"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D5C497"
FT                   /inference="protein motif:PRIAM:1.9.3.1"
FT                   /protein_id="ADE13285.1"
FT                   /translation="MAHAHGEYYQPQPSYWPIIGSIGLFTGVAGFAAFLNGVDIGKYIM
FT                   LAGIGILLFMMFGWFGAVIRESEAGLYNDQVDRSFRWGMIWFIVSEVFFFAAFFGALYY
FT                   TRDLTLPWLLGEGAKGTAHTFLWPEFTEAWPTNGPQGVGGEFQSMAAWGVPALNTLILL
FT                   TSGVTVTWAHWGLKQDNRQKLIIGLFLTVALGFTFIGLQAWEYSHAMSELNLTLGSGIY
FT                   GSLFYMLTGFHGFHVTVGSIMLLVVLIRSMAGHFTPKRHFAFEAVAWYWHFVDVVWLGL
FT                   FVFVYWL"
FT   gene            complement(65414..65659)
FT                   /locus_tag="Nhal_0065"
FT   CDS_pept        complement(65414..65659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13286"
FT                   /db_xref="GOA:D5C498"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:D5C498"
FT                   /inference="similar to AA sequence:KEGG:Noc_3043"
FT                   /protein_id="ADE13286.1"
FT                   /translation="MIFKLIVIALLISILYALGSALFALVRSGGTSDDRMVKALTFRIA
FT                   LSLGLFILLMLGYATGLITPNTMVSAEKMEMQSSQQ"
FT   sig_peptide     complement(65585..65659)
FT                   /locus_tag="Nhal_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.488 at
FT                   residue 25"
FT   gene            65921..66631
FT                   /locus_tag="Nhal_0066"
FT   CDS_pept        65921..66631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13287"
FT                   /db_xref="GOA:D5C499"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:D5C499"
FT                   /inference="similar to AA sequence:KEGG:Noc_3042"
FT                   /protein_id="ADE13287.1"
FT                   /translation="MMVSLLVTAILASLGVWQLQRADEKRTIEAALRERSASEPLWVGR
FT                   DRLSLPDSEYRQGIAEGRFDGAHTVFLDNQIQESQAGYHVLVPLRLASESGSAVLVNLG
FT                   WVPMGLDRQQLPQVDIPHSQVTVRGTLRRPPRAPFFLGDEGTQETSGWPKLVQYVNTEQ
FT                   LQSKLGYPLQPLVLQLAPDEPYGFVRQWPELPTSVQQHIAYAVQWFAMALVAVVVFVIL
FT                   YRRSFDGNEQRNRS"
FT   sig_peptide     65921..65989
FT                   /locus_tag="Nhal_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.582 at
FT                   residue 23"
FT   gene            66648..67271
FT                   /locus_tag="Nhal_0067"
FT   CDS_pept        66648..67271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13288"
FT                   /db_xref="GOA:D5C4A0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A0"
FT                   /inference="similar to AA sequence:KEGG:Noc_3041"
FT                   /protein_id="ADE13288.1"
FT                   /translation="MDNGKSKTKRGRPGWVSFAIFAICALPVIASWWFLKTLEQGGEFS
FT                   TRNYGEFIRPARPLEETTLKTLEGKDLTLSELRGKWTLVVFGPAACDETCRENLYETRQ
FT                   IRLAVGKNMQRVQRLWVVNDVSSLAESDWLQEQHPDLLIASEGEKKKGFIDQFVLPEVP
FT                   DPLAAQRVYIVDPIGNIVITYPPEEAPEHILKDLKRLLFVSQIG"
FT   sig_peptide     66648..66740
FT                   /locus_tag="Nhal_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.949 at
FT                   residue 31"
FT   gene            67281..68309
FT                   /locus_tag="Nhal_0068"
FT   CDS_pept        67281..68309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0068"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   noc:Noc_3040 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13289"
FT                   /db_xref="GOA:D5C4A1"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A1"
FT                   /inference="protein motif:PFAM:PF02628"
FT                   /protein_id="ADE13289.1"
FT                   /translation="MSPRFHTFAVAASLLALVVVVFGAYVRLSDAGLSCPDWPGCYEQL
FT                   LAPTTEQQIDQASLLYPDRPVESDKAWKEMIHRYLAGILGLLILGLAIAAWRNRSDPRQ
FT                   RVALPIFLVGLVGFQAALGMWTVTLLVQPAIVTLHLLGGLAVLSLVWWLALRQRQAQHP
FT                   MQRIWYSPAFKTWSLIGLFLLVLQIILGGWTSTNYAGFFCPDFPTCQGQWWPNMHFREA
FT                   FTFWQPLGENYEGGRLAPEAATAIHVVHRIGAMVVLIVLGAIGLRAGLGRGTPALRGVG
FT                   WVVVALLLTQVALGIATAMGGIPLALAVAHNAVAALLLLAVVTLNHLLHPTGYQLRGAT
FT                   RL"
FT   sig_peptide     67281..67352
FT                   /locus_tag="Nhal_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.589 at
FT                   residue 24"
FT   gene            68306..69205
FT                   /locus_tag="Nhal_0069"
FT   CDS_pept        68306..69205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0069"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: noc:Noc_3039 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13290"
FT                   /db_xref="GOA:D5C4A2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A2"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ADE13290.1"
FT                   /translation="MTTITLIRGALTNWREYLVLCKPRIVSLIVFTAIVGMFLSVPELA
FT                   PWQVFLLGSLGIGLGAASAAAINHLIDEKADALMARTQGRPLPSGKIDREQALAFAIML
FT                   GLLSMAILYFLVNPLTAWLTLASMFGYGIIYTAFLKRATPQNIVLGGAAGAMPPVLGWT
FT                   AVTGELHVHAFLLFLIIFVWTPPHFWALALARREEYSRANFPMLPVTHGIDFTKQQVVL
FT                   YTFLLFAVSLLPFVSQMSGLVYLVGAVGLGGRFLYLALALYRHTSNELAMKTFGYSIFY
FT                   LAALFAFLLVDHYLPKFL"
FT   gene            complement(69357..70892)
FT                   /locus_tag="Nhal_0070"
FT   CDS_pept        complement(69357..70892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0070"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; polysaccharide
FT                   biosynthesis protein; KEGG: noc:Noc_3038 virulence factor
FT                   MviN-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13291"
FT                   /db_xref="GOA:D5C4A3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A3"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADE13291.1"
FT                   /translation="MSARLLKSTAVVGSATLLSRILGFIRDVVIAQAFGAGLAADAFFV
FT                   AFKIPNFLRRLFAEGAFSQAFVPVLSAYHMRGNLSEVQQLVNRVAGTLGLVLLLVTLTG
FT                   VIGAPLLVMIFAPGFIEEQGKYELTVNLLRITFPYLLFISLTAFAAGILNTHKHFGVPA
FT                   ITPIFLNLALIAAALWLAPHLEIPVTALAWGVFFAGLAQLLFQLPFLAHLKLLPRPRPR
FT                   WKDPGVQQIFKLMLPAIVGSSVAQINLIIDTLLASFLVTGSVSWLYYSDRLVEFPLGVF
FT                   GIALATVILPSLSEKHAQASSESFSRTLDWALRWVFLIGTPAAVGLALLAGPILTTLFQ
FT                   YGEFSDHDVTMASRSLIAYSFGLLPFILIKILAPGFYARQDTRTPVRIAIIAMFANMVL
FT                   NVILIFPLAHAGLALATSLSAWLNATLLFFTLKRQGIYRPQPGWLWLSLRILIAAELMA
FT                   ISILWLMPPLASWLNWEVMTRVAEITLLIGAAVILYFGTLLVIGVRPRMLALT"
FT   gene            71029..71292
FT                   /locus_tag="Nhal_0071"
FT   CDS_pept        71029..71292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0071"
FT                   /product="ribosomal protein S20"
FT                   /note="TIGRFAM: ribosomal protein S20; PFAM: ribosomal
FT                   protein S20; KEGG: noc:Noc_3037 ribosomal protein S20p"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13292"
FT                   /db_xref="GOA:D5C4A4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A4"
FT                   /inference="protein motif:TFAM:TIGR00029"
FT                   /protein_id="ADE13292.1"
FT                   /translation="MANSLQARKRARQAEKRRLHNASQRSMMRTYMKKVIKAIASGDKE
FT                   QATVAYGVAVPVLDRLARKGLIHPNKAARHKSRLSARIRSMS"
FT   gene            complement(71295..72422)
FT                   /locus_tag="Nhal_0072"
FT   CDS_pept        complement(71295..72422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0072"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: noc:Noc_3036 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein; SMART: PUA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13293"
FT                   /db_xref="GOA:D5C4A5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A5"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADE13293.1"
FT                   /translation="MSDHRNRLIATRCWVVKVGSALLTANGRGLDAECIRALANHIANL
FT                   RKQGYAVVLVSSGSVAAGMQRLGWQRRPRALYELQAAAAVGQMGLIQAYESQFQHHGQH
FT                   TAQVLLTHEDLADRSRYLNARSTLRTLLQLGVVPIVNENDTVATEEIRFGDNDTLSALV
FT                   ANLVEAELLVILTDQPGLFDADPRHHPNARLIPEAAANNAELDTMASPGTGALGRGGMI
FT                   TKIRAARRAARSGAITIIASGKEPNILQRLANGEAIGTLLWPDKEPLAARKQWLAGQLQ
FT                   TKGRLWLDAGAAKVVREAGRSLLPVGVIASEGHFARGEVVSCLDPEAREIARGLVNYNA
FT                   EETRRILGHSSNQIEQILGYVDEEELIHRDNLVLL"
FT   gene            complement(72443..73468)
FT                   /locus_tag="Nhal_0073"
FT   CDS_pept        complement(72443..73468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0073"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; PFAM:
FT                   GTP1/OBG sub domain protein; GTP-binding protein
FT                   HSR1-related; KEGG: noc:Noc_3035 GTPase ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13294"
FT                   /db_xref="GOA:D5C4A6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A6"
FT                   /inference="protein motif:TFAM:TIGR02729"
FT                   /protein_id="ADE13294.1"
FT                   /translation="MKFIDEAIIKVQAGAGGNGCLSFRREKFIPFGGPDGGNGGNGGSI
FT                   YLIADKNLNTLVDFRHQRHYRAQRGENGRGRLQTGKSGEDLYIRVPVGTEAWEADTEEL
FT                   LGDLTRPQQTLLIAKGGTRGLGNAHFKSSTNRAPRKTTEGKPGEERTLRLELKLLADVG
FT                   LLGLPNAGKSTFIRQTSAATPKVADYPFTTLYPHLGVVSIDSNRSFVMADIPGVIEGAA
FT                   QGAGLGIRFLKHLSRTRLLLHLVDVAPMEPAMDPVANVRTIQGELQQFSPELAKRPQWL
FT                   VLNKIDLIPPSEQAERCQEILNRLAWQGPVYQISALTGEGCQPLIRAVMEYLEQPSLDK
FT                   T"
FT   gene            complement(73577..73834)
FT                   /locus_tag="Nhal_0074"
FT   CDS_pept        complement(73577..73834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0074"
FT                   /product="ribosomal protein L27"
FT                   /note="TIGRFAM: ribosomal protein L27; PFAM: ribosomal
FT                   protein L27; KEGG: noc:Noc_3034 50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13295"
FT                   /db_xref="GOA:D5C4A7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A7"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ADE13295.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKRYGGQQVLAGNILVRQRGTRF
FT                   LAGVNVGTGRDHTLFATAAGKVQFAKRGPNNRTYVDIITE"
FT   gene            complement(73854..74168)
FT                   /locus_tag="Nhal_0075"
FT   CDS_pept        complement(73854..74168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0075"
FT                   /product="ribosomal protein L21"
FT                   /note="TIGRFAM: ribosomal protein L21; PFAM: ribosomal
FT                   protein L21; KEGG: noc:Noc_3033 ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13296"
FT                   /db_xref="GOA:D5C4A8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A8"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ADE13296.1"
FT                   /translation="MYAVIKTGGKQYRVQEGDTLRVEKIDADEGANITLDQVLLVADGD
FT                   NIQVGAPYVEGGKVNATVKTQGRGEKIKIIKLRRRKHHRKQMGHRQYFTELQIDNISAG
FT                   "
FT   gene            74431..75399
FT                   /locus_tag="Nhal_0076"
FT   CDS_pept        74431..75399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0076"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: noc:Noc_3032
FT                   trans-hexaprenyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13297"
FT                   /db_xref="GOA:D5C4A9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4A9"
FT                   /inference="protein motif:PRIAM:2.5.1.30"
FT                   /protein_id="ADE13297.1"
FT                   /translation="MDIQSTYDLIADDMQAVNGLIQKRLHSDVVLINQLGHYIINSGGK
FT                   RLRPVVVLLSARAFDYQGSCHIDIATIIEFIHTATLLHDDVVDSSELRRGQKTANSIWG
FT                   SEASVLVGDFLYSRAFEMMVDVNSMRVMEILARTTNTIAEGEVMQLLNCHDPDTTEERY
FT                   LDVIRSKTAKLFEAATQLGAVLSCRPAAEEEAMAAYGMHLGTAFQLTDDVLDYSASSDD
FT                   LGKNIGDDLAEGKPTLPLIYAMRNGIPSHAEVIRNAIEGGGRDNLAEVIEAIESSGAIA
FT                   YTAKTARREAEKAIQAIKKIPASPYQEALLNLAKFAVYRTY"
FT   gene            75405..75481
FT                   /locus_tag="Nhal_R0002"
FT                   /note="tRNA-Pro1"
FT   tRNA            75405..75481
FT                   /locus_tag="Nhal_R0002"
FT                   /product="tRNA-Pro"
FT   gene            75643..76068
FT                   /locus_tag="Nhal_0077"
FT   CDS_pept        75643..76068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0077"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   btr:Btr_2586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13298"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B0"
FT                   /inference="protein motif:PFAM:PF01878"
FT                   /protein_id="ADE13298.1"
FT                   /translation="MSYWLFKSEPSKWSWEDQKKKGAAGEEWDGVRNYQARNNMRAMKL
FT                   GDKGFFYHSNKGLEVVGIIEVCKPAHPDSTTEDPRWECVDVRALCDMPKPVSLRKIKAN
FT                   PKLAKMALVTSARLSVQPVTEDEWREVCRMGGLDPAP"
FT   gene            complement(76220..76723)
FT                   /locus_tag="Nhal_0078"
FT   CDS_pept        complement(76220..76723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0078"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: ngk:NGK_0649
FT                   putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13299"
FT                   /db_xref="GOA:D5C4B1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADE13299.1"
FT                   /translation="MRPPTPSASASSAPTKTFEKVISPPGTATETTSFTHCQIFTFENY
FT                   AVLPPKAHAKHPPIGDLVGQWEQNDKRRAALEEARRWVAETFHGEEGDTVRTLRLRKGW
FT                   SQARLAKELGTSQPHIARIERGTENLAIETCRKLCIALEIDMNALDQALRRQEAIARGK
FT                   VQSK"
FT   gene            complement(77332..78384)
FT                   /pseudo
FT                   /locus_tag="Nhal_0079"
FT   gene            78709..80304
FT                   /locus_tag="Nhal_0080"
FT   CDS_pept        78709..80304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0080"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   helicase domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; KEGG: nha:Nham_3708 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13300"
FT                   /db_xref="GOA:D5C4B2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B2"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ADE13300.1"
FT                   /translation="MKRAALMRLLGNDLVHTLEQLTKDTPSDEALRKVAQVLYGDNNPA
FT                   ALQEQVVRNQIIDALPLEKARELTQKLGLFSAGNIYQSLKRFDSKSDPNRAAALRSFFG
FT                   IVEDMTAQPIRKPAVGEVSPEYGLFDHQRDVALRTRQALSESPHKAVVHMPTGAGKTRT
FT                   AMHILARHLLERGPTLVCWLANSAELLEQAAEDFEKSWRVLGDRPVKLFRFWGDRSIDL
FT                   HTLRDGVLVAGFAKMHAAYMREQNAFIALGDRTSLTIVDEAHQAIAPTYRSVIEALFTK
FT                   RPQNQLLGLTATPGRTWDNIEADAELSAFFGNAKVTLSVSKYSEPVEFLMAEGYLAKPV
FT                   FRTLSFEGAMDLPGAEELEGGSTSDLSDNALDTIARNGERNFLIIQAIEELLSRHKRVI
FT                   VFGASVRHAHLIAGLLIARSHDAKMITGETPIARRERLIRQFKSDSPQSMIMCNYGVLT
FT                   TGFDAPKTSAAVIARPTKSLVLYSQMVGRATRGPRAGGNEVAEIVTVIDTALPGFGSVA
FT                   EAFKNWEDVWHEHE"
FT   gene            80291..82120
FT                   /locus_tag="Nhal_0081"
FT   CDS_pept        80291..82120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13301"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13301.1"
FT                   /translation="MNMSSEAVQTTHYHDGEVIPPSLAVKAMRDSGYKNTAYALAELID
FT                   NSIQAGASFVEVFCIEKRVLVREQKRRRIAEIAVLDNGTGMDSSILRLALQFGNGTHLN
FT                   DRDGIGRFGMGLPNASISQCRRVDIWTWQAGPDNAIHTYLDVDEVESGKMRAVPVPKAN
FT                   PVPHEWRDRSEEIGTSGTLVIWRNFEEHRLTWRSGRSTLENTEILAGRMYRKFINEGKA
FT                   DIRLVALEANEISFNQRVRANDPLYLMTSTSTPAPFNNKPMFQIWGEQHLEFSINYQGQ
FT                   IHKVAVRMSWAKLETIPQDGTDPGGTPYGKHAAKNIGVSIVRAGRELELDNSWAIGYDS
FT                   RERWWGVEVEFPPALDEVFGVTNNKQAATVFSHMSQFEWKNEAEPGEKYMDFVRRLEEE
FT                   GDTRYLLIGIVNYIKDQLNQIRARIQDQRKGRRSGGKRHDDVSVEDTATTKWKDRASRG
FT                   YKTEADDQDFDDDAQDQLVDDLVQNKKYNEEVAREIAAAVKARDRKIIFVTAEADSQAF
FT                   FNVDLRPGGITEIVFNTRHPAYEKLLKTLDIDVSEASSSDLVWRIENASNTLKLLLAAW
FT                   ARYEEEDVPSREKIRDIRHEWGKMAKNFISEKE"
FT   gene            82124..83074
FT                   /locus_tag="Nhal_0082"
FT   CDS_pept        82124..83074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_12002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13302"
FT                   /db_xref="GOA:D5C4B4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13302.1"
FT                   /translation="MRSPGANLLELCQTAQYEVVLVAPFMKVRALEAVLGAIPENVTSI
FT                   KCVTRWRPEEIVAGVSDLEVFNLVTQRSAAALFIQPLLHAKYFRADNSCLVGSANLTQS
FT                   ALGWAMPANLELLISLPSDTESLPEFERMLFSTSIRASQTFKNEVAKAAETMQGEGIKF
FT                   VTEELGAEEEEISIPPQYWLPLCTRPDLLYSIYVNRNIDQIVGWTLESGRRDIRALCIP
FT                   PGLSEKNFRRYVATLLQQSPLAQRVYEKAREPISPTKGQEFIKSNATDDYLLYSAEQHW
FT                   ETLRAWLLHFLSGKYRQLSGSFDLQRGSEIGSMRF"
FT   gene            83187..85517
FT                   /locus_tag="Nhal_0083"
FT   CDS_pept        83187..85517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0083"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; protein of
FT                   unknown function DUF1524 RloF; KEGG: sfr:Sfri_2088 protein
FT                   of unknown function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13303"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B5"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ADE13303.1"
FT                   /translation="MSIDIENIFKATAQSTWHFLITNGQGCYIPAYQRPYSWDEGNVER
FT                   LFEDAAHGMKSLLKRGDTISFLGTIIAFHDTKHRTVQPIFQQEVASKVMTIIDGQQRIC
FT                   TFLMANMVIHDHVRRMASKFKNKEEPQFTWLAEQTQQLIAELEDSFVLDMKIGEGNYRY
FT                   YPRMIRSYEDVWSKRKGQAKYNSPIARLIWEFFCYQKTEETKPFRYIPKDNVGNPHPHY
FT                   QPVVTVFKYIQRQIDQITGKKASEADFPDVLAIIQSEDFIDAIWGFDLPSEVKTYIIDH
FT                   VDDTLYDLYCQLLRLIVFARYLNNRMAFTVVTTRSEDDAFDMFEALNTTGEPLTAFETF
FT                   KPKVIDEEGISKYEHSPSYKCISRIEEYLENFRKAEQKQKATSEMLVPFALAETGDKLQ
FT                   KRLNDQRRYLREQYEGGELSSINEKREFVRRLAYVASFMKNAWDTETAKKPSFFPLTVV
FT                   DDAVLVGFEALRELKHHITIAPLSRFYGRALETDDETEQATCTAEFVDAIKATVAFSML
FT                   WRGAFGGTSNIDRHYRDIMRQSTGKDKIPPLAKRPKSGTGAVSIANYKKALRTILEEKG
FT                   SITSRDDWVKATARTPVYKYPVIARFLLFLASDDAIVDKSEPGLVIRGRKGLASMLALN
FT                   RWRDKDYFTVEHIAPQSNTTGWQADIYDDADAINRLGNLILLPPNENSLLGNRSWEHKR
FT                   LLYRVLAAEDQESFDKAKAACSAKGLTLSKKAEEILDKANYLGLCKSVASKNDDWSLGF
FT                   IEKRSRCIAGLAWDRLAPWLDFI"
FT   gene            complement(85522..86358)
FT                   /locus_tag="Nhal_0084"
FT   CDS_pept        complement(85522..86358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0084"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="KEGG: pna:Pnap_4585 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13304"
FT                   /db_xref="GOA:D5C4B6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B6"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4585"
FT                   /protein_id="ADE13304.1"
FT                   /translation="MDIKEKHVLGLSGGRDSAALAVYMRQNFPEFEIDYFFTDTGKELP
FT                   EVYEFLGRLEGFLGKPIRQLNPDRDFDFWLKQYNSFLPSPQARWCTRQLKLRPFEQWIR
FT                   PLLESGIKVYSYVAIRSDEEYREGYTSRHKNLKVRLPFKEAGIDKAGVLEILEGSGLGL
FT                   PDYYSWRTRSGCTFCFFQQKIEWVRLMEQHPEAFEEAKAYEKNAVEHGSPFTWSQGESL
FT                   EELTRPERIEQIKEEHTRRIERMRIKQQVNPLRPDGEPLDIDDLYGQAKVCLACHK"
FT   gene            complement(86358..89762)
FT                   /locus_tag="Nhal_0085"
FT   CDS_pept        complement(86358..89762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0085"
FT                   /product="putative ATP-binding protein"
FT                   /note="KEGG: eca:ECA2875 putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13305"
FT                   /db_xref="GOA:D5C4B7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B7"
FT                   /inference="similar to AA sequence:KEGG:ECA2875"
FT                   /protein_id="ADE13305.1"
FT                   /translation="MSLADCVHIARRFQRSVRIDTDLTKANALEGFICPKSSAEVLRTM
FT                   ANHVAETGQGAFTWTGPYGSGKSSLVIALSALLDGNNHRRKQAYHAIGSKAAEAVWEAL
FT                   PPKSKGWRILPVVGQKDHPAQVIGETLAQAKFWKGKAPKVWREQALISELEVIARQNLR
FT                   SSGGLIVFLDEMGKFLEGAVHGDRDIYLFQQLAEVASRSNGRLIIVGILHQAFEEYAQR
FT                   LSREMRDEWSKIQGRFMDLAVNTAGEEQLELLARAIEDNRRSSSSHQISQTVANLIRKV
FT                   RPGASPHLEVTLEDCWPLNPIVATLLGPISRRRFGQNQRSIFGFLNSAEPQGFQDFLRH
FT                   GSEKDLYNPNRLWDYLRLNLESSILASPDGHRWALAVEAVERCEGMGGDPLQAQLLKTI
FT                   ALVDLFKERSGLAPSLPLLKAAVPNVSSRRVEKAIKELERRSFIIFRKFADAYTIYAGS
FT                   DFDIEQAVEQALTNIQDVDFAALRKLAGLHPILAKRHYHRTGALCWFDVVLVPLNKLLE
FT                   EVSRFSPDQGTMGQFVLTLPTENEPEEVAEKLCRKAARQADGWDIVVGLSSRSWTIIDL
FT                   AKELLAVEDVSLNHPELTGDAVARREVRVRIAALQGQLEDELHQAFDNTAWYLKHHPRK
FT                   RLTQAQLSFLASDLANKRFHKAPRLHNELLNRIKPSSNAVAAQNALLRQMVMKEGEPRL
FT                   GIDGFPAEGGLFASILEITGLYTETSHGWQFVAPHKTNDPCGLTPLWEAARDFLQQNRT
FT                   RTVTVSEIYEVWRQPPLGLKEGLMPVLAVAFALSCRDTVAFYRRGIFQARLQDLDVDYL
FT                   AKDPSAIQLRWMDLSKVSRRLLSGMADVVRDLDKNNSLQDLTPIDVARGLIAIYDQLPA
FT                   WTKRTMRLSSNALRIRQLFKQANDPNKFLFDDIPALFGSSVDLTKKEGLLKIIQQVREG
FT                   LSELRETYPTVLRRLRETLLVELQVPNDSPQALSELRARAENIRQLAGDFRLEAFINRM
FT                   ASYNGRDEEIEGLASLAANKPPRDWVDPDIDKAAIELSDMAQKFIRAEAFARVKGRPDK
FT                   RQAMAVVVGVGGRPTPVLGEFDITDSERESVNTLISQMKTTLDAAEARRRNVILAALAE
FT                   LSARYLNAPDDEFAAEEKEIVGKKKVS"
FT   gene            complement(89762..90721)
FT                   /locus_tag="Nhal_0086"
FT   CDS_pept        complement(89762..90721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA2874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13306"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B8"
FT                   /inference="similar to AA sequence:KEGG:ECA2874"
FT                   /protein_id="ADE13306.1"
FT                   /translation="MARRPLYQSDYRPQFSGHETFPLRYGWLKKAFDTVAATENKEENK
FT                   SVFLSDDAIARFGVGKNMVASIRHWATAANVLENPSNGPKIFTTRLGRKIFADRGLDPF
FT                   MEHPTTLWVIHWHLASYTEKTTWFWAFNYFHSATFDRNHLVQGLEKLCKDRTWSRVATT
FT                   TLKRDVECFVRTYVARPSLAGAGHEETLESPLTELGLIKPIGRREGFRFVRGAKPNLGK
FT                   GMFLYALTDFWRHSSTARTLSFENIAHEPGSPGRVLLLDEFALAERLSNLEEASGGIFR
FT                   WSETTGLKQVLRQAELTEDLAFSFMELDYPPRGNREAA"
FT   gene            90879..92060
FT                   /locus_tag="Nhal_0087"
FT   CDS_pept        90879..92060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0087"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   rcm:A1E_02335 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13307"
FT                   /db_xref="GOA:D5C4B9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4B9"
FT                   /inference="protein motif:PRIAM:2.8.1.7"
FT                   /protein_id="ADE13307.1"
FT                   /translation="MEIDGTLYFDYQASTPIDPRVLAAMMPFWRESFGNPHASDHRLGW
FT                   RAGLAVDEACERVARLIGADADEIVFTSGATEANNLALLGLSRRRSGGNRRRILVSAIE
FT                   HKCILRAAQAVSEQLGFSVELLPVCSNGCVDLDYLSQTLDQDVLLVSVMAMNNEIGTIQ
FT                   DLREIYKIISKSESYFHCDAAQAPVALDLNYLAETADMVSLSGHKMYGPQGVGALYIRR
FT                   DLQREIEPLFYGGGQQAGLRSGTVPLPLVIGMAKAAELVTSSEANEERKRVQEMRNRFV
FT                   YLLKKRIPSLVLNGPEFSVRHPGNANLRFPSVAAEDLLLALQPRLAASTGAACTTGIPE
FT                   PSHVLRAIGLSAEETDASIRFSFGRFTESAHIDEAIELISTAYARLIENMGIH"
FT   gene            92187..94745
FT                   /locus_tag="Nhal_0088"
FT   CDS_pept        92187..94745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0088"
FT                   /product="Peptidase M15A"
FT                   /note="PFAM: Peptidase M15A; KEGG: mpt:Mpe_B0183
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13308"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR024019"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4N5"
FT                   /inference="protein motif:PFAM:PF08291"
FT                   /protein_id="ADE13308.1"
FT                   /translation="MASVPSKKVARQIYVHVNYINSMDTTLKSALLEAERLAGVCRSDH
FT                   YNVVRYELGTSCISLLYYPNFFEEPFPALRESWRVDLAAGKLSYRTYKDSLNPPILHRK
FT                   ELLISDDHPRWCQYKSLTEAAESVGLFAEPTRIGYQRQWLQLVREKGYQIIGHELVPIG
FT                   NDESLQDDEAPLHADWSVARQLTALTRYGLSAPIQSLARYGFLDGCNTIFDYGCGRGDD
FT                   VRGLVENGLQAAGWDPYYAPDNPITQADIVNLGFVINVIEDFDERVDALVTAFSLARQL
FT                   LVVSVMLVNQNKIQGQRFKDGMLTKRGTFQKYYTQAEIRDFLEDLLHEEPIPVAPGVFF
FT                   VFRDKDAEQRFLVNRFRSRGNVLRVPLLFPRERQLRNRNERTDKKYAYYRESLDRLWNL
FT                   WVSLGRKPDKTEVEGQVALIEGFGSLNNAFRFIKARKNLTALECSRQTRTADLEVYFAL
FT                   CEFKRRKPYKRLEHGLQRDIKAFFGSYTNVKQVAHELLFQIADVEAINQACQQASEQGL
FT                   GWLVERKSLQLHASLVEKLSPLLRVYVGCATVIYGDYHDADLVKIHIASGKVSFMKYDD
FT                   FERKPLPRMTERVKVKLREQDIEYYAYDDNYTPPFLYNKSRYINEEFLHYPEQVVFDQA
FT                   LEKCGLFDFAGYGPNPDNFLEILSRNRLVIEGFRLVRSRTIPNLDSPCGRYFIFRQLIE
FT                   CGETQARTGLENLPEQPETYNALCDLTTQVLDPVIDYFGMIRLTYGFCSPALAKKIPGR
FT                   ISPQRDQHAACELNRRGKPICDRLGAAVDFIVDYESMLEVAQWVVANTPFDRLYFYGDD
FT                   KPIHVSFGPDNSKQIVRMILGKSGKLLPQVTPMEAFLSLE"
FT   gene            complement(94924..95820)
FT                   /locus_tag="Nhal_0089"
FT   CDS_pept        complement(94924..95820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13309"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13309.1"
FT                   /translation="MGLRLMSCGFALATIMLVTSAQAVMVTGAFTGAWFDKDAPGQGFL
FT                   LQVVDRKGTDTAIVYWFTFNAFGNQNWLLGQAPVKGNQVNFTMHSVEGGILDLNGFDPA
FT                   RITLQPWGHLVLQFEDCNHGTARYEALDPQINDGQFEITRLTRSLGDECSGGLSDNTPP
FT                   SAGAKIIRVDFDNTGLIPQATARMKFEQNRNHAKFKVWMKDLPAGQYDLLVGDKMVGVI
FT                   NARGQGQNKLFFRSPKTCNWELLDFDPLNQTIKIAQGNKVFLTAFLSNDLASFDDSDDR
FT                   DEDDDDNRDDGSCEEDD"
FT   sig_peptide     complement(95749..95820)
FT                   /locus_tag="Nhal_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 24"
FT   gene            96266..96910
FT                   /locus_tag="Nhal_0090"
FT   CDS_pept        96266..96910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0090"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: noc:Noc_0199
FT                   TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13310"
FT                   /db_xref="GOA:D5C4N7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4N7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADE13310.1"
FT                   /translation="MTKRLTGRDTEASAPAQGREAILAVAKKQFAEYGYHGATLSKIAT
FT                   RAKVCKANIFHHFGSKEGLYLAVLKDYCEQLSPLRGSRPISAPTCREQLRQFAQVHLEN
FT                   MLNEQGAVQLFLRELLAKDSLRKEILAKGVLEDNFSSLVQMVREGQEAGEIRPDIDPAM
FT                   LAVMLLGADVFFFMARDVFQHFRDVHFAEAPGDYSKALSEILLKGCLAKRD"
FT   gene            96989..98086
FT                   /locus_tag="Nhal_0091"
FT   CDS_pept        96989..98086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0091"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   noc:Noc_0200 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13311"
FT                   /db_xref="GOA:D5C4N8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4N8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADE13311.1"
FT                   /translation="MIKRLIVVLLTLGLFFGGIFGWKYYQQQQQAAQAAMPPPPATVAA
FT                   AEVHPETWQSSLQAVGSLVATQGIYVTNEVAGLIEAINFESGQQVEKGKLLLQLEDSVD
FT                   QADLKGLLAEQKLGELQFQRAARLVKEKSISRSTYDESEAQLENAQAKVAAKRALIRKK
FT                   QIRAPFSGLLGIRQVNLGEYLAPGSRIVLLQALDPIYVDYSLPERYFSSLSQGQAVFIT
FT                   VQAYPAQIFEGRIIAINPGIDPASRNVRVRAIFPNPNLRLRPGMFAEVKTLLPEQKQVL
FT                   TVPQTAITYNPYGNMVFVIQEKNGGLVVQQQLVQTGKVREGQVEIVKGLQVGERVVSAG
FT                   QMKLHNGQQVQISDKEILDGEVGDA"
FT   sig_peptide     96989..97054
FT                   /locus_tag="Nhal_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.672 at
FT                   residue 22"
FT   gene            98158..101262
FT                   /locus_tag="Nhal_0092"
FT   CDS_pept        98158..101262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0092"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   noc:Noc_0201 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13312"
FT                   /db_xref="GOA:D5C4N9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4N9"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADE13312.1"
FT                   /translation="MKFTDLFIRRPVLASVVSLLILLVGLRALTLLEVRQYPETRDTVV
FT                   TVTTLYPGASSELVKGFITTPLQQAIAEAKGIDYMVATSTQGRSVIEAYMELNYDPNAA
FT                   VAEIQAKVASQRNVLPEESEDPVIDSTTGDPTALMYMAFYSEGMLPSQITDYMLRVVRP
FT                   KLQAVPGVAKAELIGNKTFAMRIWLDPRRMAALGVTADDVKEVLLDNNYLAGVGQTKGA
FT                   YVSVDLSATTDISREEDFLNLVVYEADGALVRLRDIAEPKLGAEDYDSSNWYNGKSAIF
FT                   IGIEQAPGANPLDVAERIHDLVPEMRRQLPSGLDGYIVYDASAYIDDAIDEVFRTLAEA
FT                   VLIVLAVIFLFLGSLRAALVPAIVVPLSLIGGAFLMLLLGFSLNLLTLLALVLAIGLVV
FT                   DDAIIVVENIHRHLENGESRFQAAIQGARELGLPIIAMTTTLVAVYAPIGFMGGLVGTL
FT                   FTEFAFTLAGAVLVSGVVALTLSPMLSSKVLRSAGETGRFEQWVEHFFTRLAERYQRLL
FT                   HHALDSLPVVMVFAGVILCSIYFMYVTSQNELAPTEDQSILFFQATAPQTATIDYDEAY
FT                   SRQIIDIFETFPEYHESFLLLGRGGDPSTVFGGFKMPVPSQRERSQMEIHPELQQQLQE
FT                   VAGFEIASFPRPSLPGAGRGLPLQFVITTDADFLRLDQVAEELIQRGIASGKFAFLQKS
FT                   VKFTRPKTTLRINRDLAGDLGIRMEDIGQDLATMLGGGYINWFNLEGRSYKVIPQVARR
FT                   YRLDQEMLENYYIRTGTGELIPLAALVSFEDTVEPSKRIQFQQLNSVTVQGIMAEGVTL
FT                   GEALTYLEEQAQEIFPLGFSWDYAGESRQYTQQGSALVITFFFSLLVIYLVLAAQFESW
FT                   RDPVIIMMSVPMSIAGALVFLTLGFATVNIYTQVGLITLIGLIAKNGILIVEFANQLQI
FT                   QEGLSKREAVEKAASIRLRPILMTTVSMIVAMVPLLMASGPGAVSRFHIGLVIASGLGI
FT                   GTVFTLFVVPAVYLLLARTRSEEKKEQETEEITEQEIPVDSRELT"
FT   sig_peptide     98158..98244
FT                   /locus_tag="Nhal_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.556 at
FT                   residue 29"
FT   gene            101374..102846
FT                   /locus_tag="Nhal_0093"
FT   CDS_pept        101374..102846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13313"
FT                   /db_xref="GOA:D5C4P0"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P0"
FT                   /inference="similar to AA sequence:KEGG:Noc_2911"
FT                   /protein_id="ADE13313.1"
FT                   /translation="MNDLPEYVDDLPNLCGSEELIANARAQGPAYLPESGIDFGDINSA
FT                   FAIALHMQQPLIPAGGEDLSSAAIISNLKYMMDHQDIGDNHNAPVFHWCYKRIGEFVPK
FT                   LVDEGKNPRVMLDYSGCLLHGLRDMGLDDVFDALKRVTCDPHYRHCVEWLGCTWSHAVA
FT                   PSTPVQDYRLHVQAWRHHFAAIFGLEALSRVKGFSPAEMALPNHPDVCYEFVKTLKDNG
FT                   YQWVLVQEHSVEQPEDGRHPQRPHIPHRLVAKNSKGETASIIAIIKTQGSDTKLVAQMQ
FT                   PYYEAQGLSRQELKGQSIPPLVTQIGDGENGGVMMNEFPGKFMEVMGEATGSHTPPVNV
FT                   SEYLEYLETLGLKEADFPVIQPVQQKKIWDNFKAGGGPEKLEELIEELQHSDHQFHMEG
FT                   GSWTNNISWVQGYENVIGPIEKVSALFSEKVLDKGGISTSEYRYRNALYYLLMIQTSCY
FT                   RYWGQGIWTDYARELCRRAEAILNHDFKDAAA"
FT   gene            complement(103242..104909)
FT                   /locus_tag="Nhal_0094"
FT   CDS_pept        complement(103242..104909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0094"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   noc:Noc_0101 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13314"
FT                   /db_xref="GOA:D5C4P1"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P1"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADE13314.1"
FT                   /translation="MSSLKLSAKRFNPDVLKRAIVPITAGVLSVICLLLTMVSPWWLLG
FT                   LAVTLPLVALGIYDWTQQRWTLTRNYPVAARIRWLFYDLRPYLRAYIVEGDLEGKPFSF
FT                   DARNLVYARARGKPDTHPFGTEWDMTSDEYEWLCHSIAPAENPEKNPCVSIGGAQCQQP
FT                   YSASIFNISAMSFGSLSANAVEALNKGARLGGFYHDTGEGGISPYHLKQGGDLVWEIGS
FT                   GYFGCRDNKGNFDEDLFIEGATRNEVKMIEIKLSQGAKPGHGGLLPAAKVTEEIARIRK
FT                   VPAGQDCLSPRGHSAFSTPVEMLDFAARIRHLSGGKPVGIKLCVGQIHEVLAIMKAMLK
FT                   TGIYLDFIVVDGGEGGTAAAPLELSDYVGMPLTEGLIVVRNALVGTGLRDKVRLGASGK
FT                   VYSGAGMARNLAIGADWCNAARAFMFSIGCIQAQRCHLDTCPTGVTTQDPGRQRGLVVD
FT                   VQAERAARFHQQTLAALAHIVAAAGLTHPQDLQPYHLIRRFGTTDSRPFDRIYPFISEN
FT                   ALLEGAEETPYAEWWHAADPDSFRPRIDLGIARANVPA"
FT   gene            complement(104926..106389)
FT                   /locus_tag="Nhal_0095"
FT   CDS_pept        complement(104926..106389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0095"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="KEGG: noc:Noc_0100 glycogen synthase; TIGRFAM:
FT                   glycogen/starch synthase, ADP-glucose type; PFAM: Starch
FT                   synthase catalytic domain protein; glycosyl transferase
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13315"
FT                   /db_xref="GOA:D5C4P2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P2"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADE13315.1"
FT                   /translation="MYIVMITPECAPIAKVGGLGDVVQGLSNELSIRGNVVELILPKYD
FT                   CMRYDRIWGLVKTYSDLWVPYYNQWIHCDVYFGFADGLKCFFIEAHNGFFDRGTYYGQH
FT                   DDPQRFAFFCKAALEFMLKSNKHPEIIHCHDWQTGLVPVLLFEQYQYLGMSHPRVCYTL
FT                   HNMQHQGVTGGHIIQQVGLDPAAYMTPQRLLDHTHPHAVNLMKGGIVFSNFVTTVSSHY
FT                   LDEIRYTEQGYGLQHTLHLHGQKLGGILNGVDYNVWNPGLDPHIPVRYNLETLDQKYEN
FT                   KTALRHRLWLRDEYKPIIGVISRLDAQKGVGLIRHAIFYCLANGCQFVLLGASANDSIN
FT                   ADFWHLKHHLNDNPDCHLEIGYDEDLAHQIYAGADMLLVPSAYEPCGLTQMIAMKYGTV
FT                   PIVRSVGGLADTVFDANYAHKPYHERNGFAFNDFNHEGLESALYRAIGLWYQYPQYFRE
FT                   LMENGMHYDFSWNYPGQHYLNIYHHIQEV"
FT   gene            complement(106374..108011)
FT                   /locus_tag="Nhal_0096"
FT   CDS_pept        complement(106374..108011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0096"
FT                   /product="Domain of unknown function DUF1957"
FT                   /note="PFAM: Domain of unknown function DUF1957; glycoside
FT                   hydrolase family 57; KEGG: noc:Noc_0099 glycoside hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13316"
FT                   /db_xref="GOA:D5C4P3"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P3"
FT                   /inference="protein motif:PFAM:PF09210"
FT                   /protein_id="ADE13316.1"
FT                   /translation="MACCGYLSFILHAHLPYVRHPEQEEALEERWLFEALTECYLPLLN
FT                   AFERLAQEGTRFRLTLSLSPTLLTMLQDPLLLQRYVLHMEKLITLAEKEVQQTRAHTDL
FT                   NRLARLYRRWFLQTLSDFEERYQRRLVPTFARLQQEGLLEIITCAATHGFLPLLQPEPT
FT                   AVYAQLQVAADYYRQCFGIAPKGIWLPECAYYPGLEKALKAVGFDYFFVETEGLLYANT
FT                   RPRYGHLAPIACPNGVAAFGRDPAISQQVWSAEEGYPGDRDYREFYRDVGFERELSYLQ
FT                   PYLPGGQIRVDTGIKYYRVTDKTEHKAPYQPAKARAKVAAHADHFYHNCLQQVAGHAKT
FT                   MDRPPLLLAPYDAELFGHWWFEGPQWLESLLRRFGSTKGPIELITPSQYLTQHPVLQKA
FT                   TPNLSSWGDRGYNDFWLNKKTDWIYPLLHRAARRMRELAIAYYHEPKGTLADRALRQAA
FT                   RSLLLAQASDWPFIIENGTTVEYATRRLRDHLSRFHYLEIALEKGIFDERRLQALETLD
FT                   NIFPDLDYRVYYGYPPGNNGEAARCISL"
FT   gene            complement(108018..108680)
FT                   /locus_tag="Nhal_0097"
FT   CDS_pept        complement(108018..108680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13317"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P4"
FT                   /inference="similar to AA sequence:KEGG:Noc_0098"
FT                   /protein_id="ADE13317.1"
FT                   /translation="MNKENTPFSRQELLQISQETRDRFFRPPPTEGTKVVLMVVNPYCL
FT                   YVYWSVLKQDLVRARKKLKIKKPTQLMLRFYDLTAGKLAAPTRFDVAVPRRAHHRYVDL
FT                   WADDKRYKVELGLANSEREFVPLARSNSIKTPRAGPADPTAPVVFVRHDTQPPLPVKTF
FT                   PLEFSISPEEQASRTQEFIARYFPSLAESTQTQPPAKLTSASEPRSRWSASLSKPPP"
FT   gene            108700..109068
FT                   /locus_tag="Nhal_0098"
FT   CDS_pept        108700..109068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13318"
FT                   /db_xref="GOA:D5C4P5"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13318.1"
FT                   /translation="MDSKRGLQGGQLPLGGVPSVGDFALVHTFSIQGIYIIAFFGVNIV
FT                   ELRISADLTVDRSSISLFVRIANATCWLIGVVEQRKIDRGLLQFFLKGLNTWASQAVIA
FT                   TITIKKTRIGSKSRSIET"
FT   gene            109198..112029
FT                   /locus_tag="Nhal_0099"
FT   CDS_pept        109198..112029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0099"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /EC_number="1.2.4.2"
FT                   /note="KEGG: noc:Noc_0111 alpha-ketoglutarate
FT                   decarboxylase; TIGRFAM: 2-oxoglutarate dehydrogenase, E1
FT                   subunit; PFAM: Transketolase central region; dehydrogenase
FT                   E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13319"
FT                   /db_xref="GOA:D5C4P6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P6"
FT                   /inference="protein motif:TFAM:TIGR00239"
FT                   /protein_id="ADE13319.1"
FT                   /translation="MNAIVEKRDSTSPLYAANAPYLEELYENYLKDPNSVPVHWREWFD
FT                   RLQAGVPEQPIPEPPSRPLGPMARPSAPPVPAEALARGLTAKAAEKQTAVLQLINAYRF
FT                   RGHQKANIDPLHLHERPVIPELDPAFHGFTEEDLDKVFSTGSLIGLAQAPLRQILALIK
FT                   KIYCNTIGAEYMHITETAEKRWIQNYLEGAQGNLSPSAELRRHILERLTAAEGLERYLH
FT                   TKYVGQKRFSLEGGDSLIPLLDSLILHAGSKGMEEIIIGMAHRGRLNVLVNTLGKLPRD
FT                   LFMEFEGRHEVDDSRSGDVKYHLGFSADADTPGGPVHIALAFNPSHLEIIDPVVEGSVR
FT                   ARQQRRKDWLGDEVIPVLIHGDSAFAGQGVVMENFNMSQSRGFFTGGTLHIVVNNQIGF
FT                   TTSNPLDTRSTVYCTDVAKMVQAPIFHVNGDDPEAVVFVTHLAFDYRMTFKKDVVIDLI
FT                   CYRRQGHNEADEPAVTQPLMYQKIRSHPTLRRLYAERLIAQNIIAPEEPDRILDDYRQA
FT                   LEQGTNVAPCATESAHPFKVDWKPFLGTSWDQPVETGMPLQRLQELAARIDQPPKGFEL
FT                   HSRVSNILADRRKMAAGALPIDWGFAETLAYATLLDEGYSVRLTGQDSGRGTFFHRHAV
FT                   IYNQKDGCAYVPLEQLNPEQADFSIIDSLLSEEAVLAFEYGYAATEPNALVIWEAQFGD
FT                   FVNGAQVVIDQFLSSGEAKWSRLCGLVLLLPHGYEGQGPEHSSARLERFLQLCAEDNIQ
FT                   VCVPTTPAQMFHMLRRQILRPYRKPLIVMSPKSLLRHRLSVSSLDELCSGAFQLVIGEV
FT                   DEIKPAMVERVILCSGKVYYDLLQARRDQEQHDVAILRLEQLYPFPRQQLEEELKRYRR
FT                   AKEIIWCQEESQNQGAWDQLRRRLQGCLRRNQTLRYAGRASSAAPAVGYFNFHLKQQRA
FT                   LVKDALSPGEKNE"
FT   gene            112045..113340
FT                   /locus_tag="Nhal_0100"
FT   CDS_pept        112045..113340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0100"
FT                   /product="2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: catalytic
FT                   domain of components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain-containing protein; E3
FT                   binding domain protein; KEGG: noc:Noc_0112 dihydrolipoamide
FT                   succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13320"
FT                   /db_xref="GOA:D5C4P7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P7"
FT                   /inference="protein motif:TFAM:TIGR01347"
FT                   /protein_id="ADE13320.1"
FT                   /translation="MGIEVRVPRLPESVTEAVVGDWHKKPGDRVRRDETLLDLETEKVV
FT                   LDVPAPGDGVLQEVRKEKGATVGSEEILGIIEPAEVSEKETPEAPAGGAKAASEEKTET
FT                   EASAQAPSAKRSAPPPPPKEAEEEELPPLSPAVRRLIREYQLDPREIPATGKDGRLTKT
FT                   DVVRFLQSEELVTAPTAPEPAPPPEAKPAAVPKAEGYGVRREAMSRLRQRIAERMLESQ
FT                   QTTAALTTFNEVNMQEVMRLRHRHRDAFEKRYGVRLGLMSFFIKACIEALKRHPIVNAT
FT                   IHGNDILYYQYYHIGIAVATPRGLVVPVLRDADHLNFADIETQITDFAQRARNGQLTIE
FT                   ELTGGTFTITNGGVFGSLLSTPILNPPQSAILGMHKVEDRPVAENGEVKIRPMMYVALS
FT                   YDHRLIDGKDAVQFLVAVKEALEDPVRLLLEV"
FT   gene            113362..114795
FT                   /locus_tag="Nhal_0101"
FT   CDS_pept        113362..114795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0101"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   noc:Noc_0113 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13321"
FT                   /db_xref="GOA:D5C4P8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P8"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ADE13321.1"
FT                   /translation="MSERYDVVIIGAGPAGYVAAIRCAQLGLRTACIDKWLSPEGKPSL
FT                   GGTCLNAGCVSSKALLDSSELYQRAQTEFAEHGIKAAQVSVDLAAMQARKTRLVHRLTA
FT                   NIATLFEDYQIQWLPGHGRLLENNQVEFTPHEADGPQMLAAKNVILASGSRPMELEAAP
FT                   IDGERIVDSTGALSFQEVPRRLGIIGAGVIGVELGSIWSRLGAKVTLLEARDGFLPMVD
FT                   KAISQEAHKRFKQQGLDVRLGARVVSTRVTSKQVTVHYQIGEEDHELKVDKLIVAVGRQ
FT                   PYSEHLFALETGLLLDERGFIHVDEYGATNLPGVYAIGDVVRGPMLAHKGSQEGIAVAE
FT                   AIAQGKETTVKRDNIPWVIYTEPEISWAGRTEEALRDAGIEVRVGTFPFAASARANAMD
FT                   GTEGLVKVVADANTDQLLGVHIIGPWASELIAEAVLAMEFAASSEDLARTIHAYPSLAE
FT                   ALHEAALDVDNRAIHVAGR"
FT   gene            complement(114792..115397)
FT                   /locus_tag="Nhal_0102"
FT   CDS_pept        complement(114792..115397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0102"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: met:M446_5868 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13322"
FT                   /db_xref="GOA:D5C4P9"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4P9"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADE13322.1"
FT                   /translation="MQHTDDLYFILEHAWRLLQQGYQNPASRLRTPVLATSGLDGQANA
FT                   RTVVLRRVEPEKRKLFINTDCRSPKYHELLADPRGTLVFFDPETETQLRIYTEIRIHQH
FT                   NELTHRAWNELPAGGRQIYKTTAPPGKVAPAPTSGLPMPESTHGSMDESSHPGYENFVV
FT                   LEAIAKHLDWLCFSEQGHRRAGFTWDQEGLLHASWRYP"
FT   gene            complement(115529..116983)
FT                   /locus_tag="Nhal_0103"
FT   CDS_pept        complement(115529..116983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0103"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   noc:Noc_0114 di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13323"
FT                   /db_xref="GOA:D5C4Q0"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q0"
FT                   /inference="protein motif:PRIAM:1.11.1.5"
FT                   /protein_id="ADE13323.1"
FT                   /translation="MQKKFTLSFCAFLLASTPLHSVTSHELSPSPRGSNFYNNLASFPL
FT                   LLTHTPTYSHSHHGLPAPTADSDFYDHGTPAPTKVQLGKFLFFDKILSGNRNISCATCH
FT                   HPLAATGDGLSLPVGEGGQGLGITRNTGLGDDAIYERVPRNATPLFNLGATSMTAMFHD
FT                   GRVEVNLQATSGFHTPAGDDLPVGILDNVLAAQAMFPVTSAAEMAGQPGENSIADAAAA
FT                   DNLAGSGGVWEQLAERLKANAEYVRLFGEAFDLTAEEITYAHAANAIAAFEAVAWRADN
FT                   SPFDRYLRGNKKAMSWEAIQGMMLFYGKADCSSCHSGIFQTDMQYHAIAMPQIGPGKGD
FT                   GAEGHEDFGRERVTDDPADRYRFRTPPLRNVVITGPWGHDGAYNTLEGIIRHHLDPVTA
FT                   LLTYDCPEEAKLPFREDLDFLDCQVQNDTSKVNQIAAANELPLRELSDEEVSHLLAFLH
FT                   ALTDPASLDLRHDVPSHVPSGLTLVE"
FT   sig_peptide     complement(116918..116983)
FT                   /locus_tag="Nhal_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 22"
FT   gene            complement(117047..118345)
FT                   /locus_tag="Nhal_0104"
FT   CDS_pept        complement(117047..118345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0104"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   noc:Noc_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13324"
FT                   /db_xref="GOA:D5C4Q1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q1"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADE13324.1"
FT                   /translation="MEWWIPVMIIVLLILLNGIFVAAEFAIIGVPRAAIERRAVAGESS
FT                   AALVQAILRDPLQQDRYIATAQLGITLASLGLGMYGEPILAHWFAEGLEGLGTSRWIAA
FT                   HTVASVLAISILTYFHIVLGEMVPKSLALMHAEGTALWITRPMRWTKFATYPLVITLNS
FT                   LGTAILRAMGIERRLTSGHYHTAEELQLIVEESEESGVLNPEAGQMLRELLELRERTAE
FT                   EVMVPRVHVTGIPLGASPEELTAIITNTHHTRYPVFEGTLDQIIGLIHIKDVLRLLVAN
FT                   HSLRKEDLRPLSFVPETALVDAVLAAMRRAHTHMVVVIDEYGGTSGIVSIEDLCEEVVG
FT                   EIEEEPGTSVAAFVDAQGNLHVPGIWRLDEVGEQLGMELSHEEVDTLGGLVLHLLGREP
FT                   AVGDTVTYEDIHITVTALEGHGIKWCVLVPPPS"
FT   gene            complement(118349..119770)
FT                   /locus_tag="Nhal_0105"
FT   CDS_pept        complement(118349..119770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0105"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SMART:
FT                   CBS domain containing protein; KEGG: noc:Noc_0118
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13325"
FT                   /db_xref="GOA:D5C4Q2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q2"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADE13325.1"
FT                   /translation="MGLWVKSIDEQSTSSIFRRQNKNDRPATGPHMNVTTFAVFVFLIT
FT                   ANALYVAAEFAAVGVRRSQIQKLAENGHWLAKGLLPIIEDTARLDRYIAASQIGITLSS
FT                   LILGAYGQATLGQELALLLALFGDMEPLAAQSTAAMVVLVLLTGLQVVFGELVPKSLAL
FT                   QYPVQLALYTYLPMRWSLKLYSGFIAFLNGSGIVLLRALGVRHSRHRHVHSPEEIDMLI
FT                   AESREVGLLKLHEQQRLHQALYLSRRTARQLMVPRRFVAIVDTKTPPQQLFQIVVESPF
FT                   SSLPVYQGSLDNIIGMIHTKDVTAHFAEHRALPTVAQAMRPAISVLDKVTGDRLLAIMR
FT                   QRHSRKLIVVDEYGTMQGLVTLDDMLIALTGGVAEESKEEYAQPEYLPDGRVRLPGLLR
FT                   VEETVLWTGLPWHSQANTVAGHITSMLERIPEPGERVMIDGLEVEIEELDGPAIRSVLV
FT                   KANPPVESPTPENED"
FT   gene            119888..120490
FT                   /locus_tag="Nhal_0106"
FT   CDS_pept        119888..120490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13326"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q3"
FT                   /inference="similar to AA sequence:KEGG:Noc_0119"
FT                   /protein_id="ADE13326.1"
FT                   /translation="MDIAKKFLRLFYRPQFIAFVALTVLALPLHAQSGGDLSLSSEQMQ
FT                   ELHKLQQKMRTVGQQLDKIRQEALEAKPELQDQQGEYQSLLFETMKEQGNDPAPALTRM
FT                   SEIEGQMQDQELAEEKRKQLIMEYRQKDAGLQQASRKAMQDEEVREAAQELSQATVAAM
FT                   REHNPKTGELLQEMKQLRQEIRQMVAQIKAEEGAGSK"
FT   sig_peptide     119888..119983
FT                   /locus_tag="Nhal_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 32"
FT   gene            120918..121355
FT                   /locus_tag="Nhal_0107"
FT   CDS_pept        120918..121355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13327"
FT                   /db_xref="InterPro:IPR025693"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q4"
FT                   /inference="similar to AA sequence:KEGG:Noc_0120"
FT                   /protein_id="ADE13327.1"
FT                   /translation="MSALVRASALLSFFFAIILAATGCAGPRPILYPNPHLRSVGQEVA
FT                   EQDIAECRAMAEAAGATPGKGKAGETVENSAVGAGMGAASGAVGGAVVGAAGSGAAIGA
FT                   ASGAAAGLLRSLFGASRPSQAYIDFVNQCLRERGYKPVGWE"
FT   sig_peptide     120918..120995
FT                   /locus_tag="Nhal_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.666 at
FT                   residue 26"
FT   gene            complement(121412..121786)
FT                   /locus_tag="Nhal_0108"
FT   CDS_pept        complement(121412..121786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_1917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13328"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q5"
FT                   /inference="similar to AA sequence:KEGG:Noc_1917"
FT                   /protein_id="ADE13328.1"
FT                   /translation="MVSLRFSHLFSLRSSFSYAALLAALNLSTPAIAAASENQFSIQQV
FT                   TPSKVTHCELIGDVKGSSGWGRIAIRAWAGKAKHQALQQAKNLGATHVVWSRFHNGYGS
FT                   GPYAYGEAYNCSKAEALHGL"
FT   sig_peptide     complement(121685..121786)
FT                   /locus_tag="Nhal_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.847 at
FT                   residue 34"
FT   gene            122113..123561
FT                   /locus_tag="Nhal_0109"
FT   CDS_pept        122113..123561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0109"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG: son:SO_0541
FT                   metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13329"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q6"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADE13329.1"
FT                   /translation="MSREQRTLQIQFLGAAGEVTGSCHLVQVGEKKILLDCGLIQGRPK
FT                   DEARNREPFPFDPETIDAVVLSHAHIDHSGRLPLLIKSGYSGPVYTHRATADLCRTMLR
FT                   DAGFLSEKDAEWENRKRERKGLPLVEPLFTIQDVEAALGQFKELDYGRQQTILPGVSIR
FT                   LSDAGHILGSAVTELWLSQNGQVRKLVYSGDLGRSGMPILADPTPIQDADLVVMESTYG
FT                   NRLHRTWVQTLTELKGIFNDTLTNGKGNILIPAFAVGRTQEILYLFAKYYEEWGLERWY
FT                   IFLDSPMAAEATDTYARNSQLFDRESSEMWRRHQEHSLLPNLRFTRTAQESMQLNKIRS
FT                   GAIIIAGSGMCDGGRIKHHLKHNAWRKDCHIIITGYQASGTLGRSLVDGAKYIKLWGET
FT                   IRVAASVHTVGGLSAHADQAGLMNWYAHFQGRPPLVLVHGEAVAAEGLAKRLREDLAAP
FT                   VRIAQPASQMDLGHLGNFIGSPEK"
FT   gene            complement(123629..124672)
FT                   /locus_tag="Nhal_0110"
FT   CDS_pept        complement(123629..124672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0110"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: noc:Noc_0104 membrane-bound metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13330"
FT                   /db_xref="GOA:D5C4Q7"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q7"
FT                   /inference="protein motif:PFAM:PF04307"
FT                   /protein_id="ADE13330.1"
FT                   /translation="MDIVTQGLLGAVVAQSATRSSQVRLAAAVGFVAGLLADADVFIRS
FT                   AEDPLLTLEYHRQFTHSLLFVPIGGLIAAVLLWPFLRRRLNFGRLYGLATLGYLPSGLL
FT                   DACTSYGTQLFWPVLETRIAWSLIAVVDPLFTGVLAIALGWSLFKSTPVAARLGLGLTL
FT                   LYLLLGLVQQERVETRVATLAESRGHRIERLEAKPTLGNLILWRTIYESKGRFYVDAVR
FT                   VGILSEPRIYRGGATERFTPKQLEGLQPGSLLAQDIERFTRFSDGFIAQHPEQPNILGD
FT                   VRYAMLPTQLIPLWGIELDLTQQNQHVRFRTFRQLDEATRDAFLDMLLGRSINSSAPIS
FT                   AEEIPLE"
FT   gene            complement(124691..125545)
FT                   /locus_tag="Nhal_0111"
FT   CDS_pept        complement(124691..125545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13331"
FT                   /db_xref="GOA:D5C4Q8"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q8"
FT                   /inference="similar to AA sequence:KEGG:Noc_0105"
FT                   /protein_id="ADE13331.1"
FT                   /translation="MRGDGIVRFGLLEKGRAAASGNFRDYGIALIVFASIAFCLHLDAD
FT                   STLAFQDLLGVCAWVFLFALLRGESRLVQAQVLVAVAFATVGEHFASPYMEGYIYRFHN
FT                   VPAYVPPGHGMVYLTAVALARSELFKRNLKAITAMVLTAGGLWTIWGLTGAAQKDAVGA
FT                   LLFVVFVLFVLFGRSPGVYLGAFFVTTWLELIGVSYGNWRWVPIDPVLELPQGNPPSGV
FT                   AAWYCLVDAVALGTAPAVVKGFIWMQAALWRRYLYPEVVPRLLFAPHLQQDYIPALAPV
FT                   VLS"
FT   gene            complement(125718..126215)
FT                   /locus_tag="Nhal_0112"
FT   CDS_pept        complement(125718..126215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13332"
FT                   /db_xref="GOA:D5C4Q9"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Q9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13332.1"
FT                   /translation="MSVQLSSIKTGLALVLIGLIFGISLGISFGLNEDLFKDFVARGIT
FT                   ANPDLHDAKSQDKIWRYAQRAHFHATGIAAFSIGLLLLIAISKMKMGLKKLTSVFIGLG
FT                   SFYPFAWLSMFLLAPSIGRGPAHSHLITETLTYLGVGSLSLGLLILLANLFLGWLSETQ
FT                   DT"
FT   sig_peptide     complement(126123..126215)
FT                   /locus_tag="Nhal_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.391 at
FT                   residue 31"
FT   gene            complement(126606..127514)
FT                   /locus_tag="Nhal_0113"
FT   CDS_pept        complement(126606..127514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0113"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; KEGG: noc:Noc_0107 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13333"
FT                   /db_xref="GOA:D5C4R0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R0"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADE13333.1"
FT                   /translation="MAHDLITVFGGTGFLGRAIVRHFVESGVAVRIAARHPSAPEFAGA
FT                   SNQIELQSADVRDENSVAEAVNGATGVVNAVGLYVEKGKATFDAIHVEGAERIARRARE
FT                   ANIRKLVHISGIGADPGSASKYVRARAHGEQRVQSAFPEAVILRPSVLFGPNDAFLGAL
FT                   KTVTRLPVVPLFGKGTTRLQPVYVEDVARAVLQALETPGVAGRIFELGGAQIYSYRDIL
FT                   ERVLAHFSRRRLLLPVPFPIWRLLARISSLLPNPPLTRDQVILMETDNVVGTGAGTFGD
FT                   LGIEPYSLEQMLTHCLGNPPQ"
FT   gene            complement(127669..129147)
FT                   /locus_tag="Nhal_0114"
FT   CDS_pept        complement(127669..129147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0114"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: dar:Daro_3107 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; PAS domain containing protein; histidine kinase A
FT                   domain protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13334"
FT                   /db_xref="GOA:D5C4R1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R1"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADE13334.1"
FT                   /translation="MLQIEALSKGLLESTPDAILVVNQEGCIVQINAQTENMFGYSREE
FT                   LIGQKLEILLPERFRDRHQAHCQKFFQTPHFRPMGTGLELYGLRKDGSEFPVEISLSWH
FT                   QAKEGMLALSAVRDVTERKQAEKALQATEQRLVLLMDSLPVLISYVDAHQRYRIVNKAY
FT                   EEWFGYSRSEIQGKHLGEVLGEAAYEAIKEHVEKALGGQMAIFERVVPYQDAGPRYVEA
FT                   SYIPHLEEQGEVAGFFVLVNDITERKQIEEQIRQQQLELAHLERLSTAGEMASELAHEL
FT                   KQPLTAVSTYIEACLRMLQRGIVSPEHLVETLENAINQNQRADEIIRRLRDFIRSRETH
FT                   LSLIDLNKLVRETLSLAEIEIRNSQARLRLELADSLPPLSIDPIQIQQVLLNLVRNSLE
FT                   AMQDTEIGKRELTIQTSLTMENNQIEIAVSDKGAGISSEALKQLFEPFFTTKVSGMGVG
FT                   LSICRSIIEAHGGHIWATSNADQGATFHFTLPIA"
FT   gene            complement(129549..129761)
FT                   /locus_tag="Nhal_0115"
FT   CDS_pept        complement(129549..129761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0115"
FT                   /product="Cold-shock protein DNA-binding protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: noc:Noc_2609 cold-shock protein,
FT                   DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13335"
FT                   /db_xref="GOA:D5C4R2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R2"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADE13335.1"
FT                   /translation="MSVQETGTVKWFNDAKGYGFIQRESGGSDLFVHFRSITGHGHKSL
FT                   EEGQQVSFIEVPGQKGPQADQVTVL"
FT   gene            complement(130366..130575)
FT                   /locus_tag="Nhal_0116"
FT   CDS_pept        complement(130366..130575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0116"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   aeh:Mlg_2272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13336"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R3"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ADE13336.1"
FT                   /translation="MKYAIVIEKAASNYSAYVPDLPGCVATGSTIEEVESEIREAIEFH
FT                   LEGMREDGELIPPPSSQVEYVDIT"
FT   gene            complement(130588..130773)
FT                   /locus_tag="Nhal_0117"
FT   CDS_pept        complement(130588..130773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0117"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: aeh:Mlg_2273 YcfA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13337"
FT                   /db_xref="GOA:D5C4R4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R4"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ADE13337.1"
FT                   /translation="MKVGDILQKLKDDGWYLHSIRGSHRQFKHPSKLGRVTVPGKPGDD
FT                   LAPGTVNSIFKQAGWK"
FT   gene            130852..131124
FT                   /pseudo
FT                   /locus_tag="Nhal_0118"
FT   gene            complement(131623..131886)
FT                   /locus_tag="Nhal_0119"
FT   CDS_pept        complement(131623..131886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0119"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   addiction module toxin, RelE/StbE family; PFAM: Addiction
FT                   module toxin Txe/YoeB; plasmid stabilization system; KEGG:
FT                   aeh:Mlg_1786 addiction module antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13338"
FT                   /db_xref="GOA:D5C4R5"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R5"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ADE13338.1"
FT                   /translation="MSWRVVYTKQAQKDAKKLASSGLKPKAQELLAILAEDPFQRPPPF
FT                   EKLVGDLAGAYSRRINIQHRLVYQVLEEDRVVKVLRLWSHYE"
FT   gene            complement(131883..132125)
FT                   /locus_tag="Nhal_0120"
FT   CDS_pept        complement(131883..132125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0120"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: aeh:Mlg_1787
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13339"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R6"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADE13339.1"
FT                   /translation="MTAITASEARANLYRLIDEVASSHQPLLISGKRNKAVLVSEEDWE
FT                   AIQETLFLLSVPGMRESIRQGMETPVDECAKDLDW"
FT   gene            complement(132229..132534)
FT                   /locus_tag="Nhal_0121"
FT   CDS_pept        complement(132229..132534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13340"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R7"
FT                   /inference="similar to AA sequence:KEGG:Maqu_2675"
FT                   /protein_id="ADE13340.1"
FT                   /translation="MSKVKLDEEEKEILRDFEAGEFKSALTPQRKKQLAKAAEETFKKD
FT                   KRINIRISSRDLEALQRRALEEGIPYQTLVSSILHKYVSGSLYDATANKSLNSEPR"
FT   gene            complement(132531..132809)
FT                   /locus_tag="Nhal_0122"
FT   CDS_pept        complement(132531..132809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13341"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R8"
FT                   /inference="similar to AA sequence:KEGG:Maqu_2676"
FT                   /protein_id="ADE13341.1"
FT                   /translation="MKPFNWNHIKNQQLIEDRQISFEDILFFIQKGRLLDDIEHPNKTK
FT                   YLNQRVFVVEVDEYAYLVPYIESDNEIFLKTVIPSRKATKQYLGGKS"
FT   gene            complement(132956..133438)
FT                   /locus_tag="Nhal_0123"
FT   CDS_pept        complement(132956..133438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0123"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   noc:Noc_1856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13342"
FT                   /db_xref="GOA:D5C4R9"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4R9"
FT                   /inference="protein motif:PFAM:PF07605"
FT                   /protein_id="ADE13342.1"
FT                   /translation="MTQARSLQISLVDTPYYHCVARCVRRAFLCGVDDFSGRNYEHRRQ
FT                   WIVDKLKRLSSIFAIDICAYAVMSNHYHVVLRVDEDTAGHWEDADVIERWTTLFSTPVL
FT                   IQRYLKGETTTAAEQRGPEQRGQVLSIDIYYPNKGVKSCLLIFTIFRISTYEGVFT"
FT   gene            complement(133537..133797)
FT                   /locus_tag="Nhal_0124"
FT   CDS_pept        complement(133537..133797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_3145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13343"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S0"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_3145"
FT                   /protein_id="ADE13343.1"
FT                   /translation="MSSRALGKDILEVEVTNISKHGIWLLAHDRELFMSYENFPWFKNV
FT                   TVAKILNVEEPSPDHFYWPDLDVDLTAEIIEHPERFPLKAR"
FT   gene            complement(133757..133996)
FT                   /locus_tag="Nhal_0125"
FT   CDS_pept        complement(133757..133996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_4572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13344"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S1"
FT                   /inference="similar to AA sequence:KEGG:Sbal195_4572"
FT                   /protein_id="ADE13344.1"
FT                   /translation="MSPTIFRERGYRFFFFSREESRSHVHVYCGSGEAKFWLEPEIELA
FT                   KNYHLSRTQLKEIEGIIEAHYHELKSAWQRHFGS"
FT   gene            complement(134132..134398)
FT                   /locus_tag="Nhal_0126"
FT   CDS_pept        complement(134132..134398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_3956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13345"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13345.1"
FT                   /translation="MYWDVKRVCPLDNYEIYVELEDGRKGIFDLKPYLDHGLFRELKNK
FT                   AYFSQVDVVFGAVTWPHEQDIAPETLLAGLKPVEKEINAKQGA"
FT   gene            complement(134406..134672)
FT                   /pseudo
FT                   /locus_tag="Nhal_0127"
FT   gene            complement(135231..136055)
FT                   /locus_tag="Nhal_0128"
FT   CDS_pept        complement(135231..136055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0128"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="PFAM: protein of unknown function DUF1555; KEGG:
FT                   reh:H16_B0324 fumarylacetoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13346"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S3"
FT                   /inference="protein motif:PFAM:PF07589"
FT                   /protein_id="ADE13346.1"
FT                   /translation="MKRLMWFMAIVLSHLWWTPAAGLTIDQAFVRAEPGDPLSPLDDIT
FT                   ELVRSTPNGDPLFFDLSDSETFPNISHLYDQGEAIGFVRHTQGRFFGRLEKGISVIADA
FT                   PGEEKRAELFVAAHWTHPGGLLKQVISIDGRLEMTLDSQRLGPPAGMWAEAGADWFGRL
FT                   DPLGFEIEDATALVRSGSFDIQDSKEESGFRPANTRVDFRNVLRVGALLGPNAGAGDFA
FT                   IASLFDSSLEESRAIPEPPTIVLFFLGLGVALCFSKKAPSAAKFKPNQTGQI"
FT   gene            136609..137585
FT                   /pseudo
FT                   /locus_tag="Nhal_0129"
FT   gene            137705..138355
FT                   /locus_tag="Nhal_0130"
FT   CDS_pept        137705..138355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0130"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.21"
FT                   /note="KEGG: noc:Noc_0079 DNA-3-methyladenine glycosylase
FT                   II; TIGRFAM: DNA-3-methyladenine glycosylase; PFAM:
FT                   methylpurine-DNA glycosylase (MPG)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13347"
FT                   /db_xref="GOA:D5C4S4"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S4"
FT                   /inference="protein motif:TFAM:TIGR00567"
FT                   /protein_id="ADE13347.1"
FT                   /translation="MFRRFGVCVLDMTDFMTDLLPPSFYARDALEVAADLLGVLLCRDQ
