(data stored in ACNUC28527 zone)

EMBL: CP001800

ID   CP001800; SV 1; circular; genomic DNA; STD; PRO; 2668974 BP.
XX
AC   CP001800; ACQS01000000-ACQS01000056;
XX
PR   Project:PRJNA30989;
XX
DT   22-OCT-2009 (Rel. 102, Created)
DT   16-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Sulfolobus solfataricus 98/2, complete genome.
XX
KW   .
XX
OS   Saccharolobus solfataricus 98/2
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Saccharolobus.
XX
RN   [1]
RP   1-2668974
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Munk A.C., Brettin T., Detter J.C., Han C.,
RA   Tapia R., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Mead D.;
RT   "Complete sequence of Sulfolobus solfataricus 98/2";
RL   Unpublished.
XX
RN   [2]
RP   1-2668974
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Munk A.C., Brettin T., Detter J.C., Han C.,
RA   Tapia R., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Mead D.;
RT   ;
RL   Submitted (16-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f72f70c71d02b004342f2654148d97b2.
DR   BioSample; SAMN00120218.
DR   EnsemblGenomes-Gn; EBG00001071049.
DR   EnsemblGenomes-Gn; EBG00001071050.
DR   EnsemblGenomes-Gn; EBG00001071051.
DR   EnsemblGenomes-Gn; EBG00001071052.
DR   EnsemblGenomes-Gn; EBG00001071053.
DR   EnsemblGenomes-Gn; EBG00001071054.
DR   EnsemblGenomes-Gn; EBG00001071055.
DR   EnsemblGenomes-Gn; EBG00001071056.
DR   EnsemblGenomes-Gn; EBG00001071057.
DR   EnsemblGenomes-Gn; EBG00001071058.
DR   EnsemblGenomes-Gn; EBG00001071059.
DR   EnsemblGenomes-Gn; EBG00001071060.
DR   EnsemblGenomes-Gn; EBG00001071061.
DR   EnsemblGenomes-Gn; EBG00001071062.
DR   EnsemblGenomes-Gn; EBG00001071063.
DR   EnsemblGenomes-Gn; EBG00001071064.
DR   EnsemblGenomes-Gn; EBG00001071065.
DR   EnsemblGenomes-Gn; EBG00001071066.
DR   EnsemblGenomes-Gn; EBG00001071067.
DR   EnsemblGenomes-Gn; EBG00001071068.
DR   EnsemblGenomes-Gn; EBG00001071069.
DR   EnsemblGenomes-Gn; EBG00001071070.
DR   EnsemblGenomes-Gn; EBG00001071071.
DR   EnsemblGenomes-Gn; EBG00001071073.
DR   EnsemblGenomes-Gn; EBG00001071074.
DR   EnsemblGenomes-Gn; EBG00001071075.
DR   EnsemblGenomes-Gn; EBG00001071076.
DR   EnsemblGenomes-Gn; EBG00001071077.
DR   EnsemblGenomes-Gn; EBG00001071078.
DR   EnsemblGenomes-Gn; EBG00001071079.
DR   EnsemblGenomes-Gn; EBG00001071080.
DR   EnsemblGenomes-Gn; EBG00001071081.
DR   EnsemblGenomes-Gn; EBG00001071082.
DR   EnsemblGenomes-Gn; EBG00001071083.
DR   EnsemblGenomes-Gn; EBG00001071084.
DR   EnsemblGenomes-Gn; EBG00001071085.
DR   EnsemblGenomes-Gn; EBG00001071086.
DR   EnsemblGenomes-Gn; EBG00001071087.
DR   EnsemblGenomes-Gn; EBG00001071088.
DR   EnsemblGenomes-Gn; EBG00001071089.
DR   EnsemblGenomes-Gn; EBG00001071090.
DR   EnsemblGenomes-Gn; EBG00001071091.
DR   EnsemblGenomes-Gn; EBG00001071092.
DR   EnsemblGenomes-Gn; EBG00001071093.
DR   EnsemblGenomes-Gn; EBG00001071094.
DR   EnsemblGenomes-Gn; EBG00001071095.