FT                   VVLRITEVEAYRWPEDTANHGRHGRTLRNEALWGPPGRVYLYVCYGIHHLLNLVTGEEG
FT                   QAAAVLIRACEPVAGLDLIQRRRRGKIGPSLLTGPGKVGAALGLDLGWNHHPLYEPGGL
FT                   EVRWGAPVKGRLAGPRVGIAYARPEHRDAPWRLAIPDSPWVSCRSQLQPSQES"
FT   gene            138488..144052
FT                   /locus_tag="Nhal_0131"
FT   CDS_pept        138488..144052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0131"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: noc:Noc_0078 excinuclease ABC subunit A;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13348"
FT                   /db_xref="GOA:D5C4S5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S5"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADE13348.1"
FT                   /translation="MSKGFIWVKGARQNNLKGLNLKFPLNELIVITGVSGSGKSSLAFD
FT                   TIYAEGQRRYVETFSPYARQFLDRMDKPQVDRIEGIPPAIAIDQTNPVRTSRSTVGTMT
FT                   ELNDHLKLLFARAGKLYCQGCGQPVRRDTPDSIYDQLLHQGMGLRALMTFEIAIPPNFS
FT                   PQEVKEQLLRQGYTRFHHQNDQVLEVIQDRLRLEPSRRERIVEALETALKHGRGRLAVY
FT                   PLDEDRQPLPPWRFSSALHCPQCDLAYRDPFPNLFSFNSPLGACETCRGFGRTMGIDYD
FT                   LVVPDDRKTLAEGAIKPWQTASYEECQQDLMRFARRRGIPTQRPWRELTSDQQRWVLEG
FT                   EGEWEENKWYGVQRFFHWLEGKSYKMHIRVLLSKYRAYHLCPACHGARLKPESLLWRLG
FT                   TKADADRVLPEKHRFKPSGVRFSQPQLAALPGLTLHDVMQLPLERCQQFFTQLTLPAPL
FT                   DQAAELLLGEIRSRLNYLVEVGLGYLTLDRQSRTLSGGEVQRINLTTALGTSLVNTLFV
FT                   LDEPSIGLHARDLQRIIRVLQRLRDGGNSLIVVEHDPQVMLAADRVLDLGPGPGERGGQ
FT                   RVFFGPPHELLQAKNSLTAQYLVGKKQVVAEPSRAGKPPATASMEIRGATENNLKNITV
FT                   RFPLNRLVCVTGVSGSGKSTLVQEVLYKGLRKLKGQPVGIPGGHQALQGHEPIQGVVLV
FT                   DQSPIGKTTRSNPVSYVGALAGLRKAFAAEPLAQERGYGAGTFSFNSGNGRCPTCGGSG
FT                   FEQVEMQFLSDVYLRCPDCNGQRYRPEILEVKLQPSTHSPGKSIAEVLEMTVAEALEFF
FT                   ADYPEVKRGIEPLQAVGLGYMKLGQPVPTLSGGEAQRLKLAGHLAKGRGRKEAHRTLFL
FT                   FDEPTTGLHFDDIATLLQAFQRLLAEGHSLVVIEHNLEVIQAADWIIDLGPEGGEAGGK
FT                   VIAIGSPQEVAQSQGSHTGQALRDHAQALNLLTLATPAIGEAPSSYGAMFPEQARAEGN
FT                   SAIYIHNAREHNLKGIELQIPRERFTVITGISGSGKSTVAFDILFAEGQRRYLESLNAY
FT                   ARQFVQPAARPDLDAIFGIPPTVAIEQRTSRGGLKSTVATLTEIYHFLRLLFVKLGQQH
FT                   CPDCGIPIEAQTLEAIQARILRDYRGRRLSVLAPLVVARKGYYTDLAKWAATKGFTHLR
FT                   VDGTMIPTDPWPRLDRFKEHSIELPVGEIKVTPGEEKALGTLLERALSLGQGRVEILLP
FT                   KKGEKTLYSTKRSCPSCSRSFGELDPRLFSFNSPQGWCPRCYGTGQVLPGFDGSQTGEE
FT                   KEWAVGEENSARICPACQGRRLWPDALAVYFQERNIAEFTGMSVAAAEATFQSMKLQGR
FT                   EAAIARDLLPELRSRLKFLKEVGLSYLTLDRAAPTLSGGEAQRIRLASQLGSNLRGVCY
FT                   ILDEPTIGLHPRDNKMLLNTLGKLEGKGNTIVVVEHDEDTIRRAEHVIDLGPGAGVNGG
FT                   RVVAAGTVEALLHHPESVTGRCLAHPLPHPLMEKRRSEAAECQLEIQGASLHNLKHLDL
FT                   CLPLGRLVGVTGVSGSGKSTLVRQVIHGNLQRWLGVKGKTQGKNAAFQGCEGIRGWEAI
FT                   QRVLEVDQTPIGKTPRSCPATYVGFWDSIRRLFAETPEARIRGYGPGRFSFNTKEGRCP
FT                   ECEGQGVKKIEMSFLPDVTVPCEICHGARFTPETLMIRYKDKHIGEILAMSVDEATAFF
FT                   SAHVWIHRPLQLLQAVGLGYLSLGQPSPTLSGGEAQRIKLVTELAKARSTPGRAGNHHT
FT                   LYLLDEPTIGLHMADVEKLIRVLHQLVEVGNTVMVIEHNLDIIAEADWLVDLGPEGGDG
FT                   GGRIVAQGTPEAVARIKKGSHTAKFLAGFLRERRLKINK"
FT   gene            144075..144860
FT                   /locus_tag="Nhal_0132"
FT   CDS_pept        144075..144860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0132"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   mlo:mll2277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13349"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S6"
FT                   /inference="protein motif:PFAM:PF04248"
FT                   /protein_id="ADE13349.1"
FT                   /translation="MSARQSKENPHPQQGPAHRVEVVPIPKRVRVLFNQETIVDSTQVL
FT                   LLRETYLPPVYYFPPQDVRMEWLQRTDHSSRCPFKGEAAYWSVTVRERSAENGAWSYPE
FT                   PLEQVVPIKNHIAFYWDKMDAWYEEDEPVFVHPCDPYVRIDVRESFRPVRVVLGGKVVA
FT                   ETRRARFLFETGLPTRYYIPQEDVQMDWLEPSETHTACPYKGKASYWSVRIGDQYFKDL
FT                   VWSYPDPLPEASQVKNYLAFYQEKVEAFYVDGELQRISG"
FT   gene            144965..145570
FT                   /locus_tag="Nhal_0133"
FT   CDS_pept        144965..145570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0133"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   scl:sce5025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13350"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S7"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADE13350.1"
FT                   /translation="MSWQVKHYYTPEEYLALECQTDTKSEYFAGEIFAMVGASPAHNLI
FT                   VANMIGELRQQLKGRPCRVYANDQRVKVSPTGLYTYPDIVVTCGDERFDENDRDTLLNP
FT                   RVIIEVLSKTTESYDRGEKFEHYRSLDTLVEYLLVAQERPHLEHYRRHPDGQWLFSDAS
FT                   GLEAVIEFPAIDCRLVLAEVYDKVPLETEGPGHPPPVG"
FT   gene            complement(145834..147093)
FT                   /locus_tag="Nhal_0134"
FT   CDS_pept        complement(145834..147093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13351"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13351.1"
FT                   /translation="MKLAVFLNLRNRSGLLTAFLVIGLFIVSNQLGYAQETPEITQQLL
FT                   EKLEKRDRKIAERDALIEDLQKRVEQLERLVGTTPPPSPSPQVKQPPRHPLPKPAVPAA
FT                   QSKKPIQQAQAQEKLPEKKAKSSAPGTFEVDEDAAERALERTLTQVGALLLPFGLMEVQ
FT                   PFVVYSRREQFSPTLVLGESGQVLTRNAELRRNEFDAGFFTRFGLPFDSQLELSLPARV
FT                   VDQTLVQPAGQVSFRETNDLGSSLGDITVGVAKTVFRERGWLPDLIARVTWDTDTSQRF
FT                   SNGVALGGGFHEIRGSLTALKRQDPLAFTGNFFYESSFEKDNIDPGDKFGFSIGALLAA
FT                   SPATSLRLELQQVFSQELEVNGGDIPGSNQVSSSFIFGASSVLGRGILLSISGGIGLTE
FT                   DAPDYFINFALPIRFGIPFR"
FT   sig_peptide     complement(146989..147093)
FT                   /locus_tag="Nhal_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.958 at
FT                   residue 35"
FT   gene            complement(147134..147820)
FT                   /locus_tag="Nhal_0135"
FT   CDS_pept        complement(147134..147820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0135"
FT                   /product="peptidase C39 bacteriocin processing"
FT                   /note="PFAM: peptidase C39 bacteriocin processing; KEGG:
FT                   bte:BTH_I0933 C39 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13352"
FT                   /db_xref="GOA:D5C4S9"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4S9"
FT                   /inference="protein motif:PFAM:PF03412"
FT                   /protein_id="ADE13352.1"
FT                   /translation="MYKLTLITPFNILFKTSAMIRKQGCSPVYAVLLIVLLLANFAGTA
FT                   EGRQVKSLLEMRRENVILQQWDLSCGAAALATLLNYQHGDSVAEKEVAKALMTRKEYLK
FT                   NPAIVQIREGFSLLDLKRFVDSRGYKGIGYGKLALEDLIERAPILVPINTHGYNHFVIF
FT                   RGVQGNRVLLADPAWGNRTMLIRKFKQFWIEYPQFGKVGFIVTRRDGIEPPNRLTPKTS
FT                   DFVMLR"
FT   sig_peptide     complement(147686..147820)
FT                   /locus_tag="Nhal_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.365 at
FT                   residue 45"
FT   gene            complement(148175..148537)
FT                   /locus_tag="Nhal_0136"
FT   CDS_pept        complement(148175..148537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0136"
FT                   /product="putative hemagglutinin-related autotransporter
FT                   protein"
FT                   /note="KEGG: bcj:BCAS0236 putative haemagglutinin-related
FT                   autotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13353"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T0"
FT                   /inference="similar to AA sequence:KEGG:BCAS0236"
FT                   /protein_id="ADE13353.1"
FT                   /translation="MKNIFSIMTCALMLALAGTSSAKEPVKLTDVQMDGVTAGAFVLLQ
FT                   GNATAIAQGAGAGTILSQTNSETFAQVDTTADPQFAAAAAGNTSLGQSVAIGTPGGPVF
FT                   TGAAAQSASQAAAQLQ"
FT   sig_peptide     complement(148469..148537)
FT                   /locus_tag="Nhal_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(148591..148878)
FT                   /locus_tag="Nhal_0137"
FT   CDS_pept        complement(148591..148878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13354"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13354.1"
FT                   /translation="MKKLSSIFATGAFLAITSVAVADEPVMLSETEMDNVTAAGTANAA
FT                   AQALANGFIFSATQTLTQSNVQALQVIPTQGGQLVLTVSSSQAQSAASAF"
FT   sig_peptide     complement(148810..148878)
FT                   /locus_tag="Nhal_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(149058..149525)
FT                   /locus_tag="Nhal_0138"
FT   CDS_pept        complement(149058..149525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0A00374p"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13355"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13355.1"
FT                   /translation="MMKNVLYALSFSICITASTAVAESSNKGPLILSTAQMDYVTAGTS
FT                   ADVIVNADANSDFFALTSTFGSATATQSGADNPALRSYIGIAGGSASAVAIGEGSSTDT
FT                   DVTPTADVPGTNIQVHEINIHSKVLGVEINAASVVKVGSFTSPLPTNLPGY"
FT   sig_peptide     complement(149457..149525)
FT                   /locus_tag="Nhal_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            150120..150596
FT                   /locus_tag="Nhal_0139"
FT   CDS_pept        150120..150596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_0650 RhoGEF guanine nucleotide
FT                   exchange factor for Rho/Rac/Cdc42-like GTPases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13356"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13356.1"
FT                   /translation="MGIKKWFLIICATSAGALLSNKLLAQQLTFPGGNKSPSSETATVI
FT                   LMCNINYIGRFGRFGSPNHSLCNSSGSDSSSCSSDSSESSSGESEEEDSMTLEMSSNIP
FT                   IGIRDGLLSRFGNSAACADFKSGMSTMLDSLDPTCNISSSPNNLIYSCDFDFKL"
FT   sig_peptide     150120..150197
FT                   /locus_tag="Nhal_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(151548..153239)
FT                   /locus_tag="Nhal_0140"
FT   CDS_pept        complement(151548..153239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13357"
FT                   /db_xref="GOA:D5C4T4"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13357.1"
FT                   /translation="MNILTNSITLTAILFTIFLILFYRNMKNLIYKNIFILNIALLILG
FT                   TPRISNAVLIPSAGTESETTITAQLMSNDGIYFPPNPSTLVTAGTASYATAVSTDPDFF
FT                   ESEINLGNSDRTINSHSSSSSSSVFLNLDANISNGGVLNDPAAIATFQSQHYTAAKSSS
FT                   LDPLFSRAATISQGLISNFLIQNTFTDDTFPPPNSFNPLLNLTWDIDKLKMKSEAASSL
FT                   SYMRDTIEIVQQSGGKTKTTTIGFVSLLENGKESTMYLGDSSSQAIKNWFDTNINRIDD
FT                   QLILKENPGNLSVSVPLLDEFINPQQSLILHLKNTHIELSYEAPPRATFQVGQSIGHEI
FT                   VGESQKFQMHWDKTNNTLYFDRLPINIKDKYKNDPLNGGYIEIDPLTHFASIEGREYFS
FT                   GTEIRLLDRRGNVLYRASLPTLVFEGSIFQSQGFNMFAPILNVLEANLDVSSWLQDYFK
FT                   EISFESILLPELFLGFEQTKIGSDIWDQNFNTPVNAILSFSGPKPSTVPEPTTLVLFIL
FT                   GFMYLILMEIKYCSRVFIKTSPNSPYNHPSGGNIPVVASIAALIPR"
FT   sig_peptide     complement(153081..153239)
FT                   /locus_tag="Nhal_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.897 at
FT                   residue 53"
FT   gene            153449..154735
FT                   /locus_tag="Nhal_0141"
FT   CDS_pept        153449..154735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0141"
FT                   /product="protein of unknown function DUF1704"
FT                   /note="PFAM: protein of unknown function DUF1704; KEGG:
FT                   psa:PST_2753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13358"
FT                   /db_xref="InterPro:IPR012548"
FT                   /db_xref="InterPro:IPR012656"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T5"
FT                   /inference="protein motif:PFAM:PF08014"
FT                   /protein_id="ADE13358.1"
FT                   /translation="MSQKKYSAIIRQLSDRIVTAQAPIRILDSIKWDDSIQQAFFAHGG
FT                   RCQPEVDAAYYDRNPLKYDINALSKTFREIEADVVAKLGQSEAAGNIMCRMCREYRRVL
FT                   DMLAARGTPAFAEIARELYGSSIDVFHRGGPTVADLGTLLDRSLRNIDERVFLEKSPKD
FT                   IPTPAAVTLLQQWLDQVFTDPAARVRVMESDGIVADAAAGSDYIKLRANTCFSERDLRA
FT                   LEAHEGWVHVGTTLNGSLQPTCTFLSKGTPSDTITQEGLAVFIEVVSFNSHPARLRRIA
FT                   DRIRAIHLAEQGATFLDIFTLLCDEGRSAEEAYAATMRIFRGSTPEGGPFTKDLAYSKG
FT                   FVLVYNFFRLAVRRGRLDRIPLLFCGKLAIEDMGTLAQLAEAGVVKSPKYLPPPLVDLN
FT                   ALTAWMAYSNFLNQIDLIQIDADFAPLLD"
FT   gene            complement(154799..155677)
FT                   /locus_tag="Nhal_0142"
FT   CDS_pept        complement(154799..155677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0142"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: noc:Noc_2776
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13359"
FT                   /db_xref="GOA:D5C4T6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T6"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADE13359.1"
FT                   /translation="MTFSPSRISAFIVGFGDIGRRVAALWQAEGGEVATLVRTPCDLAG
FT                   YHAIPGDLDHPETLHDIPRNRPLLFHFAPPPLSGTSDTRTAHLLEALEEVPPRRIVYIS
FT                   TSGVYGDCRGAWVNEAFPVHPGNDRSRRRVDAERQLTAFARRHTLPLVILRVPGIYGPG
FT                   RLPLERLRQGNPVVCPDQAPWNNRIHADDLAAIALRAGQDNAPARIYNVSDDQPSSMTD
FT                   YLYRLADAAGLPRPPCVSLAEAQRTFSPKLLEYLNESRRLDNRRMKTVLGIGLHYPTLE
FT                   EGLPATLKASV"
FT   gene            155805..156137
FT                   /pseudo
FT                   /locus_tag="Nhal_0143"
FT   gene            complement(156134..157303)
FT                   /locus_tag="Nhal_0144"
FT   CDS_pept        complement(156134..157303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0144"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: noc:Noc_2775
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13360"
FT                   /db_xref="GOA:D5C4T7"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T7"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ADE13360.1"
FT                   /translation="MFLGLFELSFWGYLAVSLLLTHITITGVTVYLHRHQAHRALDLHP
FT                   VLSHFFRFWLWLTTGMVTKEWAAVHRKHHAKCETEEDPHSPQLVGIHKVLWQGASLYRV
FT                   AARNPEVTEKYGHGTPDDWMERNLYTKHSSAGIVLMLLINVGLFGVPGLLIWAIQMHWI
FT                   PFFAAGVINGLGHYWGYRNYEVADASTNLFPWGILIGGEELHNNHHAYGSSAKLSSKWY
FT                   EFDIGWMYIRLFQALKLARVKKVAPKLLIRPEKQWVDLDTARAVVAHRFHLMTSYGRKV
FT                   MLPVLKEEAAHFSGNELYRRARNWLVRHEALVDAKARQELKALLEESHRLETVYRFRQQ
FT                   LQEIWSQAWSSQEALLQALQDWCKRAEESGIKALQDFALSLRGYSLQQA"
FT   gene            complement(158017..158301)
FT                   /locus_tag="Nhal_0145"
FT   CDS_pept        complement(158017..158301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A2697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13361"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T8"
FT                   /inference="similar to AA sequence:KEGG:H16_A2697"
FT                   /protein_id="ADE13361.1"
FT                   /translation="MSKLIIADLAESKTLDRAAMTSVRGGVRAHRSLSWGPIGDRFLEV
FT                   NPTQAISQFQGIENTVGNNVANFGFSDLHNTNTQNQYAQNNVNVGRFIG"
FT   gene            158639..160243
FT                   /locus_tag="Nhal_0146"
FT   CDS_pept        158639..160243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0146"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; GCN5-related N-acetyltransferase; KEGG:
FT                   noc:Noc_2774 nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13362"
FT                   /db_xref="GOA:D5C4T9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4T9"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADE13362.1"
FT                   /translation="MSAEIPSDLHLKLRNLGADDLDQLEELMEKVYSDIGGAWPRKTLL
FT                   ALFREFPEGQICIEGNGRVIAVALTVRCSYERFSRAHTYQDLIGRRERIRHDPKGDALY
FT                   GMDVFVDPDYRGLRLGRRLYDARKELCRNLNLRAILAGGRIINYHRYAGKLTATEYIEA
FT                   VRRKEVHDPILSFQLANDFEVKRLMKNYLPEDEKSRGFATLLEWNNILYEPEGLAAEEI
FT                   RKSVVRIGIVQWQMRLTDSFQTWLDQVEFFVDSMADYQADFVLFPEFFNAPLMGMGDQE
FT                   DQFSAIRFLAQYATPSLEALSHFAVTYNINLIAGSLPVLEGDILYNNAYLCRRDGTVDK
FT                   QPKIHITPHERRDWVIQGGNTLQVFNTDAGRIGILICYDVEFPELSRLLAEEGMEILFV
FT                   PFWTDTKNGFLRVQRCAQARAIENECYVAIGGSVGNLPQVENVDIQYAQSAIYSPSDFA
FT                   FPHDAIIAESTPNTEMALIADLDLDKLMQLRYEGSVTNRRDRRPDLYQLRWVAEKTSDK
FT                   GLSKPVSQKKTKPPEGG"
FT   gene            complement(160256..160525)
FT                   /locus_tag="Nhal_0147"
FT   CDS_pept        complement(160256..160525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_7239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13363"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_7239"
FT                   /protein_id="ADE13363.1"
FT                   /translation="MASITIADLPESKTLDSRQMTTLRGGKALAPPGLSFANVAIDIDL
FT                   NQQINQFQSLDIKAANNVANFGLFAPNISPKLNQNAQLDTSLFS"
FT   gene            complement(160666..160950)
FT                   /locus_tag="Nhal_0148"
FT   CDS_pept        complement(160666..160950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A2695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13364"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U1"
FT                   /inference="similar to AA sequence:KEGG:H16_A2695"
FT                   /protein_id="ADE13364.1"
FT                   /translation="MSKLVIADLAESKTLDHSAMASVRGGMRAYRSLSWGPIGDQFLSV
FT                   NPVQSIEQFQGIENAVGNNVANFGFSDLRNTNTQNQSAQNNVNVGGFIL"
FT   gene            complement(161496..163154)
FT                   /locus_tag="Nhal_0149"
FT   CDS_pept        complement(161496..163154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0149"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: noc:Noc_2773 ABC transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13365"
FT                   /db_xref="GOA:D5C4U2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE13365.1"
FT                   /translation="MLLQIENLKTYLQAGGETVKAVDGISFTIEGGETFCLVGESGSGK
FT                   SITALSVIQLLPRDISSHPQGRILFDWRQDHRHEQVDLLRLPETRRQEIRGARIAMIFQ
FT                   EPMTSLNPVFTVGEQIMEALQLHFPGMDETEARERTVAALAQVKIPEPEQRIDEYPHRL
FT                   SGGQRQRIMIAMAMACEPDLLIADEPTTALDVTVQAEILRLMRELQARRGMSILFITHD
FT                   FGVVSQMARRLAVMRLGQIVESGTLDEVLHRPQHAYTRQLLAALPENLKRQRTGAKGSP
FT                   PPKTGTQQPPLLELRSLQVHFPIRKGVMRRVAGYVRAVDGVDMAIPAGQILALVGESGC
FT                   GKTTLGRAILRLVEPTGGQIHYEGTDLTALKHRELRRYRRELQIIFQDPMSSLNPRLSI
FT                   AATLTEPMAVHGIGHSREERLERAKAVLERVQLEADYLWRYPHEFSGGQRQRIGIARAL
FT                   VLEPRFLVCDEITSALDVSVQAEILQLLLDLQREHHLTLLFITHNIGVVEYLSNEIAVM
FT                   HNGRIVEQGPTDQVCRSPTHPYTQKLLAAVPRVPL"
FT   gene            complement(163178..164371)
FT                   /locus_tag="Nhal_0150"
FT   CDS_pept        complement(163178..164371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0150"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: noc:Noc_2772 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13366"
FT                   /db_xref="GOA:D5C4U3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE13366.1"
FT                   /translation="MTRAANSLSPPRRGRSYAAQVAGEVLTQWGARLGLAWIGLLGFLA
FT                   VFAPFLANSHPLLLSQDGQLDSPLVRYLTPADVTLLALFFTGLILALARASLRTWLGGL
FT                   GGMLFLAGTLSAALVQPPALTIYEQYRQQEAAGQYDWVVYAPIPYSPKDYQRDRGETGL
FT                   QPPLASPQEDHWFGTEENGADVLARMVHASRIALGIGFIATSIALGLGILIGGLMGYFS
FT                   GAVDIIGMRLVEIFEAVPTLFLLLTFVAFFERSLYLLMVIIGITSWSGYARYVRAEFLR
FT                   LRQQDFVQAALACGLPLYSILFRHMLPNGIGPILVAASFGVASAILAEAVLSFLGLGLV
FT                   DDPSWGQMLNQAVRSSTFNWWMAAFPGGAIFLTVFAYNLVGEALRDAIDPYLKKSLK"
FT   gene            complement(164375..165754)
FT                   /locus_tag="Nhal_0151"
FT   CDS_pept        complement(164375..165754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0151"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: noc:Noc_2771 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13367"
FT                   /db_xref="GOA:D5C4U4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE13367.1"
FT                   /translation="MSTYVIRRLLLMIPTLLGITLVVFTVMAASPGGISAQSLIEGQNL
FT                   EPQAKKALEDYYNQLYGLDSPPAVQYLRWLNNVSPVGFTFDEENNLSGFSFWKGSDLGT
FT                   SFRYGRPVLDLLEERVPITLLLNALSLPLIYTLAIAVGVRAATERGKVFDVSSSALMLG
FT                   LWSIPTMLAGVLLIGFFASDQYWHWFPTAGLSTREALDMPFLPHWGSLQEVALLFGTGA
FT                   VGTILGIGLALKAPRLLRVGLLAGVGLSLGLWMGANLPDPHQGVTVLLSLLLIVAIGGL
FT                   GYTDYTGLRVSLLGLLGAGLGLAVGAQWGSGEFVRGFLLDRLWHLVLPVLCLTYSGFAF
FT                   LSKLTRTAVLENLMADYARTAQAKGLAENVVLWKHVFRNSLLPLITVSATLLPGLLAGS
FT                   VIVESIFSIEGMGKLAVEAVQTRDRELVLSITLISGLLTLVGYLVADLCYAIADPRVSY
FT                   D"
FT   sig_peptide     complement(165668..165754)
FT                   /locus_tag="Nhal_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 29"
FT   gene            complement(165773..167632)
FT                   /locus_tag="Nhal_0152"
FT   CDS_pept        complement(165773..167632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0152"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: noc:Noc_2770 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13368"
FT                   /db_xref="GOA:D5C4U5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U5"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADE13368.1"
FT                   /translation="MARRFTVKDFFLFLFLSLLLILILLAMYMVDRQWLKLAEMERTLT
FT                   EQAQDLRGLRDLIRSTGSSGLTIAPTESRGTANIPPAFRRAYTATQQPDYRPGDWLVQA
FT                   FGTGLKTLTPLVSTDAYAAEVQGYVLETLLTRNPETLEWEGLLARDWEVSEDGLTFRFR
FT                   LRKGITFSDGEPLTAEDVAFSFAFIMNPAIAAPRERAYYEKIERVTALGPYQVEFKFKE
FT                   PYFNSLALAGGLTILPQHFYGPYLEQPESFNQSKGLLLGSGPYRLQDPKGWTPDQGLVE
FT                   LERNPRYWGPVQPSFDKLLWKVIANDSARLTTFRNGDIDIYGARPLEYHRLLEDQALVE
FT                   RTQHLEYMSPTAGYSYVAWNQERDGKPTRFADQRVRQAMTFLTDRASIIEQIMLGYAEP
FT                   AVSPFSPRSPQHDPTLTPRPFDLAKAKTLLKQAGYADRDGDGVLEDANQQPFRFELVFF
FT                   QDADDTRRLVLFLKDLYARAGILLEPKPTEWSVMLDRINKKNFDAIALGWTSGVEIDIY
FT                   QMFHSSQAIPGGDNFISYRNPELDALIEKARATVDEGERMPLWQACEHILYEDQPYTFL
FT                   MRRKSLLFVDQRMRNLEVTRLGLNLGATPVEWYVPEPEQKYTY"
FT   sig_peptide     complement(167552..167632)
FT                   /locus_tag="Nhal_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.594 at
FT                   residue 27"
FT   gene            complement(167952..168245)
FT                   /locus_tag="Nhal_0153"
FT   CDS_pept        complement(167952..168245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0153"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1
FT                   like RNA-binding protein; KEGG: noc:Noc_2769 RNA-binding
FT                   protein, RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13369"
FT                   /db_xref="GOA:D5C4U6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U6"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /protein_id="ADE13369.1"
FT                   /translation="MNIYVGNLSYQVTDEELRAAFENYGEVSSAKVIVDKFSNRSKGFG
FT                   FVEMARQEDAETAIKEMNDSDLKGRQIVVNQARPRNEGFRRSEGFGDRQRRF"
FT   gene            168614..169594
FT                   /locus_tag="Nhal_0154"
FT   CDS_pept        168614..169594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13370"
FT                   /db_xref="GOA:D5C4U7"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13370.1"
FT                   /translation="MANKTENRVSGHAEEMLKSFKEEVHAARELLAFVVSTGRRSEDGR
FT                   ELRDQVITPIRDAEQFLYNAQCPSSEQRLAFDRAYRELALFAAPVTIETLRATSDAHGR
FT                   TAWGLTWGKPLSEAKIWSRKLWIITTVLVILALAGDILGQFASQFLPAAGETRDWFWVL
FT                   FVHAPLLALNTLLPFTYGGIGACAYLLRMCHEYIHKREFDPRRIPEYYNRLLLGIVSGG
FT                   AILLFTNKLIANGGEAIHLSSAAVGFLAGYNTDFLFATVERIIAAILPKVGLESVRRVP
FT                   LRGVPPTSLLEDLTLRELLDRRDKAATDADRQFYEDLIARLKEHL"
FT   gene            169869..171539
FT                   /locus_tag="Nhal_0155"
FT   CDS_pept        169869..171539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0155"
FT                   /product="ATP-dependent endonuclease of the OLD family-like
FT                   protein"
FT                   /note="KEGG: bgl:bglu_1g28490 ATP-dependent endonuclease of
FT                   the OLD family-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13371"
FT                   /db_xref="GOA:D5C4U8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U8"
FT                   /inference="similar to AA sequence:KEGG:bglu_1g28490"
FT                   /protein_id="ADE13371.1"
FT                   /translation="MFLFEQRDSCVHTVGDSVSITCEFAELPHSLILDAGAETTLADEY
FT                   LLTEAGTLKIRKIYDCSKPKPTVEVFVVAQHPTAKDVDSLLELKEKDPQKIVKELGLEV
FT                   PLKGNPGMRKAIWNAELDLKLAETQIPITKLKGDSKCIWEQLESYLPLFALFQSDRRSQ
FT                   DSDGEVQNPMKAAVAAAIAEVKSEIEQIQLKIEEKAKTIAESTHEALKTIDSSLAKELK
FT                   PQFTQPTPAKWVGLFSVNMTTDHGIPLNKRGSGIRRLVLVSFFKAEAERQLIATNRRNI
FT                   IYAIEEPETAQHPNNQRVLIKAFKELTSEPGCQVLLTTHSPGFAAELPVDGIRFVTVHE
FT                   GSPSIRAGVDVFGEIAATLGVVPDSRVKVLVCVEGPTDVAALKSLSHALHQQDPSIPNL
FT                   SADSRVAFVVLGGSTLQHWVTQNYLRGLGRPEIHIYDSDVAKYGEFVAEVNSRTDGSWA
FT                   VQTAKHEIESYLHSDAILDAFNLNIEVTDQPNEHGHATPKVFALAYSQVNGLDGVMGES
FT                   KAKQKLADRAFPLMMADRLSERDPTGEVGDWFRRIAKML"
FT   gene            172107..172544
FT                   /locus_tag="Nhal_0156"
FT   CDS_pept        172107..172544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0156"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   noc:Noc_0766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13372"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4U9"
FT                   /inference="protein motif:PFAM:PF01724"
FT                   /protein_id="ADE13372.1"
FT                   /translation="MIDPNKDYYGWTQETVEKLRQGKFSEINIEHLIEEIEDMGKSERR
FT                   ELENRLTVLLVYLLKWRYQPNRRGRSWALTIKEQRVRVSRVIRDNPSLKPQFFGICVEA
FT                   YESAVIIAARKTGLDESIFPATFEQTGWTWEQVLNPEFLPE"
FT   gene            172676..173029
FT                   /locus_tag="Nhal_0157"
FT   CDS_pept        172676..173029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afr:AFE_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13373"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V0"
FT                   /inference="similar to AA sequence:KEGG:AFE_0501"
FT                   /protein_id="ADE13373.1"
FT                   /translation="MDKQFSEAFADEWIGAWNAHDLERILSHYEDDFEVFSPAIAKLTG
FT                   EASGMLKGKKAIGEYWSGAFEKFPDLHFELIHVLRGVNSITLIYEGVLGISAEVFHFGD
FT                   SGKVSRAFAHYDL"
FT   gene            173049..173490
FT                   /pseudo
FT                   /locus_tag="Nhal_0158"
FT   gene            173515..173580
FT                   /pseudo
FT                   /locus_tag="Nhal_0159"
FT   gene            173583..173756
FT                   /pseudo
FT                   /locus_tag="Nhal_0160"
FT   gene            complement(173941..174095)
FT                   /pseudo
FT                   /locus_tag="Nhal_0161"
FT   gene            174267..174704
FT                   /locus_tag="Nhal_0162"
FT   CDS_pept        174267..174704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0162"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   noc:Noc_0766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13374"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V1"
FT                   /inference="protein motif:PFAM:PF01724"
FT                   /protein_id="ADE13374.1"
FT                   /translation="MIDPNKDFYGWTQETVEKLRQGKFSEVNMDDLIEELEDMGRSERR
FT                   ALESRLTVLLMHLLKWKHQPDRRGRSWAATISNQRLRVARLLRDNPSLKQHFAQIGIEA
FT                   YESAVLDAVAETELDKDTFPATFEQTGWTWAQVLDSEFLPE"
FT   gene            complement(174830..174905)
FT                   /locus_tag="Nhal_R0003"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(174830..174905)
FT                   /locus_tag="Nhal_R0003"
FT                   /product="tRNA-Phe"
FT   gene            175031..175489
FT                   /locus_tag="Nhal_0163"
FT   CDS_pept        175031..175489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0163"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   noc:Noc_2923 FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13375"
FT                   /db_xref="GOA:D5C4V2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V2"
FT                   /inference="protein motif:PFAM:PF04186"
FT                   /protein_id="ADE13375.1"
FT                   /translation="MFRLLFFLFLTFPLIEIYFLIRVGSAIGPGWTVFLCIFTAVVGAA
FT                   LLRQQGFSTLSRVQTTMARGEVPALEMLEGAVLLTCGIFLLTPGFFTDTLGFLGLIPSL
FT                   RQAFVLWAVKRALQREEFEVTVYRQGPDDSSHRQRPRVIEGRAKREDE"
FT   gene            175731..176021
FT                   /locus_tag="Nhal_0164"
FT   CDS_pept        175731..176021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0164"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: noc:Noc_2922
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13376"
FT                   /db_xref="GOA:D5C4V3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V3"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADE13376.1"
FT                   /translation="MKIRPLHDRVIIRRMEEEKTSSGGIVIPDTAAEKPIRGEVIAVGN
FT                   GKTLENGEVRALDVKVGDKVLFGKYSGTEVKVEDEDLLVMREDDIMAVLEG"
FT   gene            176087..177736
FT                   /locus_tag="Nhal_0165"
FT   CDS_pept        176087..177736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0165"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: noc:Noc_2921 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13377"
FT                   /db_xref="GOA:D5C4V4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V4"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADE13377.1"
FT                   /translation="MAAKDVRFSEDARHRMIHGVNILAEAVRVTLGPRGRNVVLEKSFG
FT                   APTITKDGVSVAKEIELKDKFENMGAQMVKEVASQTSDEAGDGTTTATVLAQSILREGM
FT                   KAVAAGMNPMDLKRGIDKAVVSAVGALKKLSKPCEDSKAIGQVGTISANAEESVGKIIA
FT                   EAMEKVGKEGVITVEEGSGLENELEVVEGMQFDRGYLSPYFITDQQTMAAELDDPYILI
FT                   HDKKISNIRELLPVLENVAKAGKPLLVISEDVEGEALATLVVNTIRGIVKVCAVKAPGF
FT                   GDRRKAMLEDIAVLTGGTVISEEVGLSLEKATLDDLGRAKKVSVNKENTTIVDGAGSAE
FT                   DIKARVEQIRVQMEEATSDYDKEKLQERVAKLAGGVAVIKVGAATEMEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALIRALQGIQDLKGANHDQDVGINIARRAMEEPLRQIVTNA
FT                   GAEASVIVNQVKEGEGNYGYNAATGEFGDMIAMGILDPTKVSRTALQNAASIAGLMITT
FT                   EAMIAEAPKEEEPVPAGGGMPGMGGMGDMGMM"
FT   gene            complement(177969..178373)
FT                   /locus_tag="Nhal_0166"
FT   CDS_pept        complement(177969..178373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0166"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="KEGG: noc:Noc_0203 Cu(I)-responsive transcriptional
FT                   regulator; TIGRFAM: Cu(I)-responsive transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13378"
FT                   /db_xref="GOA:D5C4V5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V5"
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /protein_id="ADE13378.1"
FT                   /translation="MINISKASSQSGVPAKTIRYYEDIGLVSSQRASNGYRCYDQETVR
FT                   TLQFVKRARSLGFSIEECRNLLSLYKDQNRASAEVKRLTKQRVADIDTKIAELTAMRAT
FT                   LIQLMERCHGDQRPSCPILEDLAQPGTFPS"
FT   gene            complement(178392..178601)
FT                   /locus_tag="Nhal_0167"
FT   CDS_pept        complement(178392..178601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0167"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: noc:Noc_0204 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13379"
FT                   /db_xref="GOA:D5C4V6"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V6"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ADE13379.1"
FT                   /translation="MEKTYKVEGMTCGGCAQSVEKAIKGIAPAATVKVDLENKQVTVTG
FT                   VEDDTLVAQAVEGAGFDYEGLVSP"
FT   gene            complement(178648..181107)
FT                   /locus_tag="Nhal_0168"
FT   CDS_pept        complement(178648..181107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0168"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: noc:Noc_0205 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13380"
FT                   /db_xref="GOA:D5C4V7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V7"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADE13380.1"
FT                   /translation="MLEISNLDSVQQSPPREILTGAVQTLALPIKGMTCATCSTRLERV
FT                   LNKVPGVVKSQVNLASEQANIAFDPQQASPEQFYQAITQAGFTVPTAGMEFRIGGMTCA
FT                   ACSARLEKVFSRLPGVSKATVNLATERAVVTAPSGVLSPATIIAAAQRAGFTAEPLSSL
FT                   AERRAQEEAESTARERHEGRQLLLAALLTLPLALPMLLMPFGIHLGLPAETQLLLATPV
FT                   QFWIGKRFYVGAYKSLRGGAGNMDVLVALGTSAAWGLSTWNTLLPGTGHHLYFEASAMV
FT                   VTLVLLGKWLEGRAKRSAASAIHALMALRPATARIEREGKVVEVPAEQVAEGDIVLVRP
FT                   GERMPIDGLILDGRSQLDESLITGESLPVSRGEGETVTGGSVNGEGLLRIRATTVGAES
FT                   TLARIIRLVEDAQASKAPVQKLVDQVANIFVPVVVTLAFLTFAGWWLLDGAADTAFKAA
FT                   VSVLVIACPCALGLATPTALMVGTGAAARHGILIRDAVALERARDSDTVVFDKTGTLTE
FT                   GQPAVAEILPIKISGKELLRLVASAQQGSEHPLAKAVLTKAQDLPLSPPQNFRSLPGRG
FT                   LCTQVEERNLLVGNLRLMRENQVDLTPLTAQAQALEESGHTLMWVAEMDSAPQLLGVLA
FT                   VTDPIKSVTPQAVAALGAQGLTTVMLTGDNPRAAKSVADKVGIDHVIAEVLPEDKATQI
FT                   QALRAEGRHVAMIGDGVNDAPALAAADVGMAMGTGTDVAMEAAGITLMRGDPTLVAEAL
FT                   SISRATYRKIRQNLFWAFIYNVVAIPLAASGLLNPVVAGAAMAMSSVSVVSNSLLLRRW
FT                   RPGTQLK"
FT   gene            complement(181419..182506)
FT                   /pseudo
FT                   /locus_tag="Nhal_0169"
FT   gene            complement(182503..183410)
FT                   /pseudo
FT                   /locus_tag="Nhal_0170"
FT   gene            183905..184153
FT                   /locus_tag="Nhal_0171"
FT   CDS_pept        183905..184153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0171"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: dol:Dole_2342 CopG/DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13381"
FT                   /db_xref="GOA:D5C4V8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V8"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADE13381.1"
FT                   /translation="MVRTQIYLTEIEQQALRVLARRTGRTQSELIREAIDRFIAQAEQT
FT                   DRRLLLQQARGLWQNRTDLPDFAALRREFDRSTLEFE"
FT   gene            184153..184542
FT                   /locus_tag="Nhal_0172"
FT   CDS_pept        184153..184542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0172"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   cbg:CbuG_0773 PIN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13382"
FT                   /db_xref="GOA:D5C4V9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4V9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADE13382.1"
FT                   /translation="MAQRLLLDTDVLIDYLRGVPVAVSYLEGCAEVLLISVITVTELFA
FT                   GVREGRERTTLSAFLGAFEVVPLDRPIAEKGGLYRRDYGKSHGTGLADAFIAATAELCQ
FT                   AKVVTLNRKHFPMLKEVLVPYKKSD"
FT   gene            184713..187619
FT                   /locus_tag="Nhal_0173"
FT   CDS_pept        184713..187619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0173"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   GlnD PII-uridylyltransferase; KEGG: noc:Noc_0135
FT                   glutamate-ammonia-ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13383"
FT                   /db_xref="GOA:D5C4W0"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W0"
FT                   /inference="protein motif:PRIAM:2.7.7.42"
FT                   /protein_id="ADE13383.1"
FT                   /translation="MDWQANIHKLPPLLQGRIQNDLARFQEALGQGGLETVFKEKTIGT
FT                   LCPVWAASEFVASACICDPSLLLGLQESGDLFRPYEPNDYAKTLERQLDELDSEAALMV
FT                   ALRRFRRREMVRIIWRDLAGWASLEEVLGELSQLAEACLDSALAFLHRWQSEELGTPHG
FT                   AVSGQPQSLVVLGMGKLGAWELNLSSDIDLIFAYPESGETRGARRVLSNEEYFTRLARR
FT                   LIRVLEERTAEGFVFRVDMRLRPDGDSGPLVANFDAMENYYQNQGRDWERYAMIKARTV
FT                   AGDRQAGARLMAMLRPFTYRRYLDFGAIESLRSMKAMIAQELRRQGIKANIKLGPGGIR
FT                   EIEFIGQSFQLIRGGREPVLQERGILQVLALLAEKGHLPFYVKEELCAAYLFLRRVEHR
FT                   LQAYRDEQTHTLPTSAERRACLAFAMGYGDWETFASKLDDHRRRVQGHFEQLFAAPHMD
FT                   TAGQMTREKGLAEVWSGSGPTESVLATLKAAGYHSPEEVAQILAYLRQSYTVRALSAQA
FT                   RARLDQLMPLLLGAVGRTEQPEQCLQRVVTLLETVAQRTAYLALLAEHPMALSQLVKLC
FT                   AASPLIARQLTRYPLLLDELLDPRSLYRVPDYESLVKDLGRSLGAVPGDDLEQQMELLR
FT                   HFCQRQTLRVAAADVTGVLPLMKVGDHLTHLAEVILKKALELSWQHLTHRHGRPQRSSG
FT                   EQAGEYGFAVIGYGKLGGYELGYGSDLDLVFLHAAQSSDPPTEGEKTLDPIVFYSRLGQ
FT                   RLIHMLQTLTPSGKLYEVDTRLRPSGASGLLVSSLEAYSDYQRTQAWTWEHQALVRARF
FT                   VAGDERLGAAFAAMRREILGRQRDLATLREEVRGMRTKMRNQLDWSRPGWFDLKQGKGG
FT                   IADIEFMVQYGVLAWAHAYPQLLEYPDNIRILEGFAQAGLMAPAESLQLADAYRAYRAA
FT                   ANRLTLQEQKALVEDEQFRQERTAVQGVWSALLEDEAA"
FT   gene            187665..188594
FT                   /locus_tag="Nhal_0174"
FT   CDS_pept        187665..188594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0174"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: noc:Noc_0136
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13384"
FT                   /db_xref="GOA:D5C4W1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W1"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADE13384.1"
FT                   /translation="MSTMDDRDGVIWLDGELVPWREARVHVLTHTLHYGMGVFEGVRAY
FT                   KATQGTAIFRLQEHTDRLFRSAHILNMVIPYDRETLNQVQRLVVRENGLDTAYLRPMCF
FT                   YGSEGMGLRADNLRVHVMVAAWPWGAYLGAENMERGIRVKTSSYTRHHVNITMCKAKAN
FT                   GNYMNSMLALQEALAAGCDEALLLDSEGYVTEGSGENIFIARNGVLYTPDLTSALEGVT
FT                   RDTIYQLAREIGVPLCEKRITRDEVYVADEAFFTGTAAEVTPIRELDGRKIGNGARGPI
FT                   TERLQTLYFDQVHGRRETHPEWLTLVSD"
FT   gene            188626..189372
FT                   /locus_tag="Nhal_0175"
FT   CDS_pept        188626..189372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0175"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   noc:Noc_0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13385"
FT                   /db_xref="GOA:D5C4W2"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W2"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ADE13385.1"
FT                   /translation="MAGHSKWANIQYRKGAQDAKRGKLFTKLIREITVAARLEGGDPAT
FT                   SPRLRIAIDKALAANMPKDNIERAIKRGTGDMEGVAYEEIRYEGYGPHGVAVMVDCMTD
FT                   NRNRTVAEVRHVFSKWGGNLGTDGSVAYLFSKKGIISYPKGSDEEAIMEVAIEAGAEDV
FT                   VTNEDGSIDVFTEPEEFSAVKKALEEADLKPAQADVTQHASTIVSLELEDVKKMLTFLE
FT                   TLEDLDDVQQVYSNADFSEETLAQLE"
FT   gene            189474..189998
FT                   /locus_tag="Nhal_0176"
FT   CDS_pept        189474..189998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0176"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: noc:Noc_0138 crossover junction
FT                   endodeoxyribonuclease RuvC; TIGRFAM: crossover junction
FT                   endodeoxyribonuclease RuvC; PFAM: Crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13386"
FT                   /db_xref="GOA:D5C4W3"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W3"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ADE13386.1"
FT                   /translation="MVRILGIDPGSRITGYGLIETNGKEAAYITAGCIQAGNGELAERL
FT                   GRIFKGITAIIEDYHPDEVAVEQVFMHQNPGAALKLGHARGAAICAAMNVVLPVFEYTP
FT                   SQVKQAVVGRGDAAKSQVQYMIRLLLKLPSEPVTDAADALACALCHGHAGPLLAGLAGQ
FT                   VRGRRRGRYYR"
FT   gene            189995..190594
FT                   /locus_tag="Nhal_0177"
FT   CDS_pept        189995..190594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0177"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: noc:Noc_0139 DNA recombination protein, RuvA;
FT                   TIGRFAM: Holliday junction DNA helicase RuvA; PFAM: DNA
FT                   recombination protein RuvA domain I; RuvA domain protein;
FT                   SMART: Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13387"
FT                   /db_xref="GOA:D5C4W4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W4"
FT                   /inference="protein motif:TFAM:TIGR00084"
FT                   /protein_id="ADE13387.1"
FT                   /translation="MIGRLRGVLLEKRAPFLLLEVQGVGYELEAPMSTFYVLPDRGAEV
FT                   ILYTHLVVRDDAHLLYAFASEKERELFRNLIRVNGVGAKLGLAILSGIEVESFTRCVQE
FT                   GDTASLTRLPGVGKKTAERLIVEMRDRLFDGPREEMAGVLPRVGSGQVPTSDAVSALVA
FT                   LGYKSQDASRMVRQLNTEGLATEEIIRQALQRMLKS"
FT   gene            190591..191637
FT                   /locus_tag="Nhal_0178"
FT   CDS_pept        190591..191637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0178"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: noc:Noc_0140 Holliday junction DNA helicase B;
FT                   TIGRFAM: Holliday junction DNA helicase RuvB; PFAM: AAA
FT                   ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13388"
FT                   /db_xref="GOA:D5C4W5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W5"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ADE13388.1"
FT                   /translation="MTLSRGLVSPQGASDEAVVEPSLRPAKLADYVGQPQVQEQMEVFI
FT                   PAARARGEALDHVLIFGPPGLGKTTLSHIVANELGVNLRQTSGPVLERPGDLAALLTNL
FT                   EPRDVLFIDEIHRLSPVVEEVLYPAMEDRQIDIMIGEGPAARSIKLDLVPFTLVGATTR
FT                   AGLLTSPLRDRFGIVQRLEFYDVEHLVLIVERTARILGMVMEAGGALEVARRSRGTPRI
FT                   ANRLLRRVRDYAEVKGDGRVTHEVAKKALDLLDVDSNGFDTMDRKLLLAMIEKFDGGPV
FT                   GVDSLAAAISEERGTIEDVIEPFLIQQGFVMRTPRGRMATRHTYLHFGLEPAAEAVQQE
FT                   TPDLFFNE"
FT   gene            191630..192037
FT                   /locus_tag="Nhal_0179"
FT   CDS_pept        191630..192037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0179"
FT                   /product="tol-pal system-associated acyl-CoA thioesterase"
FT                   /note="TIGRFAM: tol-pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein; KEGG:
FT                   noc:Noc_0141 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13389"
FT                   /db_xref="GOA:D5C4W6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W6"
FT                   /inference="protein motif:TFAM:TIGR02799"
FT                   /protein_id="ADE13389.1"
FT                   /translation="MNEFVLPMRVYYEDTDSGGVVYHANYLKFMERARTEWLRSQGFEQ
FT                   DALLKEQGLLFAVRSLRLDYLRPGRFNDWLKVHTHLLQCRKASLTFSQTVQRGEESALC
FT                   QAEVKVACLDAQTFRPRPIPKLILAEITGGC"
FT   gene            192027..192704
FT                   /locus_tag="Nhal_0180"
FT   CDS_pept        192027..192704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0180"
FT                   /product="protein TolQ"
FT                   /note="TIGRFAM: protein TolQ; PFAM: MotA/TolQ/ExbB proton
FT                   channel; KEGG: noc:Noc_0142 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13390"
FT                   /db_xref="GOA:D5C4W7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W7"
FT                   /inference="protein motif:TFAM:TIGR02796"
FT                   /protein_id="ADE13390.1"
FT                   /translation="MAVDLSLFELVTGASFLVQLVMLILLVISVIAWTLIFRKRSELKG
FT                   AKEAADEFEDRFWSGKELNSLYAELAAREIPLHGMEGIFFSGFREFVRLRKQTNAEHRA
FT                   VLDGTQRAMRVSLAREIDTLEAALPFLATAGSTSPYIGLFGTVWGIMNSFRALGNAHQA
FT                   TLAMVAPGIAEALIATAMGLFAAIPAVIAYNRYIHEVERLINRYDTFLEEFSTILQRQL
FT                   HLA"
FT   gene            192714..193160
FT                   /locus_tag="Nhal_0181"
FT   CDS_pept        192714..193160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0181"
FT                   /product="protein TolR"
FT                   /note="TIGRFAM: protein TolR; PFAM: Biopolymer transport
FT                   protein ExbD/TolR; KEGG: noc:Noc_0143 biopolymer transport
FT                   protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13391"
FT                   /db_xref="GOA:D5C4W8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W8"
FT                   /inference="protein motif:TFAM:TIGR02801"
FT                   /protein_id="ADE13391.1"
FT                   /translation="MYASQQRKRRRPLSEINVVPYIDVMLVLLVIFMITAPMLTQGVKV
FT                   DLPQANAKPAKLPQDQDPLLVNVDAQGRYYLNMGKASHQPITADELLTKVAAVLRRKPH
FT                   TPVLVGGDREVPYGAVVRVMALLQQAGAPHIGLITETPTRREPG"
FT   gene            193169..194059
FT                   /locus_tag="Nhal_0182"
FT   CDS_pept        193169..194059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0182"
FT                   /product="protein TolA"
FT                   /note="TIGRFAM: protein TolA; TonB family protein; PFAM:
FT                   Tol-Pal system TolA; KEGG: noc:Noc_0144 TonB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13392"
FT                   /db_xref="GOA:D5C4W9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4W9"
FT                   /inference="protein motif:TFAM:TIGR02794"
FT                   /protein_id="ADE13392.1"
FT                   /translation="MGKSRPPLAAFLLALLVHGLLFGVIVLSFGWTPKPEPVDTRSMEI
FT                   VQATVVEREKLLAEQRRAEQAALARQQAEAQKREAAKQQAMAEQARQEAKKQQELEQKR
FT                   RQEQARLKRLEAERKAKKEEARRKAEAERKRAEEEKRRAEAEKRRLEEERRRAEEARRK
FT                   AEEERKKAAAAARRKAEEKRRQQELQARIEAEQNAAQVEAALNRFETQIQQRVGRYWTR
FT                   PPSARDNLEVVLQVEMLPDGEVRNVKVVKTSGDRAFDRSAEAAVYKAAPLPVPPDRAAA
FT                   AKLLPSFNFKFTSGS"
FT   sig_peptide     193169..193240
FT                   /locus_tag="Nhal_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.603 at
FT                   residue 24"
FT   gene            194060..195352
FT                   /locus_tag="Nhal_0183"
FT   CDS_pept        194060..195352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0183"
FT                   /product="Tol-Pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="TIGRFAM: Tol-Pal system beta propeller repeat
FT                   protein TolB; PFAM: TolB domain protein; WD40 domain
FT                   protein beta Propeller; KEGG: noc:Noc_0145 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13393"
FT                   /db_xref="GOA:D5C4X0"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X0"
FT                   /inference="protein motif:TFAM:TIGR02800"
FT                   /protein_id="ADE13393.1"
FT                   /translation="MGMKVWSKILWLWILLVPTQNVSAVLTIEITGGTEAALPIAIVPF
FT                   GSQGGIPPEDVAAVVAADLARSGRFAPLPEKDLLSRPHRASEIEFHDWRRLGSEGLVIG
FT                   EVTHLGADRYGVRFQLFDIYKAEQLVGRRYQVPATGLRHLAHQIADLIYETLTGEKGAF
FT                   TTRIAFVTVSKAVDGAKEYSLQVADVDGHNPHTILQSKEPIMSPVWSPDGTKLAYVSFE
FT                   RKRSEVIVQELRTGRRQSVASFPGINSAPDWSPDGRKLALVLSKEGNPEIYILDLATRR
FT                   LTRLTRNASIDTEPTWAPDGRSIVFTSDRGGRPQLYQISASGGQAQRLTFDGTYNASAS
FT                   FAPDGQRLALVHGDKGQFHIAVLDLASKDLQVLTETRMDESPSFAPNGRMILYATSGPQ
FT                   GGALAAVSTDGRVRQRLAQKGDEVREPAWSP"
FT   sig_peptide     194060..194134
FT                   /locus_tag="Nhal_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.756 at
FT                   residue 25"
FT   gene            195387..195962
FT                   /locus_tag="Nhal_0184"
FT   CDS_pept        195387..195962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0184"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="TIGRFAM: peptidoglycan-associated lipoprotein; PFAM:
FT                   OmpA/MotB domain protein; KEGG: noc:Noc_0146 OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13394"
FT                   /db_xref="GOA:D5C4X1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X1"
FT                   /inference="protein motif:TFAM:TIGR02802"
FT                   /protein_id="ADE13394.1"
FT                   /translation="MRLVIPFFFLLASVYGLAGCAGGPATQGEPTGVVVEERGTGVGET
FT                   AYPEGEALEGEGATAWGIGEGAAYQGDPLADPASPLANRVIYFEFDSSEIQEDDRPIVE
FT                   AHGDYLAKHPDVSLTLEGHTDERGSREYNLALGERRANAVRRLVLLMGASEDQVQVVSY
FT                   GEERPAVDGHDEGAWQLNRRVEILYSGE"
FT   sig_peptide     195387..195470
FT                   /locus_tag="Nhal_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.641 at
FT                   residue 28"
FT   gene            195965..196729
FT                   /locus_tag="Nhal_0185"
FT   CDS_pept        195965..196729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0185"
FT                   /product="tol-pal system protein YbgF"
FT                   /note="KEGG: noc:Noc_0147 TPR repeat-containing protein;
FT                   TIGRFAM: tol-pal system protein YbgF; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13395"
FT                   /db_xref="GOA:D5C4X2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X2"
FT                   /inference="protein motif:TFAM:TIGR02795"
FT                   /protein_id="ADE13395.1"
FT                   /translation="MASCRSHWLLAGGLLLQVSAVPGAEVEVAEVVDMGELEQRLQRLE
FT                   RIVQGQGLSELLLKLEQLEAEVRRLQGENEELGYEIDNLKEQQRELYLDLDRRLQKLNA
FT                   SEESLSPPSEMTEAGTMDSAPDSGEPAYQAALKLLKEGRYEEAMAAFRQFPQQYPESRY
FT                   RPNAQYWLGESYYMLRDFSAAAQAFQALAEQYPESAKVPDAMLKQGLAYYELEQWEQAK
FT                   AQLQEVMARYPASTVSRLAEDRLEKMKREGHR"
FT   gene            196775..197416
FT                   /locus_tag="Nhal_0186"
FT   CDS_pept        196775..197416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0186"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: noc:Noc_0148
FT                   radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13396"
FT                   /db_xref="GOA:D5C4X3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR027621"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADE13396.1"
FT                   /translation="MKRLRITEIFHSLQGESRSVGWPTVFVRLTGCPLRCHYCDTEYAF
FT                   QGGTWMELDEILATVAEFGARHVTVTGGEPLAQPACLELLTQLCDVGYEVSLETSGALD
FT                   ISAVDPRVVKVMDLKTPGSGEEARNSTTNLDYLSSQDQVKLVLCDRHDYEWARTALERH
FT                   RLAERCEVLFSPSYEQLSPTDLAEWILEDRLPVRMQIQLHKYLWGEEPGR"
FT   gene            197413..198087
FT                   /locus_tag="Nhal_0187"
FT   CDS_pept        197413..198087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0187"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: noc:Noc_0149 ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13397"
FT                   /db_xref="GOA:D5C4X4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X4"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ADE13397.1"
FT                   /translation="MSSPKAVVLVSGGLDSATVLAIAREQEFACYTMSFDYGQRHRVEL
FT                   QAAAEISRLLGAVEHKLITIDLGGMGGSALTDSSIAVPEAPTEAIPVTYVPARNTVFLA
FT                   FALGWAEVLGAQDIFIGVNAVDYSGYPDCRPAFVEAFEHLANLATRAGLEGQRFRIQAP
FT                   LIHLSKAEIIREGIRLGIDYSRTVSCYQADETGRACGVCDSCRFRKQGFQEAGVPDPTR
FT                   YH"
FT   sig_peptide     197413..197478
FT                   /locus_tag="Nhal_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.454 at
FT                   residue 22"
FT   gene            198153..198228
FT                   /locus_tag="Nhal_R0004"
FT                   /note="tRNA-Lys1"
FT   tRNA            198153..198228
FT                   /locus_tag="Nhal_R0004"
FT                   /product="tRNA-Lys"
FT   gene            198431..198586
FT                   /pseudo
FT                   /locus_tag="Nhal_0188"
FT   gene            198643..199659
FT                   /locus_tag="Nhal_0189"
FT   CDS_pept        198643..199659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0189"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; peptidase M20; KEGG:
FT                   gur:Gura_1976 peptidase M28"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13398"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X5"
FT                   /inference="protein motif:PFAM:PF04389"
FT                   /protein_id="ADE13398.1"
FT                   /translation="MKKGVYFSYKLTGFWLAGGLLAMLSLIGKATPEIADQHSPGLAMT
FT                   PAIKKSRATQLRAHVEALATGIGERNMFTPNSLARAAEYIRHQWETQGYEVAAYPYIVR
FT                   GQEVENLEVALKGTEFPEEVILVGAHYDTVPGSPGANDNASGVAALLELSHKLAGKELP
FT                   RSLRFVAFVNEEPPFFKTPKMGSRVYARMARERGKRLKGVVVLETIGYYRNEPDTQKYP
FT                   PLFGLFYPDRGNFVGFVSNLRSRGLLHRAVGSFRKHSNFPLEYLSAPALIPGVDWSDHS
FT                   SFWRYGYDAIMVTDTALYRYPYYHSFQDTPDKLDYDSLVQLTVGLYGMLLELASADL"
FT   sig_peptide     198643..198729
FT                   /locus_tag="Nhal_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.514 at
FT                   residue 29"
FT   gene            199910..200440
FT                   /pseudo
FT                   /locus_tag="Nhal_0190"
FT   gene            200440..200841
FT                   /pseudo
FT                   /locus_tag="Nhal_0191"
FT   gene            201057..201983
FT                   /locus_tag="Nhal_0192"
FT   CDS_pept        201057..201983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0192"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; KEGG: mxa:MXAN_2361
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13399"
FT                   /db_xref="GOA:D5C4X6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X6"
FT                   /inference="protein motif:PFAM:PF02129"
FT                   /protein_id="ADE13399.1"
FT                   /translation="MMGLKRGVLIIVASVLLGYLSSSWAVLHLLLTPEHKPMTQTPVQL
FT                   GFPNTKSVWVETSKDHIRLRGWLVPANQSRAIILVHGIHSNAWDCQTPDVVRAYQASGF
FT                   QVFLFDLRAHGGSGGEHIGLGLHEHHDIQAIVDYLQTEAAIPPGSIGLHGTSYGAVVAL
FT                   FAAADIEAIKAVIADSAYANLFDVIGGELERQTGLPSEWGVMFAPGFELMGRVVYGLDI
FT                   DKAMPLQAVRKIQQRPLLLIHGQEDEILPPDHARRLNQAGGPNTQLWLLPGRRHTQGVR
FT                   LVPDCDKLSPLREEFLRRTTSFFKRYL"
FT   sig_peptide     201057..201134
FT                   /locus_tag="Nhal_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.897 at
FT                   residue 26"
FT   gene            complement(202114..203973)
FT                   /locus_tag="Nhal_0193"
FT   CDS_pept        complement(202114..203973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0193"
FT                   /product="CHRD domain containing protein"
FT                   /note="PFAM: CHRD domain containing protein; SMART: CHRD
FT                   domain containing protein; KEGG: si:ch211-136a13.1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13400"
FT                   /db_xref="GOA:D5C4X7"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X7"
FT                   /inference="protein motif:PFAM:PF07452"
FT                   /protein_id="ADE13400.1"
FT                   /translation="MNKTMHLGGLAMLATLLTSIASAPANGNEPLEDPIPRSIPEGRVP
FT                   IALEAVAERLTAPNWGTAVPGCANLQNRLVVTDQDGILWAIHLTTGEKRVLLDVSDRLV
FT                   SLGVAGPGTFDERGFLGVAFHPEFADNGLLYTYTSEPVDGPADFSTLPAGETANHQSIV
FT                   LEWRIPDPCHPDSVVDPDSARELLRIDEPQFNHDAGALNFGMDGKLYISLGDGGAADDQ
FT                   GGGHVPGGNGQDPSNILGTILRIDPDGSNAANGQYGIPTDNPFVGQSGFLDEIFAYGFR
FT                   NPFRFSFDSRTGEMWIADVGQNDIEEIDVGLAGGNYGWRLKEGSFCFDPNGNDPGFVFE
FT                   CQPDDVPADLIDPIAEYDHDEGTAVIGGFVYRGIQLPSLRGRYVFGDLFDPASGSGRLF
FT                   YLERNPRIFKFPSVFGDFSDSPSGSGRLFQLEKNRRIFEFPLANQENLGLSLLGFGQDA
FT                   FGELYVLANMTGTPFGDTGVVLKITRDRGQIPARFSAHLSGDEEVPPVDTQAQGQALFT
FT                   VNQAATELTFKLIVANIEEVIAAHIHCAPQGVNGPIGVTLFSGGPVTVNGILAEGTTTT
FT                   PDAGNACTWDDIADVKAAMGNGGAYVNVHTLAHPAGEIRGQIR"
FT   sig_peptide     complement(203890..203973)
FT                   /locus_tag="Nhal_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(204124..204618)
FT                   /locus_tag="Nhal_0194"
FT   CDS_pept        complement(204124..204618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0194"
FT                   /product="outer membrane lipoprotein Slp"
FT                   /note="PFAM: outer membrane lipoprotein Slp; KEGG:
FT                   tgr:Tgr7_0668 outer membrane lipoprotein Slp"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13401"
FT                   /db_xref="GOA:D5C4X8"
FT                   /db_xref="InterPro:IPR004658"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X8"
FT                   /inference="protein motif:PFAM:PF03843"
FT                   /protein_id="ADE13401.1"
FT                   /translation="MKLVFLMLAALGLGSCATAPKLETAGAAQDLAPPEVAANFDAYQG
FT                   QRVVWGGLIVNHTSLAESTMLEVLAYPLSGNLEPKTQAQPLGRFILQSDSFLEPIDYSP
FT                   GREMTVVGSITKTTTGRIGEMEYTYPVLRPEQIYLWPREKEAGGGGRTGFHFGIGVGIG
FT                   L"
FT   sig_peptide     complement(204544..204618)
FT                   /locus_tag="Nhal_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.482 at
FT                   residue 25"
FT   gene            complement(204640..205203)
FT                   /locus_tag="Nhal_0195"
FT   CDS_pept        complement(204640..205203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0195"
FT                   /product="outer membrane lipoprotein, Slp family"
FT                   /note="TIGRFAM: outer membrane lipoprotein, Slp family;
FT                   PFAM: outer membrane lipoprotein Slp; KEGG: tgr:Tgr7_0667
FT                   outer membrane lipoprotein, Slp family"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13402"
FT                   /db_xref="GOA:D5C4X9"
FT                   /db_xref="InterPro:IPR004658"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4X9"
FT                   /inference="protein motif:TFAM:TIGR00752"
FT                   /protein_id="ADE13402.1"
FT                   /translation="MKKQRYPIFILGILLSACAQMPKPIQEELPVNPSIETVRANIDDF
FT                   QGQRVRWGGVIQEVKNFEARTIIEIVGKPLNNEGRPRAVDESPGRFLAAFPGFLDPAIY
FT                   TSGRLITVLGEVTGAETDEIGAFNYRYPVVHVDRDYLWPSKVVQYVYPDPFFYDPWFYS
FT                   WPYYRFSPFFYDPWFYPWRRPYYW"
FT   sig_peptide     complement(205144..205203)
FT                   /locus_tag="Nhal_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.661 at
FT                   residue 20"
FT   gene            complement(205337..205600)
FT                   /locus_tag="Nhal_0196"
FT   CDS_pept        complement(205337..205600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13403"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y0"
FT                   /inference="similar to AA sequence:KEGG:Noc_3005"
FT                   /protein_id="ADE13403.1"
FT                   /translation="MTDFNFVPTKLHQSGEFAVPRGPQPRGDLGLGVFTAPRAFTSGAP
FT                   HPRLREQENHSANSWQNATNVALALGAPFHFATLLGGRLTSM"
FT   gene            complement(205597..206253)
FT                   /locus_tag="Nhal_0197"
FT   CDS_pept        complement(205597..206253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: xau:Xaut_4165
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13404"
FT                   /db_xref="GOA:D5C4Y1"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y1"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ADE13404.1"
FT                   /translation="MDAQTINPTRTKSSYSPAFLVILAGFITSLLIANIIAVKLIDIWG
FT                   WVMPAGVIIFPLSYIIGDVLTEVYGYRRARQVIWLGFFCNLLAVGAITLAMALPPAAFW
FT                   DGQEAFERILGYAPRLLLVSFLAYLVGEFTNAYVLAKMKIATQGRWLWTRTIGSTLVGQ
FT                   GLDSAVFIIVAFLGTIPLEGLVLAILIQWGVKSAYETVATPLTYLVVNYLIGVSP"
FT   gene            206447..206794
FT                   /locus_tag="Nhal_0198"
FT   CDS_pept        206447..206794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0198"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   SMART: Calcium-binding EF-hand-containing protein; KEGG:
FT                   CLSPN; claspin homolog (Xenopus laevis)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13405"
FT                   /db_xref="GOA:D5C4Y2"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y2"
FT                   /inference="protein motif:PFAM:PF00036"
FT                   /protein_id="ADE13405.1"
FT                   /translation="MAMKYKVMCYSLFLGGVLSLVLIPAFAGNPYGSEEEGAAEEQEMH
FT                   KKMFQKLDEDGDGKISEDEFEEAMEEKFERMDKDDDDLLTQEEWEAAAKKHKKEYKKEH
FT                   HRGAGEGSEGY"
FT   sig_peptide     206447..206530
FT                   /locus_tag="Nhal_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.959 at
FT                   residue 28"
FT   gene            complement(207058..208819)
FT                   /pseudo
FT                   /locus_tag="Nhal_0199"
FT   gene            209011..209124
FT                   /locus_tag="Nhal_0200"
FT   CDS_pept        209011..209124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13406"
FT                   /db_xref="GOA:D5C4Y3"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13406.1"
FT                   /translation="MKRKQETQSRSSLLTFSLLILYVLFAVILLGLGLGAA"
FT   sig_peptide     209011..209106
FT                   /locus_tag="Nhal_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.580 at
FT                   residue 32"
FT   gene            complement(209420..211024)
FT                   /locus_tag="Nhal_0201"
FT   CDS_pept        complement(209420..211024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13407"
FT                   /db_xref="GOA:D5C4Y4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y4"
FT                   /inference="similar to AA sequence:KEGG:Neut_0141"
FT                   /protein_id="ADE13407.1"
FT                   /translation="MTWLGRNLCILLLFYLVPGYSSEEFSGSLPELRASLPSGKPTLHR
FT                   REPGFNHAGSGEKNSAIQRGRDIWFNNTYGGEKFFDFLADRRLQVGFKNVINTPRDRRF
FT                   QAWGTLNDPDCRANPQGGPDLCSDPNASGVIGIRRFLTADGRTIFGLSCASCHAGFDPL
FT                   NPPLDVNEPSWDNIHPTIGNQHLKAGKILAANLPADDPRRFMFEGWPDGTVDTTVLFSD
FT                   HIMNPGTITPIWELRHRPTFNVGPDKPKIRMGQGGEDDLGSQRAALRVYTNIGVCFFEC
FT                   VAPSLAEDRPIDLKQCRRDCADLPPEQDLNDLSRFLRSIKAPKFPESIQTNFSRERSRK
FT                   KYLFAWGQKVFKDNCASCHTFKGKAGRVLSNDEVNPLIQAPENATNACRALTSQWEADH
FT                   LWAAFSSQVYKDRAAAGLKGYRTMPLAGIWATAPFLHNQSVGPYPEANTSPEERAEIYE
FT                   VAMRELLSPFRVPQINMLPVSIGPFPAGTPLTYVFSRDPETNELLCDDIIENRGHYYGS
FT                   ELPEEDKEALIFWLKRQ"
FT   gene            complement(211499..212949)
FT                   /pseudo
FT                   /locus_tag="Nhal_0202"
FT   gene            complement(213344..213646)
FT                   /locus_tag="Nhal_0203"
FT   CDS_pept        complement(213344..213646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0203"
FT                   /product="addiction module antidote protein, HigA family"
FT                   /note="KEGG: noc:Noc_0571 XRE family transcriptional
FT                   regulator; TIGRFAM: addiction module antidote protein, HigA
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13408"