DR   EnsemblGenomes-Gn; EBG00001071096.
DR   EnsemblGenomes-Gn; EBG00001071097.
DR   EnsemblGenomes-Gn; EBG00001071098.
DR   EnsemblGenomes-Gn; EBG00001071099.
DR   EnsemblGenomes-Gn; EBG00001071100.
DR   EnsemblGenomes-Gn; EBG00001071101.
DR   EnsemblGenomes-Gn; EBG00001071102.
DR   EnsemblGenomes-Gn; EBG00001071103.
DR   EnsemblGenomes-Gn; EBG00001071104.
DR   EnsemblGenomes-Gn; EBG00001071105.
DR   EnsemblGenomes-Gn; EBG00001071106.
DR   EnsemblGenomes-Gn; EBG00001071107.
DR   EnsemblGenomes-Gn; EBG00001071108.
DR   EnsemblGenomes-Gn; EBG00001071109.
DR   EnsemblGenomes-Gn; EBG00001071110.
DR   EnsemblGenomes-Gn; EBG00001071111.
DR   EnsemblGenomes-Gn; EBG00001071112.
DR   EnsemblGenomes-Gn; EBG00001071113.
DR   EnsemblGenomes-Gn; EBG00001071114.
DR   EnsemblGenomes-Gn; EBG00001071115.
DR   EnsemblGenomes-Gn; EBG00001071116.
DR   EnsemblGenomes-Gn; EBG00001071117.
DR   EnsemblGenomes-Gn; EBG00001071118.
DR   EnsemblGenomes-Gn; EBG00001071119.
DR   EnsemblGenomes-Gn; EBG00001071120.
DR   EnsemblGenomes-Gn; EBG00001071121.
DR   EnsemblGenomes-Gn; EBG00001071122.
DR   EnsemblGenomes-Gn; EBG00001071123.
DR   EnsemblGenomes-Gn; EBG00001071124.
DR   EnsemblGenomes-Gn; EBG00001071125.
DR   EnsemblGenomes-Gn; EBG00001071126.
DR   EnsemblGenomes-Gn; EBG00001071127.
DR   EnsemblGenomes-Gn; EBG00001071128.
DR   EnsemblGenomes-Gn; EBG00001071129.
DR   EnsemblGenomes-Gn; EBG00001071130.
DR   EnsemblGenomes-Gn; EBG00001071131.
DR   EnsemblGenomes-Gn; EBG00001071132.
DR   EnsemblGenomes-Gn; EBG00001071133.
DR   EnsemblGenomes-Gn; EBG00001071134.
DR   EnsemblGenomes-Gn; EBG00001071135.
DR   EnsemblGenomes-Gn; EBG00001071136.
DR   EnsemblGenomes-Gn; EBG00001071137.
DR   EnsemblGenomes-Gn; EBG00001071138.
DR   EnsemblGenomes-Gn; EBG00001071139.
DR   EnsemblGenomes-Gn; EBG00001071140.
DR   EnsemblGenomes-Gn; EBG00001071141.
DR   EnsemblGenomes-Gn; EBG00001071142.
DR   EnsemblGenomes-Gn; EBG00001071143.
DR   EnsemblGenomes-Gn; EBG00001071144.
DR   EnsemblGenomes-Gn; EBG00001071145.
DR   EnsemblGenomes-Gn; EBG00001071146.
DR   EnsemblGenomes-Gn; EBG00001071147.
DR   EnsemblGenomes-Gn; EBG00001071148.
DR   EnsemblGenomes-Gn; EBG00001071149.
DR   EnsemblGenomes-Gn; EBG00001071150.
DR   EnsemblGenomes-Gn; EBG00001071151.
DR   EnsemblGenomes-Gn; EBG00001071152.
DR   EnsemblGenomes-Gn; EBG00001071153.
DR   EnsemblGenomes-Gn; EBG00001071154.
DR   EnsemblGenomes-Gn; EBG00001071155.
DR   EnsemblGenomes-Gn; EBG00001071156.
DR   EnsemblGenomes-Gn; EBG00001071157.
DR   EnsemblGenomes-Gn; EBG00001071158.
DR   EnsemblGenomes-Gn; EBG00001071159.
DR   EnsemblGenomes-Gn; EBG00001071160.
DR   EnsemblGenomes-Gn; EBG00001071161.
DR   EnsemblGenomes-Gn; EBG00001071162.
DR   EnsemblGenomes-Gn; EBG00001071163.
DR   EnsemblGenomes-Gn; EBG00001071164.
DR   EnsemblGenomes-Gn; EBG00001071165.
DR   EnsemblGenomes-Gn; EBG00001071166.
DR   EnsemblGenomes-Gn; EBG00001071167.
DR   EnsemblGenomes-Gn; EBG00001071168.
DR   EnsemblGenomes-Gn; EBG00001071169.
DR   EnsemblGenomes-Gn; EBG00001071170.
DR   EnsemblGenomes-Gn; EBG00001071171.
DR   EnsemblGenomes-Gn; EBG00001071172.
DR   EnsemblGenomes-Gn; EBG00001071173.
DR   EnsemblGenomes-Gn; EBG00001071174.
DR   EnsemblGenomes-Gn; EBG00001071175.
DR   EnsemblGenomes-Gn; EBG00001071176.
DR   EnsemblGenomes-Gn; EBG00001071177.
DR   EnsemblGenomes-Gn; EBG00001071178.
DR   EnsemblGenomes-Gn; EBG00001071179.
DR   EnsemblGenomes-Gn; EBG00001071180.
DR   EnsemblGenomes-Gn; EBG00001071181.
DR   EnsemblGenomes-Gn; EBG00001071182.
DR   EnsemblGenomes-Gn; EBG00001071183.
DR   EnsemblGenomes-Gn; EBG00001071184.
DR   EnsemblGenomes-Gn; EBG00001071185.
DR   EnsemblGenomes-Gn; EBG00001071186.
DR   EnsemblGenomes-Gn; EBG00001071187.
DR   EnsemblGenomes-Gn; EBG00001071188.
DR   EnsemblGenomes-Gn; EBG00001071189.
DR   EnsemblGenomes-Gn; EBG00001071190.
DR   EnsemblGenomes-Gn; EBG00001071191.
DR   EnsemblGenomes-Gn; EBG00001071192.
DR   EnsemblGenomes-Gn; EBG00001071193.
DR   EnsemblGenomes-Gn; EBG00001071194.
DR   EnsemblGenomes-Gn; EBG00001071195.
DR   EnsemblGenomes-Gn; EBG00001071196.
DR   EnsemblGenomes-Gn; EBG00001071197.
DR   EnsemblGenomes-Gn; EBG00001071198.
DR   EnsemblGenomes-Gn; EBG00001071199.
DR   EnsemblGenomes-Gn; EBG00001071200.
DR   EnsemblGenomes-Gn; EBG00001071201.
DR   EnsemblGenomes-Gn; EBG00001071202.
DR   EnsemblGenomes-Gn; EBG00001071203.
DR   EnsemblGenomes-Gn; EBG00001071204.
DR   EnsemblGenomes-Gn; EBG00001071205.
DR   EnsemblGenomes-Gn; EBG00001071206.
DR   EnsemblGenomes-Gn; EBG00001071207.
DR   EnsemblGenomes-Gn; EBG00001071208.
DR   EnsemblGenomes-Gn; EBG00001071209.
DR   EnsemblGenomes-Gn; EBG00001071210.
DR   EnsemblGenomes-Gn; EBG00001071211.
DR   EnsemblGenomes-Gn; EBG00001071212.
DR   EnsemblGenomes-Gn; EBG00001071213.
DR   EnsemblGenomes-Gn; EBG00001071214.
DR   EnsemblGenomes-Gn; EBG00001071215.
DR   EnsemblGenomes-Gn; EBG00001071216.
DR   EnsemblGenomes-Gn; EBG00001071217.
DR   EnsemblGenomes-Gn; EBG00001071218.
DR   EnsemblGenomes-Gn; EBG00001071219.
DR   EnsemblGenomes-Gn; EBG00001071220.
DR   EnsemblGenomes-Gn; EBG00001071221.