FT                   /db_xref="GOA:D5C4Y5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y5"
FT                   /inference="protein motif:TFAM:TIGR02607"
FT                   /protein_id="ADE13408.1"
FT                   /translation="MQMHNPPHPGEILKHLCLEPLGLSVTEAAKALGVSRKTLSSILNG
FT                   RTGISPEMAIRLSIAFDTTAESWLNQQVQYDLWRAEQHRGKLQVKKLSSKQSEYT"
FT   gene            complement(213656..213934)
FT                   /locus_tag="Nhal_0204"
FT   CDS_pept        complement(213656..213934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0204"
FT                   /product="plasmid maintenance system killer"
FT                   /note="PFAM: plasmid maintenance system killer; KEGG:
FT                   noc:Noc_0570 plasmid maintenance system killer"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13409"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y6"
FT                   /inference="protein motif:PFAM:PF05015"
FT                   /protein_id="ADE13409.1"
FT                   /translation="MIKGFKHKGLERFFLHGTKAGIQTKHTERLRLILGRLNASTCPQD
FT                   MNLPGLGLHELSGDRKGIWSVKVSSNWRVTFTFSGGDADDVDYEDYH"
FT   gene            complement(214099..214254)
FT                   /pseudo
FT                   /locus_tag="Nhal_0205"
FT   gene            complement(214382..215257)
FT                   /locus_tag="Nhal_0206"
FT   CDS_pept        complement(214382..215257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0206"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sfu:Sfum_3983
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13410"
FT                   /db_xref="GOA:D5C4Y7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y7"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADE13410.1"
FT                   /translation="MQAPKKYWWVVGVAVPIVVAIITMIPDIRKDGDSKPIYVDVVGAQ
FT                   FTGKVAFNNVTVIAEQALQVLGKDLPDDVVTTLRQALEFAQSKEFDKAIPLLQGAVAAA
FT                   PVPAVFNNLGAAYLATGNQDKAKEYFKKAVTEAPDEETASFNLTQLPGIDSIRIKEESE
FT                   EKPTPSTRPALAEVGSGSSNALAPVAGGYSSIKLQTGDVRRVKYTVKINGLPLGIYQFD
FT                   KNLVIDRFLKQGVQNTISFEFEKANDYGPDLWIDARLPGHKDWFRIYEFTAIKNRLKGS
FT                   VTIPFAGPEK"
FT   gene            complement(215591..216466)
FT                   /locus_tag="Nhal_0207"
FT   CDS_pept        complement(215591..216466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0207"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: noc:Noc_0363 oxidoreductase
FT                   FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13411"
FT                   /db_xref="GOA:D5C4Y8"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADE13411.1"
FT                   /translation="MKPKSHRGTILMEDCEVLAHDPHPGDQYVLRVTAPGIAPRATPGS
FT                   FAHLQCDPSLPMRRPLSIMRVDARHGWMDFLYKAIGQGTRLLAQRKPGEKISILGPIGQ
FT                   PFQIDPAYPRPLLLGGGVGIPPMVFLADTLRRDKQFKPLVLMGSEVPFPFRPRPSQFLI
FT                   PGLPEGAIGAMPLLEDWKIPNRLTSLQGYPGCFEGFITDLARHWLQTLDPAQRQAVAIY
FT                   ACGPHPMLEATAKLAQEFDLPCQVSLEEFMACAVGGCAGCVVKVQTSQGPAMKRVCVDG
FT                   PVFDAKAVFA"
FT   gene            complement(216463..217752)
FT                   /locus_tag="Nhal_0208"
FT   CDS_pept        complement(216463..217752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0208"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; KEGG: noc:Noc_0364
FT                   dihydroorotase multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13412"
FT                   /db_xref="GOA:D5C4Y9"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Y9"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ADE13412.1"
FT                   /translation="MRLVIKNGHLIDPYNEVDAVQDLYLADGRVVAIGNAPEGFRAEQE
FT                   INAQGQIVCPGLIDLRARLREPGQERKGTIATETLAAAKGGITTLCCPPDTISVVDTPA
FT                   VADLIAHRAAQHQRTRILPLGALTQGLKGLQLAEMAILREAGCVGVSNALVPIANSQVM
FT                   RRAMEYAATLGITVFLHPRDPWLGIDGCCHEGIVSARLGLTGIPETAETVALARDLLLI
FT                   EQTGVQAHFCHLSSSRAVRMVREARAEGLPITADVTAYHLHLTEHDIGEFNSQCHVIPP
FT                   LRSLRDRDALHEGLRDGAFSAICSDHQPHEIDAKLGPFPITEPGISGLETLLPLSLRLT
FT                   QDDILTLPEVIAYLTYQPAQVLGIEGGHLAPGQRADICIFDPHDHWVLKPEEMVSQGKN
FT                   TPFGGWEFQGRVTHTLLEGQVVFATETKDP"
FT   gene            complement(217752..218726)
FT                   /locus_tag="Nhal_0209"
FT   CDS_pept        complement(217752..218726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0209"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: noc:Noc_0365 aspartate carbamoyltransferase
FT                   catalytic subunit; TIGRFAM: aspartate carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13413"
FT                   /db_xref="GOA:D5C4Z0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Z0"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ADE13413.1"
FT                   /translation="MNNIQLDSEGRLRHFLSIQGLNRELLTRVLDTAESFAAIGAQQVK
FT                   KVPLLRGKTIVNLFFESSTRTLSTFELAAKRLSADVMNLNVRTSSTKKGESLLDTLRSL
FT                   EAMHCDMFVVRHSDSGAAHFIARHAPSHVSVINAGDGCHAHPSQAMLDMLTIRRHKGSF
FT                   PNLRVAIVGDILHSRVARSEIHALSTLGTGEIRVIAPRTLLPRSVDSLGVHVFHNMKEG
FT                   LKDVDVVVTLRLQRERMQGALLPSEREYFRLYGLTEEKLVLARPDVIVMHPGPINRGIE
FT                   IESAVADGPHSVILEQVSHGIAIRMAVMAMAMQVPVPEAKEAR"
FT   gene            complement(218723..219256)
FT                   /locus_tag="Nhal_0210"
FT   CDS_pept        complement(218723..219256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0210"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: noc:Noc_0366
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13414"
FT                   /db_xref="GOA:D5C4Z1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Z1"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ADE13414.1"
FT                   /translation="MNLPRSLSLDVEALCRKLATDLSQRMAEQQWDNPAMIGIHTGGVW
FT                   VAERLLAQLDNLVSDPLGVLNIAYYRDDFTRIGMHPQVQPSQLPFSVADRHIILVDDVL
FT                   YTGRTVRAALNEIFDYGRPASVTLAVLVERAGRELPIQADVLGHHLDLALNEQVKLTGP
FT                   EPLQFSIQCVEPNE"
FT   gene            complement(219300..219743)
FT                   /locus_tag="Nhal_0211"
FT   CDS_pept        complement(219300..219743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0211"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: noc:Noc_0367
FT                   Holliday junction resolvase YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13415"
FT                   /db_xref="GOA:D5C4Z2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Z2"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ADE13415.1"
FT                   /translation="MKGTAATPPPPKPRVVFGFDFGMRQIGVAVGQEVTHSATPLTTLK
FT                   ARDGKPNWDLVTRLIEQWRPDLLIVGLPLNMDQSEQLLTQAARRFGNRLHGRYGLAVEW
FT                   VDERLSTIEARERLNLKPSSLGRHPELDQVAAQCILQTWLREQ"
FT   gene            complement(219740..220303)
FT                   /locus_tag="Nhal_0212"
FT   CDS_pept        complement(219740..220303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0212"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   noc:Noc_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13416"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Z3"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ADE13416.1"
FT                   /translation="MKTMRYLRNHFLIAMPTLEDANFARTVTYICEHNRDGAIGLIINR
FT                   PLNITLKQVLQHMKVKNCPQEVGASPVLLGGPVQQDRGFVLHRPIGHWEATLTVSDEVG
FT                   ITTSRDILDAIAQGQGPQQTLIALGYAGWGPNQLEQELAENAWLSTPANSTIVFDTPYP
FT                   QRWEAAAALAGVDLSRLSGEIGHA"
FT   gene            complement(220337..220600)
FT                   /locus_tag="Nhal_0213"
FT   CDS_pept        complement(220337..220600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13417"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Z4"
FT                   /inference="similar to AA sequence:KEGG:Noc_3005"
FT                   /protein_id="ADE13417.1"
FT                   /translation="MTDFNFVPTKLHQSGEFAVPRGPRRRDDLGLGVFTAPRAFTSGAP
FT                   HPRLREQENHSANSWQNASNAALALGAPFHFATLLGGRLTSM"
FT   gene            complement(220597..221508)
FT                   /locus_tag="Nhal_0214"
FT   CDS_pept        complement(220597..221508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0214"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: noc:Noc_0369
FT                   TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13418"
FT                   /db_xref="GOA:D5C4Z5"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D5C4Z5"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ADE13418.1"
FT                   /translation="MSFTAFTIPTMSYRLGLALLLSALLHGAAILSIGQLNILPPPTPV
FT                   HSPPLEIVLVPIKQEQAPEKPDFLAQANHIGGSLKEKQPPRPTPPSPPPASKPLQTASN
FT                   GTTQPSGATLTEKKLPPPEPVTTPSVLTQKHASRPVTQQASEPEPLDTVEVEDSPKPRP
FT                   SARELIAALEGQLAKEIQGYANQPRKRHIDSSTKEYAATAYLDAWRKKIERVGKMNYPE
FT                   EAKRQGLSGSLILVVDLNVDGSVANIVVRRSSGYQILDEAAIRIVRLAAPFAKVPENLL
FT                   QGHDILSITRTWQFHSGIGVSP"
FT   sig_peptide     complement(221425..221508)
FT                   /locus_tag="Nhal_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.602 at
FT                   residue 28"
FT   gene            complement(221517..222479)
FT                   /locus_tag="Nhal_0215"
FT   CDS_pept        complement(221517..222479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0215"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: tgr:Tgr7_2905 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp; glutathione
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13419"
FT                   /db_xref="GOA:D5BUL9"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUL9"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADE13419.1"
FT                   /translation="MTIRLGVVMDPIATLNIKKDSTFAMLLEAQSRGWTLGYMEQSELY
FT                   LKDGHAYALLRELMVKDDPASWYQLGQPHPVSLTELDLILMRKDPPFDMEYVYTTYLLE
FT                   RAEQAGVLVVNKPSSLRDANEKLYTAWFPQCCPPTLVTRKATLLRDFLAEQQDIVLKPL
FT                   DTMGGASIFRVRQEDPNLAVIIETLTHQGQRQVMAQRYLPEIRFGDKRILMVDGQPIPY
FT                   ALARIPAPGETRGNLAAGGRGEGIPLSARDYWICEQVGPTLKARGLIFVGLDVIGDYLT
FT                   EINVTSPTCIRELDALYGLNISAQLMDCLASRLAPQARA"
FT   gene            222744..224477
FT                   /locus_tag="Nhal_0216"
FT   CDS_pept        222744..224477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0216"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: noc:Noc_0370 outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13420"
FT                   /db_xref="GOA:D5BUM0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM0"
FT                   /inference="protein motif:PFAM:PF01103"
FT                   /protein_id="ADE13420.1"
FT                   /translation="MFQRTLFALLLLFLGIGSAWPQARLEVEVQGVEGKVLKNVMAYLS
FT                   IVHHQEDPKLTVGQIRRLHDKAVDEIKTALVVYGYYWPQIQAELQPYPEQWLARYRVDP
FT                   GPRMRVEEVNLNLTGEGTEDPAFQALQEDFPVKRKDPLNHADYEQGKAALQQLAAERGY
FT                   FQAEFIQQKLQVDLEAYAATVVLHFDTGPRYRFGPVTFSETVVRPQLLARYVPFEEGEF
FT                   YESSGLIELHKALVDSDYFAEVEVEPQPEQAVEHKVPIGVRLQAKKRHRYSAGVGFGTD
FT                   TGPRINLGWENRYVNRRGHRFGFALRASEIRQAFDTNYVIPMRDPRTDQLGFASSFGRE
FT                   STRTSDSRIAQVGVRRITARDGWRETLSLDYRWEDFEIDGESGTANLLMPGVIWYRSQA
FT                   DDPIYPRRGHRLSLELRGAAQELLSDNTFSQLTLRGKMVRSLGSRSRVLVRGALGMSLV
FT                   SEFSELPPSVRFFAGGDQSVRGYAFNALGAKDEEDRVVGGRNLLVGSLEYEYRFLDKWA
FT                   VATFYDAGNAFNDFSLDLRQGAGVGIRWISPVGPVRVDLAWALSKADTPIRLHVYLGPD
FT                   L"
FT   sig_peptide     222744..222803
FT                   /locus_tag="Nhal_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.682 at
FT                   residue 20"
FT   gene            224474..228238
FT                   /locus_tag="Nhal_0217"
FT   CDS_pept        224474..228238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0217"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   noc:Noc_0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13421"
FT                   /db_xref="GOA:D5BUM1"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM1"
FT                   /inference="protein motif:PFAM:PF04357"
FT                   /protein_id="ADE13421.1"
FT                   /translation="MKFLRWVGALILLAVVLLMGSIAYVTQTEIGTRWLLTQAARVAPG
FT                   ELQTQQVEGRLGEALTLTGLRYRTPDFTLDIKHLHFAWRPAALLEATFWVERLHLREVS
FT                   WRQERPPAPSAQEASMTLPEIQLPLKVRAESVRLQNLSWHPLGVSPVVIDTMVLRGNFD
FT                   GQALEVAELGISAPQGQLEVRGGIAFQRAYPLEFAMGWKIPAPELGEVVGSGKVQGDLR
FT                   QLTLRQEVQTPFPLQFRGRLFELLEQPRWVAVVEIPETELGHLSSQWPPLRLGLDLKGA
FT                   GGLNQFKVRGSYQIQEARLGKLSGKLSGEQRAIGHWVLNQLSVQQIEGPAHLALRGEGM
FT                   MAEGQPQLTLEGQWQDLAWPLTGTAQVSSDWGQLTLAGSPAAYQLQMSSALAGQNIPTS
FT                   EWHLAGGGDTTQFGLEKLQGQLLDGFLRGSGNFRWSPALAWQLQLAGKSLNPAEQWPAW
FT                   PGELAFSTHTRGTFEDSARTLMINLQTLSGSLRGYPVAAQGQVQLQETIWRIADLRVRS
FT                   GDSQFSMEGTINEELGLDWRLASPDLSQLLPTAQGDLRAKGHLGGPLQQPALTLRLQGE
FT                   KLAYQDLQLASVAADVNVDLQGKRPSQLWVEASDFTLGTQALHSLEFQGRGTPAQHELR
FT                   LEVAAPEHSLDLEAQGSWRETAWQGQLSRALFTDSQTGRWETAAPAPLTLSPSRVDLAP
FT                   WCWQQQSAQLCLGGGWQQGGVWQASLGMADFPLAVLAPLLPEKTTLEGTVAGEARMQGE
FT                   ARQLAQAQLQLNVSEGQLAQVAAEGQTLRFSHQGAQVKLRLEKDGGEGSFQLLLAEPSA
FT                   APVHASLRLPPAPWDLTALGQLPLEGQVSAAFDDLAFVELLLPELQAVQGQLEVDLDLG
FT                   GRVAAPRLRGQVILQEGGAQVVPLGLALTGIRLRVEASEQERVTFEGEVHSGEGQLAFD
FT                   GQARLDPTAGWPARVTVSGERFEAMETTEIRVLISPQLEIKVAAEGIRVEGEVAVPEAN
FT                   VEITDIKRRGGVPVSNDVVIVSQEKEAEAKALPIYARVRITLGDKVSVQALGFKGRVAG
FT                   NLLVTETPGKVTRGNGELRVVEGQYKAYGQQLKIQQGRVIFAGPMNNPRLDVEAVRQIG
FT                   DVIAGVRIQGLANAPVLTLFSEPAMNEDNILAYLLLGRPLATASGDEGELLAKAATSLG
FT                   LSGGNLLAKRIGETFGLEEVGIETRGEDQSQALMLSKHLSPRLYIGYGIGIFERFNAFQ
FT                   MRYTLSEHWSLQAETGLESGVDLFYNLER"
FT   sig_peptide     224474..224551
FT                   /locus_tag="Nhal_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.755 at
FT                   residue 26"
FT   gene            228363..229307
FT                   /locus_tag="Nhal_0218"
FT   CDS_pept        228363..229307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0218"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: noc:Noc_0372 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13422"
FT                   /db_xref="GOA:D5BUM2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM2"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ADE13422.1"
FT                   /translation="MISKPRPVAATMPATFQELILRLQQYWAEQGCVLLQPYDMEVGAG
FT                   TFHPGTFLRAIGPEPWSAAYVQPSRRPTDGRYGDNPNRLQHYYQYQVVLKPSPLEIQDL
FT                   YLGSLQMLGISPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEITQFTYFQQVGGLEC
FT                   RPVTGEITYGLERIAMYLQGVSSVYDLIWTDGPLGRITYGDVFHQNEVEMSTYNFEQAD
FT                   TESLFAWFNSCEAESKRLIEAGLPLPAYEMVLKASHTFNLLDARRAISVTERQRYILRV
FT                   RALARAVAEAYLARREALGFPMLAGVTKEAACA"
FT   gene            229300..231375
FT                   /locus_tag="Nhal_0219"
FT   CDS_pept        229300..231375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0219"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: noc:Noc_0373 glycine--tRNA ligase; TIGRFAM:
FT                   glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13423"
FT                   /db_xref="GOA:D5BUM3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM3"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ADE13423.1"
FT                   /translation="MLETRDLLIEIGTEELPPKALRKLSESLTQELSQRLQAAGLAYGS
FT                   LKGYGAPRRLAVWVQELTASQPDRVLERRGPALTAAFDDEGRATAAAQGFARSCGVPVD
FT                   ELESLESEKGAWLVHRQRRQGAPTRELLPDILAQSLQALPIPKRMRWNDLSVEFIRPVH
FT                   WLVLLFGDEAIPAELLGVQADRETRGHRFHHPAPLYLAEPAAYGPLLETEGKVLADFSV
FT                   RREAIYAQVVEAAKKVGGEALVEDALLDEVTGLVEWPVALAGRFEPDFLQLPEEVLIAT
FT                   MQDHQKYFPVRDGQGHLLPYFITVSNIESEQPEAVVEGNERVIRPRLADAAFFYATDRK
FT                   ESLASRCGKLKKITFQEKLGSVFERTERLAQLARSIAISIGGNGDWAERAGLLSKCDLV
FT                   TEMVTEFPELQGIMGRYYALRDDEPAEVAEALREQYLPRFAGDKLPGTPTGQALSLADR
FT                   LDTLVGLFGIGEPPSGDRDPYGLRRAALGVLRIIIEAELGLDLRLLLERGCQAYGGRLT
FT                   ESNTAAQVHDYLLERLRGYYLEAGFRPDEIEAVLVLKPGRPWDFDRRLKGVASFRELPE
FT                   AESLSAANKRIRNILRKSKEKIPPQVEPGLLQDPAEQALATQMYDLEREVSPLLERQDY
FT                   QAALRALASLRGAVDRFFDEVMVMVEDPALRANRLALLERLQTLFLQVADISRLQS"
FT   gene            231435..231974
FT                   /locus_tag="Nhal_0220"
FT   CDS_pept        231435..231974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0220"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase central region; KEGG:
FT                   noc:Noc_0374 histidinol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13424"
FT                   /db_xref="GOA:D5BUM4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM4"
FT                   /inference="protein motif:TFAM:TIGR01656"
FT                   /protein_id="ADE13424.1"
FT                   /translation="MRLVILDRDGVINEDSDAYIKCPAEWVPLPRSLEAIARLNQAGYR
FT                   IVVATNQSGVGRGLLDVPTLNRIHSKMHHLLAQMGGGIEAILFCPHAPDDDCNCRKPRP
FT                   GLFQELASRLRIQLEGVPAIGDSLRDLQAAQAVGAKPLLVRTGKGEMTAKSPNLPPGVE
FT                   VYDDLSSVVDALLKHG"
FT   gene            231967..232881
FT                   /locus_tag="Nhal_0221"
FT   CDS_pept        231967..232881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0221"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: noc:Noc_0375
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13425"
FT                   /db_xref="GOA:D5BUM5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM5"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADE13425.1"
FT                   /translation="MDSQAPKSGQPLNKVSGQSFPAQHRSSSSGLLWRSLIFSLGQVFS
FT                   TLVFGLVGLCLSFLPFHYRYRFLIQWGRLNFWWLRKTCGVSFRVRGAEHIPPGPAVVLC
FT                   KHQSAWETIALQQIFPPQIWVLKRELLWIPFFGWGLALLEPIAIDRKSGRKALEQIIQQ
FT                   GRQRLAAGRWVVVFPEGTRMPPGKMGRFGIGGAALAQATGYPVVPVAHNAGRYWPRSGF
FT                   TKYPGVIDVAIGPPIDTQGKTATQVNQQAYDWIEQAMEEIDPPEADECPEASNLDALNL
FT                   VVPIEEYRKLNANTQRYSAVVNR"
FT   gene            232841..234931
FT                   /locus_tag="Nhal_0222"
FT   CDS_pept        232841..234931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0222"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: noc:Noc_0376 multisensor diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; response regulator receiver; PAS fold
FT                   domain protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13426"
FT                   /db_xref="GOA:D5BUM6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADE13426.1"
FT                   /translation="MLTPKDIVRLLIVDASFENAEMVTNLLRNMGFAVRASRVEDEEEV
FT                   REALEGQAWDLIVCAATPPQLSVTQMLQVLAQSEKDIPLVVVIDEETDPDDIDEMYADG
FT                   ARDVVLKSRPLRLQHVVKRELRDLESRRARRRSEMVLGESERRARALLESSRDAVGYVH
FT                   EGMHLYANRAYLDLFGCHDLDDIEGMPLLDMVAPEEHSRFKTFLKEYNAREGGKSQLPL
FT                   KGRKLDGSTFSATLEFTPASIEGEPCTQIVIRDEAYNPVAEEKIKQAQQRDVLTGLFSR
FT                   PYCFELMEEAVSAARAGEKESSLLYIALDQFNRVRVRVGIGASDLVITDVARILQQYCD
FT                   EKGLLARFGDEIFILLVAQASDEQVDTLAEQLRQAVDQHLVEIGERSINVTCSVGLCRM
FT                   GENTPGVQQVLERAHKACVKAQEAGGNRVERYSPVAADLTDQEKIKQWEIRLRQAIDKD
FT                   GFRLLYQPVVSLHGKTEEIFEALLRMTDKAGGYIPPEEFLEPAAQLKLMGEIDRWVIAK
FT                   ASRVLRDRHQAGQPTRFFIKLSDFSIHDKNLLPWLEKHLRENQLDANSLIFEISESSAL
FT                   NYLKQMQRLIGGIRALGCCFALEHFGTGLDMSNCLKHLDVDYLKINGAFIENLLQEEEN
FT                   QTVVKTIIEMAKEAGKPTIAEFVSDANTLALLWQFGVDYAQGHYIQEPNELLSYDFSGD
FT                   IQ"
FT   gene            complement(235012..235749)
FT                   /pseudo
FT                   /locus_tag="Nhal_0223"
FT   gene            235314..235502
FT                   /locus_tag="Nhal_0224"
FT   CDS_pept        235314..235502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13427"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM7"
FT                   /inference="similar to AA sequence:KEGG:Noc_3005"
FT                   /protein_id="ADE13427.1"
FT                   /translation="MTDFNFIPTKLHQSGEFAVPRGPRRRGDLGLGVFTAPRAFTSGAP
FT                   HPRLREQEIIAPIHGKT"
FT   gene            235870..236772
FT                   /locus_tag="Nhal_0225"
FT   CDS_pept        235870..236772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0225"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; peptidase M56 BlaR1;
FT                   KEGG: dde:Dde_1051 HtpX-2 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13428"
FT                   /db_xref="GOA:D5BUM8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM8"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADE13428.1"
FT                   /translation="MAKRGLGADTGLSFRMGVVLLILTALYLAFLAFLAAMGVPFRGLV
FT                   LFAALLLGAQYFFSGKLVLLASGAREVSPQQAPELHARIERLAMQMDLPKPRVALMETD
FT                   IPNAFATGRSQKSSVVAVTRGLLQRLDGAELDSVLAHELSHVANRDVMVMTLASFFSTV
FT                   AFFLVRWLLYMPRMGGSQRERGNSAAALFLVWVISMLVWAISTLLLRALSRYREFAADR
FT                   GSALTTGAPSTLASALQKISGTVDRIPQQDLRQVEAASAFFIIPVTGKEFLVRLLSTHP
FT                   PLEQRLQELERIQREMEQR"
FT   sig_peptide     235870..235986
FT                   /locus_tag="Nhal_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.673) with cleavage site probability 0.424 at
FT                   residue 39"
FT   gene            236769..237335
FT                   /locus_tag="Nhal_0226"
FT   CDS_pept        236769..237335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13429"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13429.1"
FT                   /translation="MKWLDSLLGRATPPPPKLERLFALSTAYVTLAAKLGYSSGGKAGI
FT                   VFRSADAAGFQGLQQELEDLLQLSAAEMESRCLLQKDDYGFLWMVVEDEQVEDQIATVH
FT                   LVSSTLTDQGYGSSLLAAVFRFEQANQPIYWVYNYKRGSFYPFVPLPNQQRDNAKEFRL
FT                   KALMEKELPLETQLELWYPLWGLPV"
FT   gene            complement(237354..237632)
FT                   /locus_tag="Nhal_0227"
FT   CDS_pept        complement(237354..237632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13430"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13430.1"
FT                   /translation="MIIRIMSEGQYRMPSGHLDQLNDLDAQVVLAVAQGDQAHFQTTYA
FT                   QMLDFVRQQGEPVAATELVESDVILPAPDLELKEAQQLFKGEGIIPG"
FT   gene            complement(237663..238364)
FT                   /locus_tag="Nhal_0228"
FT   CDS_pept        complement(237663..238364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0228"
FT                   /product="PspA/IM30 family protein"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: afr:AFE_2017
FT                   PspA/IM30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13431"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN1"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADE13431.1"
FT                   /translation="MGLLSRMATILKAKMNALLESSANPAETLEYSYQKQVELLQKVKR
FT                   GIVEVVTSKRRVELQAARVREQVSQLDAQAEEALAAGREDLARLALQRKQIGQEQLGDL
FT                   EQQLSVLEQEQQRLTTAETRLSTKVETFRTRKETLKAQYTAAEAQVRIGEAVHGLSEEL
FT                   ADMGLAIERAEEKTESMRARAAAIDELAETGVLVDLTRSGEDQLSRELKQISASRNVEA
FT                   ELAAMKERLGQ"
FT   gene            complement(238454..240034)
FT                   /locus_tag="Nhal_0229"
FT   CDS_pept        complement(238454..240034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0229"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   noc:Noc_0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13432"
FT                   /db_xref="GOA:D5BUN2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN2"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADE13432.1"
FT                   /translation="MTEPAGTLIKALQQPKVYHHAVENLTLIETHISWLVLTGPYAYKI
FT                   KKPLNLGFLDFSTLDKRRHYCHEELRLNRRLAPEIYLEVVPISGSPAHPRLGGADTPIE
FT                   YAVKMVQFPQQARLDYCLQRGELSPKLIENLAHKVAAFHQSIAIAPQDSPYGTPEAVLQ
FT                   PALENFEQVNSFLEEEKEDQKRLARLRQWTEEKWRQLQPEFIGRKKAGFVRECHGDLHL
FT                   GNIALRESQFIIFDCIEFNENLRWIDVMSELAFLVMDLEDRGRPDLAHHCLNRYLERSG
FT                   DYPGLAVLGYYQVYRALVRAKVTAIRLGQTPSAPEAQAIKERYRSYLKLASSYIQPAQT
FT                   FLIITHGLSGSGKTTLSQPLLDHLGAIRLRSDIERKRLHGLNPRDRPGEGVATGMYSAQ
FT                   SSRQTYQHLQQLAQTVLAAGYPVLVDAAFLKQAQRQAFQDLAQTLGVPFAILDFRCEPQ
FT                   QLQQRIRERQRQDRDASDADLAVLEHQQTTQEPLTEAEQNITLPIETSQPLDMESLREQ
FT                   LLHQLHPTP"
FT   gene            complement(240093..241304)
FT                   /locus_tag="Nhal_0230"
FT   CDS_pept        complement(240093..241304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0230"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; KEGG:
FT                   noc:Noc_0389 polynucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13433"
FT                   /db_xref="GOA:D5BUN3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN3"
FT                   /inference="protein motif:PFAM:PF01743"
FT                   /protein_id="ADE13433.1"
FT                   /translation="MEIYLVGGAVRDKLLGRPVKERDYVVVGATPASLLAQGYRPVGKD
FT                   FPVFLHPQTQEEYALARTERKTGPGYKGFEVYAAPDVTLEEDLQRRDLTINAIAESPEG
FT                   ALFDPFGGRQDLERGILRHVSPAFVEDPVRILRVARFAARFDFEVAPETMALMQAMVAA
FT                   GEVDHLVPERVWKELEQALAESHPRRFFEILRACGALARIFPEIERLFGVPQPKRYHPE
FT                   IDTGIHTLKVLDMAARLSQDTQVRFAALIHDLGKGETLPSEWPHHRGHGERGAALVLTL
FT                   CQRLRVPKAYQELAVHVARYHDQVHRAQELRPGTLLKLLNRVDAFRRPSRFDQFLLACE
FT                   ADARGRAGLEDRPYPQADRLRSAFHAAAAVTARPLVAAGFQGEAIARELQQQRIKAIKQ
FT                   IVTN"
FT   gene            complement(241313..242296)
FT                   /locus_tag="Nhal_0231"
FT   CDS_pept        complement(241313..242296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0231"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; KEGG: noc:Noc_0390 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13434"
FT                   /db_xref="GOA:D5BUN4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADE13434.1"
FT                   /translation="MNEQTVCILGGTGFVGRWLAAHLVDHGYRVRVLTRHRQRHRDLLV
FT                   LPGLQLKEADIHDPAQLTAQLSGCHSVINLVGILNEKGRDGSGFRRVHADLPEKVAQAC
FT                   LDTGIQRLLHMSALNADANQGASHYLRSKGEGESRVLALAEQGLQVTIFRPSVIFGPGD
FT                   SFFNRFGTLLKLSPFVFPLACPDARLTPVYVEDVVQAFVRTLPDKDSFGQSYELCGPKI
FT                   YTLQQLVEYTAKVLGLRRRVIGLSDKLSRLQADIFEYLPGKPFSKDNYDSLQAPSICHQ
FT                   NGLSELGIEPTTIDAVVPGYLGQHNQRAHYLELRRHAHRHEETGLS"
FT   gene            242489..243853
FT                   /locus_tag="Nhal_0232"
FT   CDS_pept        242489..243853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0232"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: noc:Noc_0391
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13435"
FT                   /db_xref="GOA:D5BUN5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN5"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADE13435.1"
FT                   /translation="MAFETVNPTTGQSLKTFSAWDKEAIEEALQQAQESRFVWAARPLS
FT                   ERCRLLEAVAQQLRERKEDLARLITLEMGKLVTEARAEIEKCAWVCEYYAEQAPRFLAD
FT                   EMIESDAGRSYVALQPLGTVLAIMPWNFPFWQVFRFCAPALVAGNTALLKHASNVPQCA
FT                   LAIERTLLEAGFPPGVFHTLLVTSAQAAEVIADPRVQGVTLTGSEAAGRKVAEWAGQHL
FT                   KKTVLELGGADPFIVLADADLEQTVPVAVQSRFLNGGQSCIAAKRFIVMEEVANEFVAR
FT                   FRASLEALRPGDPLDEQTTLAPLARLDLREGLHRQVKVSIEQGAVAVAGCQPLPGPGAY
FT                   YAPSILDRVQPGMPAFEEELFGPVAAIIRVADQAEAVAMANASRYGLGGSVWSRDVSWA
FT                   EQLALQLQCGAAFVNGLVKSDPRLPFGGVKCSGYGRELSWHGMREFVNQKTVWIK"
FT   gene            complement(243884..245188)
FT                   /locus_tag="Nhal_0233"
FT   CDS_pept        complement(243884..245188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13436"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13436.1"
FT                   /translation="MTDYGSVHPHLVSLENSRFLAVLRRWLGHGPWGLYRSTRFIGFGA
FT                   PRRTQHQNIFGRVDIAIMAGITVRANPLANFERHGLLNSPAIRDGFTQAAISQHPFDIQ
FT                   ILKTNYLVLVNQLRGLLVQKIPAAIRYPGMNSGHTLLLLAAAVGAFTLLAQASLRPLQL
FT                   TGIAVGVFGRTRLIPIGSDNHILDAHIHADSVPSHRQGENLYLAGHADEITASRVFADR
FT                   DHFGDAPHTLRPLELERTQLGQLQPLAFGVEVLFYMALIELIAHRLRLVAFLKSGILGP
FT                   TGEEVFKRRILVPQFLGMATGGGFAQPRAFRLLQYRQLAAEADSVQRLALRFIRLRSRF
FT                   QRPIPHIAGMAEFNGQLPLLRGRRVKPEFVGPLRYHAAIMPQLSPMAKEYSRAGQLRET
FT                   RIHGETKVMWPSRSPRSKLRTLAGGSSCVHALLQC"
FT   gene            245320..246360
FT                   /locus_tag="Nhal_0234"
FT   CDS_pept        245320..246360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0234"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: noc:Noc_0392 response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13437"
FT                   /db_xref="GOA:D5BUN7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADE13437.1"
FT                   /translation="MAPRTALVVDDSKVARIAISKLLKERNFNVDDAASGEEALEYLEH
FT                   HRPDIVFMDVMMPGMGGLEATRAILSQEATRSLPVVMCTGKEAAADQNFALEVGARDVL
FT                   AKPAGEENLDRVLQALVTDSSAAAATGEVDASERIPTATQGADARGGATTLATQEIVEQ
FT                   AVAEARRASQELAEGIAREVAESVSRQLVEKLVPELAEQVARETAQSVSQEVADKALVA
FT                   AREQAEQKAQATAEAVALKAGQEVMGKAEEAVKAMARSAGAQAVAAFLEQQQAQFRETL
FT                   QKAAEQTVAAAAEKHVASSFSRYAQEQGRALIRQIMEETAQEEAVPKEPSQQSRSGLWK
FT                   WRWGRS"
FT   gene            246851..247702
FT                   /locus_tag="Nhal_0235"
FT   CDS_pept        246851..247702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0235"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: noc:Noc_0393 modification
FT                   methylase HemK"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13438"
FT                   /db_xref="GOA:D5BUN8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN8"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ADE13438.1"
FT                   /translation="MAPHISIASAMELAADRLASTGSGRLEAELLLSYLLEVERSYLHA
FT                   WPEQELTSVQWSCFEQLLQRRAKGEPLAYIRGRQEFWSLDLRVTEATLIPRPETEQLVE
FT                   ETIKRMALEQSLKIADLGTGSGAIALAIGSERPQAQVIGADISAVALAVARENGSRLGL
FT                   ENVTFRRGDWFAPLRGERFDLLVSNPPYIAEGDPHLTQGGLEFEPDTALIAGDRGLEAI
FT                   RHIATGAREHLVEGGWLLLEHGYDQGPLLLELLTTLGYRQVVDFCDLAGVPRVVVGQWR
FT                   AC"
FT   gene            247766..248767
FT                   /locus_tag="Nhal_0236"
FT   CDS_pept        247766..248767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0236"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; Protein of
FT                   unknown function DUF1722; KEGG: noc:Noc_0394 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13439"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUN9"
FT                   /inference="protein motif:PFAM:PF04463"
FT                   /protein_id="ADE13439.1"
FT                   /translation="MSMTPAPLKGETPSPQSLGIPRIRIAVSSCLLGEKVRFDGGHKRD
FT                   TYVTEALTAYFDFVPVCPEVAIGMSIPREPIHIVKTDQGPRVRGIRHRDLDVTDKLRQF
FT                   GEAMAEELEDIDGYILKKDSPSCGMERVRVHGTGGAPSRTGVGMYAQAFMRRRPWLPVE
FT                   EEGRLNDPVLRENFFERVFVHYRWRQMQAEGMTPAALVEFHSRHKFAVMAHSQAVYRRL
FT                   GRLVAKAGSEPIETLAAAYGAELMSALKKCATRRGHANVLMHLLGFLRTQLDKEDRAEL
FT                   LESIENYRLGLVPLIVPITLLKHHFRRHPNPYVNKQYYLNPHPPELMLRNLI"
FT   gene            249201..250397
FT                   /locus_tag="Nhal_0237"
FT   CDS_pept        249201..250397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0237"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   pca:Pcar_0986 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13440"
FT                   /db_xref="GOA:D5BUP0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP0"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADE13440.1"
FT                   /translation="MKSRQIIEEQEGVQALTHHNTVFSQLLKLVPRHEFVVLANQHHEG
FT                   RKLRKMTRWSQFVSMALAQLSGRTSLRDVVSNLSAQARKLYLLGAVPVSRSSLARVNEK
FT                   QPYALYEALFAKLFSRCQGLAPRHGFRFKNKLYSLDASTLDLCLSVFPWAKFRTTKGAV
FT                   KLHVGLDHDGLLPALMTVTNGKVHDITVARTLALPKGSIVVFDRGYTDYDGYHQLNTQG
FT                   IFFVTRQRKKARYRVVERRKVDKSKGLTSDQTLELTGAKARNCPIALRRIGFKDFDTGI
FT                   RYCFLTNNFHLAASTIAAIYKSRWQIELFFKWIKQNLKIKRFLGTSKNAVMTQLWIALC
FT                   AYLLLAYLKFVSKIDCSLQQIIRLLQLNLFERRDLQALLRGDPPEPELLPLQASLQFS"
FT   gene            250541..251083
FT                   /locus_tag="Nhal_0238"
FT   CDS_pept        250541..251083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13441"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13441.1"
FT                   /translation="MLPSNLKGPGETITSLNAEAFISDNSGRYPNLDPDFISQICFEHP
FT                   TRFDSFFPGFNPQEHTALRTERSASWIKGNIRYDNDDDLRFWFKQFDDFRSAGKGSKVF
FT                   EYMIEHRNWSFPPVIVEWRFAQELGAPSYVGRPYYLVEGTHRVSYLLRMLELGLVKETD
FT                   SYQLIVITPNQAMESDT"
FT   gene            251173..252390
FT                   /locus_tag="Nhal_0239"
FT   CDS_pept        251173..252390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0239"
FT                   /product="RES domain protein"
FT                   /note="PFAM: RES domain protein; KEGG: ppg:PputGB1_4795 RES
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13442"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="InterPro:IPR041206"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP2"
FT                   /inference="protein motif:PFAM:PF08808"
FT                   /protein_id="ADE13442.1"
FT                   /translation="MGIAKRMWEEEQDRGYSSNEGKTVCSNCFGEYALKQFIEEHHTHF
FT                   NCSYCEAEGEDIIACELDSLIDHILTSIRYEWGHPADEGLPYETREGGWQVATVYDTWE
FT                   LLDEIGLGNQCGQIYEDICSSIHNQEWCERDPYSLSMDRTLIFGWEKFSDFVKNKARYV
FT                   FFKAKNPDYDEEQHDEMDPVRILDALENIIKQTGLVKSVDVNTQIRRVRIIDPEENLTT
FT                   AKELGSPPSESATMANRMSPAGIPMFYGAFDFDTAIKETYEPCLESKKAICGVFEPVRS
FT                   LSVIDLSDTPYLPSLFDEHARHNRSNLSFLYDFIADFTKPIERNDRVHVDYVPTQIATE
FT                   YIRHIFKTYEGSEIDGVIYPSSKNKGKKAIVIFATSEQCVDQDSSMMSDSTLRLVNVES
FT                   RELEGI"
FT   gene            252499..253041
FT                   /locus_tag="Nhal_0240"
FT   CDS_pept        252499..253041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0240"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein; KEGG:
FT                   ccs:CCNA_02125 polar development protein PodJ"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13443"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP3"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADE13443.1"
FT                   /translation="MENTVWFKRLGATFLLVISVSVWAEDWGRLVIQCGDAGKLRGTQF
FT                   CTYLNELTGCAKNGTTMLDGYQCTKKLADLGNPLAANQLGLWYLQGRVAPQNLSEARKY
FT                   LYFAAVNRLPSAMRRMMQLENMQGNLVRAYAWALIGAAFEDKTSIFYRDEIRAVLTDSK
FT                   RQKAETIASKIFELIAR"
FT   sig_peptide     252499..252573
FT                   /locus_tag="Nhal_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            253328..253657
FT                   /locus_tag="Nhal_0241"
FT   CDS_pept        253328..253657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13444"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP4"
FT                   /inference="similar to AA sequence:KEGG:Noc_0284"
FT                   /protein_id="ADE13444.1"
FT                   /translation="MNTPLAYNVLMFIFVESSAFERVCSVYLNDDEYAELQQYMIRNPE
FT                   AGQVVPGSGGVRKLRWTRQGMGKRGGLRVIYFVRYKPNEFWMLTAYSKAKHDNVPAHIL
FT                   KQLNY"
FT   gene            253670..253984
FT                   /locus_tag="Nhal_0242"
FT   CDS_pept        253670..253984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0242"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: noc:Noc_0283 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13445"
FT                   /db_xref="GOA:D5BUP5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADE13445.1"
FT                   /translation="MSNKLSGKELERFEAQRDVWQEVLESVKEIKAGGGKRRKVEPESD
FT                   VVRIRLKSGLSQAQFASVLGVSKRTLEQWEQGRREPSGAAKTLLKIAERHPEVLRKVAV
FT                   "
FT   gene            254223..254480
FT                   /locus_tag="Nhal_0243"
FT   CDS_pept        254223..254480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfe:RF_0889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13446"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP6"
FT                   /inference="similar to AA sequence:KEGG:RF_0889"
FT                   /protein_id="ADE13446.1"
FT                   /translation="MPEISRFLGIVIYMYYRDHAPPHFHAEYGDYEITVEIERGVVTGK
FT                   FPRRALSAVLEWYLEYKDELLENWRRAEKRQPLQKIEPLE"
FT   gene            254487..254717
FT                   /locus_tag="Nhal_0244"
FT   CDS_pept        254487..254717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amc:MADE_00619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13447"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP7"
FT                   /inference="similar to AA sequence:KEGG:MADE_00619"
FT                   /protein_id="ADE13447.1"
FT                   /translation="MFPHITEAKYIDGYKLWLKFNDGTEGRIDLSSELYGEIFEPLKDI
FT                   NYFRQFSIQGNTVAWENGADFAPEFLREHIT"
FT   gene            complement(254895..255932)
FT                   /locus_tag="Nhal_0245"
FT   CDS_pept        complement(254895..255932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0245"
FT                   /product="helix-turn-helix domain-containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: tgr:Tgr7_2573 transcriptional regulator, AraC family
FT                   with amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13448"
FT                   /db_xref="GOA:D5BUP8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP8"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADE13448.1"
FT                   /translation="MTSSNKGPIETLIVAVPETAGSALYGMVDVLLAAGNIWQTLVRTE
FT                   PEQRLFQVRIVAPTREAFKCGHGIPVAPDFSVADNPKAQILILPELWLGPDEDLHGRYP
FT                   ELMEWICRKYKEGTLLYSACSGTVMLAETGLLDGCEATSHWGYQDLFGKRYPKVRFRPE
FT                   PNLVFADPAGRIVTAGGTTSWHDLAIHIISRHCSPGEALRIAKVYLLKWHGEGQLPYAT
FT                   LVRRNPHADSVVRTCEQWLSQHFRETDAIRQVIELSKIPERTLKRRFKAATGSTLIEYL
FT                   QNLRVEEAKRLLESGAMPVEEISEEVGYEDPSFFRRLFKRLTGLSPSQYRRMFQPVFRA
FT                   SGAIE"
FT   gene            256366..256902
FT                   /locus_tag="Nhal_0246"
FT   CDS_pept        256366..256902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A1359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13449"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUP9"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A1359"
FT                   /protein_id="ADE13449.1"
FT                   /translation="MDRKYGLAPLGAVLLSLGLAAPGSATGDCIPVPVKGKIFNNALGP
FT                   GSTLGTVHIIFGTEKFKCGIRGDGKYRDPEDPHYEGPLNFDHTIVCDDDTGDDFPVHSQ
FT                   LLWDTSGEATIELEDCPNGLQSYSFWEKSWPVPGTGTGRFQGVTGGSITIEGTLFCNLA
FT                   IDMEFSGELCIKAPD"
FT   sig_peptide     256366..256449
FT                   /locus_tag="Nhal_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.530 at
FT                   residue 28"
FT   gene            257644..258233
FT                   /pseudo
FT                   /locus_tag="Nhal_0247"
FT   gene            complement(258328..259176)
FT                   /locus_tag="Nhal_0248"
FT   CDS_pept        complement(258328..259176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0248"
FT                   /product="transfer origin protein, TraL"
FT                   /note="KEGG: noc:Noc_3067 transfer origin protein, TraL"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13450"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ0"
FT                   /inference="similar to AA sequence:KEGG:Noc_3067"
FT                   /protein_id="ADE13450.1"
FT                   /translation="MARAHFTLQGKGGVGKSLVSALIAQHRQENHVPLICVDTDPVNAT
FT                   FSGYTAFSVKRIELLKENTIDEREFDRLMELIAENRDAEVVIDNGASSFIPLSSYLVEN
FT                   EAIDMLQALGHSVVIHPVVTGGQSLLDTLSGFDALASQFPASAEMVVWLNHYFGPIEKE
FT                   GKTFEKMKVFQDHQGRVKGVVTIDRYNQATFGEDVQQMLEDRMTFNQAIESEHFKLMSK
FT                   HRLKIMKKSLFEQMDRVLGVPEKEKPVAAKPAATKSTAKTTTTTAEAAKKRKKTSSTSK
FT                   T"
FT   gene            complement(259188..259553)
FT                   /locus_tag="Nhal_0249"
FT   CDS_pept        complement(259188..259553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_3066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13451"
FT                   /db_xref="InterPro:IPR035225"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ1"
FT                   /inference="similar to AA sequence:KEGG:Noc_3066"
FT                   /protein_id="ADE13451.1"
FT                   /translation="MTLSEELKQRTQARSGQRGDGRQAFLAQRREIARALKDGYPAKTV
FT                   WALLHEKGTMPVQYRTFMEYVNRYLKDCEQPQPTRPPEKPPSPPLSKPKKAVKPAKKPS
FT                   TKRFKFDARGKSKEELI"
FT   gene            259826..260412
FT                   /pseudo
FT                   /locus_tag="Nhal_0250"
FT   gene            260436..261278
FT                   /locus_tag="Nhal_0251"
FT   CDS_pept        260436..261278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0251"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   tbd:Tbd_1967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13452"
FT                   /db_xref="GOA:D5BUQ2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ2"
FT                   /inference="protein motif:PFAM:PF07605"
FT                   /protein_id="ADE13452.1"
FT                   /translation="MVRPLRIEFSGALYHVTSRGDRKEDIYQDDADRKIYLGVLGEVCK
FT                   RFNWVLHAYCLMDNHYHLLVETPDGNLAKGMRHLNGVYTQRFNARHKRVGHVFQGRYKA
FT                   ILVQKEAYLLELARYIVLNPVRARKVRSAKDWPWSSYRATAGLGKGPMWLQSKWILSAF
FT                   SRRKGEAIKRYRAFVSEGKNQPSPWEQLKNQIYLGSESFVEKMQRQLDSEQDLSEVPSA
FT                   QRRPVAKPLEYFSRKYRDRDTAIVQAYASGGYSMKEIGAHFGLHYSRISRIIRAADKT"
FT   gene            complement(261342..262775)
FT                   /locus_tag="Nhal_0252"
FT   CDS_pept        complement(261342..262775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0252"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein; KEGG: tgr:Tgr7_1394 deoxyribodipyrimidine
FT                   photo-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13453"
FT                   /db_xref="GOA:D5BUQ3"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ3"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADE13453.1"
FT                   /translation="MAQPTALVWFRRDLRLGDNPALAAACALGGQVIPVYIDAPEEEGA
FT                   WPPGAASRWWQHHSLAALDSGLKKRNSRLIVRQGPSHKALGQLAEETSATHIFWNRRYE
FT                   PAVIKRDQAIKQQLRAAGLTVKSTNALLLFEPWEIAKNDGMPYRIFTPFWKTCLEKGIG
FT                   RSPFPPPQHLPPVNRQLQSEPLSTLGLLPKIPWDQEFYTHWTPGEAGAWRQWECFLEEA
FT                   LGKYHQERDRPDLPGTSRLSPHLHFGEISPRQIAFQIQIQMDRRAELTAGGQAYLRQLG
FT                   WREFAYHLLYHFPETPEKPLNEGFTHFPWAEDYGEALTAWQQGRTGIPLVDAGMRELWR
FT                   TGWMHNRVRMIAASLLTKNLRIPWQEGERWFWETLVDADLASNTLGWQWVAGCGADAAP
FT                   YFRVFNPVLQGKKFDPEGKYVQQWIPELRKISKQHIHEPWKEARQPLSTPGSVGGQSGA
FT                   WGVRSRNVLFPYDNPKIHR"
FT   gene            complement(262784..263530)
FT                   /locus_tag="Nhal_0253"
FT   CDS_pept        complement(262784..263530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0253"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   tgr:Tgr7_1395 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13454"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADE13454.1"
FT                   /translation="MTKTVLITGAAGGLGHSLEQRLSDKGWQLALVSRDSDRLQSLDRG
FT                   GTALYLTGDVSTAQGAEQIITECVERWGHPPEALAHCAGSTLIVPLHRTPEEQYRACLA
FT                   ANLDSAFYTLKAWIQACLHHKQGGTAVLVSSVAARIGVINHEAIATAKAAVEGLARSAA
FT                   ATYASHGIRVNAIAPGLLRSPATERLFMGGKAEAQIAAQYPLGRYGSTEDAAAAMAWLL
FT                   SDEAQWITGQILPVDGGFSASRPLVR"
FT   gene            complement(263640..264401)
FT                   /locus_tag="Nhal_0254"
FT   CDS_pept        complement(263640..264401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0254"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; KEGG: pin:Ping_3063
FT                   transposase, IS605 OrfB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13455"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ5"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADE13455.1"
FT                   /translation="MTKRAYQERFYPTAEQAELLARSFGCARFVWNNTLKHRTDAFYQN
FT                   GEVIPHSALEKRLVQLKQDFSWLNEVSSVTSDGFKSGNPKYTKQYEAKLAYLQGKLAKK
FT                   RKGSRNRNKLRLKVARLHTKIADCRRDATQVVCVESLAVKNMIKHPRLAKPIADANWGE
FT                   FVRQLKYKAQWVGRTVVEIDRGFPSSKRCPTPGCGHINKTLPLEVREWSCPSCGTVHDR
FT                   DIAAAINIKTAGLAGLASGATGTGATTGVVA"
FT   gene            complement(264587..265531)
FT                   /locus_tag="Nhal_0255"
FT   CDS_pept        complement(264587..265531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0255"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: aeh:Mlg_2255 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13456"
FT                   /db_xref="GOA:D5BUQ6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ6"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADE13456.1"
FT                   /translation="MASSKSQEGTPEALYPIREVALRTGVNPVTLRAWERRYGLIKPRR
FT                   TPKGHRLYSEADINLVHRIVTLLSSGLAISQIRPLLEKPETASEIGEAMATTTWKEQAE
FT                   ALLEAIRHFNENAIDAIYHNAFSLYPTELTLRRLLQPMLDNLRQDRERLELGAAEESFF
FT                   KNYLKYRLGARIQQQNPRNSGPRLLFACLPNDHSEMELLLNAFVIVSHNYRALLLGENV
FT                   PLAQMTQAANKARCQGVMLQGNVAPTPHIIESELPELVQKLSVPVFIMGQTAARFEYEI
FT                   SAQGAIPLPMDFHPLLEKLNTQLAHQDYSPQTN"
FT   gene            265742..266515
FT                   /locus_tag="Nhal_0256"
FT   CDS_pept        265742..266515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0256"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: noc:Noc_0362
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13457"
FT                   /db_xref="GOA:D5BUQ7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ7"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADE13457.1"
FT                   /translation="MNDQQLLRYSRQILLPQIDIEGQRKLLNARVLVIGVGGLGSPVAL
FT                   YLAGAGVGQLTLVDPDQVELSNLQRQILHDSEAIGLPKVESARRRLQDLNPEVEVRAVA
FT                   DRLEGEDLEAAVAQADVVVDGSDNFATRFAVNIACVRAGRPLVSGAAIRMEGQVAVFDS
FT                   RRPEGACYHCLFREGEENEETCSQTGVIAPLLGIIGSVQAMETLKLLLGIGQSLQDRLL
FT                   LFDALGMHWREIRIRRDPQCPICNDFQDRSQELAK"
FT   gene            266512..266916
FT                   /locus_tag="Nhal_0257"
FT   CDS_pept        266512..266916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0257"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="PFAM: Mov34/MPN/PAD-1 family protein; SMART:
FT                   Mov34/MPN/PAD-1 family protein; KEGG: noc:Noc_0361
FT                   PAD1/JAB1 superfamily metal-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13458"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ8"
FT                   /inference="protein motif:PFAM:PF01398"
FT                   /protein_id="ADE13458.1"
FT                   /translation="MTEVMLPRTMVNQLLHQAQASSRREICGLIGARNGTPSNCYPVNN
FT                   IAPDPQRQFFMDPQGQIEAMRRMREGGEELFGIYHSHPETPPLPSKSDLAQAAYPDALY
FT                   LIISLNTKGVLEMRGFRLQGEAYKEIELQL"
FT   gene            266985..268322
FT                   /locus_tag="Nhal_0258"
FT   CDS_pept        266985..268322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0258"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   tgr:Tgr7_2264 microcin-processing peptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13459"
FT                   /db_xref="GOA:D5BUQ9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUQ9"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADE13459.1"
FT                   /translation="MSLPENQEPATLKLMAEEVLNEARALGATAAEVGIDAQTGLSVSV
FT                   RLGEVETVAHHRDKRLRITLYFGHRKGSASTSDLRPAALQETVRGAASIARYTAADPCS
FT                   GLAEPELMARDIPELDLCHPWGLSGEEAIAVARRCEEAGRSFDNRIVISEGAELSTRQG
FT                   YRVYANSHGFLGGYASTRHSLSCVLVARTEAGMQRDYWYTRARDWREMEPAEAVGIKAA
FT                   RRTVARLDPRRLPTGAVPVLFAAEVASRLFAHFVAAIGGGALYRRSSFLLDHLGKQIFP
FT                   SFVRLHEQPHLPKALGSAAFDNEGVATQARDIVTDGVLQGYVLGSYAARKLGMKTTGNA
FT                   GGVHNLTVDPGQHDQSALLKQMNRGLLVTELMGMGVNLVTGDYSQGAAGFWVDKGEIQY
FT                   PVSEITLASNLRDMFLGIGEVGTDMEMRGNIRTGSVLIDGMTVAGE"
FT   gene            268447..269202
FT                   /locus_tag="Nhal_0259"
FT   CDS_pept        268447..269202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13460"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR0"
FT                   /inference="similar to AA sequence:KEGG:Noc_0360"
FT                   /protein_id="ADE13460.1"
FT                   /translation="MKKLLTLSLLGGFLLGNVTYPLLTGYMSADLILGDETFPALRVWD
FT                   FTDRLINTRLFVSNTARSEGDTPAFFYTQIPPGVSGAHSPIASAVRSEGSAEAVGGFFY
FT                   SETEGPGPAFGSNSFAATYSGAPAIGLEVNGLNFSGDPGVPVRGMDIVNGGNAATQWAL
FT                   GIETSNNQPEGKPKIGIMLAGSAHGFFHAPASESGIVVDHIDSGEAIRIQAGDHISFNN
FT                   EGTVSMKYNPETNQIEFYNKDELKFAIPM"
FT   sig_peptide     268447..268497
FT                   /locus_tag="Nhal_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.364 at
FT                   residue 17"
FT   gene            269410..270132
FT                   /locus_tag="Nhal_0260"
FT   CDS_pept        269410..270132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0260"
FT                   /product="protein of unknown function DUF533"
FT                   /note="PFAM: protein of unknown function DUF533; KEGG:
FT                   noc:Noc_0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13461"
FT                   /db_xref="InterPro:IPR007486"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR1"
FT                   /inference="protein motif:PFAM:PF04391"
FT                   /protein_id="ADE13461.1"
FT                   /translation="MSFGNIVGRLLQGMAGQSRSRLEHTASSQGLGGLMDIAQDFLSNK
FT                   QAGGMTGGQLGSLGALAGALLGGGGSAAKGAAGGSAMAILGALAAKALQNKQNAQPSST
FT                   NLTSGAQPLPQEEMEALTAPQTERLVIRAMITAAKSDGQLDQKEMDSIFGKINTDGVTD
FT                   EERRLVMDELSRPMDLQALVSSVPNEAVAAELYAASLFAIDIDTEAERIYLRQLAQALE
FT                   LDAGTVARLHQLTGSPPV"
FT   gene            complement(270203..270709)
FT                   /locus_tag="Nhal_0261"
FT   CDS_pept        complement(270203..270709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0261"
FT                   /product="Alkylated DNA repair protein-like protein"
FT                   /note="KEGG: pat:Patl_0448 2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13462"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR2"
FT                   /inference="protein motif:COG:COG3145"
FT                   /protein_id="ADE13462.1"
FT                   /translation="MENINSEPRLIHLYQFNQRMQPIKASTGCLDYTHAVQSYMKVVLP
FT                   DAELLLLPKFFSSNEADLYLEVLRTKVTWTQEQIKLYGKTYDVPRLTAWYGDVGKIYTY
FT                   SGIRTVAMPWTAPLLEIKSAIEQASLAPFNSVLLNYYRSGLDGVSWHSDDEPELGKNPI
FT                   IASVS"
FT   gene            complement(270754..271335)
FT                   /locus_tag="Nhal_0262"
FT   CDS_pept        complement(270754..271335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13463"
FT                   /db_xref="InterPro:IPR041494"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR3"
FT                   /inference="similar to AA sequence:KEGG:Maqu_2987"
FT                   /protein_id="ADE13463.1"
FT                   /translation="MIWGFVDYENVGSLEGFSLLDYERVFLFCGPKNTKIKLGELPSTE
FT                   FCRIELIGIKTIGANNLDFHIAFHVGRLHESAAKDIEFHIITNDTGFNGLINHLKKIDR
FT                   PCKRISTKNKVINANYSIELSECANLVVSRIKQIDGRKRPRKKPSLINWINSQCKHMNS
FT                   EVSAEKIYEELRLSGNISVGTSGVTYHLKH"
FT   gene            complement(271346..271444)
FT                   /locus_tag="Nhal_0263"
FT   CDS_pept        complement(271346..271444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13464"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13464.1"
FT                   /translation="MAKEAEQENEPNNNIFYNPVFDRWRCAPLAST"
FT   gene            271764..272210
FT                   /locus_tag="Nhal_0264"
FT   CDS_pept        271764..272210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13465"
FT                   /db_xref="GOA:D5BUR5"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13465.1"
FT                   /translation="MYTLLLLITIVLLGAYFLRDQIPIRFFQQHERQAAGVTAVATFLS
FT                   GVLLIAGVSGFEPRLGILISMLGLLTWIAKQHPDTVLHALEGLGSYWNPFTHRLFSPLL
FT                   GWPLFLMGLVIATPPALWIDLIGVVIIYGIAVVYAQQDKSKIEP"
FT   gene            complement(272234..273952)
FT                   /locus_tag="Nhal_0265"
FT   CDS_pept        complement(272234..273952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0265"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG: noc:Noc_0358
FT                   Cl-channel, voltage gated"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13466"
FT                   /db_xref="GOA:D5BUR6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR6"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ADE13466.1"
FT                   /translation="MFNPKTTLENLRIRVASVEALPQLSLLGLLTGLLAGAITVAFRLV
FT                   VDIGQIILLPEHQVDDFESLSWIGRLLLPILGGLGIGLLQEIAHTYRTVGVVHVLERIA
FT                   YYQGRLPWRNTLQQFVTAALSIICGHSVGREGPSVHLGAASGSLLGQWLELPNNALRTL
FT                   VACGIAAAIAASFNTPLAGVIFSMEVIMMQYQLAGVAPIILAAVVGAAIAWAVFGPSPA
FT                   FSVPPTEMQSLLDLPYLVLIGLAVGILAAAYNRLLHFFSGLGSSRPVWQRCTAAGLLVG
FT                   LCGIAVPEIMGLGYDTVNTTLLGQLGLGTLIAITAAKLLATTACVGLGIPGGLIGPTLV
FT                   IGTAAGGALGIIGTALLPQEASPPALYAMVGMAAMMSATLQAPLAALVALVELTADPHI
FT                   LFPGMLAVVVANLVARELLRQEALFLMLLRARGLDYHYAPTSLKLRQAGVASVMDRRFV
FT                   ELPVTIDRETAAQTLTKNPRWVLVKQAFRPISVMQGIDVARALNEETQDPLNLMEIPAA
FT                   REDIQPVPFHATLQEALEILNTSHAKMLYVERRIGPTSVRIYGVLSRQEIESYYG"
FT   gene            complement(274294..274509)
FT                   /locus_tag="Nhal_0266"
FT   CDS_pept        complement(274294..274509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0266"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   noc:Noc_1108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13467"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR7"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ADE13467.1"
FT                   /translation="MNNTYRAILERDGDWYIAYCPEVPGASGLGHTKEEARESLATAIV
FT                   LILENHRENALRELLDDAEQDAITVA"
FT   gene            complement(275316..275651)
FT                   /locus_tag="Nhal_0267"
FT   CDS_pept        complement(275316..275651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0267"
FT                   /product="PemK family protein"
FT                   /note="PFAM: PemK family protein; KEGG: cak:Caul_3898 toxin
FT                   ChpA"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13468"
FT                   /db_xref="GOA:D5BUR8"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR8"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADE13468.1"
FT                   /translation="MAYVPNRGDVVWLDFNPQAGHEQAGRRPALALSPLAYNRKVGLAI
FT                   FCPITNQTKGYPFEVVIPDGYQVTGVILSDQIKNLDWKNRSCRRVCVLEAAIVKDVLKK
FT                   LSVLLQT"
FT   gene            complement(275656..275898)
FT                   /locus_tag="Nhal_0268"
FT   CDS_pept        complement(275656..275898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0268"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: pnu:Pnuc_1108
FT                   transcriptional regulator/antitoxin, MazE"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13469"
FT                   /db_xref="GOA:D5BUR9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUR9"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ADE13469.1"
FT                   /translation="MKIQIQKWGNSLAVRIPKSFAQEVHMDQGTIVDLALEKGQIIIRP
FT                   VVEPQYSLNELLSKVTKENIHSEADTGEPQGKEIW"
FT   gene            complement(276138..277076)
FT                   /locus_tag="Nhal_0269"
FT   CDS_pept        complement(276138..277076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0269"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: noc:Noc_2934 N5-glutamine
FT                   S-adenosyl-L-methionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13470"
FT                   /db_xref="GOA:D5BUS0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS0"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ADE13470.1"
FT                   /translation="MSTPLENQVQQQLHTLRDFIRWGASRFNEAGLFFGHGTDNAIDEA
FT                   TTLVLHALHLPPQNLPAEFFGAHLTEREKRQILTLLERRIRERIPAPYLTHEAWFAGLS
FT                   FYVDERVLIPRSPLAELIEQRFTPFVSPERVHTLLDLCTGSGCIAIAATYAFPQAQVDA
FT                   TDISQEALAVARLNIERHGLQDQVHTLPSNLFEGLKERRYDLIVSNPPYVGETELASLP
FT                   KEYHHEPRQALEAEDEGLSLVLQILLQAPDHLNEQGILIVEVGNSEAALTRRLPEVPFL
FT                   WLEFERGGYGVFLLTREQLINVKEAILKHCY"
FT   gene            complement(277088..278497)
FT                   /locus_tag="Nhal_0270"
FT   CDS_pept        complement(277088..278497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0270"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   noc:Noc_2935 isopropylmalate isomerase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13471"
FT                   /db_xref="GOA:D5BUS1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS1"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ADE13471.1"
FT                   /translation="MAGKTLYDKLWDSHVVRTDPGGTALLYIDRHLVHEVTSPQAFEGL
FT                   RLAGRKPWRKGANLAVPDHNVPTTDRSQGIQDPISRAQVEALDRNCQELGLTEFRMDDP
FT                   RQGIVHIVGPEQGATLPGMTVVCGDSHTATHGAFGALAFGIGTSEVEHVLATQCLLQRK
FT                   SKNMLIQVNGKLAPGVYSKDLILAIIAQIGTAGGTGYTIEFGGETIRDLSMEGRMTLCN
FT                   MAIEAGARAGLVAVDETTIDYLKGRPFAPSSPYWDQAVDAWRTLQSDPDAHFDRVVTMD
FT                   ASTLKPQVSWGTSPEMVVSIDGQVPDPQQEPDPTKRTGMERALEYMGLKANTPISAIQP
FT                   DIVFIGSCTNARIEDLREVAQVVAGHKVAGNIKQALVVPGSGLVKRQAEEEGLDQIFKE
FT                   AGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGQGGRTHLVSPAMAAAAAIA
FT                   GHFMDVSTLKH"
FT   gene            complement(278530..281796)
FT                   /locus_tag="Nhal_0271"
FT   CDS_pept        complement(278530..281796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0271"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   noc:Noc_2936 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13472"
FT                   /db_xref="GOA:D5BUS2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS2"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADE13472.1"
FT                   /translation="MDYASSSQGGLIGLFTRHRVAANLLMLTMIVSGMWALSQLNRQFF
FT                   PNFALEVINVSVVWRGASAEDVSRSITERLEEELRTLDRLKKLTSTSAYGLSTLTLEYH
FT                   EGTDMGVALDKVKEQIGQIRDLPLDSESPETSLVSRYENIARVLVTGPEDPRELRQLVH
FT                   TFERDLLNRGIAKVDIVGLPQQEIAIQIPVAHLHELEMSLDQVAERVANISRDLPAGTI
FT                   GRNDVARQLRSLEQRRDSLAFADIPLKAEADGRLIRLGDVGTIERRPRDGETRLLYQGK
FT                   PAVELQLQRAESGDSLQGAEILAQWLQEVRPTLPAGIELNVFNQSWELIKERIGLLLKN
FT                   GGGGLILVTGILFLFLNGRVAGWVAIGIPVSFLATLAVLWAAGGSINMISLFALIMALG
FT                   IIVDDAIVVGEDALTQHQKGLPPLPAAEEGARRMLLPVLASSLTTIAAFLPLMMIGDVT
FT                   GNILFDIPMVVICVILASLIESFLVLPGHLRHSFERIKEHREGKVRRFLNQAFERFRDR
FT                   LFRPLALLAIGHRWTTISAALGLLLVALGLLLGGRINFTFFPSPEGIVIFANTSFVAGT
FT                   PPQRVAAFITELEQALYETEAAFGQDLIAASTVKLGSTTTAGGRATRNGDRFGLVAVEL
FT                   ISPDRREIRNQEFIRAWKGRIELPPGIESFTLTEQQTGPPGQDLDIALVGEDEMTLKSA
FT                   AVELADVLRKTPGVSAVEDDLPYGQEQLVYRLTAEGESLGLTVEDVGRQLRSAYEGRLV
FT                   QIFQDGGDEIEVRVTLPDDERHSLASLTHLAIQLPNGSTAPLDTVVDLKSRRGFDVLRH
FT                   TQGKLAVHVSGTVDRTLNNSNRILADLERSLLPELRSRYGIQTIFEGRAEEQRDTLGDM
FT                   QRGVLLALALIYLILAGVFSSYGWPLVVMTAIPLGLVGAILGHYVMGIDLTILSLFGFF
FT                   GLSGIVVNDSIILVTFYKQLREQGQPYNEALVEAACQRLRAVLLTSLTTIGGLTPLLFE
FT                   RSLQAQFLIPMAVSISFGLMFATVLVLLVIPALLSLYESTLARLKPSREAATPHRAASE
FT                   IGLDSLSSGDYTPINDDELEQHKQGKMRKISAENAGSRQQ"
FT   gene            complement(281797..283047)
FT                   /locus_tag="Nhal_0272"
FT   CDS_pept        complement(281797..283047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0272"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   noc:Noc_2937 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13473"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADE13473.1"
FT                   /translation="MPARSKVVKIALPIIILLASLGIFAGLLQSKPTKPAVDQEETVWR
FT                   VAVTQVNPSQRRPTLPLYGRIETPRSSKLRAAITADVREVKAKEGDFVSGGQLLVQLDE
FT                   REAKLELAQRQADLEEIQALIASEKVRHRRDLKALEHEKALLELSRRALERAKTLEQRK
FT                   LTPRSALDEAQQAAERQALELNTRLLAIDDHQARLAQLEARQLRAQALLVQAKLDLDRT
FT                   QISSPYTGRIASVAIAAGDRVQAGNDLLEIYDTDALEVRAQIPSGYVGQIRKALAQNEQ
FT                   LQATGTVNGTPLTFLLDRLAGRVEKGSGGVDGLLKLEEAGHTLPLGNFVELQLQLPPVE
FT                   NVVALPFEAIYGLDRVYKLVEGRMRAVAVERIGEYQNQEGQIRVLVKSPQLHQDDRVIT
FT                   TQLPNAMEGLRVETVAG"
FT   sig_peptide     complement(282955..283047)
FT                   /locus_tag="Nhal_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.626 at
FT                   residue 31"
FT   gene            complement(283365..283568)
FT                   /locus_tag="Nhal_0273"
FT   CDS_pept        complement(283365..283568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13474"
FT                   /db_xref="GOA:D5BUS4"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13474.1"
FT                   /translation="MIYLLIFYLSFAFVLYFVARKKGREPVFWAGLGFFFGPFALIPLL
FT                   FSQPPRDSKKLPRKKKSGKRVA"
FT   gene            complement(283622..284731)
FT                   /locus_tag="Nhal_0274"
FT   CDS_pept        complement(283622..284731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0274"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="KEGG: noc:Noc_2938 chorismate synthase; TIGRFAM:
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13475"
FT                   /db_xref="GOA:D5BUS5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS5"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADE13475.1"
FT                   /translation="MSGNTLGKLFTVTSFGESHGPALGCIVDGCPPGLALCETDIQTDL
FT                   DRRRPGKTRHTTQRREPDQVRILSGVFEGKTTGTPIGLIIENIDQRSRDYDKIKEQIRP
FT                   GHADYTYLQKYGLRDYRGGGRSSARETAMRVAAGAIAKKYLAERYGIGIRGYLAQLGPI
FT                   RIERLDWDAVEQNPFFCPDPDKVPELEAYMDALRKEGNSIGARINIIATGVPPGLGEPV
FT                   FDRLDADLAHALMSINAVKGVEIGAGFSAITQKGTEHRDPITPEGFLSNHAGGVLGGIS
FT                   TGQDILASIALKPTSSLRLPEHTVNTRGEPVEVITTGRHDPCVGIRATPIAEAMVALIL
FT                   MDHLLRHRAQNMDVKPELSPVPPHPGGTD"
FT   gene            284937..285155
FT                   /pseudo
FT                   /locus_tag="Nhal_0275"
FT   gene            285124..285435
FT                   /locus_tag="Nhal_0276"
FT   CDS_pept        285124..285435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13476"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13476.1"
FT                   /translation="MTATSQRRSISKPPGWRGWPLERLERGRQQALSPREGVLNEESSW
FT                   SDPTTLARQGGEKSDLVRVSIYSSSALRALVKRLATERLMTNDLFLDLKFALPVITGN"
FT   gene            285459..285674
FT                   /locus_tag="Nhal_0277"
FT   CDS_pept        285459..285674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13477"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13477.1"
FT                   /translation="MRGREVDVQHVLQVPDEIRRSRSDPAVFLFYRLERPGRWLCAVVK
FT                   RLNGEGFLITTYPTDAIKEGEQIWSR"
FT   gene            285662..285874
FT                   /locus_tag="Nhal_0278"
FT   CDS_pept        285662..285874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13478"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13478.1"
FT                   /translation="MEQVKVFHDRTGNTLTVWFGDPQDEYICEETGDEVILMKDRTGRV
FT                   IGFEKLNFSVSTSEQLRVLFETVSM"
FT   gene            complement(286001..286079)
FT                   /pseudo
FT                   /locus_tag="Nhal_0279"
FT   gene            complement(286194..287051)
FT                   /locus_tag="Nhal_0280"
FT   CDS_pept        complement(286194..287051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0280"
FT                   /product="CHRD domain containing protein"
FT                   /note="PFAM: CHRD domain containing protein; SMART: CHRD
FT                   domain containing protein; KEGG: noc:Noc_0158 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13479"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUS9"
FT                   /inference="protein motif:PFAM:PF07452"
FT                   /protein_id="ADE13479.1"
FT                   /translation="MNILGGTSNDGISFDTLAADFSQPGYALARITITGPGDKLFNFAL
FT                   GGNQEVPAVDTEASGSCVGILRGDQAAFTANCNHNVDDLTAAHIHPAPPGVNGDILFPF
FT                   TSPESPIQQTFSFTEEDVATLLAGNFYVNVHSEDFPAGEIRGQITVPINGTFSGSWFNP
FT                   DRDGEGFIFEATHRDNPTLVAYWFTYQPSGDNGEQAWLIGNGPIRLNESTITNTIITEG
FT                   AEFGDGFDPSEVNQTPWGTLKFTFTSCTTAIVEYDSVIEDFGAGTLRIQRLTPALIGQE
FT                   EDCP"
FT   gene            complement(287208..287825)
FT                   /locus_tag="Nhal_0281"
FT   CDS_pept        complement(287208..287825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13480"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT0"
FT                   /inference="similar to AA sequence:KEGG:Noc_0158"
FT                   /protein_id="ADE13480.1"
FT                   /translation="MKKLSLSSSPLFRAMPLASLALGAGFSIAPHAQAVEVTVTIENLS
FT                   PSNGLFLTPVWVGFHNGNFDIYDLNTPASSALEQLAEDRNNDPLSAEFMASEPDGTDAT
FT                   ITESSRILGPFDPGSRARQTFDLNPATNRFFSYATMVIPSNDAFIANANPQAHELFDAE
FT                   GNFIGPITFTVLGTQVRDAGTEANTETDAAFFDQTAPNTNFM"
FT   sig_peptide     complement(287721..287825)
FT                   /locus_tag="Nhal_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.826 at
FT                   residue 35"
FT   gene            complement(288105..288665)
FT                   /locus_tag="Nhal_0282"
FT   CDS_pept        complement(288105..288665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13481"
FT                   /db_xref="GOA:D5BUT1"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13481.1"
FT                   /translation="MLTNGVGAQTPDENQKTGKATPPSDLLEEFVKEERAAEEHPTKMT
FT                   SRAVPPNKNSILELPVPMPDLWDKKTIQYYLGAVRGGLEYRINGYKHRQEVFEWQLFSS
FT                   QVIFWVVIMLVFTGMYFAAVQFHRGGSGKKRAREEDSGETEFVASLKGFKVKSPVLGVV
FT                   ILVISLAFFYLYLSHVYPIREIF"
FT   gene            complement(288739..289602)
FT                   /locus_tag="Nhal_0283"
FT   CDS_pept        complement(288739..289602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13482"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13482.1"
FT                   /translation="MITLRFFTPLLSLLFIFLVGCIALNAQAQQRTFELKDTVKQPLVL
FT                   QPLLPHRSLQHPSIVAPFSITPTPGDRQVYQLTVDTSGRLIVHANWPSTIALALILNGP
FT                   GQTGYYARKDGPSPLTIDFEITPELLEKGNQWKLSVVNFKGQGPPTVGRISLSLPKSTA
FT                   STASPEAIVERTIQPDGSVLIKYADGTRKHMYRGGVDLTRPDGTVQRSSFIEVQVANLP
FT                   DFPTEGQTVIWLQAHNDNLLNIIQALVDNDETAIQNYLAHEGEERPLYEKINKRTRAIQ
FT                   WLTSGQ"
FT   sig_peptide     complement(289516..289602)
FT                   /locus_tag="Nhal_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            289836..291065
FT                   /locus_tag="Nhal_0284"
FT   CDS_pept        289836..291065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abo:ABO_1043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13483"
FT                   /db_xref="GOA:D5BUT3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT3"
FT                   /inference="similar to AA sequence:KEGG:ABO_1043"
FT                   /protein_id="ADE13483.1"
FT                   /translation="MFFLFLQSFKTYLAIAWGTFAPGGKGLSWRRALVMMAFLPVFGLL
FT                   QGLHWLGFLFDEIFFRGYRKVSVSQPLLVLGPPRSGTTLLHRVLARDPQFTTFTTWECL
FT                   FAPSVTQRRFWLALGRLDRLAGWPLGRLLGRLERRVLGGLEAIHATRLDAPEEDYLILL
FT                   PLMACFILVLPFPFAEPLWRMGFFDRAMGAKEKERLLDYYRRCWQRHLYVHGPDKRLLS
FT                   KNASFGPWVGSLLTAFPDARILCCMRDPLETVPSQLSSIRSGIQLFDSSGGRAALPQRM
FT                   IEVLVFHYENLLQVLESLPPHRRLFLPMENLRSNLGREIGAAYGQLGIPFNPEFRRILD
FT                   HEDSAARCYSSQHAYSLAEFGLDSEIIQRRFRAYYAWHETFMAASLAVKAINTIPTSSH
FT                   NKVIKEVAVC"
FT   gene            291059..292192
FT                   /locus_tag="Nhal_0285"
FT   CDS_pept        291059..292192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0285"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   abo:ABO_1044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13484"
FT                   /db_xref="GOA:D5BUT4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE13484.1"
FT                   /translation="MLMASASPAIQTPHFVEQQRALRVVIFSDAAPERNGVGAYYHDLI
FT                   AHLEDQIGHGELICPDSSTHGWRGWLRFPLPGDATQEIALPPVSRIVRHVIQFKPHAIV
FT                   IATPGPYGLLGLGLGKHLGTRILIGFHTRYERLTGLYWNRLFNAASRSYFGACNRLLFR
FT                   HGAVVLANSEDMAEVARREGAREVEVVGTPLSREFLKTPPAVLGGELTRVLFAGRLAAE
FT                   KNVQAVLEAAKLLPSLEFCIAGHGPLHGVIVDHARTLPNLRYLGWLSRAGLRTALDSAD
FT                   LLVLPSHEEAFGTIALEGLARGRNVLVSVGCGILGWPSLERGLFRIREGEHLASAIQRL
FT                   VSLDYGLRNEKARLGRQAAVQLNGRTLQRWVDILGRA"
FT   gene            292192..292896
FT                   /locus_tag="Nhal_0286"
FT   CDS_pept        292192..292896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abo:ABO_1045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13485"
FT                   /db_xref="GOA:D5BUT5"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13485.1"
FT                   /translation="MVKEHSIPALVSVHDAMPETLAHVLKVLAFLEARAIAPVTLLVVP
FT                   GGSWAAAGIETLRGLQERGVVLAGHGWSHRVERIGGLRHRLHSLLLSRKAGEHLALESH
FT                   AIAHLIARCYAWFREHRLGSPDLYVPPAWAMGCLKWERLRTLPFRYYEVFGGVYDARAD
FT                   RFIRLPLVGYEADSLGRVPPLRLWNALNLRCAGSIAPLRVAIHPRDLALPLSQDLTRLV
FT                   DRPLACRTYGSL"
FT   gene            complement(293023..295251)
FT                   /locus_tag="Nhal_0287"
FT   CDS_pept        complement(293023..295251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_02894 fibronectin type III
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13486"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13486.1"
FT                   /translation="MTVLPNGTPYLFLSGVPATEEKPEQFLDSYQLQKAKTITLTPIDF
FT                   PPIPPQRTCLESYDPQTGLLSDSCPKKTQNTTDPAAPKVTWVTPADLKQPKKSDQLSVR
FT                   LKWQWTEKEQARFKANKFNIYQIINPDSKTPNVCQTQKTPPASYQIGKMNITSATSYQL
FT                   EPQPLTLMAGDTVSYYYFCITTVSHNIDDDNDGKRDEDPKGDDNADGCPGRCGIDDDGD
FT                   GQIDESVAMDDDEDNDQLLKDGIDNDRDGRIDEPGEGIDEDPYESESVPSLPLLAYMVD
FT                   KIPPQLPQAPCEISWAEITGTQLTNGVIEADSQQAPNWEGKLSVRLDWSKFSSKLASDI
FT                   KGYNLYRGIDQPTGEYIRLNRHLIDNTVYVDYLEATAKNKFYYRLQAVDKAGNESDKSE
FT                   ATCAIVLPDKIPPKPPVIVNVSGGNEAIKIIWESSSSSDVAEYHLYRGETRSQVEFQTQ
FT                   DKKNRINVSLITPLGPENKISYVDGPALKARKDYYYIVEAVDKKGNQSYSLPAAGRAYD
FT                   INPPAPPSSLSATLKLLPPKVAAQENAWVKLTRITPPKAKDGGTFPVNIEIQFKNNHLE
FT                   KLSIAEDLRAPFNLESGDLYGEWFDIPTGKLLRLNYELRVSQGTLPGQHTVALNTLEAI
FT                   PLGQPPIAIKMTSTMDVVSTPVSEVSILLTWQLDEAQVRTAVWRCEDSGCTHEGGNWKM
FT                   IAPLLLADDSDYEDVNITQGKTYYYKLQAYDKLGNKGAFSKVVEVEAK"
FT   gene            complement(295336..296172)
FT                   /locus_tag="Nhal_0288"
FT   CDS_pept        complement(295336..296172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13487"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13487.1"
FT                   /translation="MGRDSALIALFIALTLGLISCAPPPEPRLAIKTLVVENKETQGIV
FT                   VKLRWSLDKEKFTGKDRYRFPECGFTLYRKEEDSAQPSSTVFKPLGTFSLPQSKSELIS
FT                   RLQQIKDEAIKYRLLSPEGLKEEGNHLWQAIEVSQTGKQHPFPAEPMDLLTLAAINPDM
FT                   AQVLGLLYVDTAVARGKKYTYKLVGAWDQTPGGGISCKSGPANEVVTDPPVETTPEGPL
FT                   NTPLWVDIKKDTPLKQLRYITFDKPEQQVTVFWDKPTGTKQKPPSFVPEGPVVRLR"
FT   gene            complement(296172..296312)
FT                   /locus_tag="Nhal_0289"
FT   CDS_pept        complement(296172..296312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13488"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13488.1"
FT                   /translation="MNTSALIQDAKNRISALTFVSETAIMQLPAPIIDVEIKELTFTRK
FT                   P"
FT   gene            complement(296384..296638)
FT                   /locus_tag="Nhal_0290"
FT   CDS_pept        complement(296384..296638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13489"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13489.1"
FT                   /translation="MEATNTKIGGPNIVSTQPLTAYQPLSIKQPDTDFIVVNTPEPLPW
FT                   SHNKLKVTLKDAANNTIPIERLTPDHGTQHVFIRQDKKT"
FT   gene            complement(296638..297039)
FT                   /locus_tag="Nhal_0291"
FT   CDS_pept        complement(296638..297039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13490"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13490.1"
FT                   /translation="MEKNITAENKYYCFRTGPAPLDLTPYIAWTNPIADAKNIFYGDDL
FT                   MVLFNTAGMKALYNYKAPKFIIYTQNGKALGKGELTLNEQLLHISGTDLIKAGIKPRKR
FT                   YFVRIQDPYSNCLPIHSNLPPPNINLSAP"
FT   gene            complement(297047..297832)
FT                   /locus_tag="Nhal_0292"
FT   CDS_pept        complement(297047..297832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13491"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13491.1"
FT                   /translation="MRISFDITLKEKEPGIGDIPSFPHPLRSVELTFPQGNLSKNKHSI
FT                   KLEEGKIKNIPLLNPRFVSTFHRPITGELPINSPPFNKQPVSKDVLPFGGWKKATPQAW
FT                   VDQVGQFQAWYRFRYRTFKEFEEPQELLTCGAEGGRNVAIKGYWGSVYQDDPGNAWNTE
FT                   KQLIMEKPAVGKKETLAPSDHPVNQRRRQLYAWHATALPYPGGIPLTDAIFEQEDLIIT
FT                   DPPKALKPNTFYQIKLVARHDWYWPKTNQTGGSRPYPVY"
FT   gene            complement(297877..298656)
FT                   /locus_tag="Nhal_0293"
FT   CDS_pept        complement(297877..298656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13492"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13492.1"
FT                   /translation="MIDTNNDGIYEGYKNWDKLCDDDAYAFIVGLTLGTSSDNGYVVNA
FT                   DTSLLIETSGPVITLDGRGWILQNRFDRGEPTKPSNVYALTRYDGHQNIFLMQVSGFYQ
FT                   VESKGLTLIKLSGGFEILASPPEWHVYLGWKGYECQGPPPRQRTEKKLEVNILSLFDAQ
FT                   GYFMVGSMTPFPKAKDCRPAIMLGAGFDYGKEIDAKIVTIYAQSWGSGDLAISWHPTQT
FT                   FAAFGLGGKLGFSLFGIDFGRGFDANAQGQYPTQQNS"
FT   gene            complement(298640..299776)
FT                   /locus_tag="Nhal_0294"
FT   CDS_pept        complement(298640..299776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13493"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13493.1"
FT                   /translation="MGINTPIKVHHPIIDHHGLTGAINAPITQKVSLGGFSADSAQFNA
FT                   IFVRNTLKDTHLSVDLEIFNGKARGLLAFDIKGHWSAKLGPMPSEDLVKVCFPTSCSDA
FT                   PGAIPHIRLNLEELRLGHKKEQGPLVLTVDGKVSLQKLVGKVPGFGDLDCPPKKADSDY
FT                   SGCGLDFSGYQITFSSPGKMNPPEGLGGWVNIGQFKEKSFYGFNFNIRKIGFGTLAGFQ
FT                   GFEKQGWFGIGGNFALGDEFGIGVTLNELRFKWGSPAGSGCQLGPWSGVCLEIPNIDIE
FT                   VNKQVVKLKGALAWHDGGLGNQNFKGAIEATFPSLEFSVGATLYIGQAKTAAQQCQYWY
FT                   FDAQTQFPTGIPIASNVSIYGFMGGGGLPCTFQIDRYQ"
FT   gene            complement(299909..300589)
FT                   /locus_tag="Nhal_0295"
FT   CDS_pept        complement(299909..300589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13494"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13494.1"
FT                   /translation="MKIKSIYLFYFFIAFISIINPQQAEASNSSPIQITVPFHLFSSNG
FT                   QAATFNINPVSKPEDGSDTFSIIQVPHNRRILEIPGFPLFRVILGDTPLGTDAFFSALM
FT                   YPSVNYFQIQLSGSICLGFPKAILKPVSAPKHTALCQSNELELQFGRAVNTPKSINDFP
FT                   DLAEGFLEFNAVMDFNTGEFYLTGIDLPEVDIFGLGLTMSASNIALDLSDFFNPWEVLD
FT                   PPMT"
FT   sig_peptide     complement(300509..300589)
FT                   /locus_tag="Nhal_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.459 at
FT                   residue 27"
FT   gene            complement(300629..301657)
FT                   /locus_tag="Nhal_0296"
FT   CDS_pept        complement(300629..301657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_4326 penicillin-insensitive murein
FT                   endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13495"
FT                   /db_xref="GOA:D5BUU5"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13495.1"
FT                   /translation="MPPGQEPKKNYHTPHILRVGSVHSEEARYKAEVKCLQKRLEELGF
FT                   KSGVVKQITEKIEVNDLEKTVKNLKYHPYSDRNFSTATTNTPGLYDNDEALAVWQFQGL
FT                   AMCQASTGALPRLPSRCTSKIFGKIRYKAKQVDKTTVKILNATNSNPFWKWAQFQPQQC
FT                   APPHSTQKCLWRKKWKQPQVEWGTKALVEVLQNAAKALNQASASSTANYRGIEIGDISY
FT                   PTGGSVTGHGSHERGIDVDINTRALCADGTTQYGAIEYWQTAPCPYDQAYMEVLLKALA
FT                   AQKYVDKLLFHDPAFLPGGARYNNIPASDRKKITCSKYQQHTPCPGNSHTHHIHMRLKW
FT                   EN"
FT   gene            302159..302536
FT                   /locus_tag="Nhal_0297"
FT   CDS_pept        302159..302536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0297"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: tgr:Tgr7_1925 putative transcriptional
FT                   regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13496"
FT                   /db_xref="GOA:D5BUU6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU6"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADE13496.1"
FT                   /translation="MEIAIFVFMNIEPVSFFAALGHGTRLRCLLLLLSHEELCVCELTY
FT                   ALGVAQPHISRHLAQLRELGLVVDRRAGLWIYYRVNPDLPDWVFRVLRETAQGASDHEP
FT                   FTSDRTALAAMPNRPGATHCA"
FT   gene            302628..303134
FT                   /locus_tag="Nhal_0298"
FT   CDS_pept        302628..303134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0298"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: mes:Meso_4199 protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13497"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU7"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ADE13497.1"
FT                   /translation="MADQVFNVLFLCTGNSARSIIGECLINRWGQGKFRGYSAGSHPKG
FT                   EVHPLALEVLRRQHYSTESLRSKSWDEFAQPGAPAMDFVFTVCDNAAAEQCPTWPGQPI
FT                   TAHWGVPDPAAVEGDPVERMMAFRQAFRELENRIKIFVNLPFDSLDTLKLQKKLEEIGQ
FT                   TELGE"
FT   gene            303378..303947
FT                   /locus_tag="Nhal_0299"
FT   CDS_pept        303378..303947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: transcriptional coactivator"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13498"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13498.1"
FT                   /translation="MKSNEAAVLIHASAVANGGVAFTLANTALGDTMLVTGLTLYMVRR
FT                   LGKIYGVEDVAAKQIIGQCAAYYAGPYLTGKLLFWLPGVGNWANAATTVLLTETIGWTC
FT                   VSLFSSGRKPEDLSDDEWSDILKTAKKKAEEEQQKNKILLQKMTSEEKKEIKTIAKKLK
FT                   DESIPDEEKEKLLESLKAFYKDIKNR"
FT   gene            complement(303962..304579)
FT                   /locus_tag="Nhal_0300"
FT   CDS_pept        complement(303962..304579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0300"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: noc:Noc_0157 HylII"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13499"
FT                   /db_xref="GOA:D5BUU9"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUU9"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADE13499.1"
FT                   /translation="MQKGEKFNSISHLVGAIAATVGSVVLVVLAARQSDPWKIVSFSIY
FT                   GVTLCSLYIASTLYHSSLGKTRRFFRKLDHHTIYLLIAGTYTPFTLVTLRGPWGWSLFG
FT                   IIWGLAILGIVLDSLPNEGRRILPVVIYLLMGWLALIALDPLMQALPWAGFIWLLAGGL
FT                   FYTIGIIFYALGNKLDYAHGIWHLFVLAGSFTHYFAILLYVV"
FT   sig_peptide     complement(304487..304579)
FT                   /locus_tag="Nhal_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.838 at
FT                   residue 31"
FT   gene            complement(304693..305871)
FT                   /locus_tag="Nhal_0301"
FT   CDS_pept        complement(304693..305871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0301"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: noc:Noc_0156
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13500"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV0"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ADE13500.1"
FT                   /translation="MIVWDVVIIGGGAAGLMCAIEAGKRRRRVLILEHSNRVGKKILMS
FT                   GGGRCNFTNLHVTPDNFLSANPHFCKSALARYSPWDFMALVERHGIAYHEKELGQLFCD
FT                   QSSKLIVKMLVAECQQAGVQIDVGCKITMVQKTAAGFALETSLGPIQTTALVVASGGLS
FT                   IPKMGATGFGYELAKRFGHRIRATRPALVPLTLNGETLAQYRDLSGIGLLVEASCHNRC
FT                   FPGGLLFTHRGISGPAILQISSYWQPSDELQVNLLPGIEVSAWLTDRQHNRPDAELRTV
FT                   LTEKLPKRLAQRLCELAFDNLPLRQYPPQELQAMAKQLQHWRFHPQGTEGYRTAEVTLG
FT                   GVNTDELSSATMASKKVPGLYFIGEVVDVTGHLGGFNFQWAWASGHAAGQVV"
FT   gene            complement(306052..306549)
FT                   /locus_tag="Nhal_0302"
FT   CDS_pept        complement(306052..306549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13501"
FT                   /db_xref="GOA:D5BUV1"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV1"
FT                   /inference="similar to AA sequence:KEGG:Noc_0155"
FT                   /protein_id="ADE13501.1"
FT                   /translation="MKTKPLPLWSWIFIVTILWIGFVLAISFMEAPIKFQAPSLTLPVA
FT                   LEIGYLVFHALNFVEITCAALIIAATYFGQPSRKTTLFAAGVVALLIIQTLLLFTKLDA
FT                   RTLAIINGQEVSSAPYHIVYMGIEVIKLLGLVVLAFNQLHDFKSLALKLSGQNLESPRH
FT                   AR"
FT   sig_peptide     complement(306472..306549)
FT                   /locus_tag="Nhal_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.654 at
FT                   residue 26"
FT   gene            complement(306605..307090)
FT                   /locus_tag="Nhal_0303"
FT   CDS_pept        complement(306605..307090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0303"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: vei:Veis_4651
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13502"
FT                   /db_xref="GOA:D5BUV2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADE13502.1"
FT                   /translation="MIQKLHHNAYRCRDSEETRSFYEDFLGLPLAGALEIKETKSGRKT
FT                   HALHTFYELDDGSYLAFFEAPDRPFEFKPQHDFDLHIALEVDTAALHEMFAKGKAQGIE
FT                   TRGVVDHGFVHSIYFRDPNGYVIELTAKTPEHDRMMDPATNGARAILDQWQAEKSQG"
FT   gene            307574..308716
FT                   /locus_tag="Nhal_0304"
FT   CDS_pept        307574..308716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0304"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   aav:Aave_3565 cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13503"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV3"
FT                   /inference="protein motif:PFAM:PF02353"
FT                   /protein_id="ADE13503.1"
FT                   /translation="MSNQRQTPYHLSSSDNLYGSHGLPPCEGKKLASIATTIAINLTEQ
FT                   ARIPDVFIRYGIRGLLRKRLGEIQADDCEAVADTKRAFIEQMNKGPIAALPEKANEQHY
FT                   EVPPAFFEYVLGQHLKYSCCYWDEGVRTLGEAEAAALTITCERAQLEDGLRILELGCGW
FT                   GALSLWMAALYPRSTITAVSNSHSQSHYIRQRAEQFGLSNLEIITADMNDFSTQERFDR
FT                   IVSVEMFEHMRNYRWLLARIHHWLKPSGKFFMHIFCHRDVPYAFEDQGPSDWMGRYFFS
FT                   GGMMPSDDLPLHFQEHLRCIKHWRWDGRHYERTANAWLDNMETHKDLLLPILAEVYGQE
FT                   ASHQWWMRWRIFFMACAELFGYEQGQQWWVSHYLFDRPAK"
FT   gene            308739..309146
FT                   /locus_tag="Nhal_0305"
FT   CDS_pept        308739..309146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13504"
FT                   /db_xref="GOA:D5BUV4"
FT                   /db_xref="InterPro:IPR021306"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV4"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_C6579"
FT                   /protein_id="ADE13504.1"
FT                   /translation="MAVLINLFAFQVGWLACVLGGAYQLPWLGTTLAAIFVGLHVAMTR
FT                   APRRELRLILLAGVIGTVWDSFLVTMGWLHYPSGTFMVGMAPHWIIALWMLFACTLNVS
FT                   LRWLKGRWWLATASGALAGPLPITLPLDLAG"
FT   gene            309149..309307
FT                   /locus_tag="Nhal_0306"
FT   CDS_pept        309149..309307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13505"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13505.1"
FT                   /translation="MPELMQALSVLAVGWAVLLPLLARFSMRFDGIGQGAAGLAYGPHA
FT                   KGSIHHV"
FT   gene            309300..310077
FT                   /pseudo
FT                   /locus_tag="Nhal_0307"
FT   gene            310074..311102
FT                   /locus_tag="Nhal_0308"
FT   CDS_pept        310074..311102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0308"
FT                   /product="Stearoyl-CoA 9-desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /note="PFAM: fatty acid desaturase; KEGG: sml:Smlt2374
FT                   putative fatty acid desaturase (membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13506"
FT                   /db_xref="GOA:D5BUV6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV6"
FT                   /inference="protein motif:PRIAM:1.14.19.1"
FT                   /protein_id="ADE13506.1"
FT                   /translation="MTPETAMEINPMSDRKQDILASRYEVARFRPVRQRRWWSLLRWFD
FT                   SSLTTGLQEGDGTRIDGIRVLPFLLLHLSCLGVLWVGWSPTAIAVAVALYGIRMLAVTA
FT                   FYHRYFSHRAFKTSRGAQFVFALLGASAVQRGPLWWASHHRHHHRYADQKQDSHSPLQE
FT                   GFWWSHMGWFLSRANFPPKLKAVPDLVRYPELRFLDRFDALVPALLALSLYGVGEGLGA
FT                   MTPELGTNGLQLLVWGFGISTVVLYHATFTINSLAHRFGSRRYATSDNSRNNFWLALLT
FT                   FGEGWHNNHHYFPGAVRQGFRWWEIDFTYYFLRLLAATGLIWDLKQLPAKSRGGWSGTA
FT                   RS"
FT   gene            311153..312349
FT                   /locus_tag="Nhal_0309"
FT   CDS_pept        311153..312349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13507"
FT                   /db_xref="GOA:D5BUV7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV7"
FT                   /inference="similar to AA sequence:KEGG:GSU2327"
FT                   /protein_id="ADE13507.1"
FT                   /translation="MKIAVIGTGIAGNVAAYYLSQEHDITVFEANDYVGGHTHTHDIEL
FT                   DGRPYAVDTGFIVFNEWTYPHFIRLLKTLGVEFQPSPMSFSVKCERTGLEYNGTTLNTL
FT                   FAQRRNLLRPAFYRMIRDILRFNREALQLLEVGDDHLSLGQYLAEQGYSQPFIEHYIIP
FT                   MGAAIWSADPVQMHAFPAHFFVRFFHNHGMLSVNHRPQWYVIKGGSQRYVERLTAPFRD
FT                   RIRLKTPVVSIRRYPGSVKITTAGGHIDHFEQVFLACHSDQALALLADASPLEREILRA
FT                   IPYQENEAVLHTDAAVLPRQRLAWAAWNYHILRQNRGRVAVTYNMNILQSLPAPSPLCV
FT                   TLNYTDAIAPERILRRMRYHHPVYTPGGVAAQCSAAPWGNQWAPAHLFLRGLLALWVS"
FT   gene            312406..312996
FT                   /locus_tag="Nhal_0310"
FT   CDS_pept        312406..312996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0310"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; KEGG:
FT                   ppd:Ppro_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13508"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV8"
FT                   /inference="protein motif:PFAM:PF07103"
FT                   /protein_id="ADE13508.1"
FT                   /translation="MHSCIYLGQVRHRRFQPVEHQFQYRLFQMYLDLDELPELFDPYWL
FT                   WSSRRPALAWFRRRDHLGGARLPLAEAVRDGVQQQTGHRPKGPIRLLTHLRYWGYGFNP
FT                   VSFYYCFAPDGSQLEAIVAEINNTPWGEQYSYALEVRDSPGNFGHLRFEFSKCFHVSPF
FT                   MPLEIRYRWHFTTPGPRLAVHMENWKAGHKIFG"
FT   gene            complement(313017..313735)
FT                   /locus_tag="Nhal_0311"
FT   CDS_pept        complement(join(313017..313457,313457..313735))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Nhal_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13509"
FT                   /db_xref="GOA:D5BUV9"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13509.1"
FT                   /translation="MNCPRCGGTHIVKNGSNGVGTPKFLCKVCGRQFVEDPKNCSITQE
FT                   TKELIDKLLLERIPLAGIVRVTGVSERWLQYYVNDKYAHTPRRVEIKKKSRARLTLECD
FT                   ELWSFVARKGNKQWVWLAFDRDTQEVVGVYIGDRSQTGAQGLWQSLPAVYRQRAVSYTD
FT                   FWEAYEAIFPGPRHRSVGKETGQTSHIERFNCTLRQRVSRLVRKALSFSKKLENHVGAI
FT                   WYFVHHYNATLCPTTRS"
FT   gene            313813..314010
FT                   /pseudo
FT                   /locus_tag="Nhal_0312"
FT   gene            314007..315311
FT                   /locus_tag="Nhal_0313"
FT   CDS_pept        314007..315311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0313"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ppd:Ppro_0127 cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13510"
FT                   /db_xref="GOA:D5BUW0"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW0"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADE13510.1"
FT                   /translation="MSTKYFPKETPSYYRSQPLGWLERGARKAVLSRLAGLRQGQLVVK
FT                   EKDQIHTFGRRSRHFPLRATVTVHDPRFYRELAFGGSIGAGEAYMQGYWSCNDLTSAVR
FT                   ILLRNQAVLEGMETGLARLSAPLHKLFHWVHRNTQKGSRRNIAAHYDLGNALFALFLDK
FT                   TLMYSCAVFEHPQMSLEQASMAKLDRICKKLVLTPQDHLLEIGTGWGSLALHAARHYGC
FT                   RVTTTTISEQQYQFACQRVREAGLEDRIRVLQQDYRDLTGQYDKLVSIEMIEAVGQAYF
FT                   DAFFQKCSQLLKPEGLMLLQAITIADQRFAEFSRSVDFIQRYIFPGSCIPSVAVMTDSV
FT                   ARVTDMRLFHLEEIGPHYATTLRYWRENFLANLAQVQALGYSETFIRMWEFYLCYCEGG
FT                   FLERATGDVQMLFTKPLCRRAPILPSLAPPTERAA"
FT   gene            complement(315691..316722)
FT                   /locus_tag="Nhal_0314"
FT   CDS_pept        complement(315691..316722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0314"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   noc:Noc_1856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13511"
FT                   /db_xref="GOA:D5BUW1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW1"
FT                   /inference="protein motif:PFAM:PF07605"
FT                   /protein_id="ADE13511.1"
FT                   /translation="MTQARSLQISLVDTPYYHCVARCVRRAFLCGVDDFSGRNYEHRRQ
FT                   WIVDKLKRLSSIFAIDICAYAVMSNHYHVVLRVDEDTAGHWEDADVIERWTTLFSTPVL
FT                   IQRYLKGETTTAAEITKVGEIVALWRERLTDISWFMRCLNESIARRANKEDGCKGRFWE
FT                   GRFRSQALLDDSAVLACMAYVDLNPIRAGLADCPENSDFTSIQARLRQYADTLKPEEPD
FT                   TADPVTEQPLDLLPFIGGAHLDAPSGIAFALPDYLQLVDWTGRAVREDKHGAIPADVQP
FT                   IFHRLGLNESQWLETVQHFGQRYRLAAGAAERLQTMGQRLGRCWLQGVGFSRRSYRPAA
FT                   VPG"
FT   gene            complement(316790..317038)
FT                   /locus_tag="Nhal_0315"
FT   CDS_pept        complement(316790..317038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0315"
FT                   /product="transposase mutator family protein"
FT                   /note="KEGG: ppd:Ppro_0139 transposase mutator family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13512"
FT                   /db_xref="GOA:D5BUW2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW2"
FT                   /inference="similar to AA sequence:KEGG:Ppro_0139"
FT                   /protein_id="ADE13512.1"
FT                   /translation="MTSIEKKTDELLDELLKECNSPKEVLGEHGLLKQLSKRLVERVLE
FT                   AELTEHLGYAPHAQEGRGSGNSRNGKSKKRVQSEAGQ"
FT   gene            complement(317076..317480)
FT                   /locus_tag="Nhal_0316"
FT   CDS_pept        complement(317076..317480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_02566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13513"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW3"
FT                   /inference="similar to AA sequence:KEGG:VIBHAR_02566"
FT                   /protein_id="ADE13513.1"
FT                   /translation="MELDEAREILNALANGVDPVTGEVLPETSPYNEPKVIRALFTVLN
FT                   SLKGKRQPKKTLEEKQQENIAAGRPRNAGLPWTDDLKGELAEKFQSGVALDELARYFER
FT                   TRGAILSELAKQGFIEQAEVDELGGVQITV"
FT   gene            complement(317914..318201)
FT                   /locus_tag="Nhal_0317"
FT   CDS_pept        complement(317914..318201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0317"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: ppd:Ppro_3843
FT                   addiction module antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13514"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW4"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADE13514.1"
FT                   /translation="MRVKWTRPASTDLKHLQYHIAQDNPHAAFRVASLIREQTGRLSEH
FT                   PYSGRPGRVEGTRELVVSGTPYVVAYRIREGNVDILAVIHGARKWPEAFE"
FT   gene            complement(318198..318455)
FT                   /locus_tag="Nhal_0318"
FT   CDS_pept        complement(318198..318455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0318"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: mlo:msr2423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13515"
FT                   /db_xref="GOA:D5BUW5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW5"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADE13515.1"
FT                   /translation="MKEGVFTVRIDPEKQKQLDAIAQQLDRSRNYVVNQAIEEFLDTHA
FT                   WQVEHIRAGLDAAEQGAFATDEEMEAIFNRYRPEEGTPER"
FT   gene            complement(318458..318621)
FT                   /pseudo
FT                   /locus_tag="Nhal_0319"
FT   gene            complement(318630..318950)
FT                   /locus_tag="Nhal_0320"
FT   CDS_pept        complement(318630..318950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0320"
FT                   /product="PemK family protein"
FT                   /note="PFAM: PemK family protein; KEGG: noc:Noc_A0033
FT                   PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13516"
FT                   /db_xref="GOA:D5BUW6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW6"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADE13516.1"
FT                   /translation="MNRGEVYWVNLDPTQGSEIRKQRPCVLVGATPINKARRTVIVVPL
FT                   STSAKPNPPLTIPIQCLNRQIVAVCDQIRAIDKTRLLKSAGRLSKEDMKAINEGLRQVL
FT                   VL"
FT   gene            complement(318937..319170)
FT                   /locus_tag="Nhal_0321"
FT   CDS_pept        complement(318937..319170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_A0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13517"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW7"
FT                   /inference="similar to AA sequence:KEGG:Noc_A0034"
FT                   /protein_id="ADE13517.1"
FT                   /translation="MQKVLFSLPDDLVTRMRASIPSKQRSKVIACLLEQEIQKREQALY
FT                   ECALKVEADETLKEEMKDWEATQGDGIENESW"
FT   gene            complement(319233..320387)
FT                   /locus_tag="Nhal_0322"
FT   CDS_pept        complement(319233..320387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0322"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1;
FT                   nucleoside:H symporter; KEGG: noc:Noc_2803 MFS family
FT                   nucleoside/H(+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13518"
FT                   /db_xref="GOA:D5BUW8"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADE13518.1"
FT                   /translation="MSTETPAPPYWRLSGFYLFYFATLGALLPYWSLYLQSLGFTPQKI
FT                   GELMALLMATRILAPNVWAYIADHSGKRMIIVRIASLLAVLAFSAVYLNHSYWALAGVM
FT                   VTFSFFWNGTLAQVEVTTLTHLGKKTHHYSRVRLWGSIGFILTAALLGSLLDHAGMDLL
FT                   PAVILTLMAGIWVMSLTVPESNTPHHPPHHGPLWRVLQKPEVLTFFVAAFLMQASHGPY
FT                   YTFYTIYMEGYGYSRGLIGSLWAIGVIAEVGLFLGMHRLLPALGARWMLLGSLLLASLR
FT                   WLLLGLYPSLLPLMVFAQLLHAATFGAFHAAAIDWVHRHFTGPHQGRGQALYSSLGFGA
FT                   GGAFGSFYSGHLWTLEPKGAYLAAALIGITAFCLAYPTIDRPSK"
FT   gene            320450..320752
FT                   /locus_tag="Nhal_0323"
FT   CDS_pept        320450..320752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13519"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13519.1"
FT                   /translation="MRLAHATCRLVRAVEQRATDRILLTVFAEILVIELKGWQIGTFII
FT                   KEGILYQYKSLGVGQDLTGRGILQQLHCYLICNSQNGGLDHGDKKNHHCGRRPGR"
FT   gene            320706..321641
FT                   /locus_tag="Nhal_0324"
FT   CDS_pept        320706..321641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0324"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: noc:Noc_2802 malate dehydrogenase,
FT                   NAD-dependent; TIGRFAM: malate dehydrogenase,
FT                   NAD-dependent; PFAM: Lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13520"
FT                   /db_xref="GOA:D5BUX0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX0"
FT                   /inference="protein motif:TFAM:TIGR01763"
FT                   /protein_id="ADE13520.1"
FT                   /translation="MAIRKITIVGAGRVGEATAQFLAKNELCRELVLLDVQEGVAQGGA
FT                   LDIQQSAPLFNFDTRVTGSTDYELIADSDLVVITAGKPRKPGMSRSDVLDSNLPIITDI
FT                   MNQVMRFAPQSLVMMVTNPVDVLTYHAWRHCGWNRTRVFGQAGVLDSARMASFISAETN
FT                   LSVKDISAMVLGGHGDTMLPLIRYTTINGIPLTHFLDQQTIEKIIERTRHGGFEILRLR
FT                   QTSSAYDAPAASIAAMVDAIRHNRKRILPCVAILQGEYGEDEVAMGVPSVLGEDGLERI
FT                   VELSLTEEEQAQFKRSVEAIRADLAHITKA"
FT   gene            321868..322659
FT                   /locus_tag="Nhal_0325"
FT   CDS_pept        321868..322659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0325"
FT                   /product="putative hemolysin"
FT                   /note="KEGG: tgr:Tgr7_2736 putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13521"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX1"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2736"
FT                   /protein_id="ADE13521.1"
FT                   /translation="MELAHSPREVFTRTRTSRLSLSLAKNRCEVREAQRLRYRIFAKEM
FT                   GARLDSPEFGLDRDYFDDFCQHLLVRDTGTGEVVGCYRILTDWQAVNAGGFYSETEFEL
FT                   EQILALPGRFMEVGRTCIHPDYRNGATIMLLWSGLARFMTMNGVDHLIGCASIPMSAGG
FT                   AEALSVFDQLREKYLSPPHLRVVPRLPLPRTDTASRPGAVVPTLLKGYLRLGAEICGEP
FT                   CLDRAFNVADVFVLLRSANINRRYLRHFTNPSPGRDRVGIL"
FT   gene            complement(322956..324314)
FT                   /locus_tag="Nhal_0326"
FT   CDS_pept        complement(322956..324314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0326"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE
FT                   intracellular region; CBS domain containing protein; MgtE
FT                   integral membrane region; KEGG: noc:Noc_2801 divalent
FT                   cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13522"
FT                   /db_xref="GOA:D5BUX2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX2"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADE13522.1"
FT                   /translation="MLQPLSPERNNERLNALVAALESGRMVRLRRLLSSLHPAEVAHLL
FT                   ESLPPPTRHLAWQLVGAGHRGEVLSYVGDEVRSDLMSDIAVEDLASLMEDLDPDDLADI
FT                   LRDLPETVVEQVLQTMDAQNRRRLETVLSYPEDTAGGLMNTDTITIRGDITLDVVHRYL
FT                   RLLGALPEATDSLFVVDRDDNYQGVLLLTTLLTRKRELTVAEVMSHGVENIPVSLPTAQ
FT                   VAQRFEKRDLISAPVVDEEGKLLGRITIDDVVDVIRDEADHSLMSMAGLTEDEDTFAPV
FT                   LLSLRRRSLWLGINLITAFLAAWVIGLFEATIQKQVALAVLMPIVASMGGIAGSQTLTL
FT                   VIRAMALGQLSQSNTRWLLSKELTLGVLNGLLWALVIGIVAATWFKGAELGILIGAAII
FT                   INLIFAALSGVVVPLFLRRIGADPALAGGVLLTTITDVVGFMAFLGFATLYLI"
FT   gene            complement(324460..326208)
FT                   /locus_tag="Nhal_0327"
FT   CDS_pept        complement(324460..326208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0327"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region; KEGG: noc:Noc_2800
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13523"
FT                   /db_xref="GOA:D5BUX3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX3"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADE13523.1"
FT                   /translation="MTLELHGIGVSRGIAIGKVHILSRDQPEVNEYFLPLNLIENEVQR
FT                   YQAALSTAKAQLQSIQEQIPDNIPTDIASFINTHLLMLEDKALAIVPIDLIQNRHCNAE
FT                   WALKLQRDALASVFDEMDDPYLRTRKNDVDHVVNRILRILTNQESPRHEVSGGRLKGYI
FT                   LLADDLTPADIVLMQQQQISGFVTEHGGANSHTSILARSLGIPAIVGLRGARRYVQDDE
FT                   LLIIDGEQGILLAGVDAFLIEKFREKRLAQQRRLAALTALRSQPAITLEGQPITLEANI
FT                   ELPEDLPLVADSGAEGIGLYRTEFLYMNRTTPPDEEEQLSAYTRVVEALGGAPVTIRTV
FT                   DLGADKTVDGGRLNTPVATNPALGLRAIRLCLREPGLFRPQLRAILRTSAQAPVRLLLP
FT                   MICTLQELTQVMMLLEDCKRELKRQGLKYDPALPVGAMIEVPATAICADIFARHLDFLS
FT                   IGTNDLIQYTLAIDRIDDEVNYLYDPLHPAVLQLIHHTIVAGEKTGTAISMCGEMAGDP
FT                   RYTRLLLALGLRDFSMHPASLLEVKRVITESNQQKLTEVSQQFLECYDLSEMQALLDQI
FT                   NEDLPN"
FT   gene            complement(326273..326542)
FT                   /locus_tag="Nhal_0328"
FT   CDS_pept        complement(326273..326542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0328"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: noc:Noc_2799
FT                   phosphoryl transfer system, HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13524"
FT                   /db_xref="GOA:D5BUX4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX4"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADE13524.1"
FT                   /translation="MTQNEVTIINKLGLHARAAAKFVTLASRFKSEIRIQRGTKEVNGK
FT                   SIMGVMMLAASQGTRLCIMASGPDEEEALQQLKTLVNERFGEHE"
FT   gene            complement(326529..326945)
FT                   /locus_tag="Nhal_0329"
FT   CDS_pept        complement(326529..326945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0329"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: noc:Noc_2798 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13525"
FT                   /db_xref="GOA:D5BUX5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX5"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADE13525.1"
FT                   /translation="MTVGVLIITHDNIGSSLLDTTNDMLGSCPLQIQILPVTRASHPDA
FT                   LRERARELIHSLDTGHGVLVLTDMYGSTPSNIACYAADAQHAQIVTGLNLPMLIRVLNY
FT                   PRLSLTELTEKAISGGREGVCACFTTMRKQDDTE"
FT   gene            complement(326942..327790)
FT                   /locus_tag="Nhal_0330"
FT   CDS_pept        complement(326942..327790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   noc:Noc_2797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13526"
FT                   /db_xref="GOA:D5BUX6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX6"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ADE13526.1"
FT                   /translation="MKLLIISGVSGSGKSIALHALEDQGFYCIDNLPVYLLPVFAQKMQ
FT                   QDDAQQLRAAVGIDARNLPQELQQFPQILEDIENVGAHCHIIFLDASDATLLKRFSETR
FT                   RKHPLNNIPLAEAIRHERELLEAIAEKADLRIDTTCTTVHQLRDLISERVGDGARTGMS
FT                   LLFQSFGYKHGVPLDADFVFDVRCLPNPYWEPHLRPLSGRDQEVIAYLERHEAVAQMRQ
FT                   DLITFLQHWLQRFQETNRSYLTVAIGCTGGQHRSVYLTEQLTAHFHSAHSRVLCRHREL
FT                   S"
FT   gene            complement(327838..328386)
FT                   /locus_tag="Nhal_0331"
FT   CDS_pept        complement(327838..328386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0331"
FT                   /product="HPr serine kinase domain protein"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   noc:Noc_2796 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13527"
FT                   /db_xref="GOA:D5BUX7"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX7"
FT                   /inference="protein motif:PFAM:PF07475"
FT                   /protein_id="ADE13527.1"
FT                   /translation="MSSPNEDNVTGHGVLLVIFDSGVLLRGESGVGKSSLALELIRRGH
FT                   RLIADDAPLFQRASATQLMGSCPSVLQDFLTVPGLGVVDIRAIYGSQAIAAQHPIDLVI
FT                   HLIPNKHIEPLTRSLGQWEQLNVKVPELTLPLGGNLQPATMIETAVQDYQLRSKGYDAL
FT                   LELQQRQQKLLNPSPPRHK"
FT   gene            complement(328402..328884)
FT                   /locus_tag="Nhal_0332"
FT   CDS_pept        complement(328402..328884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0332"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: noc:Noc_2795
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13528"
FT                   /db_xref="GOA:D5BUX8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX8"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ADE13528.1"
FT                   /translation="MQITELLIPEQIAVGAVAGSKKRVLERLSELLARGTDDLDSTDVF
FT                   DCLLARERLGSTGLGDGIAIPHARMAGNQHTLAAFVRLDQGIDFDALDQQPVDLFCALL
FT                   VPEESAQIHVQLLAQLAEMFRDPELCTRLRQAKDPHNLLEVLKEWEQTSAPTGIVD"
FT   gene            complement(328898..329224)
FT                   /locus_tag="Nhal_0333"
FT   CDS_pept        complement(328898..329224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0333"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   noc:Noc_2794 sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13529"
FT                   /db_xref="GOA:D5BUX9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUX9"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADE13529.1"
FT                   /translation="MQVNLTGHHVEITQALRSYVENKCERLERHFDQLTNIHVVLSVEK
FT                   KRQKAEATLHVSKANVFASAEDEDMYAAIDDLVDKLDRQIKKHREKLTDHRRSEGVMKK
FT                   QQQG"
FT   gene            complement(329251..330699)
FT                   /locus_tag="Nhal_0334"
FT   CDS_pept        complement(329251..330699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0334"
FT                   /product="RNA polymerase sigma-54 factor, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor; KEGG: noc:Noc_2793
FT                   sigma-54, RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13530"
FT                   /db_xref="GOA:D5BUY0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY0"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADE13530.1"
FT                   /translation="MKTSLQLRLGQQLTMTPQLQQAIRLLQLSSLELQTEIQQALESNP
FT                   LLEQSESEEGQESLDTDEVREAITPEGNELNASLGEAIPDELPVDSSWNDIYDSLPLPA
FT                   ASGDESLPDLENQGNREETLQEHLLWQARLVATNEKDLAIATAIIDSINEEGYLCSTLE
FT                   EIQQSLGEDIEVEPGEVEVMLHQIQNFDPPGAGARDLGECLLLQLKQYPPGTPWLEEAT
FT                   LLLSQHIATLGKRDYAQLMRAMKLSEQELGATIHLIQSLNPRPGTQIQPSKTEYVVPDV
FT                   YVTKQSNSWHVELNPDIAPRLRVNTQYASLIRRADDSLTNSYLKNQLQEARWFLKSLHS
FT                   RNETLLKVACCIVECQQGFLEHGEEAMRPLVLHDIAEAVSMHESTISRVTTNKYMHTPR
FT                   GIYELKYFFSSHVATNSGGECSATAIRALIKKLIAGEEPRKPLSDSKIAQILSEQGIKV
FT                   ARRTIAKYRENLNIPPSNERKRLI"
FT   gene            complement(330767..331492)
FT                   /locus_tag="Nhal_0335"
FT   CDS_pept        complement(330767..331492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0335"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: noc:Noc_2792 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13531"
FT                   /db_xref="GOA:D5BUY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE13531.1"
FT                   /translation="MSRLSAYHLAKCYQSRWVVRDVSLELSSGEVVGLLGPNGAGKTTC
FT                   FYMLVGLISIDKGLISLDHHEITRYPIHRRARLGISYLPQEASVFRKLTVAENIMAIAE
FT                   TRSDLTKPARRQLVDELLHELNITHVKNTLGMSLSGGERRRVEIARALAVEPQFILLDE
FT                   PFAGVDPISVLDIQGIIRQLTERGIGVLITDHNVRETLGICQYAYIVNEGEVIAKGQPQ
FT                   EILNNERVKEVYLGYNFHL"
FT   gene            complement(331506..332333)
FT                   /locus_tag="Nhal_0336"
FT   CDS_pept        complement(331506..332333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0336"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; SH3 type 3 domain
FT                   protein; KEGG: noc:Noc_2791 OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13532"
FT                   /db_xref="GOA:D5BUY2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY2"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADE13532.1"
FT                   /translation="MSRHLGLKLATLWLIFGGLNGETAWALSSDQEQPIHIEADRGELD
FT                   DRKQIAVYRGNVHLTQGTLRIDSDILTIYYTPGKKLEKAIAEGQPAWYRQRPDNSDEDI
FT                   RAKALRMEYHANTATIYLLQKAHVWQGANEFTGDRIVYETEHDIVRGEGSKTGDGRVHV
FT                   TIRPDNSNTPGSEPTPESSTPIPAEPEPPENQEGDNQALNPELAHGRTTTWLNLRTGPD
FT                   TDYSKAALLPPRTPITILERQAEWLHISTLAEGESIEGWVHADFIRLLNGHGE"
FT   sig_peptide     complement(332253..332333)
FT                   /locus_tag="Nhal_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.533 at
FT                   residue 27"
FT   gene            complement(332311..332754)
FT                   /locus_tag="Nhal_0337"
FT   CDS_pept        complement(332311..332754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0337"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   noc:Noc_2790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13533"
FT                   /db_xref="GOA:D5BUY3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY3"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ADE13533.1"
FT                   /translation="MEEFTLTLMDQEGLPLYRLEGTHMVHYPATDTVEVTAPHAVFYHQ
FT                   VVPRWEVVAERGLTNSQGDEIYLLGEVVIRQFGADAKTNKMKILTQDVRVEPRAEYAET
FT                   NQPVTLLNNLGKTHAVGAQVYLKEERIELLSQVRGDYEPAPRP"
FT   gene            complement(332882..333403)
FT                   /locus_tag="Nhal_0338"
FT   CDS_pept        complement(332882..333403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0338"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: noc:Noc_2789 phosphatase KdsC"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13534"
FT                   /db_xref="GOA:D5BUY4"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY4"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ADE13534.1"
FT                   /translation="MQEVFARASAIKLVIFDVDGVLTDGGLYLSDDGQEYKVFHSRDGH
FT                   GMKMLQYTGVRIGIITGRTSQVVNHRMENLGITHVYQGQQVKLPAYEHLLEKLNLQPHE
FT                   TAYVGDDVVDLAIMQRVGLAIAVQDAHPLVKQHAHWITPKPGGRGAARDACELIMEAQG
FT                   TLEAQLEKHY"
FT   gene            complement(333425..334441)
FT                   /locus_tag="Nhal_0339"
FT   CDS_pept        complement(333425..334441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0339"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: noc:Noc_2788 sugar phosphate isomerase
FT                   involved in capsule formation, KpsF/GutQ; TIGRFAM:
FT                   KpsF/GutQ family protein; PFAM: sugar isomerase (SIS); CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13535"
FT                   /db_xref="GOA:D5BUY5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY5"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ADE13535.1"
FT                   /translation="MVSNPLNSPLSSYNEDLDKRLAQLGAAVIETEASAVAALRTRING
FT                   NFAAACKYMLACTARIVVLGMGKSGHIGGKIAATLASTGTPAFFVHPGEASHGDLGMIT
FT                   EKDVVLALSNSGETEEICTILPLIKRLGVPLIALTGQPQSTLGKAADVHIDISVEKEAC
FT                   PLGLAPTASSTATLAMGDALAIALLEARGFTAEDFARSHPGGRLGRRLLLRISDIMHRG
FT                   EAIPAVTEDVLLSNALLEMTRKGLGMTAVVDVQNQVVGIFTDGDLRRALDRGIDVHATP
FT                   IAAIMTTHCKTLGPELLAAEALQMMQRHRINALLVVDHEQHLIGALNMHDLLRAGVL"
FT   gene            complement(334583..335365)
FT                   /locus_tag="Nhal_0340"
FT   CDS_pept        complement(334583..335365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0340"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: noc:Noc_2787
FT                   VacJ-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13536"
FT                   /db_xref="GOA:D5BUY6"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY6"
FT                   /inference="protein motif:PFAM:PF04333"
FT                   /protein_id="ADE13536.1"
FT                   /translation="MNRISAMALRAGLGIFVSLLVGCATNATYDDPRDPFEGFNRAVYK
FT                   FNDAADRYVMKPIAEGYDKVVPTPVDKSITNFFSNIEDLIITVNAIFQGKFHQGLTDFA
FT                   RFLANTTVGVGGLFDVATSGGMVKHNEDFGQTLGVWGFNTGPYLVLPLLGPSDVRDGIG
FT                   LGIDALTWPITYLGNTGIKSGLTGVRAVDARADLLEATDILKEAALDPYVYTREAFLQR
FT                   RKFLVHDGKVPREEFPEEEFDEEEEVPGEPPSPVPTYR"
FT   sig_peptide     complement(335285..335365)
FT                   /locus_tag="Nhal_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.583 at
FT                   residue 27"
FT   gene            335877..336752
FT                   /locus_tag="Nhal_0341"
FT   CDS_pept        335877..336752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0341"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: noc:Noc_2786 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13537"
FT                   /db_xref="GOA:D5BUY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE13537.1"
FT                   /translation="MSTEPDASLVKIRGLHFSHGKRPVFKGVDINIQRGKVTAIMGPSG
FT                   TGKTTLLRLIGGQLHPDAGTVEVDGYQVPSLPRGELYALRRRMGMLFQTGALLTDLSVF
FT                   DNVAFPLREHTRLSETMIRDLVLIKLQAVGLRCARHLMPSELSGGMARRVALARAIALD
FT                   PMMIMYDEPFTGQDPISMGTLVQLIRLLNDALGLTSIIVSHDVQETASISDYIYILSGG
FT                   RVVEHGTPGQINRSGSAAVKQFMEGLPDGPVPFHYPGRDYAEDLLSAEQGTSAKGLRRL
FT                   FRRRTGREAA"
FT   gene            336749..337531
FT                   /locus_tag="Nhal_0342"
FT   CDS_pept        336749..337531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0342"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   noc:Noc_2785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13538"
FT                   /db_xref="GOA:D5BUY8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY8"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADE13538.1"
FT                   /translation="MIGALLRLGRWGLGTFERLGRGHLFLARLLLGIAALLLRFPLLIA
FT                   QMYSVGVLTLPIIVVSGAFVGMVLGLQGYNTLVDFGAEESLGVIVSLSLVRELGPVVSA
FT                   LLFAGRAGSALTAEIGLMKATEQLSGMEMMAVDPMRRVAAPRFFAGCFSMPLLAAIFSA
FT                   VGVLGGYFVGVGLLGVDEGAFWSQMQANTDWEEDILNGVIKSLVFGLVVTWIAVFEGYD
FT                   TAPTSEGVARATTRTVVHSAFAVLALDFVLTALMFGAE"
FT   gene            337533..338000
FT                   /locus_tag="Nhal_0343"
FT   CDS_pept        337533..338000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0343"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: noc:Noc_2784 ABC-type transport system involved in
FT                   resistance to organic solvents periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13539"
FT                   /db_xref="GOA:D5BUY9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUY9"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADE13539.1"
FT                   /translation="MRQSRTVELVVGLFVAAGLGALFMLAMKVSNLSLVAQEDTYSVIA
FT                   KFQNIGGLKVRSPVTLAGVTIGRVAAIQIDSQTYEAEVKMRIESRYDYLPEDTSASIYT
FT                   AGLLGEQYIALEPGGAEVYLKEGDKIFLTQSALVLEELIGQFLYSKAAGES"
FT   sig_peptide     337533..337643
FT                   /locus_tag="Nhal_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.527 at
FT                   residue 37"
FT   gene            338079..338720
FT                   /locus_tag="Nhal_0344"
FT   CDS_pept        338079..338720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0344"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   noc:Noc_2782 toluene tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13540"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D5BUZ0"
FT                   /inference="protein motif:PFAM:PF05494"
FT                   /protein_id="ADE13540.1"
FT                   /translation="MNNQSTLAMVTLLLLVLGWGITLPQAAANTLPVASAQDLVKQTSE
FT                   HLMETLKVQKSELEAHPERIYPVVKDIVLPHFDFRRMAQFVLGKYWRPATGEQRQRFVH
FT                   EFRTLLVRTYSTALLKYSHEKIRYLPVHGPAEARDTVVRIEVLQANGGPTVPMSLHLYN
FT                   KGGAWKVFDVKIDGVSLVTNYRASFASQVRSGGLNQLIEKLAEKNGKTGV"
FT   sig_peptide     338079..338165
FT                   /locus_tag="Nhal_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.577 at
FT                   residue 29"
FT   gene            338721..339086
FT                   /locus_tag="Nhal_0345"
FT   CDS_pept        338721..339086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0345"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: noc:Noc_2783 sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13541"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVB3"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADE13541.1"
FT                   /translation="MIFRIDSIQKGHFRIFGELTFNTVPEAAKKGLALFDEAVGELHID
FT                   LQEVSRTDSAGLALLITWMRYAQVNNKSLQLFNIPDQMLAIARISSLDQILPLAGKQAL
FT                   STPSSLAQDKKLISPVS"
FT   gene            339110..339310
FT                   /pseudo
FT                   /locus_tag="Nhal_0346"
FT   gene            339649..340293
FT                   /locus_tag="Nhal_0347"
FT   CDS_pept        339649..340293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0347"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   noc:Noc_2782 toluene tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13542"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVB4"
FT                   /inference="protein motif:PFAM:PF05494"
FT                   /protein_id="ADE13542.1"
FT                   /translation="MNRYHRLGASLAVALILTVLGFNVSPIQADPLPTASAQQLVEETS
FT                   ERMLQTLRNKSEELEEHPERIYDLVKEILLPHFDFQRIARLALGRHWRQATEDQRQRFV
FT                   GEFRTLLVRTYSTALLKYSDEKINYLPLRGPKEAENILVRMEIEQARGGPPISMEIDLY
FT                   EKGEDWKVYDIKIDGVSLVTNYRTNFASEIRQGGLDQLIEKLEKKNQKVGA"
FT   sig_peptide     339649..339738
FT                   /locus_tag="Nhal_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.965 at
FT                   residue 30"
FT   gene            340390..340617
FT                   /locus_tag="Nhal_0348"
FT   CDS_pept        340390..340617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0348"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: noc:Noc_2781
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13543"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVB5"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ADE13543.1"
FT                   /translation="MDASEIKHMIEAGLPEAEVAVHSEDGHHFEALVVYEGFKDKSLLE
FT                   RHRMVYETLGDSFKSTLHALAIRTRAPGEG"
FT   gene            340678..341973
FT                   /locus_tag="Nhal_0349"
FT   CDS_pept        340678..341973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0349"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   noc:Noc_2780 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13544"
FT                   /db_xref="GOA:D5BVB6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVB6"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADE13544.1"
FT                   /translation="MDKLLITGGIPLNGEIRISGAKNAALPMLAATLLADEPVKICNIP
FT                   HLHDITTTMELLGRMGAQLMVDEYLNIEVDNRELKEFYAPYDLVKTMRASILVLGPLLA
FT                   RYGRADVSLPGGCAIGSRPVNLHIHGLQAMGATINVEGGYIRARTQGRLRGTRLLMDRV
FT                   SVTGTENLMMAATLAKGTTFIENAAREPEVVDLAHCLNRMGARVSGMGTDTLVIEGVDS
FT                   LSGACHSVLPDRIETGTYLVAGALTGGRVKLKNTNPGILDAVLLKLEEAGAEINTGEDW
FT                   VVLDMKGHRPRAVDIRTAPYPAFPTDMQAQFTTLNIVAQGSGTITETVFENRFMHVQEL
FT                   QRMGADIRLEGNTAFTNGVATLTGAPVMATDLRASASLVLAGLVANGVTAVDRIYHIDR
FT                   GYECIEEKLQQLGAKIRRVPSHVFSEAYAAYG"
FT   gene            341966..342607
FT                   /locus_tag="Nhal_0350"
FT   CDS_pept        341966..342607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0350"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: noc:Noc_2779 ATP phosphoribosyltransferase
FT                   catalytic subunit; TIGRFAM: ATP phosphoribosyltransferase;
FT                   PFAM: ATP phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13545"
FT                   /db_xref="GOA:D5BVB7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVB7"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADE13545.1"
FT                   /translation="MAEPLKLAISKGRIFEETLPLLASADIYPREDPKTSRKLVLDTNR
FT                   EDLKLVIIRAADVPTYVEYGAADFGVAGKDVLLEHPGDGLYEPLDLRIAHCRMMVAGKS
FT                   EMTPRAGHLRIATKYVRSTRRFYAERGEQVEVIKLYGSMELAPLVGLADRIVDLVDTGS
FT                   TLRANGLVPLEHIADISSRLVINKASMKMRHQPVKKFTRLMAEAVEKLHG"
FT   gene            342600..343901
FT                   /locus_tag="Nhal_0351"
FT   CDS_pept        342600..343901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0351"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: noc:Noc_2778 histidinol dehydrogenase;
FT                   TIGRFAM: histidinol dehydrogenase; PFAM: histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13546"
FT                   /db_xref="GOA:D5BVB8"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVB8"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADE13546.1"
FT                   /translation="MVDIARLNTTQGDFWSRLKQRLTWEGVADEAVMATVGEILQGIRS
FT                   RGDGALLEYTQRFDRLEVAAVAELEIPLSRLQTALAAIPREQREALEAAAERITAYHRH
FT                   QKQESWSYTEPDGTVLGQQVNPLDRVGLYVPGGKATYPSSVLMNALPAKVAGVSELIMV
FT                   VPTPRGEVNDLVLAAAAVAGVDRVFAMGGAQAVAALAFGTESIPRVDKIVGPGNIYVAA
FT                   AKRMVFGQVGIDMIAGPSEILVLCDGKTDPEWIAMDLFSQAEHDEDAQAILLSTDDAFL
FT                   DKVVEAMARLLPTLERHEVIATSLNSRGILIEAQNMDQALEVVNFIAPEHLELSVEDPQ
FT                   AWVPRVRHAGAIFMGRYTAEALGDYCAGPNHVLPTSQTARFSSPLGVYDFQKRSSLIQC
FT                   SPQGGQTLGQVASVLARGEGLTAHARSAEYRLKR"
FT   gene            343904..344980
FT                   /locus_tag="Nhal_0352"
FT   CDS_pept        343904..344980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0352"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; Allinase-like; KEGG:
FT                   noc:Noc_2777 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13547"
FT                   /db_xref="GOA:D5BVB9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVB9"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADE13547.1"
FT                   /translation="MAKNRIAQWIRPEVQQLSAYSVADAEDLIKLDAMENPYTWSSELI
FT                   EAWLERLREVSVNRYPDPEARRLKARLRQYMAVPEGREIILGNGSDELIQMVLMAVVGP
FT                   GRAVIAPEPTFVMYRQIATMLGLRYQGVPLREDFSLDLSAMLQAIQEQEPAVVFVAYPN
FT                   NPTGNLFSAEAVRAIIEAAPGLVIVDEAYTVFADETFMPQLGDYDHLLVMRTLSKIGLA
FT                   GLRLGVLAGSPAWIEELEKIRLPYNINQLTQVSAEFVLEQPGELEEQARLICNDRARLQ
FT                   KALQRLPEVQVYPSDANFILFRTPPGRADAIFAEIKAQGVLIKNLSGQGGPLADCLRVT
FT                   IGTAEENHAFLEALAAAL"
FT   gene            345295..346053
FT                   /locus_tag="Nhal_0353"
FT   CDS_pept        345295..346053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0353"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   pap:PSPA7_5016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13548"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC0"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ADE13548.1"
FT                   /translation="MASLREILVYLDDLLQVARASDYCPNGLQVEGKPEVRRLVSGVTA
FT                   CQALLEAAAVAGADALLVHHGYFWKGEAAPIIGMKRRRLKILLANDISLLAYHLPLDAH
FT                   FELGNNAQLARVLNLEVKGQFIEAGGITIGMYGCLPTPMKGEAWARYIAERLGRKPLYV
FT                   PAHKGDIYTVGWCTGGAQGYIEQAAEKGLDAYLTGEVSEPTVHSAREQGIDFFACGHHA
FT                   TERYGVQALGRHLAEKFDLEHQFIDIDNPA"
FT   gene            complement(346157..347050)
FT                   /locus_tag="Nhal_0354"
FT   CDS_pept        complement(346157..347050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0354"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   noc:Noc_0109 formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13549"
FT                   /db_xref="GOA:D5BVC1"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC1"
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /protein_id="ADE13549.1"
FT                   /translation="MSNTMSETDKSNPQGNPAANHSVAGTTPAKSSDFVMLDAVPPAQM
FT                   GRDLVEDAVKKDKFATSHILIRGFLCTPFLAYATALSALLVTQGWPSAAAGLIFPVGYV
FT                   MLATLGLEMATGSFSVMPIGMYAGRVKAWRVVRNWSWTLLGNLLGGLFFAWLLWFSLTK
FT                   GGSVAPSGVLTTLAHLAEKKASYVDYGAIGWLAAVGMGVLCNWLVSLGPVFAKAARSVP
FT                   GKVMLIWLPISTFFALGFEHTVVNMFVFPVGILSGAEVTIYDWWMWNQIPVTIGNILGA
FT                   LVFNATLWYYTHSINP"
FT   gene            347601..347822
FT                   /locus_tag="Nhal_0355"
FT   CDS_pept        347601..347822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13550"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13550.1"
FT                   /translation="MTNRHQEIAEKAVEAFKELLSEQARQQISDRQFDELALIIREALS
FT                   EELENAVEIAEDMVKRLRAQVERPELEL"
FT   gene            complement(347806..347946)
FT                   /pseudo
FT                   /locus_tag="Nhal_0356"
FT   gene            complement(347958..349070)
FT                   /locus_tag="Nhal_0357"
FT   CDS_pept        complement(347958..349070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0357"
FT                   /product="Glutamate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.4.1.3"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   dps:DP1198 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13551"
FT                   /db_xref="GOA:D5BVC3"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC3"
FT                   /inference="protein motif:PRIAM:1.4.1.3"
FT                   /protein_id="ADE13551.1"
FT                   /translation="MENVFKFADELGPLKVIHVYEPSIDLKGILVIDNVATGPSIGGVR
FT                   LAPDVSTKECFRLARAMTLKNAAAELPHGGGKAVLFGDPKMPKSDKERLIRAFACSLRE
FT                   AEQYIFAPDMGTDEESMAWVKDEIGRVVGLPRELGGIPLDEIGATGWGISHVVDVALRF