DR   EnsemblGenomes-Gn; EBG00001071222.
DR   EnsemblGenomes-Gn; EBG00001071223.
DR   EnsemblGenomes-Gn; EBG00001071224.
DR   EnsemblGenomes-Gn; EBG00001071225.
DR   EnsemblGenomes-Gn; EBG00001071226.
DR   EnsemblGenomes-Gn; EBG00001071227.
DR   EnsemblGenomes-Gn; EBG00001071228.
DR   EnsemblGenomes-Gn; EBG00001071229.
DR   EnsemblGenomes-Gn; EBG00001071230.
DR   EnsemblGenomes-Gn; EBG00001071231.
DR   EnsemblGenomes-Gn; EBG00001071232.
DR   EnsemblGenomes-Gn; EBG00001071233.
DR   EnsemblGenomes-Gn; EBG00001071234.
DR   EnsemblGenomes-Gn; EBG00001071235.
DR   EnsemblGenomes-Gn; EBG00001071236.
DR   EnsemblGenomes-Gn; EBG00001071237.
DR   EnsemblGenomes-Gn; EBG00001071238.
DR   EnsemblGenomes-Gn; EBG00001071239.
DR   EnsemblGenomes-Gn; EBG00001071240.
DR   EnsemblGenomes-Gn; EBG00001071241.
DR   EnsemblGenomes-Gn; EBG00001071242.
DR   EnsemblGenomes-Gn; EBG00001071243.
DR   EnsemblGenomes-Gn; EBG00001071244.
DR   EnsemblGenomes-Gn; EBG00001071245.
DR   EnsemblGenomes-Gn; EBG00001071246.
DR   EnsemblGenomes-Gn; EBG00001071247.
DR   EnsemblGenomes-Gn; EBG00001071248.
DR   EnsemblGenomes-Gn; EBG00001071249.
DR   EnsemblGenomes-Gn; EBG00001071250.
DR   EnsemblGenomes-Gn; EBG00001071251.
DR   EnsemblGenomes-Gn; EBG00001071252.
DR   EnsemblGenomes-Gn; EBG00001071253.
DR   EnsemblGenomes-Gn; Ssol_R0001.
DR   EnsemblGenomes-Gn; Ssol_R0002.
DR   EnsemblGenomes-Gn; Ssol_R0003.
DR   EnsemblGenomes-Gn; Ssol_R0004.
DR   EnsemblGenomes-Gn; Ssol_R0005.
DR   EnsemblGenomes-Gn; Ssol_R0006.
DR   EnsemblGenomes-Gn; Ssol_R0007.
DR   EnsemblGenomes-Gn; Ssol_R0008.
DR   EnsemblGenomes-Gn; Ssol_R0009.
DR   EnsemblGenomes-Gn; Ssol_R0010.
DR   EnsemblGenomes-Gn; Ssol_R0011.
DR   EnsemblGenomes-Gn; Ssol_R0012.
DR   EnsemblGenomes-Gn; Ssol_R0013.
DR   EnsemblGenomes-Gn; Ssol_R0014.
DR   EnsemblGenomes-Gn; Ssol_R0015.
DR   EnsemblGenomes-Gn; Ssol_R0016.
DR   EnsemblGenomes-Gn; Ssol_R0017.
DR   EnsemblGenomes-Gn; Ssol_R0018.
DR   EnsemblGenomes-Gn; Ssol_R0019.
DR   EnsemblGenomes-Gn; Ssol_R0020.
DR   EnsemblGenomes-Gn; Ssol_R0021.
DR   EnsemblGenomes-Gn; Ssol_R0022.
DR   EnsemblGenomes-Gn; Ssol_R0023.
DR   EnsemblGenomes-Gn; Ssol_R0024.
DR   EnsemblGenomes-Gn; Ssol_R0025.
DR   EnsemblGenomes-Gn; Ssol_R0026.
DR   EnsemblGenomes-Gn; Ssol_R0027.
DR   EnsemblGenomes-Gn; Ssol_R0028.
DR   EnsemblGenomes-Gn; Ssol_R0029.
DR   EnsemblGenomes-Gn; Ssol_R0030.