FT                   CDFELAGARIVVQGFGAVGYHAARFLTDKGAVLVGAADSHGTIHRPGGLNVETLSTLKQ
FT                   QGKSVVDYPEGERLERESIIDIPCDIWIPAARPDVIREDNVQRLKTKLVIEGANIPATL
FT                   EAEKYLHAHGVLCVPDFIANAGGVICAAMEYQGANESLVFQAIEEKLRRNTEAVLKEAK
FT                   NQQKLPREAAVDLASRRVRKTMGLRRWSLF"
FT   gene            349338..350495
FT                   /locus_tag="Nhal_0358"
FT   CDS_pept        349338..350495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0358"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0442 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13552"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC4"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADE13552.1"
FT                   /translation="MVTQRAYKFRFYPTPTQKRQLAIEFGHARYVWNWALERRTKAYKA
FT                   QGESLNTIRLSRQLTVLKQTECPWLSEATASCHTQKLRDQDRAFKNFFAGRGKYPRFKR
FT                   RHQTQSVRYQLDQRHVAKNFNAESKLLKLPKLGTLKLKWSQRMGGIPKMVTVSKDPAGR
FT                   YFVSMACEVEIAALPARKNAVGVDVGVKDVVVTSSGDKSGAPKYTYQYARQLKKAQRRL
FT                   SKKKKGSQRRRRQQQRVARIHARIADSRRDFLNQQSSKLINENQVICLEDLNIKGMLRN
FT                   RRLSKAVADCGLYELRRQIECKAKWYGREVLIVDRWAPTSKRCSECGTIQESMPLKVRE
FT                   WECPDCGTEHDRDINAAKNVLRWGTAGSAETDKARGAVKTPRAVA"
FT   gene            350722..351744
FT                   /locus_tag="Nhal_0359"
FT   CDS_pept        350722..351744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0359"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /note="TIGRFAM: TIM-barrel protein, yjbN family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: noc:Noc_2960
FT                   tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13553"
FT                   /db_xref="GOA:D5BVC5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC5"
FT                   /inference="protein motif:TFAM:TIGR00742"
FT                   /protein_id="ADE13553.1"
FT                   /translation="MKTASRRFFSNTFAPAYLSRRVSIAPMMEWTDRHCRYFLRLISHH
FT                   ALLYTEMVTTGALIHGDRERFLAYHPTEHPLAVQLGGSNPEELAFCARLAEDHGFDEVN
FT                   LNVGCPSDRVQSGRFGACLMMEPELVAECVAAMAQTVQLPVTVKTRIGVDEQDSYEALT
FT                   RFINTVSQAGCRTFILHARKAWLQGLSPKENREKPPLRYEVVRAIKQDFPHLEVVINGG
FT                   IATLEEAQEQLTLLDGIMIGRAAYHNPYLLAQVDRYFYGDFHPLPTRHGIMEAFLPYVE
FT                   EQLAQGIYLSRITRHILGLFQGQPGARAWRRYLSENAHRPGAGIEVIREALRRVPQGFG
FT                   "
FT   gene            complement(351830..353086)
FT                   /locus_tag="Nhal_0360"
FT   CDS_pept        complement(351830..353086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13554"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC6"
FT                   /inference="similar to AA sequence:KEGG:Noc_2963"
FT                   /protein_id="ADE13554.1"
FT                   /translation="MNDNRSSQETKLRTKLSAARTRLVVERPFLGALILHLPLQEASPE
FT                   WCGSTATDARAIYYNPAYVEWLSFEQLQFILAHEALHCALCHFARRGRRNLGRWNAACD
FT                   YAVNQLLIREGLQPPPGVLLNQDYRGLSAEEIYPLIPSGAKLQTVDYHAYENEPSLSDT
FT                   PVDFNTASKGWSIHGSQQPDKPSKGNLLFPSTQAPPSTSPPPLTEAEREQLNRLWQQRT
FT                   TSLAQQALQAGKLSAPLQRLIGSLGQPQLPWRQLLAQYLSAAARNDYSFTRPSRREGSA
FT                   ILPRLASQQIELVIVLDTSGSIHDEQLQSFLTEVSALKGQLRARVTLHACDADLCEQGP
FT                   WIYEPWEALTLPESLPGGGDTNFRPPFDWVEQAGFYPDTLLYFTDARGPFPEVEPPYPV
FT                   IWLVKGKAQVPWGRRIQLN"
FT   gene            complement(353076..354122)
FT                   /locus_tag="Nhal_0361"
FT   CDS_pept        complement(353076..354122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0361"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: noc:Noc_2964
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13555"
FT                   /db_xref="GOA:D5BVC7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC7"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADE13555.1"
FT                   /translation="MRPSHITAILKREFAAVRCGQHTPVMLWGPPGVGKSQILSQVAES
FT                   FDVPLIDLRLSQLEPTDLRGIPFRVDQWVEWAIPAMLPNQRRHGPEGILFLDELTSAPP
FT                   TVSAAAYQLILDRHLGEYTVPEGWAIVAAGNRHGDRGITYALPAPLANRFTHYEIEPHL
FT                   GDWVTWASHQGIDQRLIGFLLYRPELLFEIEPNQTPLAFPTPRSWEYAHRALQKFADAP
FT                   ELLLEALQACVGPKAGLEFKTFIDNMARMPDVEAILRGEEVAIPEELDLQYGVAATLVR
FT                   RAVDAMETHEAHRIYGHILDYATRLPEREMGVMLVTEMFRTIGRPLLAHPGFTKWARQV
FT                   SDLMLYER"
FT   gene            complement(354142..355599)
FT                   /locus_tag="Nhal_0362"
FT   CDS_pept        complement(354142..355599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0362"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: nmu:Nmul_A0625
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13556"
FT                   /db_xref="GOA:D5BVC8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC8"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADE13556.1"
FT                   /translation="MPIKESFDPEGLRLPIKLDSTSNGEFMPYPLGAPARAARKLAHQR
FT                   ATLCGQKAGLSRRSFLKSLGGAAATLLAMNEAYAYFGKNGGGFEIPAEAVFEPAAAQAS
FT                   IGGNEFIFDIQGHHVNPQGAWRRLTNRWTYILRFFPQSRCGDGAIECFSAEHFIREVFL
FT                   DSDTDMAVLSSVPAAPEDNPLSTEEAAATRALVEAMEGDYRLLIHGLVHPNLPGAIEDM
FT                   AQQKEEHQVAAWKTYTQWGPEGKGYWLDDEQYGIPFIERARELGVKLICVHKGIPLFNL
FT                   PYAYSTCRDIGVVARRYPDVNFIVYHSGFEPRHTEGPYDPDNVDGGVDTLIQSLQENDI
FT                   PPNSNVYAELGTTWRMVMQDPNQAAHLLGKLFKYVGENNVLWGTDSIWYGSPQDQIQAF
FT                   RAFQISPQFRDSYGYPEITPALRTKVFGLNAAKPYGLAPHEIKKRNTQDRVARIKQDYL
FT                   QDPEPSFLTNGPKTRREFLQFHRLNSS"
FT   gene            complement(355725..357893)
FT                   /locus_tag="Nhal_0363"
FT   CDS_pept        complement(355725..357893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0363"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic;
FT                   Peptidoglycan-binding LysM; SMART: Peptidoglycan-binding
FT                   LysM; KEGG: noc:Noc_2988 lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13557"
FT                   /db_xref="GOA:D5BVC9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVC9"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADE13557.1"
FT                   /translation="MPYPFAVIFMIALLSLASPVSAKSWDLFPRPPELTQDIRFWTRVY
FT                   TEIDNDQGFIHDNRYLNVVYETTPVPANLDWKTAKKRIQDRRQHYQGILLRLAKGKRQN
FT                   LTTEERRVLKLWPQNVSNQTLHAAAARIRFQRGQANRFRQGLIRAGAYKPFIFNTLNSL
FT                   DLPRELAVLPHVESSFNPAAHSHAGAAGLWQFTRPTGRRFLRIDQVVDERLDPFKATVA
FT                   AARLLQHNYKVTGSWPLAITAYNHGAAGMRRAKEQVGTSDIVAIRQRYKSPTFGFASRN
FT                   FYVAFLAALDVDSQARRYFGPLQPHKPEKSEVIALPDFVPVKALQRALRLDQTTLKQSN
FT                   PALGSPVWEGHKYVPRGYELRVPCVPSCRRVKTIAALAPWERFERQVPDRFHKVQGGQT
FT                   LSHIAQRYRIKLRQLVELNGLSNRHHIRVGQVLQLPLPADGLPTGHYTVQRGDTLSGIA
FT                   RRFGITEQALLKINGITNKHRIYAGQNLRLASSSSEARRNQVSSRGKEHRTRAKTTSVV
FT                   LREETTPTKAGTLQKAAMVTPGGGSCEPLLPPECDPALSADPSNYTVTKDGTIEVQATE
FT                   TLGHYAHWLELSTQQLRNINGLPVGRSVIMGQRLKLDFSHITTKTFEARRRTYHRGLQE
FT                   TFFERYRIIGTEEHVVQQGESLWVLAQQKYQVPLWLLRQYNPDLDFSAVVAGTRVVIPR
FT                   LARREEKSLPMASVEIKGKLLSASRREG"
FT   sig_peptide     complement(357825..357893)
FT                   /locus_tag="Nhal_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            358248..358715
FT                   /locus_tag="Nhal_0364"
FT   CDS_pept        358248..358715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13558"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD0"
FT                   /inference="similar to AA sequence:KEGG:Noc_2987"
FT                   /protein_id="ADE13558.1"
FT                   /translation="MVSAQSSIVIVRPVDDVFQFISVNFFQNYPKWSPEVVELEKLSDG
FT                   PVKVGTLGRQVRNDQGRRTESTFRVTRFEPNQCFSCEGTAQTPFRVIYNFESLDQATKV
FT                   KFTFELLKIDFFMRPFEKLIEAAIRGGADRVVHNLKGLLEEEATGPSGSAK"
FT   gene            358814..359263
FT                   /locus_tag="Nhal_0365"
FT   CDS_pept        358814..359263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0365"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: noc:Noc_2986 PAS domain-containing protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: PAS fold domain protein;
FT                   PAS fold-3 domain protein; SMART: PAC repeat-containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13559"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD1"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADE13559.1"
FT                   /translation="MSFIVEKDEGLIPRVLSQILDSCVNGVSLTDPDQEDNPLVYVNEA
FT                   FEKITGYKKEEILGKNCRFLQGNDRDQEEVKRLREAIQNRVPIEVDIRNYKKNGELFYN
FT                   HLAVNPVFDQDGNLLYFLGIQYDVTKQVLAEQEIEKLRQLLGEKT"
FT   gene            359390..360013
FT                   /locus_tag="Nhal_0366"
FT   CDS_pept        359390..360013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13560"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD2"
FT                   /inference="similar to AA sequence:KEGG:Noc_2985"
FT                   /protein_id="ADE13560.1"
FT                   /translation="MGENRRHSELVTRSGLRPFFYDSVQDAIENQHVKADEATIFYLVN
FT                   LLTDFSRSEKVFDYTQEGPVLRPLAELYGFAVEAASQSERKLILQRLGDVALFISGLFS
FT                   GYFHRRLVDVDYYIAMGGSAYAYLYDAKGRNPREQALATIFRQLSQQFVQFVDVLAEVG
FT                   ENAFGSSEQDIFELYELWAKTGSPRLERKLRGFGVNPQHFGPVH"
FT   gene            360022..360678
FT                   /locus_tag="Nhal_0367"
FT   CDS_pept        360022..360678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13561"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD3"
FT                   /inference="similar to AA sequence:KEGG:Noc_2984"
FT                   /protein_id="ADE13561.1"
FT                   /translation="MDLNALQAQLEHIYDVRTYCRVEDFLVTDPAIVVELTEASGSGQT
FT                   PSMESLLIRQGEDNLDLALYLDQELLDQLGRDNPTELLHDGNLAEFWFALEGVSHFLYL
FT                   AWNAGFERTVTQLELELQAEIDKCVLTAALVYHQRGIVDMRLLRRVLFEETRLRDGLDN
FT                   VQQQRYREANRLAARYCGVLEEKYSLIPKNSYLVNELRRFYRMPQSHKIRHIRVV"
FT   gene            360758..360940
FT                   /locus_tag="Nhal_0368"
FT   CDS_pept        360758..360940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13562"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13562.1"
FT                   /translation="MWGQDNQLQIKYRLCWRDRKSCEYGYSAWMDDPKRAWEALLRAPT
FT                   SWDRMYWLETRRILY"
FT   gene            361028..362473
FT                   /locus_tag="Nhal_0369"
FT   CDS_pept        361028..362473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0369"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   noc:Noc_2983 aromatic-L-amino-acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13563"
FT                   /db_xref="GOA:D5BVD5"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD5"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ADE13563.1"
FT                   /translation="MNPPTTDETLSALDPSPAHLQQLLDEVGQRLAAFVATVDQQPAQA
FT                   AGDFDPQASWLREPIPETPSAPGELLDFIFEQVIPVAFNSASPGYLAYVPGGGLFSSAL
FT                   GELIAATVNRYTGKWAAAPAAVELETQFLRWLAELMGLPQGSLGVLTSGASMSTLIALV
FT                   AAREKYLGDHLLEGTVYYSSEVHHAVIKAARVAGIPTRNLRPIPVDTRFRLRADRLEEA
FT                   VRRDRKEGRLPFFICGTAGTVNTGAMDPLAELADIAAQHDLWFHVDGAYGAGFRMLPEL
FT                   QPLFKGMERADSIAMDPHKGLFLAYGTGALLLPDMSNLRRAFSASGAYLPASQEDDKHL
FT                   DFCELSPELSREWRGLRLWLPFKLHGVAAFRQALGEKRRLAVQAWQRLSLEPDVEIAAP
FT                   PELSLFAFRQRFEGITREEENRRNQALLERINRSRRIMITGTEINGRYFLRICILHLRT
FT                   HEAILNEGLDLILAALAEARKRF"
FT   gene            complement(362475..363113)
FT                   /locus_tag="Nhal_0370"
FT   CDS_pept        complement(362475..363113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0370"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   noc:Noc_2982 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13564"
FT                   /db_xref="GOA:D5BVD6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD6"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADE13564.1"
FT                   /translation="MSGYHKQRIAEVVENLRTIVQQHLRQIIAPVVGLLARSRLSPNQI
FT                   SIAGFVLALIAMGILMAGYPVAAGILFLLGSSFDILDGALARLEKKITPFGAFLDSTLD
FT                   RISEGAMLMAIAYRLALEGQAAAVAGVVLAMLGGMLTSYTRARAEALGITCAIGWVSRP
FT                   ERVIIMGAGLIFDLLIEAIYLLAVLSLWTAGQRFLHVSSTLRHPNSSNP"
FT   gene            363317..364474
FT                   /locus_tag="Nhal_0371"
FT   CDS_pept        363317..364474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0371"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0442 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13565"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD7"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADE13565.1"
FT                   /translation="MVTQRAYKFRFYPTPTQKRQLAIEFGHTRYVWNWALERRTKAYKA
FT                   QGESLNTISLSRQLTVLKQTECPWLSEATASCHTQKLRDQDRAFKNFFAGRGKYPRFKR
FT                   RHQTQSVRYQLDQRHVAKNFNAESKLLKLPKLGALKLKWSRRMMGIPKMVTVSKDPAGR
FT                   YFVSMACEVEIAALPARKNAVGVDVGVKDVVVTSSGDKSGAPKYTYQYARQLKKAQRRL
FT                   NKKKKGSQRRRRQQQRVARIHARITDSRRDFLNQQSSKLINENQVICLEDLNIKGMLRN
FT                   RRLSKAVADCGLYELRRQIECKAKWYGREVLIVDRWAPTSKRCSECGTIQESMPLKVRE
FT                   WECPDCGTEHDRDINAAKNVLMLGTAGSAGTDKARGAVKTPRAVA"
FT   gene            complement(364744..365907)
FT                   /locus_tag="Nhal_0372"
FT   CDS_pept        complement(364744..365907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0372"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase;
FT                   Myo-inositol-1-phosphate synthase GAPDH domain protein;
FT                   KEGG: noc:Noc_2981 myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13566"
FT                   /db_xref="GOA:D5BVD8"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD8"
FT                   /inference="protein motif:PFAM:PF07994"
FT                   /protein_id="ADE13566.1"
FT                   /translation="MSKIKIAITGIGNCASSLLQGFYYYGDKKAEDAIGLMHWSIGGYK
FT                   PSDIEVVAAFDIDGRKVGKDVAEAIFAEPNCTAVFCPNIPQTGVTVQMGKILDGFSEHM
FT                   RDYDPKHTFILADDPEPTQEKVVQILRESGAEILLNYLPVGSEQATHFYAECALEAGIA
FT                   LINNIPVFIASNPTWAKRFEEKNIPLIGDDIKAQMGATITHRALTDLFRKRGVKLERTY
FT                   QLNTGGNTDFLNMLNRHRLVSKKESKTEAIQAVTNQRLDPENIHVGPSDYVAWQKDNKL
FT                   CFIRMEGKLFGDVPMNLELRLSVEDSPNSAGVAVDAIRFVKLALERGQGGVLYAPSAYL
FT                   CKHPPRQYTDDEAYRMTEAFIDNKLVESPEPRRHRQEEDKSPAASRR"
FT   gene            complement(366197..367405)
FT                   /locus_tag="Nhal_0373"
FT   CDS_pept        complement(366197..367405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0373"
FT                   /product="oxidoreductase, putative"
FT                   /note="KEGG: noc:Noc_2980 oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13567"
FT                   /db_xref="GOA:D5BVD9"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVD9"
FT                   /inference="similar to AA sequence:KEGG:Noc_2980"
FT                   /protein_id="ADE13567.1"
FT                   /translation="MKVFLRLLAYLLLAGIALWLLLPERFAVNVPIRLFGWGRPSIEVL
FT                   HDRLQLPDGFSIEIYARDLPSARMLRFTPQGDLLVSLPEAGDIVLLERDANKDHQPDGR
FT                   HTLLTDLYRPHGIDLQGGWLYVAETDAVGRIRFDAAARTVRGKYQRIAQLPSGGGHWTR
FT                   TLGFGPDGWLYVSVGSSCNACEETDPRRAALLRFPPEGGKEEIFATGLRNTVGFDWHPG
FT                   THKLYGTDNGRDLLGDDFPPDELNRIEQGKFYGWPYANGDKVPDPTFGPGHQEAVEKSV
FT                   APVYHFAAHTAPLGITFLHGKQLPPTYQESALVALHGSWNRTQKQGYEVVSLHFHQTGE
FT                   ITERKFITGFEANEEVIGRPVDVAEGPDGAIYISDDFTGSIYRVIYKEKVAQLNRLKQS
FT                   IKN"
FT   sig_peptide     complement(367322..367405)
FT                   /locus_tag="Nhal_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.787 at
FT                   residue 28"
FT   gene            367552..369504
FT                   /locus_tag="Nhal_0374"
FT   CDS_pept        367552..369504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0374"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: noc:Noc_2979 PAS sensor, serine phosphatase
FT                   RsbU regulator of sigma subunit; TIGRFAM: PAS sensor
FT                   protein; PFAM: Stage II sporulation E family protein; PAS
FT                   fold domain protein; PAS fold-4 domain protein; PAS fold-3
FT                   domain protein; SMART: protein phosphatase 2C domain
FT                   protein; PAC repeat-containing protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13568"
FT                   /db_xref="GOA:D5BVE0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADE13568.1"
FT                   /translation="MLIGEDTEVPANQDKDEQNSDLATDKQRDTAAQRLAAIVESSEDA
FT                   IISKTLDGTIISWNAAAEQIYGYTAEEICGQSIAILVPPDRHDEIPQILQHIRRGERIK
FT                   QFETVRVRKDGRKIYVSLTISPIKDNQGHIVGAATIARDITRRKQREEKLLWLSRALEQ
FT                   SPVAVTITDTVGNIKYVNAKFTELTGYPKEEVIGKNPRILQSGKTPIEEYQRLWESITS
FT                   GGEWQGEIQDKKKNGEIYWVREHISPIKNPQGEITHFLAIGEDISERKQIEQALQESEE
FT                   RFRQVARMTGEWIWEQDPSGHFTYCSGAVKEILGYEPKEMLGKHYCEFFTPEAQESGVC
FT                   KSPDEKRFFRFISHYLHKDGHEVFAESSGEPILDEQGRIIKWLGVDRDITQQLEAQELI
FT                   RRSQISLAVARNELRIARQIQESLLPTEPLILPEVEVVGYCLPASQVGGDYFDYYHRPD
FT                   HRVDVAIADVSGHSVGPALFMVETRSALKAQIRSKFTAANTLAALNDSLYEDLNRADHF
FT                   ITMFYMQYHIGTGEINYASAGHNPPLLLRGDGARCTKLEADGLIFGVKKEVSFEEKRTF
FT                   LEKGDIMFLYTDGIIEAESKQGEFFGIKRLCKILMTNRHLAPQDLIKVVVKNLQDFCES
FT                   KTFKDDVTMVVLKTI"
FT   gene            369629..369886
FT                   /pseudo
FT                   /locus_tag="Nhal_0375"
FT   gene            370021..372249
FT                   /locus_tag="Nhal_0376"
FT   CDS_pept        370021..372249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0376"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase STT3 subunit; KEGG:
FT                   wsu:WS0043 oligosaccharyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13569"
FT                   /db_xref="GOA:D5BVE1"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE1"
FT                   /inference="protein motif:PFAM:PF02516"
FT                   /protein_id="ADE13569.1"
FT                   /translation="MIGKWESRVDRALASRLGLAVGLALIFLFAFTLRFDNLSFWLDNP
FT                   ERTLFGDPPRPLMLTVDSYIYLDLGRDLLEGTYESDLPTRHVPQGAERPPTAPLLAVML
FT                   AGLQKLTGAAPEWIAIVLPPFLGALIVLPVYMLGSLFATLVWSTPSPSTRRIAGLAAAA
FT                   AAAASPYFVFRSSIGWFDTDSLNVVFSALAAALALRAALARDQRQRIIAWVLYSLVLVL
FT                   FLWWWNTVPHIVFGLWVLPGLATLLFHLPRGWELVTVAALVLLGLVGAVAIAGWQVLNP
FT                   VAQFQMVQGLFTYIAEQTGWIFPETGQAVSEQQATGWDQFLSWVPGGWFGLAMMVIGYA
FT                   LLVWRAYRAVMVMASLVIVTALSATGYRFNIFGAPVFGVGVGIAVAFFWVLLSQRSYRT
FT                   LVTVPLLGVTLWGAVAHAQGGNNLVPRRYPIDMEAMIQLGELSAPNAVVWAMWGHGNPL
FT                   HYYARRGVVADGVFHSGRLQWVLHLPLAKNNPRLAANWMQFYVTRGYAGMQRARHLFGG
FT                   DKKSWAEGLEVIQRMFIVGPEESYRQLIPKMGGELAKAREVIEYFFPAEAPPVMLYLDH
FT                   HLARTPWFKLGKWDLNRQVEVGDDHTYLPFRGYQREGERLIAEVKGKQMVLDLNGATMT
FT                   WGERTAPLQQVRMHDGKRLLRMGLNPNADLVLSVNQVANYGAVASRAVADALLPRLFVD
FT                   LAYDNRYFTLRAMMPSFYQIWEVRGEELTAEMAARVEAGLAKGEGRGG"
FT   gene            372593..373969
FT                   /locus_tag="Nhal_0377"
FT   CDS_pept        372593..373969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0377"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   pna:Pnap_1699 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13570"
FT                   /db_xref="GOA:D5BVE2"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE2"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADE13570.1"
FT                   /translation="MGVFVLDKNRQPLMPCQPARARKLLREGKAAVFRCYPFTIILKER
FT                   AGGTTQPISLTVDPGSKTTGISLNAQFNSGTVCIFAMQLEHRGRQIKESLDSRRGVRRS
FT                   RRNRNTRYRQPRFLNRSRPKGWLPPSLLSRVDNTETWAERLVRLAPICSANVEIARFDL
FT                   QLLENPDITGIEYQQGTLYGFELREYLLARHQHTCAYCHGLSKDSILEIEHILPKSLGG
FT                   TDRVGNLVVACRTCNQHKNNLHPQAWADACRKRKNKLEQQRSLAMRAILKGHRPTLKDA
FT                   AAVNATRYAVGRVIKQLIPDIRFCSGGQTKRNRTLQGYPKAHWIDAACVGEQGQQVRLE
FT                   CSGYLQVSAKGHGARQQCRMDKYGFPRTSAKAARTVQGFRTGDIVEARVPTGKKAGHYI
FT                   GRVAVRSSGFFNITSQRIVTQGISYQYCRTLHRCDGYGYGYVIDTQIASTQQEDAGEAA
FT                   "
FT   gene            374033..374989
FT                   /locus_tag="Nhal_0378"
FT   CDS_pept        374033..374989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0378"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   amc:MADE_02590 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13571"
FT                   /db_xref="GOA:D5BVE3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADE13571.1"
FT                   /translation="MKLIVQIPCYNEEQTLPETIADIPREIAGVDVVEILVIDDGSSDR
FT                   TAAVAESLGVDHILHNNHNIGLARTFRRGIDAALKAGADIIVNTDGDNQYVGQDIPKLI
FT                   QPILEGRADMVVGDRETAKIDHFSIGKKFLQWLGSAVVRRLAGIYVPDAVSGFRAFSRE
FT                   TAIRLNIVTSFSYTIESIIQAGKRQMVVTSVPVRTNPKNRESRLFQSIPAFVQNSMWTM
FT                   LRTYAMYQPLRAFFFIGTVLSVLGAIPIVRFLYFYLIGQSEGHIQSLVLGGVFLMMGFL
FT                   AYLVGLVAELISINRQLLEMTLERVRRMELEQKRGDD"
FT   gene            374976..376241
FT                   /locus_tag="Nhal_0379"
FT   CDS_pept        374976..376241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0379"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   amc:MADE_02589 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13572"
FT                   /db_xref="GOA:D5BVE4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE13572.1"
FT                   /translation="MATTNTPRLRRILCVTSNFPRWSGDSTTPFVLHLAQDLQALGWEV
FT                   DILAPHAPGCAVTETMEGVRVERFRYLWPETQQTVCYQGGALINLRKHRGNLLKLPLLV
FT                   AAEWAALMGRLFTRQYNLVHSHWILPQGFTGVLAARSRRIPHVITVHGGDVFALRSPLM
FT                   MRFKRFSLHHADRITVNSSVTEAAVRELDPGGTPIQRVPMGVSSNVVARDIAPVAEIRA
FT                   RHRQGEGPLLVFVGRVVEEKGVRDLIDGVGLLRAAFPEVRALVVGEGQDRPELEAYAAS
FT                   SGLGAHVHFSGWVQPDEVRHYMAAADVFVGPSRRAANGWVEAQGLTLLEAMVAGVPVIG
FT                   TRLGGVVDSVADGVTGLLVDEGAPQQIAAAVKRLATDPQFAARLVKTARANVLGRFSRE
FT                   ASAQAFSELFMALSGQGEKYPT"
FT   gene            376238..376963
FT                   /locus_tag="Nhal_0380"
FT   CDS_pept        376238..376963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0380"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mno:Mnod_6874 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13573"
FT                   /db_xref="GOA:D5BVE5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADE13573.1"
FT                   /translation="MIDAKPQSHAALDSDSRVRKAMKIGRLLSQVTDLQGACVLEIGAG
FT                   AGYIASFLASRVGAGGAVSAVDIIDQRQVCDGFDFRLVSDTALPFDDDSFDICVSNHVL
FT                   EHVGDPKAQAAHLREIQRVLRPAGWLYLAVPNRWALIEPHFKLPLLSWLPPSLRDTYVR
FT                   ITGRGQRYDCHPPTHAELEALLHGAGYRTREVSFEGIKAVGDIETGPGLKRWLCKHPRF
FT                   WALPLRVLLPSHLYLARYP"
FT   gene            376964..378001
FT                   /locus_tag="Nhal_0381"
FT   CDS_pept        376964..378001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0381"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sat:SYN_00818 lipopolysaccharide
FT                   1,2-N-acetylglucosaminetransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13574"
FT                   /db_xref="GOA:D5BVE6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE13574.1"
FT                   /translation="MINGRKLKVWLPYTQGGGGSDVFTHILAKGLRKRGIDAVEQPFAH
FT                   HLQYVPWLLRKAVPPPGTDLTLTNTWNGLAFKRPGIKLVTVEHLFVLDPALRPYRSFAQ
FT                   GVFHQSLVRYFEHSSHRASEVQVAVSQYAANAHHRILGNPKPRVILNGIDTHFFTPPKE
FT                   KNAPAASRPFRLLFVGNLTRRKGVDLLPPIMDALGEGFELEYAAGLRTTRTLAGLKNAR
FT                   NLGSLDHEQVRQAYRRADVLLFPTRLEGFGYAAAEAMACGTPVVATRVSSLPEVVQDGL
FT                   TGVLCPVDDVGAFVSAIRTLARDKQRRMDMGRAARAWTVEHFDLDGMIGEYVRLCESLV
FT                   RANAT"
FT   gene            378015..379235
FT                   /locus_tag="Nhal_0382"
FT   CDS_pept        378015..379235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0382"
FT                   /product="Glycosyltransferase-like protein"
FT                   /note="KEGG: abu:Abu_0685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13575"
FT                   /db_xref="GOA:D5BVE7"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE7"
FT                   /inference="protein motif:COG:COG0438"
FT                   /protein_id="ADE13575.1"
FT                   /translation="MPNYRNILVASYYFPPFAGISGMRATKFCKYLPKNGWRPTVLTVD
FT                   PRYYRGKALSELPQEVERMEVRRIRFLKFPGSTLFVKLLYPLYVCYQAYRERRRFDVVY
FT                   LCGSPFHPFVSTAFITRVLGIPSVLDFRDFWSLYDGYDSHVSSPRARSLSFRVERLIKQ
FT                   SIEWVGIRYATKVVFASRVLKEDYAATFPAYQHKFQTINNGYDPEDFAEVEPRKVTALP
FT                   KTIVLAGKFLEYTPVAATLFLTVLREFPEACFLYVGAEHQEVAELAAQLNMSSQVTSLG
FT                   FMHYNRVLDLIAGADYGLVTNGVIYGMGTKIFDYLALGKPSLCLVPKDSIIAHEFGSNP
FT                   RVTICETPHTEERIRVSLRRLFDSKASAADAVVDGYSRADLTRKLAQVLQSAFADTDTE
FT                   TGQCLSR"
FT   gene            379461..384515
FT                   /locus_tag="Nhal_0383"
FT   CDS_pept        379461..384515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0383"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; PFAM:
FT                   glycosyl transferase group 1; KEGG: ppg:PputGB1_1389
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13576"
FT                   /db_xref="GOA:D5BVE8"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR024542"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE8"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADE13576.1"
FT                   /translation="MLLLGEYEMALTTLDRETPDANTAVDSSGVVTISVGEDRYRISLP
FT                   NAETDYIQKRISTEKKPYELQMLEDMRQRLEKGDLVLDVGAHVGNHTLYLAAVVGCKVI
FT                   AFEPNQSLAGALLSSIEINGLVDSVSVRVVGLGKANTQGHFLKEMPDNLGGQSIELGSG
FT                   NIQIIPLDSVPVEMPVKALKIDVEGMELLVLQGGETLLRKDRPLLYVECQTENSFRAVA
FT                   NWLDTLDYGYWDTFNATPTHLFLPNEAVDLQHRISRLQFKQVLDTYQAEQKLVALRKKL
FT                   EDANHKYRDANERMALIKGELRAKASELESVKGMLTQANEKYREVTGQQVPLLKQKLSQ
FT                   LQSELDQATQALHQEQTQRKEEVTHYRGELAAKARELEAVEGMLTQANEKYLEVTGRQV
FT                   PLLKQKLSQLQSELDQATQALHQEQTQRKEEVTHYRGELAAKASELEAVKRRLTQADEK
FT                   YCEADDQIPLLKQKLSAATELNRQQQRDFLRLSRQVNDLRLQKEKLESRLTALNNTVSF
FT                   QLGSSLVSAVRSWQGLARLPVSLWRVGRQGIKFLRAQRQRKRNNRPSGSGGLATPAKKL
FT                   EKLPVRSTRQHAVDRFEPSRTIPSLTEVQQLNKAKPLKIASIMDDFTFNSFNPECELHQ
FT                   LTPAHWQAELVACQPELLFIESAWRGKDKLWGSKVGHKSEEVQGIVAWCREHHIPTVFW
FT                   NKEDPVHFETFLNTAKLFDFVFTTDIDCIHRYKAALGHERVYLLPFACQPAIHNPIETY
FT                   ERKDAFCFAGAYYARYPERTRDLESFIVELPDFRPVEIYDRNYGMNDPRYQFPAAYQPY
FT                   IVGTLPFEEIDKAYKGYRYAINLNSIKQSQTMFARRVFELLACNTLTVSNFSRGLRLLF
FT                   NDLIITTDSGGEMVRRLHQLADDRTHRDRLCLAELRKVMLEHTYGERMAYVLSKVTGRR
FT                   ITDPLPGVTVIAPANSPDDVERLLAHFQRQQGVESSLTLVLGSTLERARVETMLPGSDE
FT                   RIRLLDEAALEGKTLADLAQGADWITGMLPQDYYGPHYLLDMVLATRYSQAAVIGKAAY
FT                   HGLHDGQITLNQAEQAYRPAKVLKARSAALSVEAAGQIKAQDWLAGLEQWEYTLPNQLA
FT                   IDAFNYCQEGGAEQHASTVTRTVDDLPLNTGIPIQQLLARAEAIAPLADQEADAPVLEA
FT                   QQLAEHFGKQHVHGIKTELDEQGWKITSTLADGKHEYLYAPIDFIPSELSAGANKDELR
FT                   FYLEMAPGLNLGLVMLFLDTEKQRISYVINPPNRNHVVDIPQETAYIRLGLRVYAGGTA
FT                   YLKQLLLGHRDLEPAELLGRSDILLLTNHYPRYDDLYRNGFVHSRVRAYQEHGVPVDVF
FT                   RLRKGETISYHEFQNVDVTTGSQEALHRLLATGRYKQVLVHFLDHDMWEVLQDYVERIK
FT                   IIVWVHGAEIHPWYRRKFNLETDEQMERAKLQSEKRMAFWKEILNPMPANLRLVFVSRH
FT                   FAEEVMEDLGFRLPESQYQIIHNPINTELFTYQEKDPEQRNKILSIRPYASKQYANELS
FT                   VAAILTLAKKPFFDELEFRLIGDGKLFEETLAPLQDMKNVVVERCFLTQLEIAQLHKEY
FT                   GLFLCPTRWDSQGVSRDEAMSSGLVPVTNRIAAIPEFVDDDCGILAAPEIAEEIAAGIE
FT                   ALINNPERFTAMSRNSAERVRAQTAQDKIIHQELELIRSDVVRILE"
FT   gene            384616..385425
FT                   /locus_tag="Nhal_0384"
FT   CDS_pept        384616..385425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pub:SAR11_0555 CMAS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13577"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13577.1"
FT                   /translation="MDENIQNQKYAPSVQYDGFNYVLSDEFQKNSKIETENWDKEWMRY
FT                   FSLGKDYSFYYYDMDTNNYALSVSPSKISEFSPEQTYHAKFFREIKGRVWAYGSDLVDR
FT                   DILEMGCGPGIFGRISGRFAKSYTGIDISLFALYIARLTSPKKKCNYHHLYDPSSIKHL
FT                   SKRFDTSFGRNFFIHHNYNDSLWILRFLRDLTKSGGVIIADFHCEPALVDGHRRVMAAD
FT                   SLRKNYPSALFNFMDNDIDKISQEAHLTLEAIDYVPEEACRFARLRV"
FT   gene            385635..385799
FT                   /pseudo
FT                   /locus_tag="Nhal_0385"
FT   gene            complement(385802..386689)
FT                   /locus_tag="Nhal_0386"
FT   CDS_pept        complement(385802..386689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13578"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13578.1"
FT                   /translation="MREVVFYCGAHKTASSMIRKFLRKNENFLEAKCDIKSYDREVIIN
FT                   SDFFNVISKLSSYQEVQNSEWNKGRDSFLSFMDAGNYSKYLFHNEDFFTAMFFNNVGAI
FT                   SRYLSWVAEGMNTKVIIYVRNQVDYIESWYLQKIHTGNIVSFDKYLSRINLNGFSWTKV
FT                   LDAIASNFGRENVNCIPYESIQHGSKEYLQNFISLLTDKNIDISNYDTEGQNRSFSGIA
FT                   VDMAVNFYPRLNRKEQKILRKFLQENFSTRTHEKPILFLPEERDNIKKIYSKDNKILFK
FT                   KYISGYVQESNFYF"
FT   gene            complement(386921..387157)
FT                   /locus_tag="Nhal_0387"
FT   CDS_pept        complement(386921..387157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13579"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13579.1"
FT                   /translation="MTYSRILFEKCHSCRNRISPRTSAIIMRETPTPIETRKREPPTYF
FT                   SRDLTTSPSTFQISQLAIRHELNKAELKITSSL"
FT   gene            complement(387247..387441)
FT                   /locus_tag="Nhal_0388"
FT   CDS_pept        complement(387247..387441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13580"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13580.1"
FT                   /translation="MECIQNLSIVRFPGQFEGSSLIAIIGIKKSRHIRKAISQHGDIGE
FT                   PIATFFEQRQWIKDMAKFR"
FT   gene            387570..388022
FT                   /pseudo
FT                   /locus_tag="Nhal_0389"
FT   gene            388025..388156
FT                   /pseudo
FT                   /locus_tag="Nhal_0390"
FT   gene            complement(388330..388575)
FT                   /locus_tag="Nhal_0391"
FT   CDS_pept        complement(388330..388575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13581"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13581.1"
FT                   /translation="MMSETIYGTGSEQVLQSIFSTAREREELKEASRLRALLQFPTYPG
FT                   IDYTADYSGILSRKLNEIVGLQEIPPYLALYATISV"
FT   gene            388605..391280
FT                   /locus_tag="Nhal_0392"
FT   CDS_pept        388605..391280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet2300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13582"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13582.1"
FT                   /translation="MTTKKKDRVFFLSKALNRVFFVVNVLKYKENQEASKIFPNKQLKQ
FT                   HSDDVHLLMQLAEAATSEADWANAIFHWRQVYDAYPSSQIGKQARRRLNQALINRAMQL
FT                   RRLGILDQTEGLVEEVLGIMPGNARALTEYAELATARGNWTTAIERWQAVLDAVQHEKD
FT                   ADKYKKIFSRAVGKLREAQICAAAMSLKEGVPDTEGAFLLAALQGSLVPIKPVIKLDPE
FT                   TTAEMRAARILIDLRSEPTCEKLAKYVIQVRWGKAVASALYQLTCPIAEVVNNSSLKNL
FT                   HIDTTTLSAWLVIRAASILYADADNKDSIQHSISTTEATLRMGIHDPIAKEILIDTYIR
FT                   TWNYNEVFSIYSTLDSPSVYCSLQYANVLNQLGRNEEAKEVLFELLSKNPFNWAIFNSL
FT                   LRMNSYLNIFDRLEEHALKFSEKAIEPIEIINAFQMMSSLGLCDRSLSFLFQSGLPEQV
FT                   GELNPSIAQRLCETLASTYLSQARYAESLYWSNKGIILSGAAENKKTQNLLSLRFEATH
FT                   KCGLNDLASKTSKKIIGVGKMTTRQSYLASLSEKNFSRAWKIKTDNQDSIGIKLAFSEK
FT                   YHSDGPTYHHINGRKILVFSIGGVGDQIRLLSILPDLLRHLQPRQTTVTCDPRLASLLE
FT                   HSIPGIRTIAVTEYRGVASEAIFLERNNVPNHSAVRMVNNEAYKAAEDHDLVLNIIEFF
FT                   RTLRPSVDSFKDSSHYLRPRSRLKNKWRARIHALGAKPKIGFSWRSGLMTMSRWHEYTR
FT                   LIDWIELLLREDIEIVNLQYDLSSDERRLLGKLRPEALNRWPDLDLKNDLEDLAALSSA
FT                   LDVVIGPCTTITELAAAAGASVIYTATNAGGNWRTREPEGTDLFFPNMKMVFPQTPGSK
FT                   EELVKISLKELDTLLEATPN"
FT   gene            391314..392339
FT                   /locus_tag="Nhal_0393"
FT   CDS_pept        391314..392339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0393"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD;
FT                   3-beta hydroxysteroid dehydrogenase/isomerase; Male
FT                   sterility domain; short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; NAD-dependent
FT                   epimerase/dehydratase; KEGG: gme:Gmet_0458 polysaccharide
FT                   biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13583"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF5"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ADE13583.1"
FT                   /translation="MNPIENPFLSEKHILITGGTGSFGRAFVRSVLDRYPDIERLVVFS
FT                   RDELKQFEMSQEFSPSDHPGLRYFIGDVRDYDRLRRAMEGIDTVIHAAALKQVPAAEYN
FT                   PFEAIKTNVLGAQNVIEAALDTGVQRVIALSTDKAAAPINLYGATKLCADKLFTAANNI
FT                   RGHRDIRFAVVRYGNVMGSRGSVIPFFLERRKTGVLPITDPSMTRFNISLQEGVNMVLW
FT                   AVENAQGGEIFVPKIPSYRITDLAMAIGPDCEHKVIGIRPGEKIHEEMITASDSINTVD
FT                   LGRYFAILPMAAKYNRRQYCERNGCHSVEPGFAYNSGTNQEFLTVKQLRELIRVYVDGG
FT                   I"
FT   gene            392373..393275
FT                   /locus_tag="Nhal_0394"
FT   CDS_pept        392373..393275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0394"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   sdn:Sden_1760 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13584"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF6"
FT                   /inference="protein motif:PFAM:PF03966"
FT                   /protein_id="ADE13584.1"
FT                   /translation="MLTPRRLKALHEQGKNIAQLLREEQGLKRNTVEIIEIAYDLQAGS
FT                   YIAAMEDLEKTEYQMNYTYEIANIIDSLLEPMSILEAGVGEATTLSGVLKHLKKDVKSF
FT                   GFDLSWSRVAYARQWLQSRGFYDVTLCTGSLFHIPFADNSIELVYTSHSIEPNGGNESA
FT                   ILQELFRITKKYLILLEPGYELAETEARQRMDSYGYCKNLKGIAESLGFNVLRHDLFPF
FT                   SSNPLNPTAITIIKKEEDTMSPSHILACPKFKTPLDEIGNMLFSPEALVVYPIIGGIPC
FT                   LRIENGVFASKYHEVLSAG"
FT   gene            393313..393600
FT                   /locus_tag="Nhal_0395"
FT   CDS_pept        393313..393600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13585"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13585.1"
FT                   /translation="MSRILHAGFHKTASTFLQKELFPIRNNKFNSSFYGYNVIAAYRLL
FT                   NWMRQLHFLREIFGLFKIRPRRMMQGKLGRALNNLSHRHVTPKDVEYLFR"
FT   gene            393597..394757
FT                   /locus_tag="Nhal_0396"
FT   CDS_pept        393597..394757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0396"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   har:HEAR1121 putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13586"
FT                   /db_xref="GOA:D5BVF8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF8"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ADE13586.1"
FT                   /translation="MIPYGHQSIAQTDIDAVVEVLRSDFLTQGPVVPCFERAVAEYCGA
FT                   AHAVAAHSATSALHLSCLALGVGPGDRVWTSPITFVASANCARYCGAEVDFVDIDPRSY
FT                   NLCPRALERKLVAADRAGRLPKVVILVHLAGHPCDLAAIHALGQRYGFRTIEDASHAIG
FT                   GRYRGEPIGNGRYSDITVFSFHPVKIITTAEGGMALTNNAELASRMARLRSHGITRDPE
FT                   EMTHPPDGPWYYQQHELGFNYRMTELQAALGLSQLQRLDGFVVRRHGLAARYDDALREL
FT                   PMIIPWRHPDGYSGFHLYVIRLKLDQIRKTHREVVEALGAAGIGVNLHYIPVYRQPYYA
FT                   RMGFHPADFPESERYYAEAISLPLYPGLTEAQQAQVIEALFEVIKS"
FT   gene            394754..395479
FT                   /locus_tag="Nhal_0397"
FT   CDS_pept        394754..395479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0397"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   aeh:Mlg_2324 acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13587"
FT                   /db_xref="GOA:D5BVF9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR020039"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVF9"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ADE13587.1"
FT                   /translation="MNIAIIPARGGSKRIPRKNIRDFGGKPMIVWSIETAAASGLFEHI
FT                   VVSTDDDEIAQVAVDAGAEVPFRRPAELADDYTGTTEVIAHATRWLLDQGWSIEAVCCL
FT                   YATAPFVRAEDIGRGLELLQSDNWAYTFTATEYAAPIFRSFRIHPQGGIEMLFPEHFTT
FT                   RSQDLPLILHDAGQFYWGWSEAWLEQKGLFDRHSCPLVIPRWRVQDIDTEDDWQRAELL
FT                   RDSISRQAVASLDKGHKGP"
FT   gene            395476..396984
FT                   /locus_tag="Nhal_0398"
FT   CDS_pept        395476..396984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0398"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pfo:Pfl01_1522 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13588"
FT                   /db_xref="GOA:D5BVG0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADE13588.1"
FT                   /translation="MNVAFRVDASPRIGTGHLMRCLTLADVLKSRGWETRFICRHIPDH
FT                   LAELLKQKNHPLMRLAGKGCTDSADELAHSGWLGARQAQDADDTLQALAGASLDWLIVD
FT                   HYALDIRWESVIRQSSRRILVIDDIADRSHDCDILLDQNLYADMEARYTGKVPSHCQCL
FT                   LGPRYALLRDEFGRLRQQVKPRAGPVRQVLVFFGGVDADNFTGKAIQALVNLRDERFQV
FT                   DVVIGAQHPARVDIEADCQRYDYRCHVQTAHMAELMASADLAIGAAGSASWERCCLGLP
FT                   TLAISVADNQRQMVHEAAEHGLLYAPTDNVGTVSFFERHIQALLENPYLRTCLSKAGMG
FT                   AVDGRGVFRVIRELGCHRVALRPARFDDAASLFAWRNHPGNRAFSRTSEPIAWTDHRRW
FT                   LATVLANPDRPLLIGFHDHHPIGVVRFDIDTDTAEISVYLVPGLNMRGFGTELLASAEQ
FT                   WLSEHRRDIRMIRAEVLGDNLPSHRSLRNSGYKVEVTHYTKRVH"
FT   gene            396988..398043
FT                   /locus_tag="Nhal_0399"
FT   CDS_pept        396988..398043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0399"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; SAF
FT                   domain protein; KEGG: pfo:Pfl01_1523 N-acetylneuraminate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13589"
FT                   /db_xref="GOA:D5BVG1"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG1"
FT                   /inference="protein motif:PRIAM:2.5.1.57"
FT                   /protein_id="ADE13589.1"
FT                   /translation="MSNSFKIGNRWIGRDYPPFIIAELSGNHNQSLERALAIVEAAAQA
FT                   GAHGLKLQTYTADTMTLDLAEGEFFIDDPNTLWKGCSLYELYQQAYTPWEWHELIFARA
FT                   GELGLIPFSTPFDETAVDFLETLDAPCYKIASFENTDIPLIRKVAATGKPMIISTGMAT
FT                   VAELDETVRAAREAGCQDLILLKCTSTYPAPPESSNVRTIPHLRELFGCEVGLSDHTMG
FT                   VGAAVAAVTLGARVIEKHFTLRRADGGVDSAFSLEPEEMAALVTETERGWQALGEVRYG
FT                   PTETEMASTGFRRSLYIAADLQPGDVLTPANLRRIRPGHGLPPKYYDTLLGKKVTKVVS
FT                   KGTPVDWSFIG"
FT   gene            398059..399084
FT                   /locus_tag="Nhal_0400"
FT   CDS_pept        398059..399084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0680 heparinase II/III-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13590"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13590.1"
FT                   /translation="MLWKHGFLIIFLSIVFCAQETNAAGPEHGPICRHIQHQQDMATCH
FT                   DEAVWKVLAKQRVDDEALPSRHITLFVGGDPIQRAGQLWETGFVPPGRDVAPWPFTLPV
FT                   DWNADPFQDRNWRFHLHAWRMIDPMIVAWERTGDKRYLQDALKVMTDWQDYHFGRNRRS
FT                   AFQWYDMSVGLRAMKLAYVLDRVLQGEVASDLPTWQTLVHLAHTHAQSLTDPTELSRGN
FT                   HGLFQLHGLMALCSILPDVDTCQGHEKYVLREMRDLLLRQFSSEGVHLEGAPEYHFFAL
FT                   STVRRMTRTGWYDQFAFVRELMDKVEKNRFWMVHPDGTMVTVGDSEPKRGCTNNCVTGD
FT                   L"
FT   sig_peptide     398059..398130
FT                   /locus_tag="Nhal_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.885 at
FT                   residue 24"
FT   gene            399108..400331
FT                   /locus_tag="Nhal_0401"
FT   CDS_pept        399108..400331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0401"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: son:SO_0708
FT                   transposase mutator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13591"
FT                   /db_xref="GOA:D5BVG3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG3"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADE13591.1"
FT                   /translation="MTSIEKKTDELLDELLKECNSPKEVLGEHGLLKQLSKRLVERVLE
FT                   AELTEHLGYAPHAQEGRGSGNSRNGKSKKRVQSEAGQLEIEVPRDRNGNFEPQLVKKRQ
FT                   RRLEGFDEKVLALYARGLSTREIEAQLEELYGVEVSPALISQVTDAVLEEVRAWQSRPL
FT                   SAVYPILYFDALFVKSRQEGMVKTKAVYLALGVNLEGEKELLGMWMSENEGAKFWLSVF
FT                   NELKNRGVEDCFIACVDGLKGLPEAIEAVFPQAQVQLCIVHKVRGSLKYVPWKQRRAVA
FT                   ADLRAIYGAATLAEAEQALERFSARWDETYPAISPSWRADWSRLTVFFDYPPQIRRAIY
FT                   TTNAIESLNYSLRKVLKNRGAFPTDEAIFKVLYLALNNITKKWTQPIRDWKAALNQFVI
FT                   LFAERMPK"
FT   gene            400328..401266
FT                   /locus_tag="Nhal_0402"
FT   CDS_pept        400328..401266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0402"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13592"
FT                   /db_xref="GOA:D5BVG4"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG4"
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /protein_id="ADE13592.1"
FT                   /translation="MKISYTKNLTPSPKQRNLTFPAGNQECEGASHGKESCYRLQEFRE
FT                   TGYAMVRSDWAVPPEQASMLFFMASFHEPAHKLPDDLSFEWYDRGGRILTNAGKYSYNS
FT                   DEWRNYVASTRAHNTVEIDKRSFSTRLADAYGSALQEVQRQDGAFLLRGSLFHKHLSTT
FT                   HDRTLLYAPGRWLAVIDSMGADRPRSYTQWFHFTPDIEVIADDGRYLATRNDGMKVHIE
FT                   HLSPAEETLLIRGQKEPFIQGWTTQTYGQMEPRYALGFTHQENNSTMVTLFGFSDQEMD
FT                   KAREAVQALVSRMELPRIDSARLSPLSIKRD"
FT   gene            402176..403738
FT                   /locus_tag="Nhal_0403"
FT   CDS_pept        402176..403738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0403"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   aeh:Mlg_0137 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13593"
FT                   /db_xref="GOA:D5BVG5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE13593.1"
FT                   /translation="MRKITNKIRLYVIGAILNGKNKSLKKRISEVLRVLPPLRAAWLAE
FT                   LGHIFYPLSLLKKGCYGFSNIVMLRDRLADMAAFLNADNSHEARAFKLPRKPYNGKVLY
FT                   ALHSCGPFDPSGYVSRSVGLIGAVQSKGIDTTVAIRPGYPWDLAQHAERSKVSEVHYQG
FT                   LRFRLSPESPVTRRHPESRYIKVYGERLQALAVENDVSIIHAASNYLNGWAAALAGRAL
FT                   GIPSVYEVRGLWHLSRAFANPDYADTEHYRYYEKREIGACAQVDHVITLSDGLRQWLMA
FT                   RGISGDKISVVGNAAFLPSVEKKDEASTALAVRRHYGIPADAQVMGYLGAIVEYEGLDI
FT                   LIRAHARTPLKHRPYLLIVGSGKHELVLRELVGSLETATQVVFAGRVSPDQVSAHYLAM
FT                   DAVALPRRDDMLTRLVPAIKPFEIIAHHRPLLISHALATALGNTLPEGYRVIDFDSVDR
FT                   LDLLVETNRDGRCPVKVPTWEERAAQLVDLYEQLADIGQRQSAPGDAPIKPPPGPLEPN
FT                   PAP"
FT   gene            404072..405814
FT                   /locus_tag="Nhal_0404"
FT   CDS_pept        404072..405814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_1386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13594"
FT                   /db_xref="GOA:D5BVG6"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13594.1"
FT                   /translation="MNNKFLNLTLDYLAWVRALSIKIWINSALKLFFGVLLFLTNQLSI
FT                   VLAFFLPLKVIILVGSEGVPRYLRAFVTEENKNEFIVWFAIGAFVFYLLFLLTGYLMNR
FT                   LGVSAATEILGRAKKVALFHQQELFAKDVFLRVARTWGTYFMVFLGFALGLILEWRVFS
FT                   VLLVFVVAEYAGFAYLWQQYQEPENSAKLMRFLRNRSVILDGVSALNFFTGFGILFYLF
FT                   LIDSSLNFIIGILLIMMTQQIFRRLVVAINDAVFLVQQKAKIQTVFFTYAHLDTQGKHI
FT                   HHSFEKMLLPERREALFATAAPGLSQGDVAGWRWVDCNIMGVAVYSLESAEGEKGHACY
FT                   WLKCYAGDKFNLLQKERLAYERGASGMQGMAPQLINEGSYHGTPFLLLQGGVLKRIQRR
FT                   EFKHRFKAARLKLWSLIPDGQIVSMLQRTFPTLEKRLHKNKLSLMSLASRDADEYGRIA
FT                   RFVERSEIFTDFISTMPLFITNNVFKENNLFLDAEEQPVFLHWHRMALEPVCSDITPNS
FT                   LEVFFDLEEIAAHLQEHRSDAANITALDLKKIVYLAAIERAISLQLYGEALDLVQPTLE
FT                   MFDA"
FT   gene            complement(405857..410635)
FT                   /locus_tag="Nhal_0405"
FT   CDS_pept        complement(405857..410635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0405"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /note="PFAM: NAD-glutamate dehydrogenase; KEGG:
FT                   noc:Noc_2978 NAD-glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13595"
FT                   /db_xref="GOA:D5BVG7"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG7"
FT                   /inference="protein motif:PFAM:PF05088"
FT                   /protein_id="ADE13595.1"
FT                   /translation="MKIFVEVRESQGTYSDYEQKLIEIHSLLDKQKKIHEKRFLKTLSS
FT                   LLITPDSFLLSVPSYRLAPLITQFFTIIGARETEIAAHCLPFPEKTGTLVLISSPDASY
FT                   LIASLKALQESQDLTFEIMAHHVLMIKRQGQEIIDLKAGSELGPKESLILLKLEETDKE
FT                   HLQNFTACIEKIFSQALNVQRNKESLAAKLSQLEQASVFQPWRNFLGWIREGAFIPFSY
FT                   HCFIVNSQADGEFHLQENERLGLSLDSLLGSLTTKANLSPLLAILGPEEVQREFPVLVQ
FT                   QTAIKSALYRSEPLVYLGFQEPLEKGKHKEHAFIGLFSETALAGTAMNIPALRNKVEQS
FT                   LKQLHVPTAGHEYDKLIELFNLFPKVELFFMGEIQLQIIARSLLSFLYRSDLVKLLILA
FT                   SPSPTRIATLVLIPQDFFDESHLSDIEAYLCRAFTGRLENSQVIRGTRNHYVGLHLTFL
FT                   PQQKEVHIPINRLENTLSQIAKPWDYKLQLLLQQAMGKEQGEVLWNKYRRGFSPEYRAL
FT                   IPPQAALQDIKGLEHVLETEQQFIDLWDSRYELPKEHYRLQFYSSRESFLDELMPVLEN
FT                   LGLRVIDQVRFALKVENRGLFIKSFSVKVTRDTAKPLSSLRAPLLDALTALFRGEVDND
FT                   PLNELLVLTGLSWKEIDIFRSYRNYYFQLGTPFTLSRFHQSLSHNPQVALLLCRYFEAR
FT                   FRPDPRWEDPMRREEEGLLPIRLELATALKSVTNVNEDRILRTLFNLIDATVRTNFYRR
FT                   QTQKDYFLAFKISSLGVIDMPTPRPMYEIYIHSAAMEGIHLRGGHVARGGLRWSDRPDD
FT                   FRTEILGLMQTQMMKNALIVPVGAKGGFIVKRPFSTREEGARLSKQAYITFIQGLLDLT
FT                   DNRQGDAIVRPPKIVAYDEADPYLVVAADKGTAHLPDTANEVAKQYHFWLGDAFASGGA
FT                   FGYHHKKLGITARGAWECVKRHFRELDQDIQTQPFTAVGVGSMDGDVFGNGMLLSRQTR
FT                   LRAAFGAAHIFIDPDPDPEVSYKERKRLFELPGSSWDDYDRTLISEGGGVYSRQDKDIP
FT                   LSPQVRQWLNTRHRFMDGEGLIRLLLTAPADLLWFGGIGTYVKASTEKHLDVGDRANDS
FT                   VRVDASQVQARVVGEGANLGFTQKGRTEYALGGGHINTDAIDNSGGVDLSDHEVNLKIL
FT                   FNHLREKGIITSWEEQNQCLEKVKEEVCQQVLANNYSQSLCLSLDRQRCLRDLEPFMEV
FT                   ANRLENAGLLDRLADAFPHHKEVLARHGEGLTRPELAVLMSYSKMQLYQILLEQPDFLS
FT                   SLFLQEFVVRYFPQAITDQFGNQLYDHPLAKEITATILCNTIIDHAGCTFLTWIEELKG
FT                   TAITTLVVTYLTFDKVLAGEALRAQIYALDNIIPSARQHALLLQLEDTLASFCHWTVSQ
FT                   DKPITPREETLSSLHDHLAQYEQHQEQNLSESERRLFSEKLKELQEEGFTAALARRIAL
FT                   WDRLTDFPLLVDLVNESGEEFTTVVSAYEGVSNYLGYPDIKDLLSRVPVRDRWERRAQT
FT                   TFRERFRAYLATLTLAILATPDRSMATFFAAQDRQQKLLKYQRLLEELQETSPTDLLPF
FT                   TVLNSQLESLVRA"
FT   gene            complement(410890..411315)
FT                   /locus_tag="Nhal_0406"
FT   CDS_pept        complement(410890..411315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0406"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: noc:Noc_2977 anti-sigma regulatory factor (Ser/Thr
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13596"
FT                   /db_xref="GOA:D5BVG8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADE13596.1"
FT                   /translation="MCNGDIQLDIVVPNKTCYLGFIGEIGEKVAEELDRYSGDRKALAY
FT                   HLNLALTEALVNAIEHGNTGDSEQTVHVTIQVLPDQLCIKVYDHGQGFDLDRVKTPDLE
FT                   DPGERGRGIFLIKSIMDSVSYHKINGGNVLEMRKILD"
FT   gene            complement(411369..411665)
FT                   /locus_tag="Nhal_0407"
FT   CDS_pept        complement(411369..411665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0407"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: noc:Noc_2976 anti-sigma factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13597"
FT                   /db_xref="GOA:D5BVG9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG9"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADE13597.1"
FT                   /translation="MNLHMEKSNGTVVLYIKEKRLDAHNSGELKDRMLELGENGKIHLV
FT                   VDLAEVRFIDSSGLGALLSGHKNTSLRNGSFKLCGLQSQVQSMFELTRFAPGL"
FT   gene            411899..413401
FT                   /locus_tag="Nhal_0408"
FT   CDS_pept        411899..413401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0408"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: AAA ATPase; single-stranded nucleic
FT                   acid binding R3H domain protein; KEGG: noc:Noc_2975
FT                   single-stranded nucleic acid binding R3H"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13598"
FT                   /db_xref="GOA:D5BVH0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034081"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH0"
FT                   /inference="protein motif:PFAM:PF01424"
FT                   /protein_id="ADE13598.1"
FT                   /translation="MNLQNSTDDLQQLIGILPRSLRTVLQGLPQQHLLEIIMDVGRSPQ
FT                   ARFSGQTVNLSADPVSPADLEQVVASVGEFSADNRAGIEGTLHRISCLRNRRGKIIGLT
FT                   LRVGRAVTGTIDSIRDLIERGASLLLLGRPGVGKTTRLREIARVLADEFGKRVIIIDTS
FT                   NEIAGDGDIPHPAIGSARRMQVPHPERQHGVMIEAVENHMPEVIIVDEIGTGAEATAAR
FT                   TIAERGVQLIGTAHGNTLENLVMNPTLADLVGGVQTVTLGDDEARLRGTQKTINERKAP
FT                   PTFDAVVEIVDREAVIVHPDTAGAVDKLLRGLDPGGIRRSPQGEVVFLPEEPPPQESPR
FT                   QVSTINQTGWVRIHPYALSRDTVERVIRDLRLEARTVKRPDQADFILALRSRAEDARLR
FT                   RILQATQLPLYVVKKNTTAQIRRLLQNVFNILHGMPRDEVDAAVGEAEAAIKRVMEEGV
FT                   TVALLPRPASMRKLQHRLAARHRLTAESVGSEPQRHLIIHPT"
FT   gene            complement(413446..413847)
FT                   /locus_tag="Nhal_0409"
FT   CDS_pept        complement(413446..413847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0409"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: noc:Noc_2974 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13599"
FT                   /db_xref="GOA:D5BVH1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH1"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADE13599.1"
FT                   /translation="MGMSLGTADDLGKLILRLTLGILILFHGIGKITHGISGIEEMVQG
FT                   IGLPPSAAYGVYLGEIGGPLLLLLGWYARVGAGLIAINMLFAIFLAHRPELLNLTPQGG
FT                   WALELQGMFLLTALALTLTGPGRFSLNNR"
FT   gene            414017..417178
FT                   /locus_tag="Nhal_0410"
FT   CDS_pept        414017..417178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0410"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; glycoside
FT                   hydrolase starch-binding; KEGG: pin:Ping_2529 glycoside
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13600"
FT                   /db_xref="GOA:D5BVH2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH2"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ADE13600.1"
FT                   /translation="MNPSISLWWRIAATLLLLCCSSLALAEVQRLKFEAEGNYLLVEWL
FT                   DDDLLHFEYGPGAGPVTDQPLITTDMVCQEGEAVPEVVCGTDFTGPTQFNQEGDTVIET
FT                   QEVRLVIEPRTLLVTVIDRSRNDKVLTTFHPLNLDQEFKGLVFTRTPELDVYGLGQQFV
FT                   EPGTSDIDWDGRVREGGEFGNVMAGFNGGANGNTQIPVLYAVNGASYENYALFLDNTYK
FT                   QRWDFRGDSQWQVEMFGEVIRFYLMTGPDLLDLRRDYMDLVGHPPVPPKRMFGLWISEY
FT                   GYDHWDELMGKLNSLRSHKFPLDGFVLDLQWFGGIPDVTGECRMGSLDFDRGAFPAPAD
FT                   TMATLRNQHQVGIMLIEEAYVCASLPEHQKLQAEGCLVKHRPGSPEPVFLCGFFGCGSM
FT                   IDYTDEGCARFWHDDERQKLIESGVIGHWTDLGEPEFFSPEAGYGAGRHADAHNIFNFR
FT                   WLRGIYRGYQRHQVQQRPFMMSRSGTAGIQRFGAAMWSGDISSRLSSLAAHAANQMHMS
FT                   FSGIDYYGADIGGFHRNLEGDLNEMYTQWYAYGMMFDIPGRPHVENLCNCKETAPDRIG
FT                   DLHSNLENTRLRYRLIPYLYSLAHRAYLYGEPVMPPLVMYYQSDPNVRSLGHEKLIGRD
FT                   LLAAMVAEHGETERDVYLPQGTWFDWHSGRKIASSGMWLPKVPVQRNGVLRLPLYARAG
FT                   ALIPLMPVDEKILNALGERRDGPMDPNLQVRVFPVEEGAETQFTLFEDDGKTLAYQEGA
FT                   VRTTRISQLRTGAEVLSVMVAAAEGTYAGAPSSRNVTIELVTEKEAEAVQLNGTPLPKR
FT                   ASLTEFQQHETGWMKGSQGRVLAKSGLLPVNQSRQFAFKLKESPPCTSTYRSISVPGEG
FT                   NGWNPADPQRTLTSCTGKIWQGRITLYQEQYKFAADGAWTVNWGQDGQQDGPNFPARSP
FT                   GVYEVTFNEADPAHPRFDFLQEAPAQPLHFVCENGHTVPGISVYVVGNVDELGAWEPGK
FT                   AIKLEPDGPYPTWTGWIPNLPPETPIEWKCIKRQEQGESPQVVQWEPGDNHIVDRGQAE
FT                   QRGGF"
FT   sig_peptide     414017..414097
FT                   /locus_tag="Nhal_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(417443..418351)
FT                   /locus_tag="Nhal_0411"
FT   CDS_pept        complement(417443..418351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_3673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13601"
FT                   /db_xref="GOA:D5BVH3"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13601.1"
FT                   /translation="MTEKTTPPGRPLEIRIRITYPRAAPEKASSQNQGKALGKEYSPWV
FT                   VSLVLFFLMGGLLIFLYAHFQDPAGKPGLVLEPQIAPEGSGNLIAQEAPSSNGLHSPPE
FT                   AVASAPYNKEDFFQKLETFQTEPPKETLPTVTPAPKKAPTETKLKERVEARASRQEQNP
FT                   SIPKTLPPRTDKPGTISEEKQPQLALVEPETGIIRAQFTTGIKKREPIDEAGPVILAKK
FT                   DLTRLYYFTEVKGMAGETLIHRWEHEGEVMAKVRFPIGGDPWRTYSSKYLTPAMTGQWR
FT                   VVVTDSKNTPLHASRFVYRSP"
FT   gene            418695..422549
FT                   /locus_tag="Nhal_0412"
FT   CDS_pept        418695..422549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0412"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   tgr:Tgr7_2778 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13602"
FT                   /db_xref="GOA:D5BVH4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH4"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ADE13602.1"
FT                   /translation="MDMPDRIREIPYNYTSFSDREIVIRFLGEELWTVIEELRGQRRTG
FT                   RSARMLFEVLGDMWVISRNPFIQEDLIENRKRWQSLRHALHHRLDQIQARAEGNALALR
FT                   LVEQARQAVLKFERELLDLRERHRQARRRLARTTARHNLHFDGYARVAHMTDATDWRVE
FT                   LPLAVVTPDSEAEMAAVIKACVDLGLTVIPRGGGTGYTGGAVPLTPDSVVVNTEKLEDL
FT                   GEVTERWLPGVEGQVPTLRAEAGVITKRVSEQAAAKGLAFAVDPTSQDASTIGGNIAMN
FT                   AGGKKAVLWGTTLDNLVSWRLVTPEGLWLEVERLNHNLGKIHEVEFAEFRITRYEADGR
FT                   TLRGEPEVLRIPGKAFRKPGLGKDVTGKTLAGLPGIQKEGCDGLITSGVFILHRMPKFI
FT                   RTVCLEFFGTHLRQAVPAIVETKDYLDGCEGVVLAGMEHLDERYVRAVDYSTKAPRREL
FT                   PKMVLLIDVAGDDEDAVAKAASQVVRMANGRDGEGFVAVSPEARARFWAARNRTAAIAA
FT                   HTNAFKINEDVVIPLEKLADYNDGIERINIEQSTSNKLTMIEAVLAYLDSDPPELHPSE
FT                   LEHQASDESETIIAAKREAARTQLREVRDRWQAILTQIDGSAQEAESLLDEGARERLRS
FT                   GDTLFDLLQRRDLRISYRREVEQPLKEIFGGLEFARLREQLDRLHAKIRSSRLFVATHM
FT                   HAGDGNVHTNIPVNSNDYAMMREAERIVERVMVLAGQLGGVISGEHGIGITKMQFMARE
FT                   EIEAFARYKMEVDPTGAFNRGKLLPGSGLERAYTPSLRLLEQEALILEASELGDLNNDI
FT                   KDCLRCGKCKPVCTTHVPRANLLYSPRDKILATGLLIEAFLYEEQTRRGISVRHFGEMN
FT                   DVADHCTICHKCESPCPVNIDFGDVTIKMRSILKAHGRRRANVGAWASMAFLNVTDPAT
FT                   IKLMRKAMIEWGYKGQRLAHGWAKRLRLLGNGKKRPLPTTGKTPIRAQVVHFMRKPMPG
FT                   GLPTQTTRAMLGVEDDKLIPILRNPHKASEDAEAVFYFPGCGSERLFSQVGLATLAMLY
FT                   EVGVQTVLPPGYLCCGYPQTSSGDTKKGQAISTANQVLFHRVANTLNYLDIKTVIVSCG
FT                   TCMDQLLKYQFEQIFPGCRLLDIHEFLMEKGLSLEGVSGVRYMYHDPCHTPMKSYAPLE
FT                   VTSRLVGQQVTLSDRCCGEAGTFATARPDIATQVRFRKEEEIKKGVKQLTGQEVATSGQ
FT                   VKMLTSCPACQQGLERYAGATGVETDYIVVELANNRLGEGWQQAFIEKANYGGIERILL
FT                   "
FT   gene            complement(422638..423099)
FT                   /locus_tag="Nhal_0413"
FT   CDS_pept        complement(422638..423099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13603"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH5"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2593"
FT                   /protein_id="ADE13603.1"
FT                   /translation="MEKRRVVIAILAGGWVTLSQAGGVYKCIDEQGRIHYADRPCRGVV
FT                   AQETVEIKSRSSSNPLLLENGRQAKQKELLQTWQEERKQKQQAEEEARKQKEQRSRNCA
FT                   AAKSRLHLIESARRLFKMDENGERHYYSDSERTQKLQEAQKQVNKWCSP"
FT   sig_peptide     complement(423034..423099)
FT                   /locus_tag="Nhal_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.980 at
FT                   residue 22"
FT   gene            423585..425012
FT                   /locus_tag="Nhal_0414"
FT   CDS_pept        423585..425012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13604"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH6"
FT                   /inference="similar to AA sequence:KEGG:Noc_2973"
FT                   /protein_id="ADE13604.1"
FT                   /translation="MRKKNSLLGMGLTAATLVASLPLQAAEMPKTMEEMWEIIQAQQKE
FT                   IETLKAKSQGLEEETQSEASEKATETTSTADEGGQTKEQVKELERKTDVLAEAVEKLRT
FT                   ELYIPEEFEYKSMYGLGPAASKVYQVGKGLSIGGYGEGRYQTFVNGDKEDNADFVRLVL
FT                   YAGYRFTDRILFNSEIEFEHASTGKEGSVSVEFAALDFLLDPRANIRAGLVLLPMGFLN
FT                   PIHEPPFYFGNNRPEVERRILPSTWRENGVGLFGELWPGLTYTTYAVNGLDASGFDSSG
FT                   IRGGRQSGSKALAEDLAFVGRLDYAPPGMPGLSFGGSAYVGNSGQDQTFAGEELDVFTQ
FT                   LYEGHIQWQYRGWWFRALGAWGSIDDAEVLSAAKGETVGENNFGWYTELAYNVLPLIWP
FT                   ETTQYLAPFFRFEQLDTIASTPSGFRDNGAFDRDIYQFGVNYKPIPNVVIKADYRNFEA
FT                   EDGRPADEFNLGLGFIF"
FT   sig_peptide     423585..423662
FT                   /locus_tag="Nhal_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            425077..425640
FT                   /locus_tag="Nhal_0415"
FT   CDS_pept        425077..425640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0415"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: noc:Noc_2972
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13605"
FT                   /db_xref="GOA:D5BVH7"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH7"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ADE13605.1"
FT                   /translation="MEPMNTFKQGRSALLILLMGVLVASNAMGTIYYGKKEALELAFGE
FT                   EAQVEMQSLFLTEEQVAKIEQLARTKLESKLFTFYVGRHEGKLLGYAAIESHTVRTKPE
FT                   TLLIILTPTGELDQIHVLAFHEPPEYQPPERWFAQLYRRQLSELNLNYGIQGITGATLS
FT                   SRAATSSARKVLAIYQIAIKEKAD"
FT   sig_peptide     425077..425166
FT                   /locus_tag="Nhal_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.823 at
FT                   residue 30"
FT   gene            425640..426620
FT                   /locus_tag="Nhal_0416"
FT   CDS_pept        425640..426620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13606"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH8"
FT                   /inference="similar to AA sequence:KEGG:MCA2732"
FT                   /protein_id="ADE13606.1"
FT                   /translation="MGCGLASRQASNAAKIRPRDFVETQEGLIFSVVTHHQEEGRALGV
FT                   LRYVKKGACWRKVNTPQADSLLETHYPYYLYDSPRLDARLHGVPVTRVVRHYQSQLRLA
FT                   EILTPSSGDEIEEKVRGLVQLFEAGGLYSQNLGITGSLLIGVQQVGSDIDLVVYGQKNF
FT                   QQARRIIKQALTKGQLDPLDETLWRETYKRRGCSLDFQEYLWHERRKYNKAVWEGTKFD
FT                   IVLVSRPEEIKGDSRYFHKQGKRKLQAQIKDGSEAFAYPARYRLVHAEIDTVVAFSHTY
FT                   VGQAETGEWVEVVGQLERASDGELRIVVGSSREALGEYIKVIPLP"
FT   gene            426691..427221
FT                   /locus_tag="Nhal_0417"
FT   CDS_pept        426691..427221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0417"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   noc:Noc_2971 cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13607"
FT                   /db_xref="GOA:D5BVH9"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVH9"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ADE13607.1"
FT                   /translation="MQSTVWFITLACVALLAAVFYYVISNSKTPEEYPPIQKKWYSFRG
FT                   KWFLFLAGLWVVVTFATLMPFPIAPQAQAYSGDGYQVVDVSGHQWYWTMSTDTVVAGKP
FT                   VAFQVTGADVNHGLGIYDEDLTLVAQVQAMPGYTNKLIYTFDEPGKYRILCLEYCGLAH
FT                   HAMIAELNVEAAS"
FT   sig_peptide     426691..426774
FT                   /locus_tag="Nhal_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.649 at
FT                   residue 28"
FT   gene            427262..428737
FT                   /locus_tag="Nhal_0418"
FT   CDS_pept        427262..428737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0418"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   noc:Noc_2970 cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13608"
FT                   /db_xref="GOA:D5BVI0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI0"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ADE13608.1"
FT                   /translation="MSTTTLSGTVSYSEAENQGALVAVKTHLIVGILVFLLMMLAGAVM
FT                   RAAQGNMFTISPDLFYQFMTVHGAGMVGTAGIASTGVLWYFLRQYVQLSTKIFWINFGI
FT                   FLTGVVLILGSIFLGKYGGAWTFLYPLPGISLGAWSAGAAAAFLLGLLVIGTGFLILYL
FT                   DVGRAILARYGSFGRALGLPQLFGKEPVDTSHPPTVVAGTMVLIVNFLGIAAGAVVLVM
FT                   MLVNLYNPEFKPDALLIKNLIYFFGHVFINATIYASVTAVYELLPRYTGRPWKTSKVFY
FT                   AAWLAIVFMVMAVYPHHLMMDFAMPPWALIVGQVLSYGSGVPVMVVTGYGALMIVYRSG
FT                   IQWNTTTKLLFLSMFGWAAGVIPAIIDAMVTVNRVFHNTLWVPGHFHFYLLLGLLPMIF
FT                   GFAYHLLGEAKEGGTTMADRLGFYSFLGGGLLLAFTFLASGASSIPRRWAVHMDEWIPM
FT                   AHWGTLAAILVVLGVLLFTWRALTALPRAPEPS"
FT   gene            429007..429633
FT                   /locus_tag="Nhal_0419"
FT   CDS_pept        429007..429633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0419"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   noc:Noc_2969 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13609"
FT                   /db_xref="GOA:D5BVI1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI1"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADE13609.1"
FT                   /translation="MKTLFLSTLLAMAGLATLWFGTDGGRAFTAEEARRLEVREHPKPV
FT                   PNWQLENQDAKAIALGNWQGQYVVVDFIYTSCPSVCLTLSSGMQSLRKEFSEALEKEKL
FT                   HLLSISFDPEKDTPERLRTHLSHFSGDGEQWVAARPTHPVEKKAILDFFKVTVIPDEMG
FT                   GYTHSAGYHVIDTQGRLVAIFGVEEYPKLQEYLTIALAEGESHEG"
FT   sig_peptide     429007..429096
FT                   /locus_tag="Nhal_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.867 at
FT                   residue 30"
FT   gene            429623..430231
FT                   /locus_tag="Nhal_0420"
FT   CDS_pept        429623..430231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0420"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: noc:Noc_2968 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13610"
FT                   /db_xref="GOA:D5BVI2"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI2"