DR   EnsemblGenomes-Gn; Ssol_R0031.
DR   EnsemblGenomes-Gn; Ssol_R0032.
DR   EnsemblGenomes-Gn; Ssol_R0033.
DR   EnsemblGenomes-Gn; Ssol_R0034.
DR   EnsemblGenomes-Gn; Ssol_R0035.
DR   EnsemblGenomes-Gn; Ssol_R0036.
DR   EnsemblGenomes-Gn; Ssol_R0037.
DR   EnsemblGenomes-Gn; Ssol_R0038.
DR   EnsemblGenomes-Gn; Ssol_R0039.
DR   EnsemblGenomes-Gn; Ssol_R0040.
DR   EnsemblGenomes-Gn; Ssol_R0041.
DR   EnsemblGenomes-Gn; Ssol_R0042.
DR   EnsemblGenomes-Gn; Ssol_R0043.
DR   EnsemblGenomes-Gn; Ssol_R0044.
DR   EnsemblGenomes-Gn; Ssol_R0046.
DR   EnsemblGenomes-Gn; Ssol_R0047.
DR   EnsemblGenomes-Gn; Ssol_R0048.
DR   EnsemblGenomes-Gn; Ssol_R0049.
DR   EnsemblGenomes-Gn; Ssol_R0050.
DR   EnsemblGenomes-Tr; EBT00001674965.
DR   EnsemblGenomes-Tr; EBT00001674966.
DR   EnsemblGenomes-Tr; EBT00001674967.
DR   EnsemblGenomes-Tr; EBT00001674968.
DR   EnsemblGenomes-Tr; EBT00001674970.
DR   EnsemblGenomes-Tr; EBT00001674971.
DR   EnsemblGenomes-Tr; EBT00001674972.
DR   EnsemblGenomes-Tr; EBT00001674973.
DR   EnsemblGenomes-Tr; EBT00001674974.
DR   EnsemblGenomes-Tr; EBT00001674975.
DR   EnsemblGenomes-Tr; EBT00001674976.
DR   EnsemblGenomes-Tr; EBT00001674977.
DR   EnsemblGenomes-Tr; EBT00001674978.
DR   EnsemblGenomes-Tr; EBT00001674979.
DR   EnsemblGenomes-Tr; EBT00001674980.
DR   EnsemblGenomes-Tr; EBT00001674981.
DR   EnsemblGenomes-Tr; EBT00001674982.
DR   EnsemblGenomes-Tr; EBT00001674983.
DR   EnsemblGenomes-Tr; EBT00001674984.
DR   EnsemblGenomes-Tr; EBT00001674985.
DR   EnsemblGenomes-Tr; EBT00001674986.
DR   EnsemblGenomes-Tr; EBT00001674987.
DR   EnsemblGenomes-Tr; EBT00001674988.
DR   EnsemblGenomes-Tr; EBT00001674989.
DR   EnsemblGenomes-Tr; EBT00001674990.
DR   EnsemblGenomes-Tr; EBT00001674991.
DR   EnsemblGenomes-Tr; EBT00001674992.
DR   EnsemblGenomes-Tr; EBT00001674993.
DR   EnsemblGenomes-Tr; EBT00001674994.
DR   EnsemblGenomes-Tr; EBT00001674995.
DR   EnsemblGenomes-Tr; EBT00001674996.
DR   EnsemblGenomes-Tr; EBT00001674997.
DR   EnsemblGenomes-Tr; EBT00001674998.
DR   EnsemblGenomes-Tr; EBT00001674999.
DR   EnsemblGenomes-Tr; EBT00001675000.
DR   EnsemblGenomes-Tr; EBT00001675001.
DR   EnsemblGenomes-Tr; EBT00001675002.
DR   EnsemblGenomes-Tr; EBT00001675003.
DR   EnsemblGenomes-Tr; EBT00001675004.
DR   EnsemblGenomes-Tr; EBT00001675005.
DR   EnsemblGenomes-Tr; EBT00001675006.
DR   EnsemblGenomes-Tr; EBT00001675007.
DR   EnsemblGenomes-Tr; EBT00001675008.