FT                   /inference="similar to AA sequence:KEGG:Noc_2968"
FT                   /protein_id="ADE13610.1"
FT                   /translation="MKVRQGWYLPCLVWGVLALPPLRYALELSMVTHMLVQLPALAFLG
FT                   WWLGQTLPEEFKRKIAPWNRWGITGMVLVVVTVLYWMLPRALDAAISEPAFEMIKFITV
FT                   PLFIGTALNLSWFQLSSIAQGVLKLEFWAMFMRLGWLYMVLPDRLCANYLLGEQRILGR
FT                   ALLILGSIWAASWTLRILFGVRWRKPRLLAPSSSLPEKK"
FT   gene            complement(430309..430770)
FT                   /locus_tag="Nhal_0421"
FT   CDS_pept        complement(430309..430770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0421"
FT                   /product="transcriptional regulator, Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   noc:Noc_2967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13611"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI3"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADE13611.1"
FT                   /translation="MQLTQYTDYSLRVLIYLSLHDEQLATISEIASSYNISRNHLGKVV
FT                   HNLANLGYIDTTRGKGGGMRLSQAPEKINLGRIVQQTEGRFDVAECFNTTHNTCSISSC
FT                   CQLKDVFWEARCAFLAVLNRYTLADVIKNKNELRSSLRVEWFPPRAAGY"
FT   gene            complement(430887..434549)
FT                   /locus_tag="Nhal_0422"
FT   CDS_pept        complement(430887..434549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0422"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein;
FT                   Hydantoinase/oxoprolinase; KEGG: noc:Noc_0378
FT                   5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13612"
FT                   /db_xref="GOA:D5BVI4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI4"
FT                   /inference="protein motif:PRIAM:3.5.2.9"
FT                   /protein_id="ADE13612.1"
FT                   /translation="MKQVQARRGWQFWIDRGGTFTDIVAKAPDNTIKTHKLLSENPSHY
FT                   RDAALQGIRDLLGLGPQDPIPATRIDSVKMGTTVATNALLERRGEPTVLVTTQGFGDAL
FT                   RIGYQNRPHLFALHIKLPEMLYQQVIEVDERYSAGGEVLQPLNLDTVRQQLQSCYDRGL
FT                   RSVAIVFMHAYRYPHHEQTVARIARDIGFTQISTSSEVSPLMKLVSRGDTTLVDAYLSP
FT                   ILRRYVDHVAAELGDTRLLFMQSNGGLTEAHCFQGKDAILSGPAGGVVGMARTSELADF
FT                   HQVIGFDMGGTSTDVSHYAGEYERAFETEVAGVRIRTPMMQIHTVAAGGGSILHFDGAR
FT                   YRVGPDSAGAQPGPACYRKGGPLTVTDCNVMLGKLQPEFFPKVFGPHANQPLDEAIVQE
FT                   KFTALAAEIKTATGDDRTPLQVAEGFLAIAVENMANAIKRISIQRGYDVSEYGLCCFGS
FT                   AAGQHACLVADALGMKRALIHPYAGLLSAYGMGLADLRSLREMAVEAPLREELMPTLAA
FT                   TFDQLMAQGEQEILAQGVAQECISSVRKLHVRYQGTDTALLVNFDHQTEIAAEFAKVYK
FT                   QAFGFLMPEKPLIVESAQIEVIGRNPLWSDPTSFESPPPRQGTVPTIATVTATLGGKTQ
FT                   DTPIYQREAMQPHDRVSGPAIIIETNSTTVVEPGWEAELTPRRDLVLTRMIPLPKQLDI
FT                   GTQADPVMLEIFNNLFTSIADQMGAVLKKTASSVNIKERLDFSCAIFDQQGDLVANALH
FT                   IPVHLGSMSASIKAVIRDHREHISPGDVFMLNTPYNGGTHLPDVTVVKPVFDKSEAQLL
FT                   FYVAARGHHGDIGGITPGSMPPYSQTIDQEGIVIDNVKLLEGGRFLEQEVVALLSSGPY
FT                   PARNIPQNLADLKAQVAACEKGVQELRRMVDHFGLEVVQAYMKHVQDNAETSVRRVLET
FT                   LKDGSFTYPMDDGSKIKVSIRIEEPSPQEGIQALIDFSGTSPQHLGNFNAPAAVTMAAV
FT                   IYVFRCLVKADIPLNGGIFKPLKIVIPEHCLLNPCYPAAVAAGNVETSQYIVDALLGAM
FT                   GVVAASQGTCNNFTFGNEQYQYYETICGGAGAGPNFKGADAVHTHITNTRLTDPEILEW
FT                   RFPVLLESFEIRKESAGNGRYPGGNGTVRRFRFLEPMTAAIISSHRKIPPFGMAGGEPG
FT                   QVGRNWIERVDGSVVELSSCGQAQMGIGDIFIIETPGGGGFGAPLHTSGATSNG"
FT   gene            434791..435948
FT                   /locus_tag="Nhal_0423"
FT   CDS_pept        434791..435948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0423"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0442 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13613"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI5"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADE13613.1"
FT                   /translation="MVTQRAYKFRFYPTPTQKRQLAIEFGHTRYVWNWALERRTKAYQA
FT                   QGESLNTISLSRQLTVLKQTECPWLSEATASCHTQKLRDQDRAFKNFFAGRGKYPRFKK
FT                   RHQTQSVRYQLDQRHVAKNFNAESKRLKLPKLGTLKLKWSQRMGGIPKMVTVSKDPAGR
FT                   YFVSLACEVEIAALPARKNAVGVDVGVKDVVITSDGYKSGAPKYTYRYARQLKRAQRRL
FT                   SKKRKGANRRRQQQQRVARIHARIADSRRDFLNQQSSKLINENPVICLEDLNIKGMLRN
FT                   RRLSKAVADCGLYELRRQIEYKAAMYGREVLIVDRWVPTSKTCSECGTIQEPMPLKVRE
FT                   WVCRDCNTSHDRDINAAKNVLMLGTAGSAETDKARGAVKTPRAVA"
FT   gene            436566..436850
FT                   /locus_tag="Nhal_0424"
FT   CDS_pept        436566..436850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0424"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   noc:Noc_2966 histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13614"
FT                   /db_xref="GOA:D5BVI6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI6"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADE13614.1"
FT                   /translation="MNKTELVNFVASEANLSQADAQRAVNALLQTIEQTLGEKGMVSLV
FT                   GFGSFSVQKRSARSGRHPQTGETITIPATNVPVFKPGKALKEAVQQRKR"
FT   gene            437127..437555
FT                   /locus_tag="Nhal_0425"
FT   CDS_pept        437127..437555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13615"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13615.1"
FT                   /translation="MGKFILFCLALFTMGSVWASDDPSPGVEFPELVITYRYENFPSFP
FT                   SHAQAEAHTPKEGKRVLGSAKIIKLRWRELAEAKILVSFIVEETHFDDKGEVIYRAHST
FT                   FSGEGRSMEEEGRKIEEEVLEGRKRLELFSWWPIGSLP"
FT   sig_peptide     437127..437186
FT                   /locus_tag="Nhal_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(437710..438624)
FT                   /locus_tag="Nhal_0426"
FT   CDS_pept        complement(437710..438624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0426"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: sfr:Sfri_0093 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13616"
FT                   /db_xref="GOA:D5BVI8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVI8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADE13616.1"
FT                   /translation="MAITPLNQKNRSFPFPSARLEKEKKIFILTGILLTALIFIFDYLT
FT                   PPGIASSISYIGVVFIGLAARSPLALLLFAGLSSLLIVCGVLLSPEPPAPFNTVMVNCT
FT                   LTLFAVWLTASFCYLHLHSVLTLQHLAHRDQLTGVYNRHYLIAKGSEQIKMWQRYQMPF
FT                   SLIILDIDYFKKINDQYGHGAGDQVLKHIAKLLQSQTRNVDTICRYGGEEFVILLPMVD
FT                   LDGALAMAHRIQRALSKSSLPWETMTFRPTVSMGVAELVDKRWDLDKLIAEADMALYQA
FT                   KSLGRNQIIPMSMSKLARISSAT"
FT   gene            complement(438864..440087)
FT                   /locus_tag="Nhal_0427"
FT   CDS_pept        complement(438864..440087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0427"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: son:SO_0708
FT                   transposase mutator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13617"
FT                   /db_xref="GOA:D5BVG3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVG3"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADE13617.1"
FT                   /translation="MTSIEKKTDELLDELLKECNSPKEVLGEHGLLKQLSKRLVERVLE
FT                   AELTEHLGYAPHAQEGRGSGNSRNGKSKKRVQSEAGQLEIEVPRDRNGNFEPQLVKKRQ
FT                   RRLEGFDEKVLALYARGLSTREIEAQLEELYGVEVSPALISQVTDAVLEEVRAWQSRPL
FT                   SAVYPILYFDALFVKSRQEGMVKTKAVYLALGVNLEGEKELLGMWMSENEGAKFWLSVF
FT                   NELKNRGVEDCFIACVDGLKGLPEAIEAVFPQAQVQLCIVHKVRGSLKYVPWKQRRAVA
FT                   ADLRAIYGAATLAEAEQALERFSARWDETYPAISPSWRADWSRLTVFFDYPPQIRRAIY
FT                   TTNAIESLNYSLRKVLKNRGAFPTDEAIFKVLYLALNNITKKWTQPIRDWKAALNQFVI
FT                   LFAERMPK"
FT   gene            440194..440682
FT                   /locus_tag="Nhal_0428"
FT   CDS_pept        440194..440682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0428"
FT                   /product="zinc transporter ZupT"
FT                   /note="KEGG: spe:Spro_4285 zinc transporter ZupT"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13618"
FT                   /db_xref="GOA:D5BVJ0"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ0"
FT                   /inference="similar to AA sequence:KEGG:Spro_4285"
FT                   /protein_id="ADE13618.1"
FT                   /translation="MPAELPYITYIAVLLLASLSVLTTLLGVALAIYIGRNERAIAVGI
FT                   GFSAGIMLLVSFLELMPEAIGEAGTGTASRAFMLGMLIVAVLHWVIPHTHLVEERGAYP
FT                   KALLKTAYLVAFGLILHDVPEGFAMANAYIASPSLGVLVALAIAIHNTPVEKGYLTER"
FT   gene            440708..441328
FT                   /locus_tag="Nhal_0429"
FT   CDS_pept        440708..441328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0429"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; regulatory protein MerR;
FT                   KEGG: xfm:Xfasm12_1564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13619"
FT                   /db_xref="GOA:D5BVJ1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ1"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ADE13619.1"
FT                   /translation="MKMQKRLVKIGEAAKLLGTTPDTLRKWEASGELLPARKTKGGTRY
FT                   YAVADLLGLADESSPTVCYARVSSHDQKEELERQHAMLEAYCAAKGWKAEVIKDLGSGM
FT                   NDRKKGLNRLLELILRGKMRRLVITHKDRLLRFGAELVFTLCEIQGIEIVIIHKGEQPS
FT                   FEEELAQDVLEIITVFSARLYGSRSRKHQQTVEALKNVAGAQD"
FT   gene            441306..442460
FT                   /locus_tag="Nhal_0430"
FT   CDS_pept        441306..442460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0430"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0401 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13620"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ2"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADE13620.1"
FT                   /translation="MLLAHKIELRPTLEQAAYLDKARGSRRHCYNKLLEHFFKPENNWS
FT                   KAAAYQHYIKVIRPEFPWYNEVSSRVTRNAIDDLDNAFKHFFRRVKKGEKPGFPKFKKK
FT                   DINDSFALRERTKFEVRGRKLRIEKLSTLIPMRQRLRFEGTPKQVTISKRAGKYFASIL
FT                   VDTEDYKDYSQKRAPSVGVDFGVKSLAVTSDGQVFPANNKLKRSLKKLKRLSKNLSRKQ
FT                   KGSHRRAIAKQRLAKLHYRIAKQRSAVLHELSHQLTASYDRIALEDLNVKGMVKNRKLA
FT                   RSIVDAGFAMLRQFIEYKAYLRGCTVERVDRFFPSSKMCSGCGQLHDITLADRALACDC
FT                   GLTIDRDLNAAINLNQYRRDTLKPDVKRTQESSKTALAASVLTV"
FT   gene            442504..443238
FT                   /locus_tag="Nhal_0431"
FT   CDS_pept        442504..443238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0431"
FT                   /product="putative selenocysteine protein"
FT                   /note="KEGG: dat:HRM2_15520 putative selenocysteine
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13621"
FT                   /db_xref="InterPro:IPR014426"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ3"
FT                   /inference="similar to AA sequence:KEGG:HRM2_15520"
FT                   /protein_id="ADE13621.1"
FT                   /translation="MLNTATDVVFSHFHGDHVPLVDANPYQLSVRALPHSFRELRCWSK
FT                   SGNDLSANMSKRFQDLADLLGTNLQVAEGRSEGGLSFSRSVPHGAPGSKMGTLMMARIK
FT                   VGTRVFVHASDIQLLDDPTVDQVINWWPDIVLAAGPPLYLDRLTNAERERAWEKAVRLA
FT                   QNIEVVILDHHLMRSEDGAIWLDTLSTTLGKKVYCAADYMGQPRRLLEAERVQLYAQMP
FT                   VPEGWHEAYAEGRANPDQYLLE"
FT   gene            complement(443331..443963)
FT                   /locus_tag="Nhal_0432"
FT   CDS_pept        complement(443331..443963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0432"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gur:Gura_3459 diguanylate cyclase with
FT                   PAS/PAC sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13622"
FT                   /db_xref="GOA:D5BVJ4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADE13622.1"
FT                   /translation="MPRTTPFELHHRRYDEWFMRHAAAYHSELLAVRTLLPWRGLGLSI
FT                   GVGTGRFAAPLGVQTGIDPTHEVLAYASKRGVSVVQSIAEALPFTDHSFDYALCVTTIC
FT                   FVDDAGAMLREAHRVLKSSGALVIGFIDRTSELGQHYLAHQAENVFYRDATFFSAAEVE
FT                   QLLHDTGFSEPVWVQTLSKTLEETREIEPLRAGYGEGAFVTVKVNRP"
FT   gene            complement(444022..444342)
FT                   /pseudo
FT                   /locus_tag="Nhal_0433"
FT   gene            444745..444948
FT                   /pseudo
FT                   /locus_tag="Nhal_0434"
FT   gene            445065..445163
FT                   /locus_tag="Nhal_0435"
FT   CDS_pept        445065..445163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13623"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13623.1"
FT                   /translation="MFMALEYEWGIIGAWFQGGEHYCLTVHKRRQA"
FT   gene            complement(445328..445414)
FT                   /locus_tag="Nhal_R0005"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(445328..445414)
FT                   /locus_tag="Nhal_R0005"
FT                   /product="tRNA-Leu"
FT   gene            445495..447666
FT                   /locus_tag="Nhal_0436"
FT   CDS_pept        445495..447666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0436"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: noc:Noc_2897 ribonuclease R; TIGRFAM:
FT                   ribonuclease R; VacB and RNase II family 3'-5'
FT                   exoribonuclease; PFAM: ribonuclease II; Ribonuclease B OB
FT                   region domain; RNA binding S1 domain protein; Ribonuclease
FT                   R winged-helix domain protein; SMART: Cold shock protein;
FT                   RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13624"
FT                   /db_xref="GOA:D5BVJ6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ6"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ADE13624.1"
FT                   /translation="MSNWRKKDPYFAREAQKYGQPIPSREYIIQCLERQGRPMTRKELI
FT                   KKLGLEGDEETREAFRRRLRAMERDGQLMRNRRRAYGLVHKMDLVRGRVIGHRDGYGFL
FT                   VPDEGGEDLYLSARQMRTVLHGDRAVAQVIGIDRRGRREGAVVEVLERNNHQVVGRFIA
FT                   EDKFGFLMPSNQRINQDILIPPEHQKGAQDTQIVVAEITEQPTAKRQPMGKIVEVLGDH
FT                   MAPGMEVDVAIQTYGLLHAWPEEVLAEAQAFKATVPKKAKAERLDLRDLPLVTIDGEDA
FT                   QDFDDAVYAERDGQGWRLWVAIADVSSYVRPSSALEAEAEERGNSVYFPNRVIPMLPEV
FT                   LSNGLCSLNPEVDRLCLVCEMAIGPRGGLKGFRFHSGVMRSAARLTYNQVAAMLLDGDE
FT                   RLRKRYNAVLPGLETMYALYQALRKARTRRGAIDFEMGETQIVFDKTQKIKDIRPLVRN
FT                   DAHRLIEEFMILANVAAARFLTKHKVPTLFRVHEPPEEDRLADLHSFLAELGLAVGGGD
FT                   SSPAPKDFARFLLSIEDRPDAHLIQTVVLRSFKQAIYSPENNGHFGLALDAYTHFTSPI
FT                   RRYPDLLVHRAIRHVLEQKSPKMFLYTKDEMTNLGEHCSMSERRADDATRDAVDWLKCE
FT                   YMMDKVGESFDGLITGVTAFGLFVELSNIYVEGLVHVTALGNDYFHFDPVGRRLLGERT
FT                   RKVYRLADKVQVTVVRVDLDEKKIDLELA"
FT   gene            complement(447834..449417)
FT                   /locus_tag="Nhal_0437"
FT   CDS_pept        complement(447834..449417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0437"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 2; KEGG: neu:NE0782 putative periplasmic cell
FT                   division protein (SufI)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13625"
FT                   /db_xref="GOA:D5BVJ7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ7"
FT                   /inference="protein motif:PRIAM:1.3.3.5"
FT                   /protein_id="ADE13625.1"
FT                   /translation="MNSFIDIKRRKFLQYAGIGTATMALAPNWLWAEASPKNNAYLFSN
FT                   PDVEIGMTAQVTEIPILSGPPTEVWKFSAKLLNGPEGTVEEIPGSYLGPILRLRKGQKV
FT                   RIHFHNNVPGPCVVHQHGLHVPEKSDGHPHYAIDSGQTYSYDFQVLNRAGTYWYHSHTH
FT                   RVTGHRVYFGLAGLLLVSDEEERALNLPGGDYEIPLVIQDRQFGNRNELHYVHGMHDRM
FT                   TGFLGDQILVNGFPDFELPVATRAYRLRILNGSNSRIYKLAWSDGTPMTVIASDGGLLE
FT                   KPERYPYVTLAPAERVELWVDFSGRKVGSEIKLQSLPFSGATPRMGGGMGRGHGRGRHG
FT                   HGSSALPNGAGFSIMKVRIVRKEEVNQKLPERLSTIRSHQIQEAENPDHPRTIRLSMRP
FT                   HSPRLNGRSFRMTAVADEEVFKLNSLQLMEFVNRDRRARGMMMAHPMHIHGQPFQIVKR
FT                   EVLPGFQQDYATLSEGFISSGWRDTVLVMPGEKVTLLKPFEDYEGLFLYHCHNTEHEDL
FT                   DMMRNFQVRA"
FT   sig_peptide     complement(449319..449417)
FT                   /locus_tag="Nhal_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.765) with cleavage site probability 0.751 at
FT                   residue 33"
FT   gene            complement(449592..450512)
FT                   /locus_tag="Nhal_0438"
FT   CDS_pept        complement(449592..450512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0438"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: noc:Noc_2896 phosphatidylserine decarboxylase;
FT                   TIGRFAM: phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13626"
FT                   /db_xref="GOA:D5BVJ8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ8"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ADE13626.1"
FT                   /translation="MASAAQHRLRDWLLSLYQYLLPQHTLSRLMYRLTRHRIAWLTGLQ
FT                   IRLFARIFGVNLEEAESSSPKDYPNFNAFFTRALGEGTRPIAGPADAVVSPVDGRISQL
FT                   GPLTGNRLIQAKGWSYSLVDLLGGSETRAAPFQDGQFATLYLSPKDYHRIHMPLSGCLR
FT                   EMVYLPGRLFSVSPKTVNGIPNLFARNERVVSIFETEAGPLAMVLVGAIFVGSIETVWA
FT                   GQITPPYRHQPCHWLYEGEKALPLEKGQEMGRFNMGSTVILILPPGVIHWQSSLQPESR
FT                   ILMGQTLGQLTTTVQVDAERQRASA"
FT   gene            450748..452490
FT                   /locus_tag="Nhal_0439"
FT   CDS_pept        450748..452490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0439"
FT                   /product="general secretory pathway protein E"
FT                   /note="KEGG: noc:Noc_2895 type II secretion system protein
FT                   E; TIGRFAM: general secretory pathway protein E; PFAM: type
FT                   II secretion system protein E; General secretory system II
FT                   protein E domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13627"
FT                   /db_xref="GOA:D5BVJ9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVJ9"
FT                   /inference="protein motif:TFAM:TIGR02533"
FT                   /protein_id="ADE13627.1"
FT                   /translation="MVQQLEKTVPITPTSGEEAVPQSFEEELGQYLIDRSKLRAAEFRH
FT                   ARRLAAEEGVRLSVMLIRLGLVSERDMAEAFSALLDLPLLATNDYDSGGLNGQVSLRFL
FT                   KESRAVPVLEEEDAVVVAMADPSDRYVQEAIALAYGKPISLRVGLPSEIEAALERQAGG
FT                   KSAMGQIVEHLGADEEAETDVQHLKDMASEAPVVRLVNLLIQRAVESRASDIHIEPFEN
FT                   SLRVRYRIDGVLRDVEAPPARSTAAVISRFKIMAKLNIAERRLPQDGRIQLRIQGRELD
FT                   LRVSTVPTLYGESVVLRLLDKGSVVLDFDSLGFQGSTLERFLRVLEMPHGIIIVTGPTG
FT                   SGKSTTLYTALHKLNTPDRKIVTVEDPVEYQLEGINQIQVKPQIGLTFAGALRSIVRQD
FT                   PDVIMIGEMRDRETAGIAVQSALTGHLVLSTLHTNDAAGGVTRLLDMGVEDYLLTSTVN
FT                   GILAQRLVRTLCKHCAEPYEAMPEIIEELELHRFSEEKPVMLYRPVGCEHCNGIGYHGR
FT                   AAIMEFLVMSDPIRRLVLQHADAGNIQDQAQKEGMRIMYEDGLLKALSGLTTIEEVIRV
FT                   SQES"
FT   gene            452493..453725
FT                   /locus_tag="Nhal_0440"
FT   CDS_pept        452493..453725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0440"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   noc:Noc_2894 general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13628"
FT                   /db_xref="GOA:D5BVK0"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK0"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADE13628.1"
FT                   /translation="MAAFHYKATTSSGEILEGERRADHEANVVEWLHSQGYIPIRIEEA
FT                   AAGGRGRSRQRVGKGLFGGKKTVRQNDVAVVTGELATLLRAGLPLDRAFSTLIEIAEEG
FT                   PVREILTRLQEQVRGGASLAEAMESQGETFSPLYISMIRAGEAGGALDVILGRLADFME
FT                   RSKALKNAVTSALIYPAILVGVAGLSVIILLAFVVPQFQQLFEDAGKALPLATQIVIAA
FT                   GDLLQNYWWALLLGFLAVLLLLRYQLQVPEYRYRWDGWLLRLPLAGDLIAKLEMARLSR
FT                   TLSTLLLNGVPLLSALAIIKDTLGNRVMAEALNEVADELRQGHGMADPLLETGLFPKMA
FT                   VQMIKVGEETGQLEDMLGQVAETYDVEVESTIKRLLALLEPVLILSLGVIIAGIIMSIL
FT                   VAILSVNELAF"
FT   gene            453741..454175
FT                   /locus_tag="Nhal_0441"
FT   CDS_pept        453741..454175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0441"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: noc:Noc_2893
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13629"
FT                   /db_xref="GOA:D5BVK1"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK1"
FT                   /inference="protein motif:TFAM:TIGR01710"
FT                   /protein_id="ADE13629.1"
FT                   /translation="MQRKRLRHAGSFGFTLIELLVVLVILGLLAGLIGPQVMKYLGSAK
FT                   TDSARLQIEDLAATLDLYRLEVGRYPSTEEGLQALVEAPPGANRWNGPYLKKSQVPADP
FT                   WGYDYHYRSPGEHGAFDIYSLGADNAEGGEGENQDIVSWK"
FT   gene            454218..454754
FT                   /locus_tag="Nhal_0442"
FT   CDS_pept        454218..454754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0442"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   noc:Noc_2892 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13630"
FT                   /db_xref="GOA:D5BVK2"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK2"
FT                   /inference="protein motif:TFAM:TIGR01708"
FT                   /protein_id="ADE13630.1"
FT                   /translation="MGSVGEAYQWAMTRYSPSPSRQGRPPLSAVPRFKPQSAFTLIELL
FT                   VVLALVAVLMTLVPPFLQGGVSGAELKGTARKLAAALKYVRSQAITQHREAVLILDLER
FT                   RRFMITGRKRHYPIPDNMEISLVTARSELETERIGKIRFFPDGTSTGGRITLAQGESQY
FT                   GVDVNWLTGQVVILD"
FT   gene            454747..455190
FT                   /locus_tag="Nhal_0443"
FT   CDS_pept        454747..455190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0443"
FT                   /product="general secretion pathway protein H"
FT                   /note="KEGG: noc:Noc_2891 general secretion pathway protein
FT                   H"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13631"
FT                   /db_xref="GOA:D5BVK3"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK3"
FT                   /inference="similar to AA sequence:KEGG:Noc_2891"
FT                   /protein_id="ADE13631.1"
FT                   /translation="MIKRDRGFSLLEVLVAFAILGISLGVLLQIFSTGMRTTTLSEEYT
FT                   RATSLAESKLATIGVETPYLEGIEEGQFDEKYAWRTTILPYEEPEEEREKRLGEGFDDA
FT                   VNLPALPYTVKVEVFWETGGKERRVVLETLRLGSLSQSQSQLQ"
FT   gene            455303..456520
FT                   /locus_tag="Nhal_0444"
FT   CDS_pept        455303..456520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13632"
FT                   /db_xref="GOA:D5BVK4"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK4"
FT                   /inference="similar to AA sequence:KEGG:Noc_2890"
FT                   /protein_id="ADE13632.1"
FT                   /translation="MAGFFSLSTAPAMSFWRRLLIALGLMTLSGALLISGFLAYHHKDF
FT                   APPEVQPKVWQGHSLQLMAGEGARVEEGLEVRALSASGQAIISSGKIALATEKYPFLQY
FT                   QVQGSHPEMDPVFFWRRVAERGKVISLPLRWKGEGHAMMRLGNHPGWQGTIVEFGVAFR
FT                   KMPSESVVIKEFAFKPLSAVSLLAMVWFEWTTFEGWSQRSINFIESGPANVLVPPTLAA
FT                   AAWVGLSLFCYGLWGFFRGRHWDWPVVGIVFLLGWMVMDLRWQAGLWQQLQQTYDRYGG
FT                   KGWEEKHLAAEDGFLFKFITEIKTHLPSLPQRVFLVTAKSLAEDHYTRLRVRYHLLPYN
FT                   VHDYGTGLPRQDHAQAGDYLLILGATPEFTFDPERQLLRGREGKRKGLAAKKIYAASMG
FT                   ALYQLL"
FT   gene            456576..457745
FT                   /locus_tag="Nhal_0445"
FT   CDS_pept        456576..457745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0445"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   noc:Noc_2889 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13633"
FT                   /db_xref="GOA:D5BVK5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE13633.1"
FT                   /translation="MLRVLHIGKFFPPFAGGMEYFLQDLLPALQRQDIEVAALVHDHLS
FT                   PCQQRFSNHSSPVQWPFPVYRAPCHGRLLYAPVSPQFPFWLRRTIRQFKPDYLHLHLPN
FT                   TSAFWAMVVPAARRIPWIVHWHADVVASRHDRLLALAYPVYRPFEQSLLGGASAIIATS
FT                   PPYLDSSLALGSWRDKCHVIPLGLDPARLPEPTEAEQAAAYHLWGDKGRLRVLTIGRLT
FT                   YYKGHEVLLHAIKALPEARLLIIGTGEGEAKLRSLIAHLALEERVTLQGSCTEAQRNGL
FT                   LATCDVFCLPSIERTEAFGVVLLEAMRFGKPVVASKIEGSGVGWVVADEETGKLCTPQD
FT                   SASLAQALGDLLYASEKRESLGKAGEQRFRKYFQIERIGEKAAELYRCV"
FT   gene            complement(457869..457946)
FT                   /pseudo
FT                   /locus_tag="Nhal_0446"
FT   gene            458680..459150
FT                   /locus_tag="Nhal_0447"
FT   CDS_pept        458680..459150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13634"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK6"
FT                   /inference="similar to AA sequence:KEGG:Noc_2987"
FT                   /protein_id="ADE13634.1"
FT                   /translation="MVSAQSSIVIVRPVDDVFQFISVNFFQNYPKWSPEVVELEKLSDG
FT                   PVKVDTLGRQIRNDQGRRTESRFRVTQFEPNRCFSCEGTAQTPFRVIYNFESFDQATKV
FT                   KFTFELLRVDFFMRPFEKLIEAAIRGGADRVMHNLKGLLEEEATEPSGSAKR"
FT   gene            459759..460217
FT                   /locus_tag="Nhal_0448"
FT   CDS_pept        459759..460217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_1824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13635"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK7"
FT                   /inference="similar to AA sequence:KEGG:Noc_1824"
FT                   /protein_id="ADE13635.1"
FT                   /translation="MKSTTLITLAALGSFAFYGNAYAENGHAYNGSFCDNYYGSQVGNF
FT                   NHQHNGIKNNTNSGRYVSCPVIVDEIAKTTGTTRVWLYYSGSGKISCSMFSKNGNGTTR
FT                   QSKMGSRTNSGWFSIPAITSDNYWGSYSMYCYLPPKGILKTIWVGEKS"
FT   sig_peptide     459759..459830
FT                   /locus_tag="Nhal_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 24"
FT   gene            460264..461046
FT                   /locus_tag="Nhal_0449"
FT   CDS_pept        460264..461046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_1823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13636"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK8"
FT                   /inference="similar to AA sequence:KEGG:Noc_1823"
FT                   /protein_id="ADE13636.1"
FT                   /translation="MKASHLLIVTGSLAALSLSFYVTKFSHIEDVALPSNDTLPSTDIA
FT                   KSSYQANDYGGGIAPTLAALKEEVSLLKAEFSTLKKSSIGSSGLKKEFFRLKEEVAALH
FT                   QKVGNTSAMSEYYNNTEDVADSPGEMALTEQDIVAATQRQAYEDHKQMEVIDSVFLSEN
FT                   IDYQWSAQTSDLIAQNLENSEQIKTDLESLECRATLCRVEVNHHDASIAEEFELQFPLQ
FT                   VGEALPQINYLYEPQDDGSVSVVMYLARDGYDLPQVIQ"
FT   sig_peptide     460264..460338
FT                   /locus_tag="Nhal_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.507 at
FT                   residue 25"
FT   gene            461392..462267
FT                   /locus_tag="Nhal_0450"
FT   CDS_pept        461392..462267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0450"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: mca:MCA1012
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13637"
FT                   /db_xref="GOA:D5BVK9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVK9"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ADE13637.1"
FT                   /translation="MTASATSLQPVNTHIESGEPAVSMFASLGIEDVLMMTVFGVFFLL
FT                   LVMEVVHPYRRFATKIARASLTTNTTAFLFNDVILTLVSISSLFLIAQQYSHLGLLSNL
FT                   DDGVFKWLLSFLLFDLALYGWHVASHRFEFLWRFHKIHHSDKSLNVSTGFRFHVFDQCL
FT                   EVIYKCLFVIVVGVNAYVVLVCDLTKTLFVLFHHSNISFKGEKWLSKIIIVPTLHRVHH
FT                   STLRSEHDSNYGIVLSIWDRLFGTRKELVPKKIGLELVQADNLVQLFCLAFITERRIAR
FT                   IFHMIPKGKR"
FT   gene            complement(462387..462782)
FT                   /pseudo
FT                   /locus_tag="Nhal_0451"
FT   gene            463121..464266
FT                   /locus_tag="Nhal_0452"
FT   CDS_pept        463121..464266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0452"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   aby:ABAYE3624 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13638"
FT                   /db_xref="GOA:D5BVL0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL0"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADE13638.1"
FT                   /translation="MPVKKILHRMLSEIMHLKRLWTLVLLVETVLETKRLSVTQLGRSL
FT                   KLPIQERSGIRRSDRFMGNKYVQAQSKAVYEALVKQLVGNKRRPWILVDWSHLPNTDLY
FT                   VLRAALVAPGRALTLYETVHAQSQQGNERVQRAFLKTLKALLPAASRPVIITDAGFHNP
FT                   WFKQIVSYGWDYVGRIRGRKSYRPVGEREWRPCRELWAQASGRAKALGAVEMCRKNPLK
FT                   SRFYLFKGKARGRHGKSIAEYRLAAKEPWLLASSLCGRQSAKRVVKLYRTRMQIEEGFR
FT                   DLKSPAYGFSFNLAYSRDPHRIEVLLLIAALAGMVAWAVGWLTERQQLHYQFQANSIKH
FT                   RRVLSLFYLGCQVIRRKVRVIVSEQSIREVFDAIENEGCPP"
FT   gene            464496..464771
FT                   /locus_tag="Nhal_0453"
FT   CDS_pept        464496..464771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13639"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13639.1"
FT                   /translation="MALSTIDFVKARDTVAELLDELALEAYLFEVEPRNSHWEVKVECA
FT                   ITEGWETVTLSIPKEVLLASADDKVIRKQVLEEWRARLAACKIQSS"
FT   gene            465128..467182
FT                   /locus_tag="Nhal_0454"
FT   CDS_pept        465128..467182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0454"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: noc:Noc_0207 protein phosphatase 2C-like,
FT                   stage II sporulation E; TIGRFAM: PAS sensor protein; PFAM:
FT                   Stage II sporulation E family protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: protein phosphatase 2C domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13640"
FT                   /db_xref="GOA:D5BVL2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADE13640.1"
FT                   /translation="MNEREVDPIRTESDAEHKLARGRPTEQALRQQFANLEERLAQQSA
FT                   ELAAIKAALKESEERFNQIAAMTGEWIWEQDAEGRYIYCSASVNAILGYPWRELIGRFY
FT                   DEFVPSEDQQALRLKLREGAETEEGFQRLMRRYQHRDGHLIFTESTAVPLFDDQHRLLK
FT                   WRGIDRDITATRQADELVFKLSRALEQSPNAILITDLNGNIEYVNPAFTRLTGYKAEEV
FT                   IGKNPRLLQSGKTSLEQYRRLWETITAGREWRDEIQDRKKNGELYWALETIAPIRNAAS
FT                   NPTHFLAIQQDITERKRVEAALRESEAQTRLIIQNALDAIILMDADELITDWNPQAEKI
FT                   FGWNRNEVLGSSLADTIIPPRYREAHRQGLRRFLKTGKGPVLSKRLELSGLHRDGYEFP
FT                   VELTVSPLKVGDSYVFSGFLRDLTQRKEAEEAIRRARVKLAVSRNEMRIAQQIQESLFP
FT                   PAPLILPTVEIRGYCLPATHVGGDYFDYFQWQDEAIDIVIADVSGHSVGPALLMAETRS
FT                   ALKAQFHLHRTVADTLSGLNEALYEDLDRSDHFITMGYLRYDTVTGQLAYANAGHIPPL
FT                   LFRQGQTCRQLDADGLVLGVKLDVVFEERLVNLQQGDMIFLYTDGIIETENQKGECFGI
FT                   DRLCDLLNQHHQRGSEPQEIITTLIERLQAFCHRKTFEDDVTMVVVKIL"
FT   gene            467254..469293
FT                   /locus_tag="Nhal_0455"
FT   CDS_pept        467254..469293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0455"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: noc:Noc_0208 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13641"
FT                   /db_xref="GOA:D5BVL3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL3"
FT                   /inference="protein motif:PRIAM:3.4.24.70"
FT                   /protein_id="ADE13641.1"
FT                   /translation="MSNPLLEFTGLPPFSKIQPAHVEPAVDILLAEGRALVEQLLASRT
FT                   EYTWDTLIQPLEEMQERLDRVWSPVSHMNAVVNSDELRRVYNACLPKLSDFTTELGQNE
FT                   GLYQAFQAVAEGGEYPKLDTSQKKIIANALRDFRLSGVTLSAEKKARFKAIQQRLASLT
FT                   AKFEENLLDATQAWRKHLTDEAALAGLPEGARAQARQAAEQAGLEGWLLTLEAPSYIAV
FT                   TTYAHDRALREEIYTAFVTRASDQGPHGGRWDNTQVMEEILALRHEAAQLLGFANHAER
FT                   SLATKMAGSPQQVLDFLNDLAARSKGVAERDFAEIKAFALEQYGVEDLQVWDVAYYGEK
FT                   LRQHKYAISQEELKPYFPAPRVLEGLFTIVHRLYGLEIQERKDVDIWHPEVRFFDIFDD
FT                   KGELRGQFYLDLYARSNKRGGAWMDDCLSRKRQGEQLQIPVAYLTCNLTPPVGGKPALF
FT                   THNEVITLFHEFGHGLHHLLTKIDYPSVAGISGVPWDAVELPSQFMENWCWQREALDFI
FT                   ARHFETNEPLPEELFERMLAAKNFLSGMTMVRQLEFALFDFRLHLEYEPAKGAPIDELL
FT                   QEVREQVAVVKPPPFNRFAHSFSHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGIFNQ
FT                   QAGRAFMASILEQGGTREPMELFIEFRGREPTIDALLRHSGLAA"
FT   gene            469293..470066
FT                   /locus_tag="Nhal_0456"
FT   CDS_pept        469293..470066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0456"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: noc:Noc_0209
FT                   exodeoxyribonuclease III xth"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13642"
FT                   /db_xref="GOA:D5BVL4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL4"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADE13642.1"
FT                   /translation="MPKLKIATWNVNSLRVRLPQVMDWLEAHQPDILALQETKLSDGEF
FT                   PQEAFGDMGYRAAYSGQKTYNGVAILCRQEPQDIMTDLPNLEDPQRRILGISLGDIRLL
FT                   NLYVPNGSEVGSEKYAYKLDWLARVKDYLQEALAEYPKLIVLGDFNVAPGDGDVHNPEI
FT                   WHETILCSTPEREALGEILDLGFQDSFRLFEQEGQSFSWWDYRGGAFRRNWGLRIDLIL
FT                   ISKELVPKCTECVIDKEPRRLKRPSDHAPVIATFA"
FT   gene            470119..471930
FT                   /locus_tag="Nhal_0457"
FT   CDS_pept        470119..471930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0457"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   noc:Noc_0210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13643"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL5"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ADE13643.1"
FT                   /translation="MGAQNQSELGAELKTWVNRLCQKNFGGAGELLREAAERKAKQLNK
FT                   VRKELEQLTEETVSSFRLAGDAHSNNYAFGQALEVYERALEYVSRELTPHLWAVVVTQV
FT                   GKAYHELGIRIEGVALHYHFSAAVESYRRALEVQTQEHLLQDWARTQTHLGTALREQGV
FT                   RLGGEAGWRLLEKAVAAYRQALEVQTRRHLPQDWAWTQTHLGTALREQGVRLGGEAGQR
FT                   LLEEAIAAYRRALEIQTQGHLPQDWARTQTHLGTALREQGVRLEGEAGQQLLAEAIASY
FT                   RRALEVQTRGELSQDWAWTQTHLGTALGEQGVRIEGEAGWQLLEEAVIAYRQALEVQTR
FT                   GHLPQDWAWTQTHLGTALGEQGVRLGGEAGQRLLEEAIASYQGALEVQTPETLPGYWIQ
FT                   AQYHLAQTHLALETWSEAAASFARLLQVSPDNGEAYYAASVLYHEKLLAFEEAFSLSQQ
FT                   WLNSHPEDLEAHSQLAEQCFTTGRFAEAVEHFARLLANPELDPQIKIPLQAFEIAALLG
FT                   LNQKAVVPQKFKGLCVAIAHQPEDFSLEWTFGGSKYFIAQAEQLSPYRAWLLELFAALE
FT                   EKNRNAILSCLGEDVEQVSSTAQSQPS"
FT   gene            471971..473434
FT                   /locus_tag="Nhal_0458"
FT   CDS_pept        471971..473434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0458"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: noc:Noc_0211
FT                   carboxylyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13644"
FT                   /db_xref="GOA:D5BVL6"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL6"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADE13644.1"
FT                   /translation="MKYKDLRDFITKLEAEGELKRIAVEVDPHLEMTEICHRVLHAGGP
FT                   ALLFERPKGASMPVLGNLFGTSRRVALGMGEDSVAALREVGKLLAFLKEPDPPRGMKEA
FT                   WRTLPIFKKVLDMAPKVVRSAPCQEVVLEGSQVDLGRLPIQTCWPGDAAPLITWGLVVT
FT                   KGPYKERQNMGIYRQQVLGPNRVIMRWLAHRGGALDFQAWQQAHPGEPFPIAVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSKTELTRCLGSELQVPASAEIVLEGYLKPGDDAD
FT                   EGPFGDHTGYYNEVERFPVFTIERLTHRRDPIYHSTYTGRPPDEPAILGVALNEVFTPI
FT                   LQKQFPEIVDFYLPPEGCSYRLAVVTMKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTD
FT                   QDINARDWKDVIWAMTTRMDPARDCVMIENTPIDYLDFASPVSGLGSKIGFDATHKWKG
FT                   ETQREWGQPIVMDEAVKRRVDEIWDRLGF"
FT   gene            complement(473423..473587)
FT                   /locus_tag="Nhal_0459"
FT   CDS_pept        complement(473423..473587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13645"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13645.1"
FT                   /translation="MQQQHNQQRTLYTNRTALHPLPEGRGFGRRISKQQEVLGAIQEPS
FT                   PEGRGMSEA"
FT   gene            473706..474326
FT                   /locus_tag="Nhal_0460"
FT   CDS_pept        473706..474326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0460"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   noc:Noc_0213 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13646"
FT                   /db_xref="GOA:D5BVL8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL8"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADE13646.1"
FT                   /translation="MSKTDLRNVMTNTPWDARLAALIVRPLCNSWVTPNHLTTLRLVTG
FT                   LGAALCFGSGEWLNLAAWLWVMSTFLDHTDGELARMSGKQSRGGHFYDLVTDAVATIGL
FT                   FIGIGWGLTSSHLGEWTPLMGGVAGIAIAIIFHFRNEIEQQSGKVATKQPGFAGFEPED
FT                   TLYLLPLITWLDGLILFLLAATLITPIIAIVVGWQYLTQPHKM"
FT   gene            474427..474756
FT                   /locus_tag="Nhal_0461"
FT   CDS_pept        474427..474756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0461"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   noc:Noc_0214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13647"
FT                   /db_xref="GOA:D5BVL9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVL9"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADE13647.1"
FT                   /translation="MGAKVLTALGVKSKMSCFLSKKIERRRNPRKRAGVRVYLSWPGQQ
FT                   PQRCQVINLSVTGAFVEVGPLRIPEDRIIKLVFVLSADSLIKMHHLSATVVHRSQEGIG
FT                   LMFQQ"
FT   gene            complement(474855..475100)
FT                   /locus_tag="Nhal_0462"
FT   CDS_pept        complement(474855..475100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13648"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM0"
FT                   /inference="similar to AA sequence:KEGG:Noc_0215"
FT                   /protein_id="ADE13648.1"
FT                   /translation="MTDYVPINCNCHDHLEALATLSKRCRIVYQTADGKIIETLDTIAD
FT                   IYTKHQEEFAVLGSGETIRLDTLKEVDGQSIDSGSH"
FT   gene            complement(475134..476423)
FT                   /locus_tag="Nhal_0463"
FT   CDS_pept        complement(475134..476423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: geo:Geob_0338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13649"
FT                   /db_xref="GOA:D5BVM1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM1"
FT                   /inference="similar to AA sequence:KEGG:Geob_0338"
FT                   /protein_id="ADE13649.1"
FT                   /translation="MPPLNPEHRRTEDLLEQCYQYSLALLRRNSAPAGIMACTPTEKAS
FT                   NRHYTAIFGRDAAICTLGLIASGQPDLIGTAVNGLLTLAKHQAPNGQIPKYVKPDLKEV
FT                   DFWYSGCIDATLWWLIALNYVDQHRPEIKLGEELNTAVQRALNWLLCQEHQTFFLLQQN
FT                   EASDWADIMPRSGFVLYTNALWFYVKKLYQLPCLEQTHYYFNALFFPFRQQFIKHRRAR
FT                   LLAHYIRNKCNSRQTYLSFINFSFWGEEIDVFGNILALLLNLPEDSRWRKEIHAALSKL
FT                   GIDHPFPVRVVGIPIHQENPLWRTYMQRHQQNYPYQYHNGGIWPFIGSFWVLLLARLGM
FT                   GGKARKTLLKVAASHQVNEWQFNEWFHGETGKPMGMPGQSWNAAMFILNYHILYGEAAS
FT                   KGKGPSNFDAHFPERSVLSSRRRLKYKPLA"
FT   gene            476588..477052
FT                   /locus_tag="Nhal_0464"
FT   CDS_pept        476588..477052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_3386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13650"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13650.1"
FT                   /translation="MKRLAFYTIGFACLAFGIATPGWAEETRCISISGAIAGSIVGPTS
FT                   VLGTVTGSLQGATQATITKQEKGEDRVDLELKHIFVTESRDTLQTRDKALWIPIPGRSG
FT                   VYHMSTQYKVTGGTGRFAEATGTFKNHGEADTHQGLVTLAYSGQICGVAP"
FT   sig_peptide     476588..476662
FT                   /locus_tag="Nhal_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(477081..477842)
FT                   /locus_tag="Nhal_0465"
FT   CDS_pept        complement(477081..477842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0465"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   tgr:Tgr7_0283 HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13651"
FT                   /db_xref="GOA:D5BVM3"
FT                   /db_xref="InterPro:IPR006355"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM3"
FT                   /inference="protein motif:TFAM:TIGR01458"
FT                   /protein_id="ADE13651.1"
FT                   /translation="MIKGVLLDLSGVLYVGEQIVPGALKALTRLRKSGLPVRYLTNTSR
FT                   STGRTIHSKLRAMGFDISVDEIFTAPLAIRRYLETHQLRPYLVIHPDLTPEFADFPQTE
FT                   PNAVVLGDAGHAFTYPRLNGAFRVLLTGAPLLAVGNNRYFQEAEGLSLDAGPFLRALEY
FT                   AANVQGIILGKPAKEFFHSAVESLGCLPQETVMVGDDAKADVEGALKAGLQAVLVKTGK
FT                   YRPGDEATIQPPGTVLQNNIEEAVDWILNPS"
FT   gene            complement(478027..478653)
FT                   /locus_tag="Nhal_0466"
FT   CDS_pept        complement(478027..478653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0466"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   ank:AnaeK_0375 ABC-type uncharacterized transport system
FT                   auxiliary component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13652"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM4"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADE13652.1"
FT                   /translation="MFSPSRRQLPYRGLCLIMVVILSSCTLSPKQPGPVRTYLLAPQLP
FT                   PQTTAAPTPLTLLVSTPQAAAGYGTSQIAYTRKPYELDYFSRNQWVDTPERMLKPILVN
FT                   ALEASGHFQSIAPDDTRILAELRLDTEILRLVQDFSGQPSQSHLVLRARLIDLAKGEEI
FT                   ASQTFEAREPAPEEGPYGGVIALNRALERILRELVTFCARAYLKR"
FT   gene            complement(478657..479661)
FT                   /locus_tag="Nhal_0467"
FT   CDS_pept        complement(478657..479661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0467"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: cbg:CbuG_1274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13653"
FT                   /db_xref="GOA:D5BVM5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM5"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADE13653.1"
FT                   /translation="MDTKVNYILVGLFTILLATALTAIIFWLSAAPATKNYQTYLAYMR
FT                   ESVAGLNMNAAVKYRGVDVGQVEAIELDKQNPERVRLTLAIEQGTPIKEDTIAILASNG
FT                   LTGIAYVELTGGTQDSPTLQAEKGQSHPVIQTGPSLLMRLDTALTKLLTELTGVAGDLS
FT                   RIAQSVNTVLIEQNQQALAETLRNTERLSKVLADLAANQENQQALRKTLHNTEHLTARL
FT                   AGHGSQLETAVEDLVTILEAGAKASKQLPILVEQASRSLRPIEKTAEGLETLLRDGEQG
FT                   FRLFTQSTLPRIDQLLNDFDRVTRNLERFSQQVEQNPRTLLFGSPPNQLGPGE"
FT   sig_peptide     complement(479569..479661)
FT                   /locus_tag="Nhal_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.476 at
FT                   residue 31"
FT   gene            complement(479646..480431)
FT                   /locus_tag="Nhal_0468"
FT   CDS_pept        complement(479646..480431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0468"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pfl:PFL_0099 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13654"
FT                   /db_xref="GOA:D5BVM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE13654.1"
FT                   /translation="MAKTQKTVIQIQNLETRFGEALIHKKISLEVYRGEIFAIVGGSGS
FT                   GKSTLLREIIMLTSPSAGSIRVFGEELRELDEARAARLQARFGVMFQQGALFSSFTVLE
FT                   NVALPLKEHTQLSSRFITELALHKIKLVGLPLEAACRYPRELSGGMIKRVAVARALVLD
FT                   PELLFLDEPSAGLDPVSAAALDELILELRASLDLTVVLVTHDLDSLWRIADRAAFLGEK
FT                   TLLGLDTVAALARSEHRLLQAYFKGPRGRTAQESAWTQK"
FT   gene            complement(480433..481575)
FT                   /locus_tag="Nhal_0469"
FT   CDS_pept        complement(480433..481575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0469"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   aeh:Mlg_1205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13655"
FT                   /db_xref="GOA:D5BVM7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM7"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADE13655.1"
FT                   /translation="MGNATMKPETAANPARIEYDPATSTLRCLGTWTLYGISQLEQTLP
FT                   LSQSHPPVHAVDASGITQMDTGGAWLLQRLLADLEQQTRPIPCKGLGQEQQKLLRLVQG
FT                   GSTSQQLTTAPPPGILERIGRLSWAHVEEALSFLAFIGETLLYFLRSMAHPSRIRWRPF
FT                   LSNLQTAGINALPIVGLLIFLVGVVLAYQGGIQLRAYGANIFIVELVTLTMVRELAPLM
FT                   AAIIIAGRTGSAFTAQIGTMQVTEEIDALRTLGIPPMEQLVLPKIFALVLALPLLTVFA
FT                   DMVGIFGGMVMSQALLEVEFREFAQRIPEVVPLSSFLIGVGKAPVFAVIIATVGCYQGF
FT                   RVGGGAESVGRHTTTSVVQAIFLVIIADATFSILFSWLGI"
FT   gene            complement(481665..481967)
FT                   /locus_tag="Nhal_0470"
FT   CDS_pept        complement(481665..481967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13656"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM8"
FT                   /inference="similar to AA sequence:KEGG:Noc_0351"
FT                   /protein_id="ADE13656.1"
FT                   /translation="MKLIYSAPNLLLVRHFQNLLESHGIDCVIKNESLSGAAGELPPTE
FT                   CWPELWLTEEKRYREASRLLKGAEEDQRPWTCLHCGELLEGQFDRCWNCGEYRDD"
FT   gene            complement(482241..483671)
FT                   /locus_tag="Nhal_0471"
FT   CDS_pept        complement(482241..483671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0471"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   noc:Noc_0352 D-lactate dehydrogenase (cytochrome)"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13657"
FT                   /db_xref="GOA:D5BVM9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVM9"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ADE13657.1"
FT                   /translation="MSIYPKLILNSSPVTPQEFLTNLVQIVDEQRVRFDPADCWPYGYD
FT                   NSRRHALPQWVVFALTPKEIRDIIRLCNHARVPLTPRGRGTGTTGATVPINGGLVLSLE
FT                   RMNRIHLVDPANRAMVVEPGVTNQEVQMAAEQRGFFWPPDPTSAAFCTVGGNLAYNSAG
FT                   PRAVKYGTPRENVLGLRAVTGAGEEIRCGGYTTKGVVGYDLTRLLIGSEGTLAIITEAT
FT                   LKLTPLAEAKQTLRAAYRDTESAGQAVAALMSQPLTPCALEFMDRQAVTLAQAQGGATL
FT                   PGGTGALLMIEVDGPAAAMEEAVTQLKKAADNAGLLEIVAAHTPQEVAQLWSARKALSP
FT                   ALRTLAPKKINEDVVVPVSHLPALIGGLERLAREFAITIVNFGHAGNGNIHVNLLINPD
FT                   DPLEMERAGKCLERVFELVLSLNGSLSGEHGIGLEKRDFVAREIDATTLNLMGRLKAQF
FT                   DPRGILNPEKTLPLKSLT"
FT   gene            complement(483640..484239)
FT                   /locus_tag="Nhal_0472"
FT   CDS_pept        complement(483640..484239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0472"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   noc:Noc_0353 periplasmic or secreted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13658"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVN0"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADE13658.1"
FT                   /translation="MKSCLTVLLFCFALLFQGCAAVVATGVVAGAATGISAAYDRRTFS
FT                   TVIDDQSIELKASATLRNDQVLHDSAHINVTSYNGMVLLTGEAPNQELKKRATELIQPL
FT                   PHIKQIYNELDILAPSSLVSRSNDSWITTKVKTKIAAEKGLDPTRVKVVTERGTVYLMG
FT                   LVTAREAELATTVASHTKGVQRVVKIFEYLPETDLE"
FT   sig_peptide     complement(484165..484239)
FT                   /locus_tag="Nhal_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.292 at
FT                   residue 25"
FT   gene            complement(484243..484833)
FT                   /locus_tag="Nhal_0473"
FT   CDS_pept        complement(484243..484833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0473"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   noc:Noc_0354 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13659"
FT                   /db_xref="GOA:D5BVN1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVN1"
FT                   /inference="protein motif:TFAM:TIGR00441"
FT                   /protein_id="ADE13659.1"
FT                   /translation="MNARERIEQHFFNSAQLKLSAMSSLAPPIERAVQHLLDSLQHRHK
FT                   ILSCGNGGSAADAQHFASELINRFERERPGLPAIALTTDTSAITSIANDYHYDIVFARQ
FT                   VEALGSKGDLLLAISTSGHSTNVVRAIEAAHTQEMKIIALTGGDGGKIAPLLTAQDVEI
FT                   RVPAHNTARIQEVHLLVLHCLCDLLDHSLWPEK"
FT   gene            complement(484962..485333)
FT                   /locus_tag="Nhal_0474"
FT   CDS_pept        complement(484962..485333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0474"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   noc:Noc_0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13660"
FT                   /db_xref="GOA:D5BVN2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVN2"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ADE13660.1"
FT                   /translation="MTRSSRHDQGQQAEQLACHYLQTQGLRLAQRNYRCRLGEIDLVME
FT                   DGEHLVFVEVRCRRKGRFGSAIDSITPTKQARLIAAAQHYLQQAGGTHNKPCRFDVVGI
FT                   TPLQGSNDIVWLQDAFRLE"
FT   gene            complement(485330..487246)
FT                   /locus_tag="Nhal_0475"
FT   CDS_pept        complement(485330..487246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0475"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: noc:Noc_0356
FT                   LppC putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13661"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5BVN3"
FT                   /inference="protein motif:PFAM:PF04348"
FT                   /protein_id="ADE13661.1"
FT                   /translation="MYFIIPMVIFPRRTGHYLPLMGFAIILGLSACAPPSKVPPRAPSA
FT                   LAQAEALAAEGRYLAAATEYIRLAAETPPPQRQDYQLRAVAALLQGNQWQEAQELLESI
FT                   APESLAPALSLRYRLLAAQLAVAKGEAKRALSLLKDIEALEPSLEQQATLHRLRAEAYE
FT                   LADKPLAAAHERVQLEPLLSDAQALQENQRALWRGLMGLSPDTFKRLRKESLSNTLRGW
FT                   LELAQLFQRYPLDPLGLQQAIEDWRKRYPGHPASLALLQAEMPTLPTAPYQPTTIALLL
FT                   PTEGRFAASAAAVRDGFFAAYYSDNSDWTPVIRFYGVKIDSKSSNSNAYKVYQQAQAEG
FT                   ADFVVGPLTKQSLAQLAEVGDLPLPTLALNYLEKSHKPVGGLYQLALSPENEAQGVAER
FT                   AWRDGHHNALVLIPDTQWGQRVRDAFTERWEKLGGSLLEVQAYDPEKEDYSFLIQRLLN
FT                   IDESQSRHRELRDLLDRQLAFEPQRRHDADFVFLAAFPRQARLLIPQLQFYRAEDLPVY
FT                   SSSHIYTGSPDPERDLDLNGVIFSDIPWVLNGNMQDEPSYQNLAAVYPEHFERLKRLYA
FT                   LGSDAYRIIPHLNALYRVPDMTFEGATGRLRMDAEQRLRRELNWAQFKKGRPQPTANPT
FT                   SQP"
FT   gene            487301..488158
FT                   /locus_tag="Nhal_0476"
FT   CDS_pept        487301..488158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0476"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: noc:Noc_0357
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13662"
FT                   /db_xref="GOA:D5BW12"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW12"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADE13662.1"
FT                   /translation="MMADKWGILYVVATPIGNLGDLSPRAQETLQEVELIAAEDTRHSG
FT                   GLLRHFGITTAMVSLHEYNERQQAELLIGRCQEGLSVALISDAGTPLISDPGYRVVRQA
FT                   RQAGIAVVSVPGPCALVAALSVAGLPSDRFVFEGFLPAKSQARQTRLEQLVDETRTLIF
FT                   YEAPRRLPQTLQAMVETFGPDREAVVARELTKRHETVRGGSLSTLLTWAKQAPESGRGE
FT                   LVLLLHGAEKKQDAPRQEALKVLLPLVTALPLKQAVALATKITGFKKNRLYQLALELRA
FT                   PQED"
FT   gene            complement(488160..489539)
FT                   /locus_tag="Nhal_0477"
FT   CDS_pept        complement(488160..489539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0477"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   pfo:Pfl01_3771 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13663"
FT                   /db_xref="GOA:D5BW13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW13"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADE13663.1"
FT                   /translation="MLFRLNAGLMASLLVVLDLQLAATEVYANYLMENYVKNRLIQDSE
FT                   SLLAALSIAPDGVATLDKGHLPPHFLRPFSGHYYRITITDPLGSIDQPNDPPLSLYSRS
FT                   LWDTDLSLPSVVVGESLHWRIPGPEDQDLLTLVTGYSKQKHRIVIAVAEDLSPLHADVQ
FT                   SFQVHFTVIFLAGMALLIGLQTWLVRASTRTLAQTRNDIVRLERGEIEHINEDVPSEIA
FT                   PLVQEVNRLLRILRQRLKRSRNALGNLAHALKTPLTQLTQLTDDPNLSNHPALQERFQH
FT                   HIHTLRFLIERELKRARLAGGGLTLQPMDVAEASRDLIPVFQALYRDKGVTIDSRLPSS
FT                   VLFKGDREDLLELLGNLLDNACKWAHSQIRLGVMNANTSTLTLIIEDDGPGCTSETLEH
FT                   LTQRGLRLDEATPGHGLGLSIVKDIVTSYGGAIDFALSSDLGGLKVTIQLPNDFKSAAL
FT                   K"
FT   sig_peptide     complement(489468..489539)
FT                   /locus_tag="Nhal_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.303 at
FT                   residue 24"
FT   gene            complement(489616..490287)
FT                   /locus_tag="Nhal_0478"
FT   CDS_pept        complement(489616..490287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0478"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: tmz:Tmz1t_1913 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13664"
FT                   /db_xref="GOA:D5BW14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW14"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADE13664.1"
FT                   /translation="MRVLLVEDDRELQKRLHRELTQQGFVVDTADNGVDAEFLGFEEPY
FT                   EAVILDLGLPQRSGLDVLRHWRDHDNRVPVLILTARDAWHEKVEGFKCGADDYLSKPFH
FT                   TEELLARLQALIRRSQNRPHQSQLTSHSLTLDEERQCVHKDGHLIELTGTEFRLLRYFM
FT                   LHPGRILSKSRLTEQVYALDADKDSNVMEVYVNRLRKKVGSDLIKTRRGQGYIFGETEH
FT                   S"
FT   gene            complement(490473..490793)
FT                   /locus_tag="Nhal_0479"
FT   CDS_pept        complement(490473..490793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_1786 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13665"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13665.1"
FT                   /translation="MIKYLKNRLLLVSGILLLGTLNNSLAENESDQDRARQLRENEDIL
FT                   PLERILEQAKTQHRGRLIEAELDQEENRWIYGVEILDENGIVWDMDYDATTGTLLETDQ
FT                   EK"
FT   sig_peptide     complement(490713..490793)
FT                   /locus_tag="Nhal_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 27"
FT   gene            491010..491933
FT                   /locus_tag="Nhal_0480"
FT   CDS_pept        491010..491933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0480"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   noc:Noc_2871 cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13666"
FT                   /db_xref="GOA:D5BW16"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW16"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADE13666.1"
FT                   /translation="MAETVVAHHDSTRMMRQATYAAVAVAMVLVVIKLGAYWVTGSVAM
FT                   LSTLIDSVLDVAASFINLLAVRAALTPADREHRFGHGKAEPLAGLGQAAFITGSALFLA
FT                   VESIRLLWAPQPVTNGALGIGVMGVSILLTLALVYYQRIVIRKTGSLAISADSLHYTGD
FT                   VLVNLGVIVALGLSTFWGWSLADPLFALAIAAYILRNAWQIIFHSLNQLMDRELPEEER
FT                   AQITQLALSHPEVLDFHDLRTRAAGQDLFIQFHLGVEGQLSLQRAHQIGKEVEAKVLNI
FT                   FPQAEIIIHHDPMDKNEEDSGGRINF"
FT   gene            492018..492314
FT                   /gene="rnpB"
FT                   /locus_tag="Nhal_R0006"
FT   ncRNA           492018..492314
FT                   /gene="rnpB"
FT                   /locus_tag="Nhal_R0006"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam(RF000
FT                   10), score 278.26"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            492551..493000
FT                   /locus_tag="Nhal_0481"
FT   CDS_pept        492551..493000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0481"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: noc:Noc_2870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13667"
FT                   /db_xref="GOA:D5BW17"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW17"
FT                   /inference="protein motif:TFAM:TIGR00242"
FT                   /protein_id="ADE13667.1"
FT                   /translation="MFRGITTLNLDAKGRLSIPAKHRRRLGTYCDGKVVVTIDLLDPCL
FT                   QLYPLPEWEAVEQKLIALPSHNRQARYIKRQLIGHSVECELDSHGRILLPSELRVRADL
FT                   KKNITLVGQGNKFELWDTGVWEQQMAEEETLAGEELARELALLAL"
FT   gene            493010..493963
FT                   /locus_tag="Nhal_0482"
FT   CDS_pept        493010..493963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0482"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: noc:Noc_2869 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13668"
FT                   /db_xref="GOA:D5BW18"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW18"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ADE13668.1"
FT                   /translation="MAPMDEKETLTHQPVLLREVIQALAIRRDGLYVDATFGRGGHAQA
FT                   ILDALSSEGRLLGVDKDPEAIAAGRILAQQDRRFSIVQASIGELARVVAEQGWLKRVNG
FT                   VLFDLGVSSPQLENAKRGFSFLQDGPLDMRMNPAVGQSAAEWLASATEKEIAAVLKTYG
FT                   EERFCRRIARAIVQAREINPLTRTKQLAEVVAKANPSWEPGRHPATRSFQAIRIFINNE
FT                   LEELRAALEQAVTVLAVKGRLVVISFHSLEDRMVKRFFRQKSRGEDLPPDLPVMQDHFQ
FT                   ASLQVLGKLIWPTPEEVSRNPRARSARLRVAEKPVH"
FT   gene            493980..494252
FT                   /locus_tag="Nhal_0483"
FT   CDS_pept        493980..494252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0483"
FT                   /product="cell division protein FtsL"
FT                   /note="TIGRFAM: cell division protein FtsL; PFAM: cell
FT                   division protein FtsL; KEGG: noc:Noc_2868 cell division
FT                   protein, FtsL -like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13669"
FT                   /db_xref="GOA:D5BW19"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW19"
FT                   /inference="protein motif:TFAM:TIGR02209"
FT                   /protein_id="ADE13669.1"
FT                   /translation="MTSLQWLLLGGLMVLVLGSGVSVVYVKHENRKLFMELQGLYKARD
FT                   RLDDEWGRLLLEQSTLVGQGRVERLARERLEMVVPGPTEVVIIKL"
FT   sig_peptide     493980..494054
FT                   /locus_tag="Nhal_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.735 at
FT                   residue 25"
FT   gene            494257..495960
FT                   /locus_tag="Nhal_0484"
FT   CDS_pept        494257..495960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0484"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   noc:Noc_2867 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13670"
FT                   /db_xref="GOA:D5BW20"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW20"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADE13670.1"
FT                   /translation="MSRGRNKGYPARLGVVGLVFAVAAVGLAWRLVELQVFNRDFLRGE
FT                   GEARHLRVVEVPAHRGMITDRHGEPLAVSTPVASVWFNPQLLREARERWPALAKAVGVS
FT                   TAYLSRRIKEGGEREFVYLKRWVEPNVARQVQALDIPGVNLQSEYRRYYPAGSVAAHVV
FT                   GFTNIDDRGQEGLELAFDKTLQGVPGKKRVIRDSRGRVVEDVENLRVPRPGQDLRLSID
FT                   LRLQYLAYRELKAAVRTHNARAGSLVILDVDTGEVLAMVNRPSYNPNDRSQLKSHLYRN
FT                   RAVTDLFEPGSTIKPFTIGVALESGKYHPHTPIDTTPGYFRVGRHVIRDIRNYGRVDVS
FT                   TVIKKSSNVGASKIALSLDSQRLWQGFAQAGLGASTASGFPGEAEGHLPDPFSFRQIEQ
FT                   ATLAFGYGLSVTTLQLARAYAALGAGGELKPVSFLHREQAAGGRQVWSESTVSALLSML
FT                   EEVVSEGGTGERAHVPSYRVAGKTGTVKKAIRGGYADERYVSLFAGLIPASRPRLAAVV
FT                   LIDEPQGKIYYGGQVAAPVFSRVMVGAMRLLNIAPDNLHPLRLAERENRG"
FT   sig_peptide     494257..494343
FT                   /locus_tag="Nhal_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.307 at
FT                   residue 29"
FT   gene            495969..497540
FT                   /locus_tag="Nhal_0485"
FT   CDS_pept        495969..497540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0485"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG: noc:Noc_2866
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13671"
FT                   /db_xref="GOA:D5BW21"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW21"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ADE13671.1"
FT                   /translation="METAEETAKEGQGTIMAESGDRSCWLSDLLAGLVSVGTAQDRRIN
FT                   RLSLDSRRVGPGTLFFACRGTRQSGHDYIGAAVGKGAVAVAYDPIIPLSSVVHAGLQAQ
FT                   DVPLIALPDLGARLGVIADRFYLRPSQQLCVMGVTGTNGKTSVSHFLAQALHQQEAPCG
FT                   LIGTLGVGLMGALKPSQLTTPDAVTVQEQLAVTRAAGGRYAVMEVTSHALEQGRVNGVI
FT                   FNTAIFTNLSREHLDYHGDMTRYGAAKFRLFGQPGLRHAVINVDDTAGEAFLAHLPAEV
FT                   TVISYGLTNPQASLRVNELHCDRRGIVMNIQGPWGEGELICPLLGRFNAYNLLAALGGL
FT                   LTTGMPFTEALQRLSQVQAVAGRMEPMGGAAGEPLLVVDYAHTPDALEQALCSLRAHLE
FT                   PGARLWCVFGCGGNRDRGKRPLMGAVAERWADFVMLTDDNPRDEDPRQIIIEILSGMEA
FT                   PDRVYQLRDRAEAISRAVELAGSKDIVLIAGKGHEEYQQVGTEQRPFSDREQAQQALQQ
FT                   RRRGLC"
FT   gene            497558..498904
FT                   /locus_tag="Nhal_0486"
FT   CDS_pept        497558..498904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0486"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: noc:Noc_2865
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-D-alanyl-D -alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13672"
FT                   /db_xref="GOA:D5BW22"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW22"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ADE13672.1"
FT                   /translation="MGLAELTPVVQGRLQGEDVVAQGVSTDTRSMTPGALFVALKGQNF
FT                   DGHAFVAQAREKGASAALLEQTIEDSLPQVEVADARTALGQLATYWRQRFEHPVVAVTG
FT                   SNGKTTVKEMIASVLGGAGSVLATQGNLNNDIGVPLTLLGLDPSHRFAVIEMGANQPSE
FT                   IGYLSCLVRPQVALITNAGPAHLDGFGDLKGVARAKGEIFQGVNPGGVAVLNADDPHFS
FT                   YWRDLAGELPVIGFGLTQSAEVTAHHLAAHSEGSRFTLVTPVGKTPVQLSLPGRHNVLN
FT                   ALAASAVAIALGLDRDQISAALAALPSIPGRLQIRRGAGGMRLLDDTYNANPASLKAAL
FT                   ELLAEFPGERFLVLGDFAELGEEAAPLHRMMGKQARAAGVNRLYTLGHLSALAAEAFGQ
FT                   EALHFFEQQSLLAALREEQRPNVTMLVKGSRCMRMEQIVAALGSDRDND"
FT   gene            498909..499985
FT                   /locus_tag="Nhal_0487"
FT   CDS_pept        498909..499985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0487"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: noc:Noc_2864
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13673"
FT                   /db_xref="GOA:D5BW23"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW23"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ADE13673.1"
FT                   /translation="MLLYLTDYLARFDSGFYVFQYLTLRAILGVLTALIISFVVGPAMI
FT                   RRLKFVGQPVRANGPVTHLCKAGTPTMGGALILVAIAATTLLWADLSNRYVWVVLVVTL
FT                   LFGGVGFIDDYKKLVSQNPRGLSGWRKYFWQSVIALGVALFLYFTAQVSAETELIVPFF
FT                   KNVAVDLGGYYVLLTYLVVVGSSNAVNLTDGLDGLAVLPTVLVGGALGIFAYATGHSGF
FT                   AHYLAIPYIPGVGELVVFCGALVGAGLGFLWFNAYPAQVFMGDMGALALGAALGILAVL
FT                   VRQELVLFIMGGVFVVETVSVILQVVSYKLTGRRIFRMAPLHHHFEIKGWPEPRVIVRF
FT                   WIITVILVLIGLATLKIR"
FT   gene            500066..501424
FT                   /locus_tag="Nhal_0488"
FT   CDS_pept        500066..501424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0488"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG: noc:Noc_2863
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13674"
FT                   /db_xref="GOA:D5BW24"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW24"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ADE13674.1"
FT                   /translation="MLNEPIPPWTVASAVIVGLGKTGLSCARFLANRGLSVTVVDSREA
FT                   PPGLAALQEQVPGVAVRLGDFEVALMQQAERLVISPGVALSEPAIQVAQARGIPVLGDI
FT                   ELFAYWAQAPVIAITGSNGKSTVTVLVEAMARQAGKKVLSGGNLGLPALELLEKPVPDL
FT                   YVLELSSFQLETTSTLNAVAACILNISPDHMDRYPNLEAYVQAKGRVYHGTGAMVINAD
FT                   DVQVAGLAQPERHCLRFTLGAPAADEYGLRERAGETWLARGHELLLPARQFPLVGRHNL
FT                   ANALAALALGEAAGLPQLAMLSALREFRGLPHRCEWVAQANGVDWYNDSKGTNVGATVA
FT                   AIEGLHCQGKLVLIAGGVGKGADFSPLCAPLSRRARAVVLMGQDAPRLEAALANSVPLY
FT                   QVNDMGEAVNKASALAEPGDSVLLSPACASFDMYSGFEARGQAFIQAVQEHLS"
FT   gene            501421..502584
FT                   /locus_tag="Nhal_0489"
FT   CDS_pept        501421..502584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0489"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: noc:Noc_2862 cell cycle protein, FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13675"
FT                   /db_xref="GOA:D5BW25"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5BW25"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ADE13675.1"
FT                   /translation="MSRFFSTRQAVGGSTPQPDLYLLGAAVALMGLGWVMVGSASVAIA
FT                   DSRFGQPTYYLWRQGLFLLLGLVTAFGVWRIRLAFWEKLGPVMLLLGLGLLLLTLIPGI
FT                   GVEVNGSRRWLALGPIRLQPSELAKLFMVIYLSGYLVRRSAEVRTIRGFLFPVGVFAMA
FT                   GLLLLLEPDFGAVVVLFATLLGMLFLGGARLWHFLLLAALGGASLAALAWYSPYRMQRL
FT                   TSFLDPWADPLNSGYQLTQALIAFGRGEWLGVGLGNSIQKLFYLPEAHTDFLYAVLAEE
FT                   LGLMGSLAVIALFVVFIYRVLLIGRAAERAGRTFGAHLAYGLGIWIGLQAFINLGVNMG
FT                   VLPTKGLTLPLMSAGGSSSIVTCVAVALILRVDLETRFPKVARRSVK"
FT   gene            502581..503663
FT                   /locus_tag="Nhal_0490"
FT   CDS_pept        502581..503663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0490"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: noc:Noc_2861 N-acetylglucosaminyltransferase,
FT                   MurG; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13676"
FT                   /db_xref="GOA:D5BW26"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW26"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ADE13676.1"
FT                   /translation="MRATRVLIMAGGTGGHVFPALAVADTLRAWGVEVVWMGTHQGLEA
FT                   ELVPKAGYPMEWISIGGLRGKGWANWLRAPFKLLLALFQALNALRRQQPTVVLGLGGFA
FT                   SGPGGLGAWLLGRPLLIHEQNAIAGTTNRLLSHLACRVMEAFPGTFPAAMEAECTGNPV
FT                   REGIEALPEPQTRFQDRRDRFRLLVLGGSQGARVLNEMLPQALALLPPEARPQVWHQCG
FT                   PRQWEKAVAAYRAAGVESRLVPFIDEMAEAYAWADLVLCRAGALTIAELMAAGIGSLLV
FT                   PFPLAIDDHQRANADYLVDAGAALLLPEKEVTPQRLAGEIERLGGDRFTLMTMAQIARQ
FT                   LHRVGAARRVAERCLEVARG"
FT   sig_peptide     502581..502649
FT                   /locus_tag="Nhal_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.803 at
FT                   residue 23"
FT   gene            503656..505086
FT                   /locus_tag="Nhal_0491"
FT   CDS_pept        503656..505086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0491"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: noc:Noc_2860
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13677"
FT                   /db_xref="GOA:D5BW27"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW27"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADE13677.1"
FT                   /translation="MVEPQMTPIPPMMRRIRRIHFVGIGGVGMGGIAEVLLNLGYQVSG
FT                   SDLRQNQLTQRLISLGGEVRIGHDPQHIEGCDVVVVSSAVSEDNPEVSAARRRLIPVVP
FT                   RAEMLAELMRFRYGIAVAGTHGKTTTTSLIAGILGEGGFDPTFVIGGRVNSIGANGRLG
FT                   SGEYLVAEADESDASFLHLQPLLAVVTNVDADHMGTYGGDFTALKAAFLEFLHHLPFYG
FT                   LAVVCLNDPVLRELLPDIGRPVLTYGTCEDADYRLRELKHVQGRTQFRVARPGNDNWLT
FT                   VVLNLPGAHNALNALAAMVVAHELGAEDAAIQRALEGFSGIGRRFQCYGEIATPRGRVL
FT                   LVDDYGHHPRELTATLEALHAGWPGRRVVVVFQPHRYTRTRDLFEDFIEALSLADVLLL
FT                   LEVYPAGEEPIAGADSRTLGQAIRANGHVDPIGVEDMETIEEVLLGVLQEGDVLLTLGA
FT                   GDIGALARRLSASLGGCR"
FT   gene            505086..505982
FT                   /locus_tag="Nhal_0492"
FT   CDS_pept        505086..505982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0492"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: noc:Noc_2859
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13678"
FT                   /db_xref="GOA:D5BW28"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW28"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ADE13678.1"
FT                   /translation="MVVVNGASFRGQLQQQVSMGGYTSWRVGGPARCLYRPADVDDLMA
FT                   FLGSLPEDEPLSWLGLGSNLLVRDGGIEGTVIAIAGALNRIERRSATTVWVEAGVPCAK
FT                   LAKFCAREGLRGAEFMAGIPGTVGGALAMNAGAFGRETWELVTAVETVGVGGRRHRRRP
FT                   QEYQVGYREVHRPKGEWFIAAELRLAQGDSQAAQQQIRHLLRHRNSCQPTQQPCAGSVF
FT                   RNPPNDKAGRLIESCGLKGVSIGGAQVSEKHANFIVNTGDAAAADIEHLIQLVAETVAR
FT                   RRGVTLVPEVHVVGDLA"
FT   gene            505979..506929
FT                   /locus_tag="Nhal_0493"
FT   CDS_pept        505979..506929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0493"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: noc:Noc_2858 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13679"
FT                   /db_xref="GOA:D5BW29"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW29"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADE13679.1"
FT                   /translation="MTRRMATENWGKVAVLMGGRSAEREISLKSGTAVLEALLRQGVDA
FT                   QGIDVGERVLEQLSRGQFERAFIALHGRGGEDGVIQGALETLGLPYTGSGVLGSALAMD
FT                   KLRSKQLWRGMGLPTADFSVLNEGTDLALVVANLGLPLMVKPAREGSSLGMRKVDSIEA
FT                   LRAAYREAMAFDGTVIAEQWLPGAEYTAAILTGRALPLIGLETPRIFYDFEAKYLTDTT
FT                   RYLCPCGLSEEQAQHLQALALQAFQALGASGWGRVDFRCDAQARPCLLEVNTVPGMTAH
FT                   SLVPMAAQAAGIEFDQLVLQILESSLERSAPQDGR"
FT   gene            506919..507719
FT                   /locus_tag="Nhal_0494"
FT   CDS_pept        506919..507719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0494"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: noc:Noc_2857 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13680"
FT                   /db_xref="GOA:D5BW30"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW30"
FT                   /inference="protein motif:PFAM:PF03799"
FT                   /protein_id="ADE13680.1"
FT                   /translation="MAVRRRKPRRIRQGASRPQPAPALPLRAMGQGLLVLFLVGAAAWG
FT                   ISRLADPQTLPLRKVSIEGQFKQVTQEKLHEAVAPHVSGGFFSVNLETIRAAVEALPWV
FT                   AQAGVRRVWPDSLRIEVKEQVPLAYWGEEALVSVEGEIFAPPRESFPKGLPKLQGPLGS
FT                   ERLLVSRLGEIEAQLSALELQVAQLTMGERRDWHIVFEDGVELILGRAHSKQRLTRFQQ
FT                   IYARLLQLHREDIRRVDMRYTNGFAVTWRGDTAPAWVREAAFDV"
FT   sig_peptide     506919..507071
FT                   /locus_tag="Nhal_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.513 at
FT                   residue 51"
FT   gene            507712..508947
FT                   /locus_tag="Nhal_0495"
FT   CDS_pept        507712..508947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0495"
FT                   /product="cell division protein FtsA"
FT                   /note="TIGRFAM: cell division protein FtsA; PFAM: cell
FT                   division protein FtsA; KEGG: noc:Noc_2856 cell division
FT                   protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13681"
FT                   /db_xref="GOA:D5BW31"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW31"
FT                   /inference="protein motif:TFAM:TIGR01174"
FT                   /protein_id="ADE13681.1"
FT                   /translation="MSKRGDKNLIVGLDVGTSKVAAIVAEAHPEGEIEVIGIGSHPSRG
FT                   LKKGVVVNIDSTVHSIQRAVEEAELMAGCQIHSVFTGIAGSHIRSLNSHGIVAIRDKEV
FT                   TTEDVERVIDAARAVAIPADQKILHVLPQEFIIDSQEGIRDPVGMSGVRLEAKVHLVAG
FT                   AVSAAQNIIKCVRRCGLEADDIILQQLASSYSVLTDDEKELGVCLVDIGGGTTDIAVFV
FT                   GGAIRHTAVIPIAGDQVTNDIAVALRTPTQHADDIKLRYACALTQLTHSDESIEVPSVG
FT                   DRPPRRLSRQTLAGVVEPRYRELLELVLEELQRSGYEELLGAGVVLTGGSAKMEGVTEL
FT                   AEEVFHTPVRLGMPQHVTGLADVVRNPVHATGVGLLLFGHHHRYTPGLGNRPLGSIRGV
FT                   WDRMRGWFQGNF"
FT   gene            509012..510169
FT                   /locus_tag="Nhal_0496"
FT   CDS_pept        509012..510169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0496"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   noc:Noc_2855 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13682"
FT                   /db_xref="GOA:D5BW32"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW32"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ADE13682.1"
FT                   /translation="MFELMDSYTQSAVIKVIGVGGGGGNAIRHMVDTKIEGVDFIVANT
FT                   DAQALKDCAAHTVLQLGNNITKGLGAGADPEIGRQAALEDRERIMEVVSGADMVFITAG
FT                   MGGGTGTGGVPVVAQVTKELGVLTVAVVTRPFSFEGRKRAAIADQGIKELTEYVDSLIT
FT                   IPNEKLMPVLGKSISLLNAFKAANDVLLGAVQGIAELITRPGLINVDFADVRTVMSEMG
FT                   MAMMGSGNATGEERARLAAEAAVASPLLEDISLKGARGVLVNITGGPSMSIGEFEEVGS
FT                   TVKEYAAENATVVVGTVIDPDLENELRVTVVATGLGQPETQAKAPVSLVQSSSQQPESE
FT                   EPIDYHMLDKPTVIRHGSSRDRMVAGSDTSMDYLDVPAFLRRQAD"
FT   gene            510304..511215
FT                   /locus_tag="Nhal_0497"
FT   CDS_pept        510304..511215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0497"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="TIGRFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; KEGG: noc:Noc_2854
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13683"
FT                   /db_xref="GOA:D5BW33"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW33"
FT                   /inference="protein motif:TFAM:TIGR00325"
FT                   /protein_id="ADE13683.1"
FT                   /translation="MIRQRTLKNVIRATGVGLHTGDTVYLSLRPAAVDTGIVFRRVDLD
FT                   PPIEIEARAENVGDTTLSSTLLKGGVRIATVEHLLSAFAGLGIDNAYVDLNASEVPIMD
FT                   GSAGPFVFLIQSAGIATQEAPKRFIRIKKTLIMKEEDKWARFDPFDGFKVSFVIDFDHP
FT                   AFKDRPQGVEVDFSSTSFVKEVSRARTFGFMKDLERLREANLALGGSLNNAVVVDDYRV
FT                   INEDGLRYEDEFARHKILDAIGDLYLLGHTLIGAFSGYKSGHALNNKLLCALMADQSAW
FT                   EVVTFEDEAAVPILFTSPLTAV"
FT   gene            complement(511253..511783)
FT                   /locus_tag="Nhal_0498"
FT   CDS_pept        complement(511253..511783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0498"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   noc:Noc_2853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13684"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW34"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADE13684.1"
FT                   /translation="MNTIAAFRGLGKDDNLHDLIFGINLGIPTMQVAQPIGKLLDTTEG
FT                   NLQRLLARAKALQQLTSKIRQCLPETLSPHCLVANIRDHRLIVHTDTAARANLLRYYTP
FT                   SIIKYLQQYPEFRNLRKVTIKVRPLYCLAPASQAQRPFLSPGNGTLLRNIASGMKDPHL
FT                   KSAFLRLSRRANP"
FT   gene            511820..512683
FT                   /locus_tag="Nhal_0499"
FT   CDS_pept        511820..512683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0499"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: noc:Noc_2852 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13685"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW35"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADE13685.1"
FT                   /translation="MLVCILLVVYGAYCLGIKTQFVAQQQSLAQMKTLAENWQATLEQQ
FT                   QVVLSTTMHQAEEGLGTLAQRVGHLQADLVRLNALGQRLIVHADLEEGEFDFTNPPAMG
FT                   GPELPRTEERLKLNDFLARLGQLEQAVADRRQQLSLLETVLVERGMRQAALPAGRPLRQ
FT                   GWLSSKYGYRTDPFNGRREFHNGVDFASKAGTEILAVAAGIVTWVGERSGYGKMVEIDH
FT                   GNGYVTRYAHNQKNLVQVGESIVKGQPIAAMGSSGRSTGPHVHLEVLHEGRTVDPLRFV
FT                   GTAEES"
FT   gene            512868..515594
FT                   /locus_tag="Nhal_0500"
FT   CDS_pept        512868..515594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0500"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; SEC-C motif domain
FT                   protein; KEGG: noc:Noc_2851 SecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13686"
FT                   /db_xref="GOA:D5BW36"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW36"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADE13686.1"
FT                   /translation="MVTNLLSKVFGSRNDRLLRSMNKVVAQINVLEQDIAALSDEQLQA
FT                   KTNEFRNRLAEGEDLDDLLPEAFAVVREAGKRVLNMRHFDVQLLGGMVLHEGKIAEMRT
FT                   GEGKTLVATLAAYLNALPGKGVHVVTVNDYLAQRDAQWMGPLYQFLGLSTGAIVANMDP
FT                   VARRAAYAADITYGTNNEFGFDYLRDNMAFSLEDKVQREMHYAIVDEVDSILIDEARTP
FT                   LIISGAAEQSSELYRRINAFIPQLSKQEGEEGPGDYTVDEKVRQVYLTEAGHEHVERIM
FT                   FESGLMQEGESLYDAANIGLMHHLNAALRAHVLFHRDVDYIIKDNQVVIVDEFTGRTMP
FT                   GRRWSEGLHQAVEAKEGVPIQSENQTLASITFQNYFRLYDKLAGMTGTADTEAYEFQQI
FT                   YGLEVVVVPTHLPMVRVDHGDKVYLTTEEKFQAISEDIKDCRSRGQPVLVGTTSIEASE
FT                   HLSKLLKKEKIEHQVLNAKFHEKEAQIISQAGRPGTVTIATNMAGRGTDIVLGGSLEAE
FT                   LAALDENADKAKREELRRIWQERHEEVVAAGGLHIIGTERHESRRIDNQLRGRSGRQGD
FT                   PGSTRFYLSLEDNLMRIFASERISGLMQKLGMEEGEAIEHPWVTRAIENAQRKVEGHNF
FT                   DIRKQLLEFDDVANDQRKVVYEQRNELMATDDISEMVQGIRESVIGSVFSQYIPPGSID
FT                   EQWDISGLQEALASEFGLQLDIAAWLKTDEDLHEETLRERILEAMESAYKEKESLVSPE
FT                   VLRHFEKAAMLQVLDSQWKEHLAMMDHLRQGIHLRGYAQKNPKQEFKREAFELFQEMLE
FT                   RIKYDVITLLSKVQVRTESDVEAVEHQRRATSAVEYQHAAASAMAGGAGEAEAPRAESE
FT                   ASESKAPYVREGRKVGRNEPCPCGSGKKYKHCHGKLN"
FT   gene            515710..516060
FT                   /locus_tag="Nhal_0501"
FT   CDS_pept        515710..516060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13687"
FT                   /db_xref="GOA:D5BW37"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW37"
FT                   /inference="similar to AA sequence:KEGG:Noc_0454"
FT                   /protein_id="ADE13687.1"
FT                   /translation="MKLPLTFGKIIFFIIQHPLAAILVAGLVGVFAFFFPLLAYVSGAI
FT                   VGLVALEREFKVALVVALGAALPAAIMAFSGANKAGIVFPLLLVLGLPHCICAALLRAT
FT                   RSQSVALNSPRA"
FT   sig_peptide     515710..515829
FT                   /locus_tag="Nhal_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.743 at
FT                   residue 40"
FT   gene            516117..517334
FT                   /locus_tag="Nhal_0502"
FT   CDS_pept        516117..517334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0502"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: noc:Noc_2850 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13688"
FT                   /db_xref="GOA:D5BW38"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW38"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADE13688.1"
FT                   /translation="MAVGLEHLPELLPVAGVKLGTVAAGIRYRDRLDLAVIEAIEGSTC
FT                   AAVFTRNAFCAAPVVVARRHLAENSPRLLLINAGNANAGTGAQGLRDAEACCTTLAELA
FT                   GVAPRAVLPFSTGVIGEPLPVSLVRTALPQAWEARSPTGWEGAARAIMTTDTVPKGLSV
FT                   SFTCQGRPVTVTGIAKGSGMIRPDMATMLAFLATDAQVPKEVLQLCLTKAVAESFNRIT
FT                   VDGDTSTNDACVLMATGQSGVSIRAAEGPDFAALQQAVSEVCLHLAQAIIRDGEGATKL
FT                   IAVKVAGGGNVQECEQVAYAIAQSPLVKTACFASDPNWGRILAAIGRSGVPDLEITGVS
FT                   LYLSEVCVIDKGVPHPDYTEEQGQAVMERDEITIGVELGRGNFCAQIWTCDLSFDYVKI
FT                   NAEYRS"
FT   gene            complement(517350..517682)
FT                   /locus_tag="Nhal_0503"
FT   CDS_pept        complement(517350..517682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0503"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   noc:Noc_2849 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13689"
FT                   /db_xref="GOA:D5BW39"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW39"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADE13689.1"
FT                   /translation="MFLCHLEELPEYGTRGFAIGQQEIFVIRQATQIWAYMNRCPHTGV
FT                   TLNWVPDQFLDWEGRYVQCATHGALFRFEDGLCLAGPCPGTHLEPVPLSLIGGEIYLTN
FT                   PGKIRS"
FT   gene            complement(517697..518578)
FT                   /locus_tag="Nhal_0504"
FT   CDS_pept        complement(517697..518578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0504"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: noc:Noc_2848
FT                   ketohexokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13690"
FT                   /db_xref="GOA:D5BW40"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW40"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADE13690.1"
FT                   /translation="MAKMLGIGIATVDIINTVEGYPAENDEIRALSQRRCRGGNCANTL
FT                   TVLQHLGHECMFAGILAEEPDGQFITQELKQQGINTDNCRIVKGKTPTSYVTLSRATGS
FT                   RTIVHYRDLPEFSFADFANIDLSPFDWLHFEGRNVAETARMLALVRERFPSLPWSVEIE
FT                   KPRPGIESLFEGAAVLLFSRHYVTYHGYSEAQTFLQKWHATLPDTEKICAWGEEGAYAI
FT                   DEEGKMHHAPAFFPPQVVDTLGAGDTFNAGFLDARLRHRSLSESLTFGCQLAGRKCGQQ
FT                   GFDGLGSSDLKP"
FT   gene            complement(518589..519242)
FT                   /locus_tag="Nhal_0505"
FT   CDS_pept        complement(518589..519242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0505"
FT                   /product="adenylate kinase"
FT                   /note="TIGRFAM: adenylate kinase; PFAM: adenylate kinase;
FT                   adenylate kinase lid domain protein; KEGG: noc:Noc_2847
FT                   adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13691"
FT                   /db_xref="GOA:D5BW41"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW41"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADE13691.1"
FT                   /translation="MRTVLLGAPGSGKGTQGELLSQKYGIPQISTGDLLRAAVAAGSEL
FT                   GKQAKAAMDAGKLVSDEIVIGIIRERLTQPDAAKGYILDGFPRNLAQAQALDEMLAALE
FT                   QPLQAVILLDVDFEVLMKRLTGRRTCQVCGAIYNIYFSPPQEDQRCDKCGSDQLIQRSD
FT                   DNEETIANRLQVYQSQTAPLVDYYEAQGKLHKVNGTDEVTEVAKHIGQILETAM"
FT   gene            519509..520774
FT                   /locus_tag="Nhal_0506"
FT   CDS_pept        519509..520774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0506"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: noc:Noc_2846
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13692"
FT                   /db_xref="GOA:D5BW42"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW42"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ADE13692.1"
FT                   /translation="MAKKNAFYAQSGGVTAVINASACGVIETARQHSEVIGKVYAGRNG
FT                   IIGALTEDLIDTSQESDSAIAALRHTPGGAFGSCRYKLKGLEENKAEYERLIEVFKAHD
FT                   IGYFFYNGGGDSQDTAHKVSQLGDQLGYPITCIGVPKTVDNDLPITDNCPGFGSVAKYV
FT                   AVSVREAALDVASMARTSTKVFILEVMGRHAGWIAAAGGVAAEQEGDAPHIILFPEIPF
FT                   EQEQFLQKVDASVKDYGYCVIVASEGVRNKEGQFLSETGTRDAFGHAQLGGLAPLVAQI
FT                   VREKLGYKYHWAVADYLQRAARHIASQVDVEQAYAVGKAAVEFAVRGENAVMPTIIRKS
FT                   SDPYRWEIGSAPLKDVANVEKDLPRSFITPEGFGITEEARSYLTPLIQGEDYPPYKNGL
FT                   PVYVQLKNAPVEKKLKESFTLR"
FT   gene            complement(520925..521902)
FT                   /locus_tag="Nhal_0507"
FT   CDS_pept        complement(520925..521902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0507"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: noc:Noc_2845 peptidase S49,
FT                   SppA"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13693"
FT                   /db_xref="GOA:D5BW43"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW43"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ADE13693.1"
FT                   /translation="MSEQDPSTTDLDKKQETQLSWEREVLERLAFSALKEQRRARRWNI
FT                   FFKILFAGYLLVFLLLYLPNGLSAPGITTPHTALVEVDGLISADSFASAENIKKGLQTA
FT                   FESEHSRGVILHINSPGGSPVQTGRINDEIHRLRQEHPNIPLYAVISDVCASGGYYIAV
FT                   AADQIYADKASIVGSIGALINGFGFVDAMEKLGVERRLFAAGDYKGFLDPFSPIKESEA
FT                   QHIQKMLENIHKQFIQIVKDGRGERLKEDPSLFSGLVWTGEQALTLGLIDGLGSSDYVA
FT                   REIVGAEKIVNYTPKPGFLERFSAQIGATLIEMLSDFSLAANMR"
FT   gene            complement(521987..522964)
FT                   /locus_tag="Nhal_0508"
FT   CDS_pept        complement(521987..522964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0508"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="KEGG: noc:Noc_2844 pseudouridine synthase, RluD;
FT                   TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; RNA-binding S4 domain protein;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13694"
FT                   /db_xref="GOA:D5BW44"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW44"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ADE13694.1"
FT                   /translation="MNSKEQSSTPRVRLVEIQLEQAGQRIDNFLLSQLKGVPKSRIYRC
FT                   LRRGEVRVNKSRVASSYRLEQGDQVRIPPLRVSHPSVKEPVAPSLLHLIESSLLYEDKH
FT                   LLILNKPAGIAVHSGSSISYGVIETLRHLRPEAPFLELVHRLDRETSGCLMVAKTRSTL
FT                   LALQSMQREQLIHKRYLALVKGRWPRNIGQVNLPLLKNILQSGERVVKVSATGKPAASH
FT                   FHPKQLYKEATLMEITLETGRTHQIRVHAAHLGHPLGGDEKYGDPAFNKRLRNLGLRRL
FT                   FLHADQLSFTPPEGKKLLKITAPLPEELSAVLKAYANKILTQQP"
FT   gene            complement(523038..523865)
FT                   /locus_tag="Nhal_0509"
FT   CDS_pept        complement(523038..523865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0509"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: eba:ebA3597 molybdate or tungstate transport"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13695"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW45"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADE13695.1"
FT                   /translation="MALTGKLLIAATLLLSLTTNAAAADKFITVASTTSAENSGLFREI
FT                   LPQFKQKTGIAVRVVAQGTGQALDTGRRCDADVVFVHDPASEEKFVAEGHGVKRHGVMY
FT                   NDFVLVGPKSDPAGVAGGKDITIALKKIANTKTPFASRGDNSGTHKAERRLWQAAGIDL
FT                   EKAKGPWYREMGSGMGATLNTAAQMNAYLLTDRGTWLSFKNPVELAILVEGDTRLFNPY
FT                   SVILVNPTKCPNVKKDLGQAFIDWLVSPEGQKAIGAYQIGGKQLFFPNTNANS"
FT   sig_peptide     complement(523794..523865)
FT                   /locus_tag="Nhal_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.641 at
FT                   residue 24"
FT   gene            complement(523856..524581)
FT                   /locus_tag="Nhal_0510"
FT   CDS_pept        complement(523856..524581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0510"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aeh:Mlg_2739 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13696"
FT                   /db_xref="GOA:D5BW46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW46"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE13696.1"
FT                   /translation="MGYPGTLLPLQLDGVTFTAGGRTILEGITARIEAGPRTVILGPNG
FT                   AGKSVLMRVCHGLLAPTAGTVKWNVPDRPGRRRQAMVFQRPVMLRRSAWDNITYALKLA
FT                   GVARKDRDRRAQAALEQVGLSRLAQSQARVLSVGEQQRLALARAWAMRPEVLFLDEPTA
FT                   GLDPTATGEVHRIIQAIHDAGTKIVMTTHNLGLAKYCADEILFLNEGRLLEQTPAERFF
FT                   TQPASAKAHAFLCGELLWH"
FT   gene            complement(524585..525289)
FT                   /locus_tag="Nhal_0511"
FT   CDS_pept        complement(524585..525289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0511"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aeh:Mlg_2740
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13697"
FT                   /db_xref="GOA:D5BW47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW47"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE13697.1"
FT                   /translation="MNTLGLAFQQAIDMISRGDPELVEIVLLSLRVSLTATLIASGIAL
FT                   PIGAATGVAKFPGRQVLIVIFNALMGLPPVVIGLLVYLLLSRAGPLGDYGLLFTPTAMI
FT                   IAQTILIVPIVAALSRQVIEDAWSEYSEQLRSLGAGLTQSALTLLWDTRFSLVTVVLAG
FT                   FGRAAAEVGAVMIVGGNIAGVTRVMTTAIALETSKGDLPLALGLGIVLISLVLLLNAVA
FT                   YGVKRIAQRRYG"
FT   gene            complement(525479..525913)
FT                   /pseudo
FT                   /locus_tag="Nhal_0512"
FT   gene            526012..526113
FT                   /pseudo
FT                   /locus_tag="Nhal_0513"
FT   gene            complement(526226..526302)
FT                   /locus_tag="Nhal_R0007"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(526226..526302)
FT                   /locus_tag="Nhal_R0007"
FT                   /product="tRNA-Arg"
FT   gene            complement(526469..526780)
FT                   /locus_tag="Nhal_0514"
FT   CDS_pept        complement(526469..526780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_1602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13698"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW48"
FT                   /inference="similar to AA sequence:KEGG:Noc_1602"
FT                   /protein_id="ADE13698.1"
FT                   /translation="MSVAATTPTKTHTIVLTIRDTLDFTMSQDSWEVSTQGQKINFVVD
FT                   LANMESIKDSGYDLLWMLKECADREQADISIIHCTPCLHKELCELGLDQYFRIDETQD"
FT   gene            complement(527777..527852)
FT                   /locus_tag="Nhal_R0008"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(527777..527852)
FT                   /locus_tag="Nhal_R0008"
FT                   /product="tRNA-Ala"
FT   gene            complement(528320..528802)
FT                   /locus_tag="Nhal_0515"
FT   CDS_pept        complement(528320..528802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0515"
FT                   /product="FlgN family protein"
FT                   /note="PFAM: FlgN family protein; KEGG: noc:Noc_2685 FlgN"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13699"
FT                   /db_xref="GOA:D5BW49"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW49"
FT                   /inference="protein motif:PFAM:PF05130"
FT                   /protein_id="ADE13699.1"
FT                   /translation="MSAQVLINLLQEELSCLECLWQTLQDEHLALRQREVTDMEAAVNK
FT                   KQDAMIRLEAVFQDHEERLRMSGLPSTPEGISAYVQASTSQEQGQLSTLWEQRQERLQQ
FT                   CRDQNQLNGSLINRNRHQVLRALTILSGQELKSAAYGPGGDLLPSASAPRSLLGRV"
FT   gene            complement(528813..529127)
FT                   /locus_tag="Nhal_0516"
FT   CDS_pept        complement(528813..529127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0516"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="PFAM: Anti-sigma-28 factor FlgM family protein;
FT                   KEGG: noc:Noc_2684 anti-sigma-28 factor, FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13700"
FT                   /db_xref="GOA:D5BW50"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW50"
FT                   /inference="protein motif:PFAM:PF04316"
FT                   /protein_id="ADE13700.1"
FT                   /translation="MSTEINGLSGYSHAPVQKSLETATADRSKSAEDSSALSHQTAETI
FT                   TLTNTAEQLRETEASLASVSVVDNQKVEQIKQSIQDGSYQIDSERIADKLIALEQALNK
FT                   "
FT   gene            complement(529199..529864)
FT                   /locus_tag="Nhal_0517"
FT   CDS_pept        complement(529199..529864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0517"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA"
FT                   /note="TIGRFAM: flagella basal body P-ring formation
FT                   protein FlgA; PFAM: SAF domain protein; KEGG: noc:Noc_2683
FT                   flageller protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13701"
FT                   /db_xref="GOA:D5BW51"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW51"
FT                   /inference="protein motif:TFAM:TIGR03170"
FT                   /protein_id="ADE13701.1"
FT                   /translation="MLLSPSHSMAKDKQSLAEIQEIARKFVLKQAKALPGNIEVTPGAL
FT                   DRRLRLPKCSHPLKAFFPSGSRPTGNTTVGVRCTGGTPWTVYLSVKVAVYGKVVVATHP
FT                   LVPGSPLSLADIHLERRNLEQLRQGYLRDPAQVAGKRLKRPLGLGAVITPEVLEIPKLV
FT                   RRGQQVILIAKVPGLQVHMKGQALEDAGAGEHIRVRNNSSQRIVEGTVTADGIVQVQM"
FT   gene            complement(530013..530528)
FT                   /locus_tag="Nhal_0518"
FT   CDS_pept        complement(530013..530528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0518"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: tgr:Tgr7_2950 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13702"
FT                   /db_xref="GOA:D5BW52"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW52"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADE13702.1"
FT                   /translation="MKKLSHLNESGEAHMVDVGNKAITQRVAIAEGRILMQPQTLNMIN
FT                   EGHHKKGDVLGIARIAGIMAAKKTADLIPLCHPLALTRVAIELFPHPEISAIDCRATVE
FT                   TKGQTGVEIEALTAVQITLLTLYDMCKSVDRGMTMTDIRLVEKTGGKSGDWKSRGTARR
FT                   TPTHEKPK"
FT   gene            530663..530905
FT                   /locus_tag="Nhal_0519"
FT   CDS_pept        530663..530905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0519"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: mca:MCA3054 molybdopterin
FT                   converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13703"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW53"
FT                   /inference="protein motif:TFAM:TIGR01682"
FT                   /protein_id="ADE13703.1"
FT                   /translation="MAITVKFFASLRERLGCTERQIDFSEPITVAEVWTLVGDGQPISE
FT                   NVLIAVNMEYAGAETVVRDGDEVAFFPPVTGGGGP"
FT   gene            530902..531339
FT                   /locus_tag="Nhal_0520"
FT   CDS_pept        530902..531339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0520"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   tgr:Tgr7_2952 molybdopterin biosynthesis MoaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13704"
FT                   /db_xref="GOA:D5BW54"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW54"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ADE13704.1"
FT                   /translation="MTVHIINAPFDPWQEVANYQQAYLKRAGRFGATACFIGTMRDFNE
FT                   GENVQAMELEHYPGMTEKYLGKLTEEARRQWPILDSLIIHRYGHLQPNEPIVLVVVWSA
FT                   HRAAAFKACYYLVEELKANAPFWKKETLATGTRWVESNTSS"
FT   gene            531392..534118
FT                   /locus_tag="Nhal_0521"
FT   CDS_pept        531392..534118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0521"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: noc:Noc_2682 PAS sensor diguanylate
FT                   cyclase/phophodiesterase; TIGRFAM: diguanylate cyclase; PAS
FT                   sensor protein; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; GAF domain protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13705"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW55"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADE13705.1"
FT                   /translation="MKQGSDVKAKRPTILQALRPIAQAASDHADIDRLLAVAVDSVFSL
FT                   FNCDQVWLLYPCSSIATSYRICCQRSKPGLPQVQTLNRNLPVDEFTGRLFRLALASRSP
FT                   VVFNVDSPLPAQFLEQEPLSSQALMAMALYPNQGEPWLLGMQRSQQNCLWSEQEETLFL
FT                   SVTEFLTEILNTSTRHSNLYEVSQRLLDLLAHATDEEYLLRGGMDILQALIQPEYAVAT
FT                   TLNAEGQLEAFVFSGVSEEKAELITQLSGGKEFLGARLEQALRIDDLNSHPDLVDFLPP
FT                   DFPLKSLLMAPIINEGKIIGRIYLCDKRNHRTFTLDDEVLSMSFADAFAQTLIRFRKTL
FT                   VSQGAQEALFLDHQRAQVTLESIADAVITIDSQGRIDYLNPLAEELIGTTQSQAQGKSL
FT                   EKVTCLLDEESRSHVIRDIAAWLAQEPVESRSCTALLQDARDQELIVQTSIAPLRDSQD
FT                   RIFGAVLVLRDITPLRALASQLSYQATHDVLTGLINRREFEVRLRQALDDVCQNNTHHV
FT                   LCYLDLDQFKVVNDTCGHLAGDKLLRQLATLLQERIREADCLGRLGGDEFGVLLLGCHL
FT                   DQAQGIAESLRILIRDFRFNWKGKTFQLGVSIGLVPLARGSGGLEEVLSAADTACYVAK
FT                   DQGRDRIHTYRLDDCIVERHHGEMQWVARIQQAFEESRFLIYYQPIRALNKEEHLCHGE
FT                   VLLRMKGEDESLIPPMAFIPAAERYRLMSALDRWVISNTFIALEEHSIGQALIGINLSG
FT                   QSVCDELFLKFVIEQLQRSPVNPRMICFEITETAAVANFDSAIRFIRALKEIGCRFALD
FT                   DFGSGLSSFNYLKNLPVDYLKIDGSFVKDMVDDPVDYAMVEAIHKVGKVMGLKTIAEFV
FT                   ENEAILEKLRGIGVDYVQGLIIGGPRPFHKTPWADKE"
FT   gene            complement(534139..535032)
FT                   /locus_tag="Nhal_0522"
FT   CDS_pept        complement(534139..535032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0522"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: noc:Noc_2680 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13706"
FT                   /db_xref="GOA:D5BW56"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW56"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ADE13706.1"
FT                   /translation="MHSQRKYPLTFSCEFFPPKGNEGASKLRRTRKKLALLHPRYYSVT
FT                   FGAGGSTRDRTFETILEIQAEAKKSGIDAAPHLSCVGSTRGNIREILKAYQQHGVKRLV
FT                   TLRGDLPSGMVDPGDFHYANQLVEFIRAETDDYFYIEVAAYPEVHPQARSAQADLMNFK
FT                   RKVEAGANSAITQYFYNIDAYLRFVDRCESVGIDLPIVPGIMPINNYVQLARFSDACGA
FT                   EIPRWLRKRLEEFHDPAAMSAFALDVVSDLCHRLLEAGAPGLHFYTLNRAGPTLAIWDN
FT                   LGLEAKPADLPTAAKT"
FT   gene            complement(535172..536485)
FT                   /locus_tag="Nhal_0523"
FT   CDS_pept        complement(535172..536485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0523"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: noc:Noc_2679 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13707"
FT                   /db_xref="GOA:D5BW57"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW57"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ADE13707.1"
FT                   /translation="MSTQTAENLTSDYKVADISLADWGHKEIAIAETEMPGLMALREEY
FT                   QGQKPLAGARIAGCLHMTIQTAVLIDTLVALGAEVRWSSCNIFSTQDHAAAAIAAKGIP
FT                   VFAWKGETEEEYWWCVDQTIHGPNGWQPNMLLDDGGDLTAVMHERYPEILEGVRGLSEE
FT                   TTTGVHRLYEMMEQGTLKVPAFNVNDSVTKSKFDNLYGCRESLLDGIKRATDVMIAGKT
FT                   TVILGYGDVGKGCAQSLRGQGATVWVTEIDPICALQAAMEGFRVVTMEEAASKGDIFIT
FT                   ATGNYHVITHEHMQAMKNQAIVCNIGHFDSEIDVASLRQYTWENIKPQVDHIIFPDEKR
FT                   IILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELWNNPEKYGKQVYVLPKKLDEQV
FT                   AQLHLKKLGAQLTPLTEEQAKYIGVPVDGPYKPDYYRY"
FT   gene            complement(536566..537783)
FT                   /locus_tag="Nhal_0524"
FT   CDS_pept        complement(536566..537783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0524"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: noc:Noc_2678 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13708"
FT                   /db_xref="GOA:D5BW58"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW58"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADE13708.1"
FT                   /translation="MSMKETRQFTSESVSEGHPDKIADQISDAILDAILAEDRKARVAC
FT                   ETLVKTGMVLVAGEITTQAQVDYEKIIRELIIKIGYDSSEMGFDGATCAVLNAIGKQSP
FT                   DIAQGVDRELEEEQGAGDQGMMFGYASDETDVLMPAPITYSHRLVQRQAEVRRSGELPW
FT                   LRPDAKSQVTLLYEDDIPVGIDAIVLSTQHSPEIKQTTLREAVIETIIKPVLPAEWLAR
FT                   CKSENIHVNPTGSFAIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAA
FT                   YAGRYVAKNLVAAGLAERCEVQISYAIGVAEPTSVSVNTFGTGRVAESRLVQLIRAHFD
FT                   LRPAGLLRMLDLLQPIYRKTAAYGHFGREEPEFTWEQTDKAEALRDAAGLGPATAEVVN
FT                   VRSESH"
FT   gene            complement(538088..538267)
FT                   /locus_tag="Nhal_0525"
FT   CDS_pept        complement(538088..538267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0525"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   noc:Noc_2677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13709"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW59"
FT                   /inference="protein motif:PFAM:PF03966"
FT                   /protein_id="ADE13709.1"
FT                   /translation="MDKKLLEILACPVCKSSLVYQKANQELICKACRLAYPIRDDIPVM
FT                   LEEEARQLDPEEEV"
FT   gene            complement(538271..539287)
FT                   /locus_tag="Nhal_0526"
FT   CDS_pept        complement(538271..539287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0526"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: noc:Noc_2676 tetraacyldisaccharide 4'-kinase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13710"
FT                   /db_xref="GOA:D5BW60"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW60"
FT                   /inference="protein motif:TFAM:TIGR00682"
FT                   /protein_id="ADE13710.1"
FT                   /translation="MLDYRSLILNYWYSTHPTRWLLTPLSALFQMAVKGRQWAYSQGLR
FT                   AIQMLPVPVLVIGNLTLGGTGKTPLIIWLAQFLRRHGYRPGLISRGYGGQARNYPQRVY
FT                   PDSDPRLVGDEAILLARRTACPLVVGPDRAAAARTLLAHAGCDVLLSDDGLQHYALGRD
FT                   IEILVVDGARRFGNGHCLPAGPLREPLDRLQTVDLVVTNGFPQAGEFAMHLQLQAARRL
FT                   TDGTPCPLKNFRHSKVHGVAGIGNPERFFIQLQTQGLTVQPHPFPDHHRFQPDDLTFED
FT                   QQPVLMTEKDAVKCTYFARDNHWSVPLDVSLPTSFGDQVLDLLQQASRKKLNIETTG"
FT   gene            complement(539274..541067)
FT                   /locus_tag="Nhal_0527"
FT   CDS_pept        complement(539274..541067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0527"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="KEGG: noc:Noc_2675 lipid A export
FT                   ATP-binding/permease protein MsbA; TIGRFAM: lipid A ABC
FT                   exporter, fused ATPase and inner membrane subunits MsbA;
FT                   PFAM: ABC transporter transmembrane region; ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13711"
FT                   /db_xref="GOA:D5BW61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW61"
FT                   /inference="protein motif:TFAM:TIGR02203"
FT                   /protein_id="ADE13711.1"
FT                   /translation="MTLTPSLESGLTAYRRLLSYVRPYRWIFAVSVITMAVYAATETGL
FT                   AALMKPLMDGSFVERDPATIKLIPLLLIGLFVIRGIANFITNYGLKWVARRVVKDLRKD
FT                   MFCHLLTLPARYYDQNSSGQLLAKLIYDVEQVSNAATDAILTIVRDSLTILGLLAWMVY
FT                   LNGLLTLIILVTVPIIALIVWWISHRFRRISRKIQNSMGNVSQVAQEALEGHREVKIFG
FT                   GQTYEAERFEQVNEQNRQQAMKMVATDAISQPVVQFIAVLGLAGVIHLATRESMLAQIS
FT                   IGTFISFVTAMMMLLGPVKRLTKINGTLQRGIAAAQSIFSLLGEPPETNGGQHALGRAQ
FT                   GAVRFEQLSFCYDATKGPVLENISLEIMPCQTVALVGHSGSGKSTLVNLLARFYEIDSG
FT                   RIFLDGIDIQELPLTELRRQIALVNQQIVLFNDTIAHNIAYGSHRQVSKQDIIRAAEAA
FT                   HAMEFINRLPKGLETIIGENGVLLSGGQRQRLAIARALLKDAPILILDEATASLDTEAE
FT                   RHIQAALETLMRRRTTLVIAHRLSTVENADQIIVLHQGRILERGTHRQLLAQEGHYAEL
FT                   YRLQFHNGNEPTLPLAANVGL"
FT   gene            complement(541084..541506)
FT                   /locus_tag="Nhal_0528"
FT   CDS_pept        complement(541084..541506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0528"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   noc:Noc_2674 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13712"
FT                   /db_xref="GOA:D5BW62"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW62"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADE13712.1"
FT                   /translation="MNIHPTSHNEPEINLTPLIDVVFLLLIFFMVSTSFIHESEMKVDL
FT                   PEATTRPMEQQGPPIQVTIGKGGKIAINGKRLLNNQSATLTAAIKEAAGDRQHPHVIIS
FT                   ADAKTDYQSVVTVMDVAQQLGFERLSLATAQRRNDP"
FT   gene            complement(541554..542189)
FT                   /locus_tag="Nhal_0529"
FT   CDS_pept        complement(541554..542189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0529"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   noc:Noc_2673 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13713"
FT                   /db_xref="GOA:D5BW63"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW63"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADE13713.1"
FT                   /translation="MLEIIKAGGWLMLPILVCSIVAIGIIIERFWSLRRQRVAPKHLVG
FT                   QIWQWQCCNQLHELQIKRVRENSPLGRILAAGLVNRNHSREIMKESIEDVGRHVTLELE
FT                   RFLNTLGTIAAITPLLGLLGTVIGMIKVFTVINTQGVGNPAVLAGGISEALITTAAGLA
FT                   VAIPSLMFYRYFRGKVMALVVDMEEQAIQLVEVMHGDRELDPVENAAA"
FT   gene            complement(542306..544678)
FT                   /locus_tag="Nhal_0530"
FT   CDS_pept        complement(542306..544678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0530"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /note="TIGRFAM: DNA internalization-related competence
FT                   protein ComEC/Rec2; ComEC/Rec2-related protein; PFAM:
FT                   ComEC/Rec2-related protein; beta-lactamase domain protein;
FT                   KEGG: noc:Noc_2672 DNA internalization-related competence
FT                   protein ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13714"
FT                   /db_xref="GOA:D5BW64"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW64"
FT                   /inference="protein motif:TFAM:TIGR00361"
FT                   /protein_id="ADE13714.1"
FT                   /translation="MVLNIHDQDPQPIVLNALTFLAGIVILQQLPLLPNSKWSLLLWGF
FT                   IPLALSYQRLRPVLLIATGFLWALFRAHLLLSQELPPALEGQDVLLEGRVVSIPETQDH
FT                   SLRFAFAIERLIFKGQPRHAPKRVRLSWYQDPPSELRVGDRWQLMVRLKRPRGFMNPGG
FT                   FDYEGWLFRQGFRATGYVRSATANRFIESHWYHSPIDRVRQHLLERMTTVLADSPQQGL
FT                   VQALTLGERGGITPPQWQILERTGTNHLVAISGLHIGLLAGFAYFLGRRLWSLRAANTL
FT                   ALPAHQAAALGAIISALFYAALAGFSIPTQRALIMVSVVMLAVLVKRPVRASRTLALAL
FT                   ILVLIWDPLSALAPGFWLSFGAVAALMMGMTEFRPLPSPQSASFNPVSHRLGRLWQEWG
FT                   KAQWVVALGLAPLLLYQFQRLSLVAPLTNLVAVPWMGLLIVPPLLLGTLLLIPFPLVGT
FT                   ALINFADTLLALLWGLLSGCATLPMAQWEQYRPPLWVLPPAILGSLLLLAPRGLPGRWL
FT                   GLVALLVLFLTPPPRPAHGTLWFTLLDVGQGLAAVARTRHHTLVFDAGPRYSSRFNTGE
FT                   AVVAPFLSSQNTSDIDTLVVSHGDNDHLGGVAGLLRHIPAQQILTSVPEQLPWAHPKPC
FT                   VHGQHWRWDGVDFQILHPPATQGHGNNHSCVLRITSGEQRILIAADIERSAERTLLAMN
FT                   ADELAATILVVPHHGSLTSSSPEFVAAVNPEHALFAVGYRNRWGFPKPAIVQRYLAHGA
FT                   KSWSTARHGAITFHLGNEPLGKPETFRQSNRHYWTGN"
FT   gene            544748..545293
FT                   /locus_tag="Nhal_0531"
FT   CDS_pept        544748..545293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13715"
FT                   /db_xref="GOA:D5BW65"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW65"
FT                   /inference="similar to AA sequence:KEGG:Noc_2671"
FT                   /protein_id="ADE13715.1"
FT                   /translation="MPRRFLRRYLPPPHRLKEHKQLQYLGEWLSVPNLWHLNRRSVAGA
FT                   VSIGLFIAFLPLPGQMLVAAIAAVWTRVNLPVSVLMVWVTNPLTMGPIFFFAYKVGTWL
FT                   LGISVQEVTFELTWHWLQTRLVTIWEPFLLGCLVVGLVVGLTGGMLTLGLWRMEVGRRW
FT                   KERKRRKIIPKPGDKRCA"
FT   gene            complement(545307..546008)
FT                   /locus_tag="Nhal_0532"
FT   CDS_pept        complement(545307..546008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0532"
FT                   /product="lipoprotein releasing system, ATP-binding
FT                   protein"
FT                   /note="KEGG: noc:Noc_2670 lipoprotein releasing system,
FT                   ATP-binding protein; TIGRFAM: lipoprotein releasing system,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13716"
FT                   /db_xref="GOA:D5BW66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011924"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW66"
FT                   /inference="protein motif:TFAM:TIGR02211"
FT                   /protein_id="ADE13716.1"
FT                   /translation="MNDTEKAAVLCCRDLARSFTDGYLSVEVLREVSLSIAPGECVAIV
FT                   GASGSGKSTLLHLLGGLDRPTHGQVWVAGQNLAQLSDTACGQLRNHALGFVYQLHHLLP
FT                   EFTALENVALPLLIAGAKTTHAQEKATTLLQRVGLEARLHHKPGELSGGERQRAAVARA
FT                   LVTDPRCVLADEPTGNLDRKNAEQVFNLMLKLNSDFNTALVVVTHDPHLAVQMDRALTL
FT                   VDGRLMSGLLL"
FT   gene            complement(546001..547248)
FT                   /locus_tag="Nhal_0533"
FT   CDS_pept        complement(546001..547248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0533"
FT                   /product="lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family"
FT                   /note="TIGRFAM: lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family; PFAM: protein of unknown function
FT                   DUF214; KEGG: noc:Noc_2669 LolC/E family lipoprotein
FT                   releasing system, transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13717"
FT                   /db_xref="GOA:D5BW67"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW67"
FT                   /inference="protein motif:TFAM:TIGR02212"
FT                   /protein_id="ADE13717.1"
FT                   /translation="MFKPLPFYIGLRYTRAKRRSHFISFISLTSMLGVSLGVAALITVL
FT                   SVMNGFEKELRTRILGMVSHVIVTGPDGTLGNWQALKAQLEKDSRLVGIAPFVEGQGML
FT                   THRSQVRGTLVRGILPQQEDQVADIRSKMVVGSLDVLHPGSFQIVLGMDLARALGVFVG
FT                   DKITLVTPHATTTPAGVIPRLKRLTVAGVFQVGMYEYDSALAVMNLEDAALLFRIPGKI
FT                   SGLRLKLDNLFKAPYVARELRETLPGSYRTADWTYQHANFFRALKTEKTVMFVILFLIV
FT                   AVAAFNIVSTLVMVVTDKQADIAILRTLGATPASIMGIFMVQGTAIGFIGTLLGMIGGI
FT                   ALAFNVETVVPQIEALFGVQFLPADVYYISDLPSELSWHDVITVCSTAFLLCVLVTLYP
FT                   AWRAARTQPAEALRYE"
FT   sig_peptide     complement(547126..547248)
FT                   /locus_tag="Nhal_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.599 at
FT                   residue 41"
FT   gene            547396..547671
FT                   /locus_tag="Nhal_0534"
FT   CDS_pept        547396..547671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0534"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   noc:Noc_2668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13718"
FT                   /db_xref="GOA:D5BW68"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW68"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADE13718.1"
FT                   /translation="MVERRKSERLPVTVEVQVEWTPATAGPLVFKTRDLSDSGILLRVD
FT                   GQAIPPVGQVVTVRLKDPLADGETPPLLKAEVVRQDNRGLGLKFLN"
FT   gene            complement(547700..548362)
FT                   /locus_tag="Nhal_0535"
FT   CDS_pept        complement(547700..548362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0535"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: noc:Noc_2667 ribose-5-phosphate isomerase A;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13719"
FT                   /db_xref="GOA:D5BW69"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW69"
FT                   /inference="protein motif:TFAM:TIGR00021"
FT                   /protein_id="ADE13719.1"
FT                   /translation="MSPDEMKKLAAKAALEYVEPGAVIGIGTGSTVNHFIELLGTVKSK
FT                   IDGAVSSSEASTERLKALNIPVYDLNAVGEIPLYVDGADESNHYLQLIKGGGGALTREK
FT                   IIASASRKFVCIADQSKLVDILGDFPLPVEVIPMARSHIARQIVKLGGEPVYREGFVTD
FT                   NGNQILDIHGLSIMEPAKLEGQLNNIPGVVTNGLFAIDPADVLILGTPEGANTVYSK"
FT   gene            548463..549992
FT                   /locus_tag="Nhal_0536"
FT   CDS_pept        548463..549992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0536"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain protein; KEGG: noc:Noc_2666
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13720"
FT                   /db_xref="GOA:D5BW70"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW70"
FT                   /inference="protein motif:TFAM:TIGR01124"
FT                   /protein_id="ADE13720.1"
FT                   /translation="MLYSYLERILKARVYEVARETPLEPMRRLSLRLKNAVLLKREDLQ
FT                   PVFSFKLRGAHNKLTHLSEEARLRGVIAASAGNHAQGVALSARKLGVSARIVMPRTTPP
FT                   IKIEAVRDLGAEIDLVGDTYDEACQHALALAEGEGRAFIHPYDDPEVIAGQGTIAMEIL
FT                   RQHPDPLQALFVPVGGGGLIAGVAAYVKALSPEIRIIGVEPDDAPSLYQALQAKERVVL
FT                   DHVGIFADGAAVRQVGKEPFRIARETVDEVILVDSDAICAAIMDIFEDTRSIAEPAGAL
FT                   AVAGLKRYVEREGLQGQRLVAIDSGANINFDRLRHVAERAELGERREALFCVTIPEQRG
FT                   SFLEFCKAIGQRGITEFNYRYADSNEAHVFVGVQMCDSGHAKDRLLQELRAKHYAVVDM
FT                   TDNEMAKLHIRYMVGGRAPKLENEVLYRFEFPERPGALLRFLTCMGSRWNISLFHYRNH
FT                   GAAYGRILVGIQVPAAEKVEFQTFLDELAYDYQEESDNPAYRLFLGPSTTG"
FT   gene            550065..552524
FT                   /locus_tag="Nhal_0537"
FT   CDS_pept        550065..552524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0537"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: noc:Noc_2665
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13721"
FT                   /db_xref="GOA:D5BW71"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW71"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADE13721.1"
FT                   /translation="MEEHYQATQIEAEAQAYWEQHQSFRVIEDSTREKFYCLSMFPYPS
FT                   GRLHMGHVRNYTIGDVIARYQRMGGKNVLQPMGWDAFGLPAENAAMQNRVPPDQWTYQN
FT                   IDYMRGQLKRLGFAYDWSRELATCHPAYYHWEQWLFTKLFDKGLVYKKTALVNWDPVDQ
FT                   TVLANEQVVDGRGWRSGAVVERREIPQWFLKITAYAEELLTGLDQLSGWPEQVRTMQRN
FT                   WIGRSEGVEVQFQVEGRAPLLVFTTRPDTLMGVTFVSVAAEHSLAREAAKTNPALAAFI
FT                   EECQHTVTSEAVLETLEKKGMDTGLKAVHPLTGETIPIWVANFVLMSYGTGAVMAVPAH
FT                   DQRDYEFAQVYGLPIQQVIAPQDDQSACHLEQAAFVEKGVLINSGQFTGLDFEQAFAAI
FT                   AQHLEGQGKGQRVVNYRLRDWGVSRQRYWGAPIPVINCPSCGAVPVPEEELPVVLPEGV
FT                   RFDGVRSPLKQMPEFYQTTCPRCGENAERETDTFDTFFESSWYYARYCCPDNDAAMVDE
FT                   RGHYWLPVDQYIGGIEHAVLHLLYARFFHKVMRDMGLVRGDEPFTHLLTQGMVLKDGAK
FT                   MSKSKGNTVDPQALIEQYGADTARLFIMFAAPPEQSLEWSESGVEGAHRFLKRLWRMVA
FT                   THVAQRQGSVPPLEVKTLSAEQKLLRTKVHETIVKASDDIGRRYTFNTAIAAVMELMNA
FT                   LAKLDDDTPQGQAVRQETLETVVLLLSPITPHICHRLWRELGHEGAVIDASWPEADPAA
FT                   LVKETVDLVVQVNGKRRGQITVAAEASREVIEAQAQSEPNVQRFIEGKTVRKVILVPHR
FT                   LVNLVVR"
FT   gene            552544..553053
FT                   /locus_tag="Nhal_0538"
FT   CDS_pept        552544..553053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0538"
FT                   /product="Rare lipoprotein B"
FT                   /note="PFAM: Rare lipoprotein B; KEGG: noc:Noc_2664 rare
FT                   lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13722"
FT                   /db_xref="GOA:D5BW72"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW72"
FT                   /inference="protein motif:PFAM:PF04390"
FT                   /protein_id="ADE13722.1"
FT                   /translation="MVRQWLGRAALFSLLLLAGCGFHLRGDTQLSPLLERTYLQGVVPY
FT                   SDLGVGLKRSLEAYGVTVTSVPAEASAILSVTYNQLQRQVLSVGATGKVQEYALKYVLQ
FT                   FQVTNPKGEILLPSQQLELMREYQFDERSVLSAGEQEALLREVLQEEMVQQILWRLEAL
FT                   PPTLNG"
FT   sig_peptide     552544..552624
FT                   /locus_tag="Nhal_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.921 at
FT                   residue 27"
FT   gene            553050..554105
FT                   /locus_tag="Nhal_0539"
FT   CDS_pept        553050..554105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0539"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: noc:Noc_2663 DNA polymerase III, delta
FT                   subunit; TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13723"
FT                   /db_xref="GOA:D5BW73"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW73"
FT                   /inference="protein motif:TFAM:TIGR01128"
FT                   /protein_id="ADE13723.1"
FT                   /translation="MRVKLEQLAAHLERKIAPIYLLFGDEPLLIEEAADLIRAQARSQG
FT                   FNEREVMHVDRGFDWGQLQLATESLSLFASRRLLELRLSGGGVGEPGAKALQAYGKDPS
FT                   RDTLLLIISNKLERRHQGSSWFSLLEQAGVVVQVFKVDPSLLPRWIERRMQSKNLHPTP
FT                   EAVTALAERLEGNLLACAQEIDKLALLCPEGTIDIHGVEEVVADSARYDAFRLVESALA
FT                   GDVVRISRIWRGLRAEGVDPSVVLGALAWELRRLVRVATACAQGTPVDQALREERVWER
FT                   RKALSKQALSRHAAYRWRIFLQRLSDIDRMIKGAAKGRPWEAILQLCIAIAGVELFPPC
FT                   RGNLGYELDRA"
FT   gene            554176..555432
FT                   /locus_tag="Nhal_0540"
FT   CDS_pept        554176..555432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0540"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: noc:Noc_2662 gamma-glutamyl
FT                   phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13724"
FT                   /db_xref="GOA:D5BW74"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW74"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADE13724.1"
FT                   /translation="MDIKDYMQNLGRRARDVSRILTRASTADKNRALEKAASILEAEGQ
FT                   ALDEANRKDLAVGRNKGLDEALLDRLTLTEARIKAMAEGLRQIASLPDPVGAISDLNYR
FT                   PSGIQVGRMRVPLGVIGIIYESRPNVTADAAGLCLKSGNAVILRGGSEALHSNQAIARC
FT                   IHQGLEQAGLPREAVQVVETTDRSAVSELITQEAYVDVIVPRGGKGLIERISREAKLPV
FT                   IKHLDGICHVYIDERADLDKAVAIAVNAKCQRYGVCNAMETLLVARGIAAKVLPVLGEH
FT                   YRTAEVELRGCSETQGLLPQVKPATEEDWYTEYLAPILAIRVVAGLDEAIEHITHYGSH
FT                   HTETIVTEDFTQARRFLTEVDSSSVMVNASTRFADGFEYGLGAEIGISTDKLHARGPVG
FT                   LEGLTSQKWIVLGNGHIRE"
FT   gene            555439..556140
FT                   /locus_tag="Nhal_0541"
FT   CDS_pept        555439..556140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0541"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="KEGG: noc:Noc_2661 nicotinic acid mononucleotide
FT                   adenylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13725"
FT                   /db_xref="GOA:D5BW75"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW75"
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /protein_id="ADE13725.1"
FT                   /translation="MTLHSKTFATNSPHPTAPIGIFGGTFDPVHFGHLRPALELLEQLP
FT                   LAEIRFIPCRQPPHRQVPAASPGQRLAMLELAIAGEPRFFADDRELLRPGPSYMVDTLA
FT                   SLRAEQGSVPLCLILGTDAFRGLPKWHRWAELTELAHLLVMKRPGEPLPQEGELKHFLE
FT                   SRCICDPAQLAQQPRGLILPLEVTQLEISATRIRTLIGAGRSARYLLPDAVWDDIQQKR
FT                   LYSAPLFMPEK"
FT   gene            556140..556490
FT                   /locus_tag="Nhal_0542"
FT   CDS_pept        556140..556490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0542"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: noc:Noc_2660 iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13726"
FT                   /db_xref="GOA:D5BW76"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW76"
FT                   /inference="protein motif:TFAM:TIGR00090"
FT                   /protein_id="ADE13726.1"
FT                   /translation="MSAVELKELVVTALEALKGRDIQVLDVRELTDVVDYMVVASGASN
FT                   RQVKALANEVVERCKAAGYRPLGVEGELHGEWVLVDMGDVVAHIMLPQVRAFYNLEKLW
FT                   NVSPSPGVKEQQ"
FT   gene            556497..556970
FT                   /locus_tag="Nhal_0543"
FT   CDS_pept        556497..556970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0543"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   noc:Noc_2659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13727"
FT                   /db_xref="GOA:D5BW77"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW77"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ADE13727.1"
FT                   /translation="MNIHVITVGQRLPSWIGEGYRDYARRLPQQCSLHLVEVATARRGK
FT                   SGNPTQWQQDECRRLLAAIPANSQVIACDEHGESWTTEEVAKHLQTWMNEGRDVALLVG
FT                   GPDGLAPLCLERATRKWALSALTLPHGLVRVILAEQIYRAFSLLNHHPYHRAS"
FT   gene            557079..557687
FT                   /locus_tag="Nhal_0544"
FT   CDS_pept        557079..557687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0544"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: noc:Noc_2658 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13728"
FT                   /db_xref="GOA:D5BW78"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW78"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ADE13728.1"
FT                   /translation="MEILYCPFPPIALASASPRRQALLTQIGVEFKRLNVRVDESPQPG
FT                   EMPASYVRRLAVAKAQAGWKQQLPPDQLPVLGADTAVVIDDNILGKPTDQAHAEAMLAR
FT                   LSGRSHQVLTAVALIDGGIQCQLSVSTVTFKPLTKAERQAYLASGEGLDKAGAYAIQGQ
FT                   AALFISYLEGSYSGVMGLPLYETGELLRSLLPRKEIAGE"
FT   gene            557680..559152
FT                   /locus_tag="Nhal_0545"
FT   CDS_pept        557680..559152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0545"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: noc:Noc_2657 ribonuclease E and G; TIGRFAM:
FT                   ribonuclease, Rne/Rng family; PFAM: RNA binding S1 domain
FT                   protein; SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13729"
FT                   /db_xref="GOA:D5BW79"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW79"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ADE13729.1"
FT                   /translation="MSEEILINVTPSETRVAVVENGVVQELYIERSSRRGWVGSIYKGR
FT                   VSRILPGMQAAFVDIGLERAAFLHASDIRLPSGQMGDLESEVGVPSITSLLSEGQEVLV
FT                   QVIKDPIGTKGARLTTQISVASRYLVYMPEMSGIGVSLKIEDEEERQRLKNLLASILLE
FT                   DDQGGYIIRTVAEGAIADELQTDMEFLHRLWRTIKERSQTVKAGRVVHEDLSLVMRTMR
FT                   DLVHERVERVRVDSRETYHKLVDFAEHFVPELLATLEYYQGERPIFDLYGIEDEIQKSL
FT                   GRKVQLKSGGYLIIDQTEAMTTIDVNTGAFVGHRNLEETIFKTNLEAAQAICRQLRLRN
FT                   LGGIIIIDFIDMEEEDHKRQVLRALEKGLEKDHAKTHISEVSSLGLVEMTRKRTRESLE
FT                   QILCETCPTCGGRGTVKTVETVCYEILREILREARQFEASQYLVIAAQEVVDRLMDEES
FT                   ASVAELEAFIGKPIKFQAELLYMREQFDVVMM"
FT   gene            559176..563036
FT                   /locus_tag="Nhal_0546"
FT   CDS_pept        559176..563036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13730"
FT                   /db_xref="GOA:D5BW80"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW80"
FT                   /inference="similar to AA sequence:KEGG:Noc_2656"
FT                   /protein_id="ADE13730.1"
FT                   /translation="MAVIRFSLRWFYFSLGILAFCTVSIVGMLWVLWATVGEEPATASR
FT                   WLSTFLGREVQIGHIDLSWRGLEPKLRLTEVRVLDPKTEEQLLSFREAYLGTAPYRSLI
FT                   EGEWLPRHLTIMGGQLTVERKPEGCVRVHGLQSLEAPCPDPPRLPAWLLELTQLTLVDV
FT                   DIRWLDPALERKPLSLKVEELWLKNKGDLHQVEGKATLPEEFGREIAIKAKFTGRSIRG
FT                   FESKGTLHLKGESLQLAPWYPHDFLYGLYFTQGRGNLELGLRWSKAALRQAVVKFDWKS
FT                   LQIVGKAQGAEAPPPIAFQQLAGTAHYHSLAQGWSLKIPRLVVVRNDKAWPATALQVRM
FT                   EREPTFKLQGQFTFLRLQDIAALFQLSDQLDPQLRLLLLEVQPVGELRDVKVVLPLGEA
FT                   QGKNWKFSASTAQFGVRPWQHWPGCQGLSFDVQLIGGEGQLHINSRHVQLFSDDLEKPV
FT                   MVDSLGGRITWLQKKAGWRVLADHIQLRNSDLALTAALRLKEPPQANSPYLDLSVELEK
FT                   LDLAALSQYLPSRYMKPGLVRWLNQAFPKGGSAKGGLVFQGPVDRFPPPQDQGRFTTNL
FT                   DIQGPTLNYARGWPALEGVEAHLHSDGRHITIQATEGRMFNARVTEAAVRIADLGARTI
FT                   PLTVVGWAQGDAEDARRFIQHSPLQKKYGGFLEEIKLSGDTRLKLKLMMPLGKKKKRPE
FT                   VDGELIFADAHLRQRVHPFLTFTAINGSVSFTQAGLNSEGLAAQFLEQPIKADLRSLSN
FT                   QKGEAEVRLRLNGHLEALRLAEKWFPSWSPWFQGAADFTAHIIFRKAKTSGDKVTTVRV
FT                   SSALKGIEVTLPPPLAKPADQGQKLLWEIRGTHGDKKQITLTYGDGLQGVFEITGSGKS
FT                   LRLLKGKIRVGNGPPVLPERGIWLVGTLPQLSIDAWRKVLTKTARGDSSKLVQPDHMVL
FT                   QVEQMELFGWHFGGVTVKVNRELSHWQTQVSGPSLKGSITIPAQGSKGPLTADLDYLHL
FT                   HSRALEGEFQLAHPQSWPALDLICRQCQYNNYDLGVIKVYASPYANGLHLEELEMVSPV
FT                   MQLRASGDWTVHGETQWSHLDIKAHSPDLGQLLTKFNYQTNIAGGKTEVEIVAGWPGAP
FT                   TLFDLERLDGSMRLTVGKGRLLNVEPGAGRLFGLLSVSTLPRRLALDFSDIFSKGFAFD
FT                   RIQGTFAIRQGNAYSNQLVMEGPTAQVQASGRIGLATQDYDQIIAVTPNVFSSLPLAGA
FT                   VAGGPVGLGVGTAIMLADKLVDKMFGTQVGQLLTYYYTVSGPWAKPLVSRVNKLLPSQE
FT                   DD"
FT   sig_peptide     559176..559280
FT                   /locus_tag="Nhal_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.395 at
FT                   residue 35"
FT   gene            563162..563989
FT                   /locus_tag="Nhal_0547"
FT   CDS_pept        563162..563989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0547"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: noc:Noc_2655 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13731"
FT                   /db_xref="GOA:D5BW81"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW81"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADE13731.1"
FT                   /translation="MSFVAAIQMASGPNVGANLLEVERLIAQAAAEGANLVVLPENFAL
FT                   MGEKDDALLSIVEEEGEGPLQSFLAQQAARYKLWLVGGTVPLRASETGKVRAACLLFDA
FT                   SGRRVARYDKLHLFDVSLPGGGERYCESLTIEPGREVVVADTPFGKIGLAVCYDLRFPE
FT                   LFRCLVEQGMEILALPSAFTALTGRAHWEPLVRARAIENLCYVVAAGQGGFHASGRTTH
FT                   GDSMIVDPWGVVLARLPRGSGVITAELDPERLRSTRRNFPTIEHRRLSCKLSS"
FT   gene            564219..565658
FT                   /locus_tag="Nhal_0548"
FT   CDS_pept        564219..565658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0548"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   tgr:Tgr7_2267 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13732"
FT                   /db_xref="GOA:D5BW82"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW82"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADE13732.1"
FT                   /translation="MELKETAKALLLAPAGLSETDLERVLGQLMSRHVDSADLYFQLSR
FT                   QESWVLEDGVVKEGSHSRDQGVGVRAISGEKTGFAYSDEVLLPALTQAAAAARAIAHHG
FT                   AQGSLQAWRAQPERKLYASIDPLDTLSTEDKVSLLQQVDQEARRQDPRVKQVVISLLGT
FT                   QDVVLIAANDGTLAADIRPLVRLNVSVIVEQSGRREQGSAGGGARLGYDYFLEQERALG
FT                   YAREATRQALINLEAKEAPAGTMTVVLGAGWPGVLLHEAVGHGLEGDFNRKGSSTYAGR
FT                   IGEKVASKYCTVVDDGTLANRRGSLTVDDEGTPAHCTLLIENGVLRGYMQDKLNARLSS
FT                   AQPTGNGRRQSYAHLPMPRMTNTYLLPGQHDPGEIIASVEKGLYAVNFGGGQVDITSGK
FT                   FVFTTSEAYLIENGRVTCPVKGATLIGNGPEVMAQVAMVGNDLRLDPGVGTCGKEGQRV
FT                   PVGVGQPTLRIDGLTIGGTSI"
FT   gene            565679..566722
FT                   /locus_tag="Nhal_0549"
FT   CDS_pept        565679..566722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0549"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: noc:Noc_2654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13733"
FT                   /db_xref="GOA:D5BW83"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW83"
FT                   /inference="protein motif:PFAM:PF03054"
FT                   /protein_id="ADE13733.1"
FT                   /translation="MEKQRKAVALISGGLDSMLAAKVMQEQGIHVEGINFFTGFCVEGH
FT                   THAIRNKDKKRAKRNNALWAAEQLGIKLHMVEVIDEYKDVVLNPKYGYGAHLNPCLDCK
FT                   CFMVTKALAWMKENGFDFIVTGEVVGQRPKSQRADTMPVVARESGAHDLLLRPLCAKNL
FT                   PPTLPEREGWVDRDKLYDFSGRSRKPQMALVARFGIEDYAQPAGGCCFLTDANYSAKLA
FT                   DLWQARSARDYDLDDIMLLKVGRHLRPRPHFKLIVARDGGESNYLEGYAKEFIHLRTVS
FT                   HKGPLTLVDGALEEEDMILAGQLVARFSQGREAQQVQVKVVRPSGLTQTLEVAPLSNED
FT                   IPKEWYV"
FT   gene            566777..567013
FT                   /locus_tag="Nhal_0550"
FT   CDS_pept        566777..567013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0550"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: noc:Noc_2653
FT                   SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13734"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW84"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ADE13734.1"
FT                   /translation="MNVQTLDVRHLLCPLPVIRTQQKVKELIPGDVLEVISTDPGALND
FT                   IPAWCRVNGHRVLKATERDREVVVRLEVGKTAN"
FT   gene            567086..568495
FT                   /locus_tag="Nhal_0551"
FT   CDS_pept        567086..568495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0551"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: noc:Noc_2652 glutamine synthetase type I"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13735"
FT                   /db_xref="GOA:D5BW85"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW85"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADE13735.1"
FT                   /translation="MAVDDVLKTIKEEEIKFVDFRFTDSRGKEQHLSMPAYRLDEEAFR
FT                   EGKMFDGSSIAGWKAIQESDMILMPDPETAVLDPFMEEKTLVLRCDIVEPTTLQGYERD
FT                   PRSVAKRAEAYLKSTGIADTAYFGPEPEFFVLDDVRWGTDISGAFYKIDAEESHWNSER
FT                   VYDRGNIGHRPTIKGGYFPVPPVDSLQDLRSTMCLIMEQMGLPVEVHHHEVATAGQCEI
FT                   GTQFNTLVRRADELQILKYVVLNVAHSFGKTATFMPKPLVGDNGSGMHTHQSLAKEGQN
FT                   IFAGDKYGGLSETALYYIGGIIKHARALNAFTNASTNSYKRLVPGFEAPVLLAYSARNR
FT                   SASIRVPYVTSPKARRIEVRFPDSTANPYFAFTAMLMAGLDGIQNQIHPGDAMDKNLYD
FT                   LPPEEMKEIPTVCFSLEQALEALDRDRDFLKGGGVFTDDAIDAYIALKMDDVTRLRMTT
FT                   HPIEFDMYYSL"
FT   gene            568688..569308
FT                   /locus_tag="Nhal_0552"
FT   CDS_pept        568688..569308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13736"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW86"
FT                   /inference="similar to AA sequence:KEGG:Noc_2650"
FT                   /protein_id="ADE13736.1"
FT                   /translation="MRTLLLLFGLMPALVAAGIYKYVTPDGRVEYSDQPREGAAEVEVT
FT                   PLQTYTPPPLPKMKTIGQTKTQAQATTAYQVSIITPQDDATVRENTGRVEVALQVTPSL
FT                   EADSNYSLQLLFDGQPVGKTGSSLKYTLTNVDRGTHTLQAKLLGPSGTSVAHSKAITFH
FT                   MRRISILFRGDDNGQPGGVQRAPRAPQMPKMPGPPNPGGAPTP"
FT   sig_peptide     568688..568741
FT                   /locus_tag="Nhal_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.472 at
FT                   residue 18"
FT   gene            complement(569352..569546)
FT                   /locus_tag="Nhal_0553"
FT   CDS_pept        complement(569352..569546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13737"
FT                   /db_xref="GOA:D5BW87"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW87"
FT                   /inference="similar to AA sequence:KEGG:Noc_2649"
FT                   /protein_id="ADE13737.1"
FT                   /translation="MSVPKILITIAVIVALINLIGWLTKPDDYRPAQNYRGSLSPMQPY
FT                   AQQINDQEILALAANRSKS"
FT   gene            complement(569756..570571)
FT                   /locus_tag="Nhal_0554"
FT   CDS_pept        complement(569756..570571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0554"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: noc:Noc_2648 DNA-formamidopyrimidine
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13738"
FT                   /db_xref="GOA:D5BW88"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW88"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ADE13738.1"
FT                   /translation="MPELPEVETVRCGIEPHLVGCQVRTVIVREPRLRWPVPLSLSENL
FT                   TGQSFLTVQRRGKYLLLNCPRGTVLLHLGMSGSLRLVPSNLPPKKHDHLDIVLSNGRCL
FT                   RFNDPRRFGSVLWTQENPWRHPLLKTLGPEPLDPLFDGPYLFKRSRHRQAPVKVFIMNP
FT                   RVVVGIGNIYASEALFQAGIHPRRAAGRISLARYQRLAEAIKTVLYQAIQAGGTTLRDF
FT                   VASDGKPGYFSHQLQIYGRTAHPCPTCGNPIHLDHIGQRASYYCTQCQH"
FT   gene            complement(570601..571485)
FT                   /locus_tag="Nhal_0555"
FT   CDS_pept        complement(570601..571485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13739"
FT                   /db_xref="GOA:D5BW89"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW89"
FT                   /inference="similar to AA sequence:KEGG:Noc_2647"
FT                   /protein_id="ADE13739.1"
FT                   /translation="MNTRTLLNLALVAIAILLGWVVFYKPGIAPEPPSPPLTPLDPEHI
FT                   QAIRIAHKFREEIQLERKEGNWFITAPIQAPANKAMVETLLGIAQTPSLSRYPIEDVAL
FT                   ANLGLEPPEAHLSLDGVAIAFGTIEPLNQRRYALREDTIHLISDDAFQTVASSTARFVD
FT                   PALLPGNHPITQIRLPQVTDYGGNPKVSPKGTITLRRNQDGWIAEGSSGEVASEAIAKL
FT                   VEAWQQHTAQQVKLKGDRATLATIEIRREGVPPVYFDLQASLPRLILVRSDLGVQYHLS
FT                   PPAWNTLFQLPRK"
FT   gene            complement(571498..572886)
FT                   /locus_tag="Nhal_0556"
FT   CDS_pept        complement(571498..572886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13740"
FT                   /db_xref="GOA:D5BW90"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW90"
FT                   /inference="similar to AA sequence:KEGG:Noc_2646"
FT                   /protein_id="ADE13740.1"
FT                   /translation="MRVTRKTHWQIRLQNLFFTVLFLAIVGLIAALSIRYNYQADWTAS
FT                   GRNTLSEASQALLKQLEGPVTIISFAQGPSAKQQISQLIERYQRYKPDLELEYINPETA
FT                   PDQVRKLGVASDTEIVIKKDGRQEKLQDLSEEGLTNALNRVARSAGTLIVFLEGHGERG
FT                   PQGRANFDLGNFSHHLQTKGFQIQSLNLSTQPQLPEDTQVLVIASPQVDLLPGEVTLIQ
FT                   RYVNHGGHLLWLTEPGPLHGLDPLVEELGIKILAGTIIDPSAQLLMGRGNTAFALVPEY
FT                   GDHPVSERLTSATLFPQAAALEATKKSKWQPQPILSTLSRTWLETSRLDGDIEFNQGED
FT                   AVGPFTIGFALSREHPSSQQEEAREEQNKSGSTTQRIAIISDGDFLSNAYLGTGANLDL
FT                   GLSLINWLAHEDRFITIPARTRPDTSLQLSSMASWIIGLGFLLVLPVILLGTGLLIWWR
FT                   RRQR"
FT   sig_peptide     complement(572794..572886)
FT                   /locus_tag="Nhal_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.401 at
FT                   residue 31"
FT   gene            complement(572932..573693)
FT                   /locus_tag="Nhal_0557"
FT   CDS_pept        complement(572932..573693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0557"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="KEGG: noc:Noc_2645 ABC transporter, permease
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13741"
FT                   /db_xref="GOA:D5BW91"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW91"
FT                   /inference="similar to AA sequence:KEGG:Noc_2645"
FT                   /protein_id="ADE13741.1"
FT                   /translation="MMVFTLALHELRRLFLSPLAWATLAVSQILLGYMFLSQVAYFLQV
FT                   QSRLMGLPEMPGVTEVVAMPLFQNAAVVMLLIVPLMTMRLVADERRSHTLALLFSAPLS
FT                   MTEIVLGKYLGTLAFFAIMTLLLTLMPLSLLIGGTLDLGLLAAGLLGLGLLLASFTAIG
FT                   LFLSCLTQQATLAAVGSFGVLLLLWIIDWAGSSGLLAKGSEVLNYLSLLQHYQALLKGQ
FT                   FNSSDIIYYLLIIITFLTLSIRRLDADRLPH"
FT   gene            complement(573690..574637)
FT                   /locus_tag="Nhal_0558"
FT   CDS_pept        complement(573690..574637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0558"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: noc:Noc_2644 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13742"
FT                   /db_xref="GOA:D5BW92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW92"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE13742.1"
FT                   /translation="MKQDVLIRAEQLYRYYGENCAVKGVSFDVRRGEVLGFLGPNGAGK
FT                   STTMQMLTGNLAPSSGQVWINGLDLLDRPKQAKRGLGYLPEAPPLYRELTVKEYLAFCA
FT                   RLNYIPRNQQTKAIASAVERCGLKEVTKRLIGNLSKGYQQRVGIAQAIIHSPSVIILDE
FT                   PTVGLDPIQIREIRELIRELAQEHSVILSTHILPEVQTICDRVQIINQGELVLTDTIAG
FT                   LSQRMESTSVLVRFDNPPATEVLMSLRGVENVASQGDGRIRLRYRPEQDPVDELVRRAV
FT                   NENWRLRELTPERRTLEEIFVSITQTEDQQEAAA"
FT   gene            complement(574704..575153)
FT                   /locus_tag="Nhal_0559"
FT   CDS_pept        complement(574704..575153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0559"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: noc:Noc_2643 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13743"
FT                   /db_xref="GOA:D5BW93"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW93"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADE13743.1"
FT                   /translation="MPKPTTPLLAVDIIITLKDQPNQPIVLIKRRHPPLGWALPGGFVN
FT                   VGEMLEQAATREAREETGLSVRLETLLGCYSNPTRDPRGHTVSAVYTASASGMPKAADD
FT                   AAEAALFSLDKLPKNLAFDHRQILADYTRYRSIGELAPIHPAGSD"
FT   gene            575303..576472
FT                   /locus_tag="Nhal_0560"
FT   CDS_pept        575303..576472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0560"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: noc:Noc_2775
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13744"
FT                   /db_xref="GOA:D5BW94"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW94"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ADE13744.1"
FT                   /translation="MFLGLLDLSFWGYLAAILLLTHITIISVTVYLHRHQAHRALDLHP
FT                   ALSHFFRFWLWLTTGIITKEWAAVHRKHHAKCETEEDPHSPQMVGIHPVLWRGATLYRV
FT                   AARNPEVTEKYGHGTPDDWIERNLYTKHSYLGIGLMLLIDLGLFGVPGLLVWAIQMHWI
FT                   PFFAAGVINGLGHYWGYRNYEVADASTNLFPWGILIGGEELHNNHHAYGSSAKLSSKWY
FT                   EFDIGWMYIRLFQALKLARVKKVAPKLLIRPEKQWVDLDTARAVVAHRFHLMTSYGRKV
FT                   MLPVLKEEAAHFSGNELYRRARNWLVRHEALVDAKARQELKALLEESHRLETVYRFRQQ
FT                   LQEIWSQAWSSQEALLQALQDWCKRAEESGIKALQDFALSLRGYSLQQA"
FT   gene            complement(576559..576714)
FT                   /locus_tag="Nhal_0561"
FT   CDS_pept        complement(576559..576714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0561"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: noc:Noc_2641 ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13745"
FT                   /db_xref="GOA:D5BW95"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW95"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADE13745.1"
FT                   /translation="MRDKIKLVSSAGTGHFYTTTKNKRTTPEKLEKKKYDPVVRKHVIY
FT                   KEAKIK"
FT   gene            complement(576727..576963)
FT                   /locus_tag="Nhal_0562"
FT   CDS_pept        complement(576727..576963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0562"
FT                   /product="ribosomal protein L28"
FT                   /note="TIGRFAM: ribosomal protein L28; PFAM: ribosomal
FT                   protein L28; KEGG: noc:Noc_2640 ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13746"
FT                   /db_xref="GOA:D5BW96"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW96"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ADE13746.1"
FT                   /translation="MSRVCQVTGKRPVSGNNVSHAHNKTKRRFLPNLHTHRFWVESEKR
FT                   WVKLKVSSKGLRIIDKRGIDQVLADLRTRGERV"
FT   gene            complement(577077..577937)
FT                   /locus_tag="Nhal_0563"
FT   CDS_pept        complement(577077..577937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0563"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   noc:Noc_2639 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13747"
FT                   /db_xref="GOA:D5BW97"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW97"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADE13747.1"
FT                   /translation="MPTLALHSPLVSSTKRHPLRLLSYNIQAGVTTSRYHHYLTRSWKH
FT                   ILPDVHRHKTMASIAGVISDFDIVGLQEADVGSLRTGFVNQAELLAELCHFPHWHQQAT
FT                   RRFANIAQQSNALLSRIQPNYVRSYRLPGLVPGRGAILAHFGNPENPLIVLIIHLALGR
FT                   RSRTQQLSLISHLVHEHPYVVVMGDLNCQPHSPELSALLQKTGLKAPATKIATYPSWRP
FT                   KRHIDHILVSPSLEVTQVCALEHTVSDHLPLATEILVPAEIGLWGDNASGLPTKSNPEI
FT                   SQKVA"
FT   gene            complement(577973..578983)
FT                   /locus_tag="Nhal_0564"
FT   CDS_pept        complement(577973..578983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0564"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   noc:Noc_2638 UDP-glucuronate 5'-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13748"
FT                   /db_xref="GOA:D5BW98"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW98"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADE13748.1"
FT                   /translation="MKIMVTGSAGFIGAALTEKLLKRGDEIIGVDNLNDYYDVNLKLAR
FT                   LARFQDQPAFTEARMGLENREALNTVFAKHRPQRVVNLAAQAGVRYSLENPHAYVDSNL
FT                   QGFLNILENCRHYQVEHLVFASSSSVYGANTKMPYSVHDNVDHPLSLYAASKKANELMA
FT                   HTYSHLYQLPVTGLRFFTVYGPWGRPDMALFKFTRNILAGRPIDVYNYGHHQRDFTYID
FT                   DIVEGVIRTLDRLPTPNSNWNGAAPDPSTSTAPYRLYNIGNHQPVELSDFIKTLEECLG
FT                   CEAKKNLLPMQPGDVPATYADVDDLMRDVGFHPATPIEQGIARFVTWYKDYYKVR"
FT   gene            complement(579022..580299)
FT                   /locus_tag="Nhal_0565"
FT   CDS_pept        complement(579022..580299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0565"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: noc:Noc_2637
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13749"
FT                   /db_xref="GOA:D5BW99"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BW99"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADE13749.1"
FT                   /translation="MLTLGEVRIGIIGLGYVGLPLAVEFGKKFPTLGFDINSTRITELK
FT                   EGYDSTLEVEPELLAAANQLQYTRQLQDLADCNVYIITVPTPIDEHKRPDLRPLESASS
FT                   TVGKVLKPGNIAIFESTVYPGATEEVCVPILEQESGLIYNRDFFAGYSPERINPGDKQH
FT                   RVTSIRKVTSASTAEAAEFVDQLYGTIITAGTHRTSSIRVAEAAKVIENTQRDVNIALI
FT                   NELAMLFNRLGIDTQEVLQAAATKWNFLPFRPGLVGGHCIGIDPYYLTHKAQAIGFQPE
FT                   MILAGRRVNDGMGSYVASQVVKLMTQRRIHVVDSRILILGLTFKENCPDLRNTRVTDII
FT                   AELEGYHAQVDIYDPWADAKEALKEYGITLVTSLNKGYYDAIVVTVAHQQFAEFSAEGI
FT                   RALGKPGSILYDVKHLLPKETVDGRL"
FT   gene            complement(580393..581844)
FT                   /locus_tag="Nhal_0566"
FT   CDS_pept        complement(580393..581844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0566"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: noc:Noc_2636 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13750"
FT                   /db_xref="GOA:D5BWA0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA0"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADE13750.1"
FT                   /translation="MHHKSLAELARALKAREFSSEELTQHYLKRIEQLDENLNSFISVS
FT                   AEEALQQAKAADTLLHSGEGNAMTGIPLAHKDIFCTAGMKTSCGSKMLDNFIAPYDATV
FT                   VSRLKAAGAIMLGKTNMDEFAMGSSNETSFYGPVKNPWAHERVPGGSSGGSAAAVAAKL
FT                   SPAATGTDTGGSIRQPAALCGITGLKPTYGRVSRYGMIAFASSLDQGGPMAHSAQDVAL
FT                   LLNAMAGFDPSDSTSVVQEVPDYTLSLEESIEGIKIGLPKEYFGEGLDPNIAATIDAAI
FT                   KEFEGLGAQIREISLPNTELAVPTYYVVAPAECSSNLSRYDGVRFGYRCHNPKDLLDLY
FT                   CRSRGEGFGPEVKRRILIGTYVLSAGYYDAYYLKAQKLRRLISDDFKRAFTEVDVIMGP
FT                   TSPTPAFQLGEKTDDPVAMYLADIYTISTNLAGLPALSIPAGFTQGLPVGLQIIGNYFS
FT                   EAHLLNIAHRYQQITDWHCHTPTDY"
FT   gene            complement(581873..582160)
FT                   /locus_tag="Nhal_0567"
FT   CDS_pept        complement(581873..582160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0567"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: noc:Noc_2635 glutamyl-tRNA(Gln) amidotransferase C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13751"
FT                   /db_xref="GOA:D5BWA1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA1"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADE13751.1"
FT                   /translation="MALKTTDIEYIAHLARLAIDAEAVPHYVRDLSRILEFVEQMNKVD
FT                   TTGIEPMAHPLEAIQRLRPDEVTEIDQREIFQATAPQIEAGVYLVPKVID"
FT   gene            582274..583323
FT                   /locus_tag="Nhal_0568"
FT   CDS_pept        582274..583323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0568"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: tgr:Tgr7_0514 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13752"
FT                   /db_xref="GOA:D5BWA2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA2"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADE13752.1"
FT                   /translation="MFFDHLRGLFSNDLSIDLGTANTLIYVRGQGIVLNEPSVVAIRQE
FT                   RGPGGPRSIAAVGIEAKRMLGRTPANITAIRPLKDGVIADFTVTEKMLQHFIRKIHDSR
FT                   FFRPSPRVLVSVPCGSTQVERRAIRESAAGAGAREAYLIEEPMAAAMGAGLPVDEASGS
FT                   MVLDIGGGTTEVAVVSLNGIVYSSSARIGGDRFDEAIANYVRRNYGILIGETTAERIKH
FT                   EIGSAYPGAEVKEIEVRGRNMAEGVPRSFALNSNEILEALQEPISGIVSAVRTALEQTP
FT                   PELGADVAERGIVVTGGGALLRDIDRLLREETGLPVIIAEDPLTCVVRGGGRALELIDE
FT                   RGISLFATE"
FT   gene            583401..584327
FT                   /locus_tag="Nhal_0569"
FT   CDS_pept        583401..584327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0569"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: pfl:PFL_0897 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13753"
FT                   /db_xref="GOA:D5BWA3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA3"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ADE13753.1"
FT                   /translation="MRPSLTTRLVICAILSLALIVLDQRLHYLASLRSTLLAVTYPLQV
FT                   VVDAPASIGEWLSQMFASRTELQEENMTLRSRNLLLEARLQKMAALERENRRLRELLDA
FT                   SFRLPDRVLVTELLAVDLEALSHRVVLNKGDLQGVFKGQPLLDAKGIMGQVVQVGPLSS
FT                   VALLITDPSHALPVEVNRNGLRAIAVGTGTTGGLQLLHIAHNADVRKGDLLVSSGLGGR
FT                   FPPGYPVGTVTRVVHDASAAFAQVFANSAAELEKTREALLVVSATPRHQAGEKIVRELS
FT                   RATNTMEAADISPLPPTLNSPAPDVTQ"
FT   gene            584314..584808
FT                   /locus_tag="Nhal_0570"
FT   CDS_pept        584314..584808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0570"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: tgr:Tgr7_0512 rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13754"
FT                   /db_xref="GOA:D5BWA4"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA4"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ADE13754.1"
FT                   /translation="MSPNDRRHSGGGVIILSFVTAYVLTLIPLPAWAMFYRPEWGGLIL
FT                   IYWCLFLPQRVGVVGAWLVGLLMDALTGAVLGQHALAFALIAYITLCWQRRLSQQTIWQ
FT                   QAVNVLFLVALGQFLEAWVRGLDGQLMGGWRFWMPAVTSMLLWPWLSVVLRNIQQRFAV
FT                   R"
FT   gene            584821..586662
FT                   /locus_tag="Nhal_0571"
FT   CDS_pept        584821..586662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0571"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: mca:MCA0103 penicillin-binding protein 2;
FT                   TIGRFAM: penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13755"
FT                   /db_xref="GOA:D5BWA5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA5"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ADE13755.1"
FT                   /translation="MGAYFKIKDHFQESRLFQERIVVALVLTAFLVLGVLARLLYLQVY
FT                   AHEHFTMLSHDNRVDMRPLLPRRGLIYDRNGVLLAENVPSFSLEVVPERVGDLDGTLAA
FT                   LQELIPLGGEEVADFRRRMKKKGIFEKVPLSLHLGEEEVARFAVNRHRFPGVSVEARLI
FT                   RYYPQKELFAHVVGYVGRINEAELQRLDPVNYRGSRYLGKTGVEKAYEAILHGSVGFEQ
FT                   VEVNAQGRVIQVLRQMPPVPGHDLYLSLDSRLQAAAIDALGEYNGAVVALDPKTGDVLA
FT                   MVSRPGFDPNVFVTGLSTQSFAALRDSPDRPLYDRALRGLYPPGSTLKPFMALAGLEWG
FT                   LAGHDKATYCPGWYKLPGHSRRYRCWRRRGHGPVDLVKAVAESCDVYFYDLAVALGIDR
FT                   IYEYLGRFGFGRRAQVDIPGERAGLLPSRDWKRQVHQLPWFPGETVITGIGQGFIQATP
FT                   LQLATAVAVLAEQGLKRTPGVVYASRAPGAEKITLRPTRAPEVVSINKAKHWERVEAAM
FT                   VEVVHGERGTARQIGKDLSFQIAGKTGTAQVFSVKQNEHYTEAEVPMNLRDHALFIAYA
FT                   PVAEPAIAVAVVVENGGHGGSVAAPIGRRLIDVYLNS"
FT   gene            586671..587810
FT                   /locus_tag="Nhal_0572"
FT   CDS_pept        586671..587810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0572"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: tgr:Tgr7_2710 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13756"
FT                   /db_xref="GOA:D5BWA6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA6"
FT                   /inference="protein motif:TFAM:TIGR02210"
FT                   /protein_id="ADE13756.1"
FT                   /translation="MAQARIEPPGWLERRRRPNSGLLYCLHLDSPLLLGLVLLSSFGLV
FT                   VLFSAGGQDIDLIQRQLLRLGVALVALIGLAQVPPRQFERWAPWLYGLGLGLLIFVLVY
FT                   GHVGKGAQRWLDFGIFRFQPSEIMKIAVPMMIAHFFAQAALPPRWWQLLLALVLIILPA
FT                   GLIAKQPDLGTALLIAVAGLWVLFLAGVTWRLIMGFGGVVLALVPVLWYQMHDYQQQRV
FT                   LTFLNPENDPLGAGYHMIQSKIAIGSGGLYGKGWLNGSQAHLDFLPEQSTDFIFAVIGE
FT                   EFGLVGAALIVLLYWLLAARGLYIAFQAQDSFSRLLAGSLSLTFFIYVFVNVGMVTGLL
FT                   PVVGVPLPLISYGGTSMVTLFSAFGILMSIHTHRRLIPR"
FT   gene            587831..588826
FT                   /locus_tag="Nhal_0573"
FT   CDS_pept        587831..588826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0573"
FT                   /product="lytic murein transglycosylase B"
FT                   /note="TIGRFAM: lytic murein transglycosylase B; KEGG:
FT                   noc:Noc_2634 lytic murein transglycosylase B"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13757"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA7"
FT                   /inference="protein motif:TFAM:TIGR02282"
FT                   /protein_id="ADE13757.1"
FT                   /translation="MRKTITALIVIVYAFLPLRVVAADNDLPGIDDFIDEMTVQHGFDK
FT                   NELNQLFTEIEVKENILRVISRPAEKSKPWYEYRRIFLTPEHIQGGVSFWELNQHSLAR
FT                   AQEVFGVAPEVIVAILGVETRYGRHTGRYRVIDSLATLAFRYPPRSRFFRQQLVEFLLL
FT                   TREENRDPRHFTGSYAGAMGLAQFMPDSFRDYAVDFDQDGWRDIWENPEDAVGSIANFL
FT                   KRKGGWQAKAPVVSAAAANGVDYRHWLQQGLKPSIPLRQLRQEGIEVAEPIPEDELVSL
FT                   FQLEQEKGPELWVGFHNFYAIIRYNPSPLYAMAVYQLAEAIKAQREGGSS"
FT   sig_peptide     587831..587899
FT                   /locus_tag="Nhal_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            588823..589602
FT                   /locus_tag="Nhal_0574"
FT   CDS_pept        588823..589602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0574"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; Sporulation domain protein; KEGG: noc:Noc_2633 rare
FT                   lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13758"
FT                   /db_xref="GOA:D5BWA8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA8"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADE13758.1"
FT                   /translation="MRSVVPSFLLPLVVLFNVSCSNISETRESKPPANDMPGDVSDPLF
FT                   RFEPLSKYGNPPVYEVNGQRYHTLRSSRGYREKGIASWYGSKFHGRRTSSGETYDMYGM
FT                   TAAHRSLPLPSYVVVTNLSNQRQVVLRVNDRGPFHSDRIIDLSYAAAVKLGLAREGTGL
FT                   VEVRAIEPRSVSGRKGEVAEKEIYLQVGAFQNRRHAERLQKQLQSVLGTGVNVSPTTAQ
FT                   QVPFYRVRVGPLPNVEKLDNLAKQLAELGYPDHIIVH"
FT   gene            589690..590838
FT                   /locus_tag="Nhal_0575"
FT   CDS_pept        589690..590838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0575"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: noc:Noc_2632 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13759"
FT                   /db_xref="GOA:D5BWA9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWA9"
FT                   /inference="protein motif:PRIAM:3.5.2.6"
FT                   /protein_id="ADE13759.1"
FT                   /translation="MKSLGSLFSWYWLLLLFMGGTVWGQPLPIPAAPSLSAKAYILQDF
FT                   ATGQVLAEAQADQRVEPASITKLMTAYVVFAELKRGNIHLEDKVLISEKAWRTGGSRTF
FT                   IEVDSRVSVETLLQGMIIQSGNDASVALAEYVGGTEEIFATLMNQQAQALGMTGSHFVN
FT                   STGLPHENHYMTTRDIATLARALIRDFPEYYGWYSEQEFTYNNITQYNRNVLLRRDPSV
FT                   DGCKTGYTEAAGYCLVSSAMREGMRLIAVVMGTKGPKIRARESLALLNYGFRFYDTRSL
FT                   YAAREPVTSARVWQGANKELSLGVADDLAVTLQRGRWQELSSSIQLQDPITAPITEGQR
FT                   LGVVIVKLGEEALLKRPLVALTAIPEGSWWQRFVDWLLSFFT"
FT   sig_peptide     589690..589764
FT                   /locus_tag="Nhal_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            590846..591709
FT                   /locus_tag="Nhal_0576"
FT   CDS_pept        590846..591709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0576"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: noc:Noc_2631
FT                   D-alanine transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13760"
FT                   /db_xref="GOA:D5BWB0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB0"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADE13760.1"
FT                   /translation="MALVYLNGEFLPLAQAKVSVLDRGFLFGDGVYEVIPVYGGHFFRL
FT                   SLHLQRLEHSLQAIHLENPLSPSQWREVLQRLVARNEGLDQAVYLQVTRGPAARDHAFP
FT                   QPVEPTVFAMSNPLKPLPTEWRLKGVAAVTREDIRWKYCHIKSVALLANILLRQEAIEA
FT                   GAQEALLLRDEQLTEGAASNVFIVRGGVLATPPKGPFLLSGITRDLILELAGEGGIPCR
FT                   ERVITAWDLTQADELWLTSSTREIVPVTRLDGIEVGSGKPGPLWGQMDILYQEYKARVR
FT                   AGLYEN"
FT   gene            591738..592370
FT                   /locus_tag="Nhal_0577"
FT   CDS_pept        591738..592370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0577"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="2.3.1.181"
FT                   /note="KEGG: noc:Noc_2630 lipoate-protein ligase B;
FT                   TIGRFAM: lipoate-protein ligase B; PFAM: biotin/lipoate A/B
FT                   protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13761"
FT                   /db_xref="GOA:D5BWB1"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB1"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ADE13761.1"
FT                   /translation="MDTLRIRNLHLQEYGAVWQAMRDFTASRDSATVDELWWVEHPPVF
FT                   TLGLNGRECHVREVGDIPVVHCDRGGQVTYHGPGQVVVYALIDLRRRALGVRQLVDALE
FT                   LSVVDLLQSYGIEGSRRTEAPGVYVQGRKIASLGLRVRGGCSYHGLSLNVAMDLSPFDY
FT                   IDPCGYPGMKVIDLRSLGVIVPVATLRRTLSQHLARRLGYPAPLYEE"
FT   gene            592450..592674
FT                   /locus_tag="Nhal_0578"
FT   CDS_pept        592450..592674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13762"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13762.1"
FT                   /translation="MVVKRPHIRTAYPPGAPVAKLISKAIPRYLFTPVWQAGHRRGIRA
FT                   PSQQYTPLNLVVKTDRLKTVVSTFGRVRS"
FT   gene            592671..593651
FT                   /locus_tag="Nhal_0579"
FT   CDS_pept        592671..593651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0579"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="KEGG: noc:Noc_2629 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13763"
FT                   /db_xref="GOA:D5BWB3"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB3"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ADE13763.1"
FT                   /translation="MNSKTPPSSGELKRDRDIRALKGASKVARIPVKVEPTTERQRKPR
FT                   WIRAKAPIGSEVLRLKGLLREHELHTVCEEASCPNLGECFGHGTATFLIMGNICTRRCP
FT                   FCDVAHGRPDPLDAGEPMHLAQAVRAMGLRHVVVTSVDRDDLRDGGAAHFARCIQALRT
FT                   QSPQTCIEVLVPDFRGRMDRALEALAVAPPDIFNHNLETIPRLYKAVRPGADYQWSLRL
FT                   LERFKEGHSAVPTKSGLMLGLGEELAEVEQVMRDLRDHGCDMLTLGQYLQPSLHHLPVK
FT                   RFVTPAEFDALGEKARAMGFSHVASGPMVRSSYHADRQAAGEAIT"
FT   gene            593836..594996
FT                   /locus_tag="Nhal_0580"
FT   CDS_pept        593836..594996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0580"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: noc:Noc_2628 methylcitrate synthase; TIGRFAM:
FT                   2-methylcitrate synthase/citrate synthase II; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13764"
FT                   /db_xref="GOA:D5BWB4"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB4"
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /protein_id="ADE13764.1"
FT                   /translation="MSEYLPGLEGVPATRSNISEVDGEHGILTYRGYPIEDLAERSTFE
FT                   ETVLLLLDGELPTAQRLEEFTQELRQNYRVKYNIRTLMTALPSTGSPMEMLQAGVSALG
FT                   MFYPGNECLTGSASCTDRNYVDNMTVKIIARMPALVAMWEHIRNGYDPVPPRPDLPIAQ
FT                   NLLYMFHGEEPDPLMAKIMDTCLILHAEHTINASTFATLVAGSTLASPYAVISGAIGTL
FT                   SGPLHGGANERVVEMLREIGRPEKVKSWLDERLAHKQKIWGFGHRVYKTKDPRAKILQK
FT                   LMERLPAERGGQLSPLFETALALEEAATERLGHKGIYANVDFYSGILYRELGIPTDQFT
FT                   PLFAVSRSGGWLAHWREQLSDNRIFRPTQVYVGSPLRHYVPLNERG"
FT   gene            complement(595050..596060)
FT                   /locus_tag="Nhal_0581"
FT   CDS_pept        complement(595050..596060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0581"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: noc:Noc_2627 hypothetical protein; TIGRFAM:
FT                   lysine 2,3-aminomutase YodO family protein; PFAM: Radical
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13765"
FT                   /db_xref="GOA:D5BWB5"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB5"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ADE13765.1"
FT                   /translation="MITQSPPPLQRPAWQTELARAVRNPQELLALIGLNHHPQLAGEAT
FT                   RRQFPLRVPRGYIARMKKGDPNDPLFRQVFPLIAEDQISPGFSADPVGDLAAMPAPGVL
FT                   QKYAGRVLLVTTGACAIHCRYCFRRHFPYADHNPAPSQWQQALQYIAQNPSTQEVILSG
FT                   GDPLTLTDNRLTELVQALAAISHVKRLRIHTRLPVVLPERVDSHLLQWLEHTSLQKVVV
FT                   IHANHANELDDRVGEALEGLSRAGCRLFNQTVLLRGINDRVSALCDLSESLFDAGVIPY
FT                   YLHLLDRVQGAAHFEVDTPTAQCLHRTLRARLPGYLVPLLVQELAGAPSKLPLEG"
FT   gene            596120..596689
FT                   /locus_tag="Nhal_0582"
FT   CDS_pept        596120..596689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0582"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P ; Elongation factor P/YeiP protein;
FT                   Elongation factor KOW domain protein; KEGG: noc:Noc_2626
FT                   elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13766"
FT                   /db_xref="GOA:D5BWB6"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB6"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADE13766.1"
FT                   /translation="MAAYSTNEFKSGLKVMMDGDPCSIVENEFVKPGKGQAFNRVKLRN
FT                   LKTGRVIDRTFKSGETLEAADVLETQLQYLYSDGEFWHFMSPETFEQYSADGAAVGDAA
FT                   KWLKEQDICTVTLWNGVPLSVAPPNFVTLKVTETDPGLRGDTSSGGNKPATLETGAVVR
FT                   VPLFIDVGEVLKIDTRTGEYVERAKE"
FT   gene            596736..597731
FT                   /locus_tag="Nhal_0583"
FT   CDS_pept        596736..597731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0583"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase-related protein GenX;
FT                   PFAM: tRNA synthetase class II (D K and N); KEGG:
FT                   noc:Noc_2625 lysyl-tRNA synthetase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13767"
FT                   /db_xref="GOA:D5BWB7"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB7"
FT                   /inference="protein motif:TFAM:TIGR00462"
FT                   /protein_id="ADE13767.1"
FT                   /translation="MAEAETRWRPTANRRALEARARLLADIRRFFAERGVLEVETPILA
FT                   TAPATAPHLHSLTTHYQGPQNPEGQRLFLQTSPEHAMKRLLAAGSGPIYQLARVFRNGE
FT                   SGRRHNPEFTLLEWYRPGFDHWALMEEVDIFLSLLLGTPKGERLSYGEAFQHYLEVDVF
FT                   AASHKVLEGLARAHGFQGGTEKGEEARQIALDFLMAAVIEPQLGQGRPCFVYDYPASEA
FT                   QLARVRPPSKACSVSLAERFEVYLNGMELANGYHELSDAAEQRQRFQADLAHRKARGLE
FT                   EVPLDELLLAALAQGLPDCAGVALGVDRLLMLLLGSLHIEEVLAFPVDRI"
FT   gene            complement(597838..599166)
FT                   /locus_tag="Nhal_0584"
FT   CDS_pept        complement(597838..599166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0584"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: noc:Noc_0709 TRAP
FT                   dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13768"
FT                   /db_xref="GOA:D5BWB8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB8"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADE13768.1"
FT                   /translation="MEVWALVMFAVLFALLLLGYPVAFTLGGVALAFGTIFLDMDFFRL
FT                   LPLRIWGIITNFTLLAVPLFVFMGVILEKSGLAEELLETMGLLFGRLRGGLGISIVVVG
FT                   ALLAATTGVVGATVVTMGIIALPSMLKHGYAKELATGTIASAGTLGQIIPPSIVLILLG
FT                   DVMGVPVGQLFMAAVVPGILLILLYIAYIVVTAWRRPEVAPALNRTATLGHPSLGLQIL
FT                   KSLIPPLALVIAVLGSIFFGIASPTESAAVGALGAMLLALSHRRLTLDNLREASAQTMR
FT                   LTSMVFIILIGATAFGLVFRGMGGDALVLELMSGLPGGAWTFLAISMLLIFLLGFFLDF
FT                   LEICFIVVPILTPVAIHLGLNPLWFAVLIALNLQTSFLTPPFGFSLFYLKAVTPPEVQI
FT                   SHIYRGILPFVAIQLIALVLLLVFPELGLWLPTTMDRWQGLGG"
FT   sig_peptide     complement(599068..599166)
FT                   /locus_tag="Nhal_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.703 at
FT                   residue 33"
FT   gene            complement(599166..599705)
FT                   /locus_tag="Nhal_0585"
FT   CDS_pept        complement(599166..599705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0585"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: noc:Noc_0710 tripartite
FT                   ATP-independent periplasmic transporter DctQ"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13769"
FT                   /db_xref="GOA:D5BWB9"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWB9"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ADE13769.1"
FT                   /translation="MGFPEQKLQQFATSIDKLSSWTGRLVAWLVLLLVLLVCYDVSMRY
FT                   LFQSGSVALQELEWHLFALIFLLGAAPTLKNDGHVRVDVLYHSHWFSPRTRIWINLLGT
FT                   LAFLLPFCLVVITASWPFVRNAFLQNEGSPDPGGLPYRYLLKAVIPLAFSLLALQGIAD
FT                   LIRNLLKLRQDSEATE"
FT   gene            complement(599712..600176)
FT                   /locus_tag="Nhal_0586"
FT   CDS_pept        complement(599712..600176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0586"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: noc:Noc_0711
FT                   D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13770"
FT                   /db_xref="GOA:D5BWC0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC0"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ADE13770.1"
FT                   /translation="MIALLQRVTNAQVTVDGETIAHIGPGLMVLVGVERGDGAPQAERL
FT                   LERLLSYRVFADSKGHMNRSLTDMGGDLLLVPQFTLAADTRKGTRPSFTPTAPPALGQQ
FT                   IFEHLLTRAKTRYPRLAAGRFGAHMQVSLTNDGPVTFTLRVPPEVKTTTT"
FT   gene            complement(600186..601130)
FT                   /locus_tag="Nhal_0587"
FT   CDS_pept        complement(600186..601130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0587"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="KEGG: noc:Noc_0712 peptidase S33, proline
FT                   iminopeptidase 1; TIGRFAM: proline iminopeptidase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13771"
FT                   /db_xref="GOA:D5BWC1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC1"
FT                   /inference="protein motif:TFAM:TIGR01249"
FT                   /protein_id="ADE13771.1"
FT                   /translation="MLSLYPDIKPYVRHTLAVEAPHQLYVEECGHPGGLPVLVLHGGPG
FT                   NGCQPHQRCFFDPDLYRVILFDQRGCGRSQPHGELEKNTTTGLLADIEHIRKHLGIERW
FT                   LIFGGSWGATLGLLYAEAYPNQVLGLLLRGIFLGREQDTRWFLQEGTPQIFPDVWDSLV
FT                   EDIPPGEQNNLIEAFHRLLNSPDELAQMAAAKALNTWESSCSRLVSGKMPSPQAHPALL
FT                   AQARLRIHYARNHYFIKPNQILNNAHQLANIPGIIIHGRYDVLCPVGNAWELHQAWPLS
FT                   ELQIVPVAGHAATEPAIVDALVRATNLMARRVG"
FT   gene            601192..602361
FT                   /locus_tag="Nhal_0588"
FT   CDS_pept        601192..602361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0588"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: noc:Noc_0713 succinyl-CoA synthetase, beta
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13772"
FT                   /db_xref="GOA:D5BWC2"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC2"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ADE13772.1"
FT                   /translation="MILHEFQAKRLFADYGIPVPPGGPAETAEEAGAQARELGGERWVV
FT                   KAQVHAGGRGKAGGVRVVSSLEELSEVGAQLLGTRLVTAQTDATGLPVKTLLIEQPAAV
FT                   AREFYLATTVDRQLKRVVIMVSSRGGVDIEQVAAEHPGEILQLVINPIMGLQPYQCREV
FT                   GFALGLTGEQRRQLSQIMEKMYQLFREQDGNLVEMNPLVVTEQGNLLALDAKVILDDNA
FT                   FFRHPAWEALRDPTQEDPKEVEARAHGLSYIALEGEIACMVNGAGLAMATMDLIKLQGG
FT                   EPANFLDVGGTATADRVAEAFKLILADGKVKSILVNIFGGIVRCDLIAEGIIQAVQEVA
FT                   IQLPVVVRLEGTNAKQGRTLLQDSGMNLITADDLTDAARKAVAAAGEEK"
FT   gene            602358..603239
FT                   /locus_tag="Nhal_0589"
FT   CDS_pept        602358..603239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0589"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; CoA-binding
FT                   domain protein; KEGG: noc:Noc_0714 succinyl-CoA ligase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13773"
FT                   /db_xref="GOA:D5BWC3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC3"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ADE13773.1"
FT                   /translation="MSILVDEQTRVICQGFTGKQGTFHSQQAIEYGTQLVGGVTPGKGG
FT                   QTHLERPVFDTVAEAVEATGADATMIYVPAALAADAILEAAAGGIRLIVCITEGIPVLD
FT                   MLKVKAVLADTPSRLVGPNCPGVITPGACKIGIMPGNIHQPGRIGIVSRSGTLTYEAVY
FT                   QTSQKGLGQSTCVGIGGDPIQGMSFVDCLALFEQDSQTEGVILVGEIGGSAEEEAAEYI
FT                   QHHVSKPVVAYIAGITAPKGKRMGHAGAIVSGGKGTAKGKVEALSAAGVVIAHSPAEMG
FT                   ECMEQALSGDGR"
FT   gene            603369..603707
FT                   /locus_tag="Nhal_0590"
FT   CDS_pept        603369..603707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0590"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   noc:Noc_0715 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13774"
FT                   /db_xref="GOA:D5BWC4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC4"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADE13774.1"
FT                   /translation="MKKIEAIIKPFKLDDVREALSEIGVSGMTAIEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIMLEIVVGDDQVDACIEAITKAAQSGRIGDGKIFVTNVERAVRIRT
FT                   GEEGGDAI"
FT   gene            complement(603809..604591)
FT                   /locus_tag="Nhal_0591"
FT   CDS_pept        complement(603809..604591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0591"
FT                   /product="outer membrane assembly lipoprotein YfiO"
FT                   /note="TIGRFAM: outer membrane assembly lipoprotein YfiO;
FT                   KEGG: noc:Noc_0716 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13775"
FT                   /db_xref="GOA:D5BWC5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC5"
FT                   /inference="protein motif:TFAM:TIGR03302"
FT                   /protein_id="ADE13775.1"
FT                   /translation="MRIFYFLSLFLVLWLGGCSWLGKPQEQPEADWNVERYYSEAKAAL
FT                   NSGNYQQAITLYEQLEARYPFGVYAQQALLESAYAYYKFDEPESALAALDRFIRLYPLN
FT                   PHMDYAHYLKGLVNFHRGIGLIEKYIPRDESQRDPESARDALKDFRTLVKRFPDSRYAK
FT                   DGAQRIVYLRNRLAQHEINVAQYYMRRGAYIGAINRAKYVVENYQRTPTVPEALTIMAR
FT                   GYKVLGLDELAEDTLRVLETNFPGHPGIAQARQIKIIE"
FT   gene            604686..605654
FT                   /locus_tag="Nhal_0592"
FT   CDS_pept        604686..605654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0592"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   noc:Noc_0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13776"
FT                   /db_xref="GOA:D5BWC6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC6"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADE13776.1"
FT                   /translation="MFKSKITPLIIIVNFYVTIIAISLLLTTAVSAATLVLPSSGESVV
FT                   GRNLIVPAKASETLLDIARRYDVGYSEIKAANPNIDPWLPKEGSPVVVPTQYVLPQAPR
FT                   RGIVINLAEMRLYYFPESQPGQPGVVVTHPIGIGREGWSTPLGKTSVISKKKNPTWIPP
FT                   ESIRAEHEANGDPLPKVVPPGSDNPLGKFALRLGMPGYLIHGTNRPWGVGMRVSHGCIR
FT                   LYPEDIASLFAQVKVGASVNIVYQPFKAGIKDAVLYLEAHVPLPELESPEQGGLTKMVA
FT                   TIVAATEKPIPEMYWEAAKRVADERTGVATQVGKIEAGDTL"
FT   sig_peptide     604686..604784
FT                   /locus_tag="Nhal_0592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 33"
FT   gene            complement(605728..606039)
FT                   /locus_tag="Nhal_0593"
FT   CDS_pept        complement(605728..606039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0593"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: noc:Noc_0718 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13777"
FT                   /db_xref="InterPro:IPR021793"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC7"
FT                   /inference="similar to AA sequence:KEGG:Noc_0718"
FT                   /protein_id="ADE13777.1"
FT                   /translation="MKKGFGNVLKLSIAMTLVVLLGACASTSRVDQVEALVQEAQSAAD
FT                   EAQTAARNAQSAANSAAQRAEDAAARADAAHQTADEAFQAVTECCAKVDRMFEKAMSK"
FT   sig_peptide     complement(605947..606039)
FT                   /locus_tag="Nhal_0593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.545 at
FT                   residue 31"
FT   gene            606619..607416
FT                   /locus_tag="Nhal_0594"
FT   CDS_pept        606619..607416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0594"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: noc:Noc_0719
FT                   inositol-1(or 4)-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13778"
FT                   /db_xref="GOA:D5BWC8"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC8"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ADE13778.1"
FT                   /translation="MHPLLNIAVRAARSAGNLIVRSLDRVDHLEVTVKDRNDFVSDVDR
FT                   LAEREIIGIIRKAYPSHGILAEEGGGQAGDDTIWVIDPLDGTTNFLHGFPQFAISIAVK
FT                   HRGRLQHAVIYDPLRQELFTASRGSGAQLNERRIRVSPQKGLEGALLGTGFPFKKHQYL
FT                   DCYLATFKALFRDTAGIRRPGAAALDLAYVAAGRLDGFWELSLAEWDMAAGALLIQEAG
FT                   GIITDFSGGHDFLTTGNVVAGNLSVHKAILQTIQPLLVEELAR"
FT   gene            607738..609567
FT                   /locus_tag="Nhal_0595"
FT   CDS_pept        607738..609567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0595"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; KEGG: noc:Noc_0720 GTP-binding protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13779"
FT                   /db_xref="GOA:D5BWC9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWC9"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ADE13779.1"
FT                   /translation="MVDKLRNIAIIAHVDHGKTTLVDQLLKQSGTFGEWETVAERVLDS
FT                   NDLERERGITILAKNTAIEWNGYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTQKAFALGLRPIVVINKIDRPGSRPNWVLDQTFDLFDRLGATDEQLDFPVV
FT                   YASALQGYGGLTPEVDAGDMTPLFQTIVQQVPPPPVDLEGPFQMQISSLDYSPYVGVIG
FT                   IGRIQRGVVKTNTPVEILDREGHRRKGRVLQVMGFRGLERVEIPEARAGDIIAISGIEN
FT                   LRISDTLCDPAQVEGLPPLTVDEPTVSMTFQVNNSPFAGRDGKYVTSRQLRERLLRELI
FT                   HNVALRVEESDDPDKFKVSGRGELHLSILIENMRREGYELGVSRPEVIVKEIKGELCEP
FT                   YEQLMVDVEEQHQGAVMEKLGERKGELADMVPDGKGRVRLEYSIPSRGLIGFQTEFLTA
FT                   TSGTGLIYHVFDHYGAIKKGAVVHRKNGVLVANGVGKALGYALFNLQERGRLFIGPGTE
FT                   VYEGMILGIHSRENDLVVNPMKAKQLTNIRAAGSDENILLTPPLQLSLEQALEFIDEDE
FT                   LVEVTPKHIRLRKKLLLEHERKRAARSKVAAGE"
FT   gene            609572..609799
FT                   /locus_tag="Nhal_0596"
FT   CDS_pept        609572..609799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13780"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWD0"
FT                   /inference="similar to AA sequence:KEGG:Noc_0721"
FT                   /protein_id="ADE13780.1"
FT                   /translation="MRLLFFILFVLLAYLFLRKLLKDYQSGRKIQETDTRHMVRCAYCG
FT                   VFLPEGEALTEDSDNFCCREHRELAKRDKN"
FT   gene            609744..611411
FT                   /locus_tag="Nhal_0597"
FT   CDS_pept        609744..611411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0597"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: noc:Noc_0722 signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13781"
FT                   /db_xref="GOA:D5BWD1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWD1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADE13781.1"
FT                   /translation="MTIFVAVSTVNWRRGIKTKITTAVKGQSLVPAWRPLAVFCVYRLL
FT                   IVFLLLGVVITGVGPRFLGQSQPDLFLITCLVYGAAAIALSVATVARIGGFYFQVLLQL
FT                   SLDIGAITLLMHASGGVPSGLGMLLVVVIAAGGILTVGRTANALAALATLAVLFEQSYS
FT                   LVSRDFEAVHYTQAGLLGATLFATALLAQVLAARIRESEALAAQQSLDLANISQLNGYI
FT                   IQRLQSGVLVVDRNDTIRLINQAGEELLGLKPGREGDPLAMAVPPLAEQLACWRKEHHS
FT                   YQPKAFRSALEQSEILPKFISLGAPYGTLIFLEDTSVLARQAQQLKLASLGRLTASIAH
FT                   EIRNPLGAISHASQLLRESSTLNPSERRLLEIILNHCGRVNDIIKNVLQLSRRKHSRLE
FT                   ALLLKPWLLHFLEEFCRTHGIDRAAVVLQVDPGKVRVHVDPSQLHQILWNLCDNARRHS
FT                   QDSDGSPCLQISVGIKANTGQVFLDVMDRGPGIAKEAVDKIFEPFFTTQGAGTGLGLYL
FT                   ARELSECNDASLEYYPVPGGGSCFRLCFAPLGVGANAA"
FT   gene            611408..612742
FT                   /locus_tag="Nhal_0598"
FT   CDS_pept        611408..612742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0598"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; SMART: response regulator receiver; AAA ATPase;
FT                   KEGG: noc:Noc_0723 two component, sigma-54 specific, fis
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13782"
FT                   /db_xref="GOA:D5BWD2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWD2"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADE13782.1"
FT                   /translation="MKEHPLALIVDDEPDILELLELTLAPMGVACHKAVDLAEARQYLQ
FT                   QHSFDLCLTDMRLPDGDGIELVRLISQHFPETPVAVITAHGSVETAVEALKSGAFDFIS
FT                   KPVDLQALRNLTNAALRLPLRYPQRERRTRYRLLGESAAMRAVRSKIAKLARSQAPVYI
FT                   SGESGTGKELVARLIHEQGPRLEAPFVPVNCGAIPNELMESEFFGHKKGSFTGATHDKR
FT                   GLFQTAGGGTLFLDEVADLPLPMQVKLLRAIQEKSVRPIGSEKEISVDVRILCATHKDL
FT                   AALVKEGSFRQDLFYRLNVIELPVPPLRQRASDIPQLAEHILSKLAGINQITCPKLTSD
FT                   ALEALQVYPFPGNVRELENTLERAMTLCDSEIIEAKDLHLPKAEPPSTPTSLPVGSLEE
FT                   CLEGVERRAILQALERTHYNKTAAAKLLGITFRALRYRLKKLELE"
FT   gene            612887..613300
FT                   /locus_tag="Nhal_0599"
FT   CDS_pept        612887..613300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0599"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rms:RMA_0745 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13783"
FT                   /db_xref="GOA:D5BWD3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWD3"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADE13783.1"
FT                   /translation="MMDTKKKANQYTAEFKARAVKLAVESDQPFSKTAGELGVNKNTLH
FT                   PWIGKYHRAQAVEHPVGEEHLYDELKRLKKENARLKEEREILKRSRAEIVRDAIERYLE
FT                   DSDDLHIALERLQDPNDPVLEWEDVKRGLLAQD"
FT   gene            613365..613523
FT                   /locus_tag="Nhal_0600"
FT   CDS_pept        613365..613523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0600"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0628 addiction module toxin,
FT                   RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13784"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWQ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13784.1"
FT                   /translation="MLNSAYGLQIGMSGLRRIRVGEYRLIYEVDGGKLTVLVVRVRHRR
FT                   DAYRRSR"
FT   gene            613570..614133
FT                   /locus_tag="Nhal_0601"
FT   CDS_pept        613570..614133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0601"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   noc:Noc_0762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13785"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWQ4"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADE13785.1"
FT                   /translation="MTVTLPRHRLTVADYHKMGEMGILSEDDRVEMIEGEIIDMAPIGS
FT                   AHAACVRYLLHSFAPHLGEAAMLDIQNPLRLSDYSEPQPDMMLLKPRSDFYRRVHPQAQ
FT                   DVLLLVEVAETSVAYDREVKIPLYACHQIPETWLFDLKAQRLEIFLDPSSEGYKKILRP
FT                   GRGERVAPGLLPEAIINWAEALSN"
FT   gene            614319..614648
FT                   /locus_tag="Nhal_0602"
FT   CDS_pept        614319..614648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13786"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWQ5"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_4515"
FT                   /protein_id="ADE13786.1"
FT                   /translation="MSNKNKIAQLQLSDKRAREIIREAVLDTSRIQWSKHARKRMRERR
FT                   ITTRQVLDVLSKGKIIEGPVRGTTGDWECTLERFVAGDNVVVVVAIETDSAGQPVIIVT
FT                   TYHHR"
FT   gene            614721..615164
FT                   /locus_tag="Nhal_0603"
FT   CDS_pept        614721..615164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13787"
FT                   /db_xref="GOA:D5BWQ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWQ6"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_4514"
FT                   /protein_id="ADE13787.1"
FT                   /translation="MYHYTECGLRNIYLKNGYYLRKTPYGETVSIENMEDLHGAIACDL
FT                   IYHKPKLTGAEFRFLRNELLMSQKRLAELLSTSEQTLSLWERKGRVPMWADRMIRLVYL
FT                   DYSNKSPAIVNLVDQLNHLDRNEYQKARTFSDTESGWKPDLAA"
FT   gene            615201..615467
FT                   /locus_tag="Nhal_0604"
FT   CDS_pept        615201..615467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0604"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: noc:Noc_2545 AbrB
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13788"
FT                   /db_xref="GOA:D5BWQ7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWQ7"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADE13788.1"
FT                   /translation="MFFRLSSKGQIIIPKSIRAVRHWEAGMEFIVEERDDSIILRPLKP
FT                   FPATCLEEGLGCTGYQGKAKSLEEMDKGIAESLRWRWSKKEKR"
FT   gene            615536..615703
FT                   /locus_tag="Nhal_0605"
FT   CDS_pept        615536..615703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0605"
FT                   /product="PilT protein-like protein"
FT                   /note="KEGG: noc:Noc_2544 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13789"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWQ8"
FT                   /inference="similar to AA sequence:KEGG:Noc_2544"
FT                   /protein_id="ADE13789.1"
FT                   /translation="MELLGSNEILVTKTVLLELRWILQAVYELPLKAVLKAMLHILGLP
FT                   NVRIERNENN"
FT   gene            complement(615715..616098)
FT                   /locus_tag="Nhal_0606"
FT   CDS_pept        complement(615715..616098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0606"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: noc:Noc_2542 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13790"
FT                   /db_xref="GOA:D5BWQ9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWQ9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADE13790.1"
FT                   /translation="MTAQVIKRNGKPEWAVLPYEEYQALLEKAEMLDDIAAYDKAIAAD
FT                   EENIPQEVVESLVAGENPLKVWRTYRGLTQAQLAEQVGLSQSHLVTMEKGERKGTIKVL
FT                   KRIAQTLRVDIDDLYPLSEGGGE"
FT   gene            complement(616095..616352)
FT                   /locus_tag="Nhal_0607"
FT   CDS_pept        complement(616095..616352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0607"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: bgl:bglu_1g12000
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13791"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR0"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADE13791.1"
FT                   /translation="MYTILYKKSAQKSLQRMPRKMALKVIESFKKLAVDPTRKDLDINP
FT                   LTGREGFRLRIGGWRAIYQIEQKRLVTHVLTIGARGDVYK"
FT   gene            616719..617210
FT                   /locus_tag="Nhal_0608"
FT   CDS_pept        616719..617210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0608"
FT                   /product="Fimbrial protein pilin"
FT                   /note="PFAM: Fimbrial protein pilin; KEGG: tgr:Tgr7_0797
FT                   pilin"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13792"
FT                   /db_xref="GOA:D5BWR1"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR1"
FT                   /inference="protein motif:PFAM:PF00114"
FT                   /protein_id="ADE13792.1"
FT                   /translation="MRKVQQGFTLIELMIVVAIIGILASIAIPAYQDYTIRTQVTEGLN
FT                   LAAEAKQSIGDFWSARGRLPGDNASAGLADATSITGNYITQMAVDNGQIALTYGNRANS
FT                   NIENGILTLTPAQNQAGSLVWLCGKAYDSKDDSKLPEISGVGSTQTDIEDKYLPTECRS
FT                   "
FT   gene            617321..619285
FT                   /locus_tag="Nhal_0609"
FT   CDS_pept        617321..619285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13793"
FT                   /db_xref="GOA:D5BWR2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR2"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_0796"
FT                   /protein_id="ADE13793.1"
FT                   /translation="MLNPASRSHSKLATSYSLMGLLGVLFLTFFLYSPGLGGTFLFDDE
FT                   HNITDNKAIQIEDISPESLWQAAFSTESGPLKRPLSLLSFAFNHYVSGLDPYAFKLVNL
FT                   FVHLATGILVYFTAWQLLAAYRRCQQKILNDTTISWISLGCAALWLLHPLNLTPVLYVV
FT                   QRMTSLAALFTFAGLGLYAWGRRRQMEGKNGWIAIALALFIALPLGALSKENAFLLPLF
FT                   LLLAELTLFQFSAVRQGTRRLLIAGHGLIVVLPVILGVLYLLFNLEWLLGGYETRAFTL
FT                   GERLLTEARVFWYYLQLIFLPRLANFSLYHDDFAISHGWLEPTTTLPAVLGVIALGMAC
FT                   LLLRKRAPVFVFGLGFFLIGHSMESTIFGLELVHEHRNYVPLFGIALMLAYGAGVLIPQ
FT                   RGLRIFMASTTLVLLSTMTAIRADTWGHPLEHLLVSARHHPHSARTHYGAGQLYFDLAL
FT                   AEKKEADREVYYQRGKEFFSQAYRNDPRFLSALLATLAINYTFEKSVNEAQVKLLAQEL
FT                   ETTPLTPFTIHNLQKTNQCHLEGECRWPAEQLKMLFSAAVKNPTLVPQAKVVLLTEYSI
FT                   LLLAKGDLSQALQVAEEAKKVNPRDPQLTLNYAALLRYGGRYQEAQAEYAALSSLSLSN
FT                   LHSQRLQKEKKALEALLDE"
FT   sig_peptide     617321..617434
FT                   /locus_tag="Nhal_0609"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.792 at
FT                   residue 38"
FT   gene            619444..620310
FT                   /locus_tag="Nhal_0610"
FT   CDS_pept        619444..620310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0610"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tgr:Tgr7_0794 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13794"
FT                   /db_xref="GOA:D5BWR3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADE13794.1"
FT                   /translation="MAPPTLSIVLPAKNEANSLRKLLPALREIYSDAEILVVNDGSSDE
FT                   TLEVAQAAGAKVVTHAYSMGNGAAVKHGARAATGEIIVFMDADGQHDPGDIPRLLERLF
FT                   EGFDMVVGARDSTSQASLSRRLGNSFYNRLSSWVTGHRIEDLTSGFRVVRAKRFREFLY
FT                   LLPNGFSYPTTSTMAFFRAGYLVSYVPIHANKREGKSHINLVKDGIRFFLIILKVATLY
FT                   SPLKVFTPISFVFFMLGAGNYLYTYLLEGRFTNMSALMFITAILVFLMGLISEQIANLL
FT                   YANTSQR"
FT   gene            620322..621587
FT                   /locus_tag="Nhal_0611"
FT   CDS_pept        620322..621587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0611"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tgr:Tgr7_0793 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13795"
FT                   /db_xref="GOA:D5BWR4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE13795.1"
FT                   /translation="MMKPLSKSLEQNRGAFPRLDCSSEPTSSVGYAHEEAEKARPKILV
FT                   ITRNLPPLVGGMERLNWHMIEELAKRAEVRVIGPEGAAAIAPVGVVQLREAPLKPLPGF
FT                   LLAAQWRAWREARAWRPHIVLAGSGLTAPISWLTAKSCGARAAVYVHGLDLAVKQSVYR
FT                   ALWLPAIRRMDNVIANSHATEKLAIDAGVDLARITIVPPGVELPQGELDPEAITRFRAE
FT                   HQLGQRPVLLSVGRLTRRKGLREFVANVLPQIVAARSDVMLLVVGDAPTQSLHAESQTP
FT                   ESIQAAADSKGIGNHIKFLGVITDRDRLATVYQSADVHVFPVQHIPNDPEGFGMVAIEA
FT                   AAQGLPTVAYATGGIVDAVAEGKSGYLVAPGDDRAFVGAVIQLLERSLPAAVLRFHAEG
FT                   FSWKHFGNAVWSRIGDALSTYE"
FT   gene            complement(622427..623551)
FT                   /locus_tag="Nhal_0612"
FT   CDS_pept        complement(622427..623551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0612"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   smt:Smal_3173 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13796"
FT                   /db_xref="GOA:D5BWR5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE13796.1"
FT                   /translation="MRIAFLCKRRYMGKDVIDDRYGRLYEIPYQLARLGHTVRGYCLSY
FT                   QGAPGGTWSHDASPGLLEWESRPLDMGTVLYPAHLRRRLRYFRPDVIVGASDIPHVALA
FT                   ARLGQQLDVPHALDLYDHFESFGQARIPGIKTLLRRAVGGAPLVTTTSQMLADHVLSEY
FT                   RARGNVLSMPSTVDKTVFRPLDKTQCRQALGLPTNARLIGTAGGLLGNRGIGTLYDAWK
FT                   QLAATDASSHLVLAGPTDPQCPPPNGERVHYLGMLAHGQIAQLFNALDVGVIYLRDSLF
FT                   GRYCFPQKAYEMAACGIAIVATRVGAMTDVLHDHPQCLYQTDNIEDLTRCIRQQLQHPT
FT                   PPALLIDDWSKIIGKMEPHLRALTTKGFATGARA"
FT   gene            complement(623601..623720)
FT                   /pseudo
FT                   /locus_tag="Nhal_0613"
FT   gene            complement(623736..624836)
FT                   /locus_tag="Nhal_0614"
FT   CDS_pept        complement(623736..624836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0614"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="KEGG: bpy:Bphyt_0851 UDP-galactopyranose mutase;
FT                   TIGRFAM: UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13797"
FT                   /db_xref="GOA:D5BWR6"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR6"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ADE13797.1"
FT                   /translation="MTDTFLVIGAGYAGSVMARELAEAGHRVLVIERRPHIAGNAYDEP
FT                   DAHGVLVHRYGPHIFHTNGERIFEYLSRFTQWRPYEHRVRSVVDGVRYPFPINRDTLNQ
FT                   LYGLELDEASAADFFERVREPREPVSTSEDVVLNSVGRDLYEKFFLNYTRKQWGLEPSQ
FT                   LKAGVAARIPVRTNTDDRYFTDNFQAMPKHGYTKMFEAMLDHPNISVELGVDFTEVRNR
FT                   IKARHIVYTGPIDAYFDYRYGHLPYRSLSFEHEHLTDTERFQETGTVNYPNDHAYTRIT
FT                   EFKHLTGQQHTGTSIVREYPQAQGEPYYPVPRAENEALFKRYQALAEQESGVTFVGRLA
FT                   QYRYYNMDQVVGAALAAAKRLIGTGS"
FT   sig_peptide     complement(624780..624836)
FT                   /locus_tag="Nhal_0614"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.868 at
FT                   residue 19"
FT   gene            complement(624861..625901)
FT                   /locus_tag="Nhal_0615"
FT   CDS_pept        complement(624861..625901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0615"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gur:Gura_1682 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13798"
FT                   /db_xref="GOA:D5BWR7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADE13798.1"
FT                   /translation="MSTPLLSVVMPCFNAQRWVEGAIDSILTQTHTHLELIVVDDGSSD
FT                   SSVKRIRKIANTDARLRLLTANCNTGIVHALNYGIEEARGKFIARMDADDICMPNRLSQ
FT                   QISFLEQTSCDLCGSWFVEFGQGIPRTVRWPHTESALRAAMIFQNTICHPTVMARREVF
FT                   EQFRYREAYQLAEDYDLFARASTKFRLANIPEPLLRYRRHPQQATQARRNDMEIVTRQI
FT                   RLQALQAQGIEATPEEQRLHNLIRAPSSIYNTTDLEGIEAWLLKLYKANDDKEGKRIIA
FT                   SQWVRACIRAAPLGHNMWRIYRLSPLRASAGINLMTHTDLRILSALKLDYGSNAFSSLR
FT                   RFGLSA"
FT   gene            complement(625898..626965)
FT                   /locus_tag="Nhal_0616"
FT   CDS_pept        complement(625898..626965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0616"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mca:MCA0622 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13799"
FT                   /db_xref="GOA:D5BWR8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADE13799.1"
FT                   /translation="MPKISVLMSAYNCGPYIVEAVSSISAQTYPNFEFLIIDDASTDDT
FT                   WRKLQQCTRNDGRIRLFQNSRNLGVAHSINTLIPKSTGEYIARMDADDIALPTRFEQQV
FT                   AVLDSGKADLCGGWMTVFGTDTEVMWSAPSNDTEIKAGLLFTPMFSQPTVMLRRELMEQ
FT                   HQYDPSTVPAEDYDLWVRMAPEAIMHNIPTPLVRYRIHPTQISARMQQKQWESAASIAS
FT                   KYLERTGLPFTEAERKIHTLISHPDPPASINHVRATDDWFCKLLTVFNSKTEAQRIIAR
FT                   MWYRYCLRAAALGPLVFWLFLRSPVTRCGAFRPWQYLAIFGLSALRVRHNSKLYRLLIV
FT                   RSPASRVNSKLSNNT"
FT   gene            complement(626965..627891)
FT                   /locus_tag="Nhal_0617"
FT   CDS_pept        complement(626965..627891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0617"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_1817 sulfotransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13800"
FT                   /db_xref="GOA:D5BWR9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13800.1"
FT                   /translation="MSLKRHPMQKKVRIPNLFIIGAPKCGTTALSHYLAGHPMIFMAEQ
FT                   SGTKEPDFFDKDLALSHIPQKIRDWESYLGLFVSAPENVIYMGDASPLYLYSKSAVPEI
FT                   LDNCEQPRFIISLRNPIELAQSLHNQHVKNGTEIFDFEQAWYLQDKRKQGKYLPCEFTD
FT                   GDLLQYGEVAKLGRQIQRLFQLVPRELVHVILYDDFSSRPDVCYRKLLAWLDLPDDGRM
FT                   EFPRLNTRVGYRWMWLEQSLRALRSVRQTLGLPGGIGIHHAINRFNVINRKQPLSKAFR
FT                   EQLAHHFRDDVRLLEKLLGRDLSHWNI"
FT   gene            complement(627982..628911)
FT                   /locus_tag="Nhal_0618"
FT   CDS_pept        complement(627982..628911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0618"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_1817 sulfotransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13801"
FT                   /db_xref="GOA:D5BWS0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE13801.1"
FT                   /translation="MSLKHHPMQEKVRIPNLFIIGAPKCGTTALSHYLAGHPMIFMAEQ
FT                   SGIKEPNFFNKDLALSHLPQKIRDWEAYLGLFVSAPENVIYMGDASVLYLYSKCAVPEI
FT                   LDNCEQPRFIVSLRNPIELAQSLHNQRAKHGIEILDFEQAWHLQDKRKQGKCLPHEFID
FT                   VDLLQYGEVVKLGAQIQRLFQLVPREFIYVILYDDFSSRPDVCYRKLLAWLNLPDDGRM
FT                   KFPRLNTYVGGYRWMWLEQSLRALRSVRQALGLPGGIGIHHTINRFNVINRKQPLSKAF
FT                   REQLAHHFRDDVRLLEKLLGRDLSHWNI"
FT   gene            complement(628902..630206)
FT                   /locus_tag="Nhal_0619"
FT   CDS_pept        complement(628902..630206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nhal_0619"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; multi
FT                   antimicrobial extrusion protein MatE; KEGG: abo:ABO_0915
FT                   polysaccharide export protein, translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Nhal_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADE13802"
FT                   /db_xref="GOA:D5BWS1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5BWS1"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADE13802.1"
FT                   /translation="MRAQPLIRSLWADLRPGSERGRLVRAAGGSSLIKLGSVLLAFLAS
FT                   LLYARALGPHDYGLYAYVIAWATMLTIPASLGLPRYLVREGARHPANIRGLLHWSDKRI
FT                   AWAGAFAALVLASAFFIPAAAEARWLFLIAAPLPLLANLGALRQSLLQAQNRVVQSQWA
FT                   QLLLAPALMLTALIIILLWSGRITAMELTALLVGTSVVPLIINHAQLRKTLEDSHQSHQ
FT                   PTPASIRQGLTFMWLGMLYLINSRTDLIMLGALQGAESAGVYAVTSRAADLVAFFLAAS
FT                   NTVIAPRIAGLYQRGEHAQLQRLISGAAMGVFLLTLPIALIFALFSHQIITLFYGPAYA
FT                   AGAVALQILTLGQLFNVLAGPTATILNMTGHEHLSTAGVGISVVINVALNTLLIPHFGV
FT                   EGAATATATSL