DR   EnsemblGenomes-Tr; EBT00001675009.
DR   EnsemblGenomes-Tr; EBT00001675010.
DR   EnsemblGenomes-Tr; EBT00001675011.
DR   EnsemblGenomes-Tr; EBT00001675012.
DR   EnsemblGenomes-Tr; EBT00001675013.
DR   EnsemblGenomes-Tr; EBT00001675014.
DR   EnsemblGenomes-Tr; EBT00001675015.
DR   EnsemblGenomes-Tr; EBT00001675016.
DR   EnsemblGenomes-Tr; EBT00001675017.
DR   EnsemblGenomes-Tr; EBT00001675018.
DR   EnsemblGenomes-Tr; EBT00001675019.
DR   EnsemblGenomes-Tr; EBT00001675020.
DR   EnsemblGenomes-Tr; EBT00001675021.
DR   EnsemblGenomes-Tr; EBT00001675022.
DR   EnsemblGenomes-Tr; EBT00001675023.
DR   EnsemblGenomes-Tr; EBT00001675024.
DR   EnsemblGenomes-Tr; EBT00001675025.
DR   EnsemblGenomes-Tr; EBT00001675026.
DR   EnsemblGenomes-Tr; EBT00001675027.
DR   EnsemblGenomes-Tr; EBT00001675028.
DR   EnsemblGenomes-Tr; EBT00001675029.
DR   EnsemblGenomes-Tr; EBT00001675030.
DR   EnsemblGenomes-Tr; EBT00001675031.
DR   EnsemblGenomes-Tr; EBT00001675032.
DR   EnsemblGenomes-Tr; EBT00001675033.
DR   EnsemblGenomes-Tr; EBT00001675034.
DR   EnsemblGenomes-Tr; EBT00001675035.
DR   EnsemblGenomes-Tr; EBT00001675036.
DR   EnsemblGenomes-Tr; EBT00001675037.
DR   EnsemblGenomes-Tr; EBT00001675038.
DR   EnsemblGenomes-Tr; EBT00001675039.
DR   EnsemblGenomes-Tr; EBT00001675040.
DR   EnsemblGenomes-Tr; EBT00001675041.
DR   EnsemblGenomes-Tr; EBT00001675042.
DR   EnsemblGenomes-Tr; EBT00001675043.
DR   EnsemblGenomes-Tr; EBT00001675044.
DR   EnsemblGenomes-Tr; EBT00001675045.
DR   EnsemblGenomes-Tr; EBT00001675046.
DR   EnsemblGenomes-Tr; EBT00001675047.
DR   EnsemblGenomes-Tr; EBT00001675048.
DR   EnsemblGenomes-Tr; EBT00001675049.
DR   EnsemblGenomes-Tr; EBT00001675050.
DR   EnsemblGenomes-Tr; EBT00001675051.
DR   EnsemblGenomes-Tr; EBT00001675052.
DR   EnsemblGenomes-Tr; EBT00001675053.
DR   EnsemblGenomes-Tr; EBT00001675054.
DR   EnsemblGenomes-Tr; EBT00001675055.
DR   EnsemblGenomes-Tr; EBT00001675056.
DR   EnsemblGenomes-Tr; EBT00001675057.
DR   EnsemblGenomes-Tr; EBT00001675058.
DR   EnsemblGenomes-Tr; EBT00001675059.
DR   EnsemblGenomes-Tr; EBT00001675060.
DR   EnsemblGenomes-Tr; EBT00001675061.
DR   EnsemblGenomes-Tr; EBT00001675062.
DR   EnsemblGenomes-Tr; EBT00001675063.
DR   EnsemblGenomes-Tr; EBT00001675064.
DR   EnsemblGenomes-Tr; EBT00001675065.
DR   EnsemblGenomes-Tr; EBT00001675066.
DR   EnsemblGenomes-Tr; EBT00001675067.
DR   EnsemblGenomes-Tr; EBT00001675068.
DR   EnsemblGenomes-Tr; EBT00001675069.
DR   EnsemblGenomes-Tr; EBT00001675070.
DR   EnsemblGenomes-Tr; EBT00001675071.
DR   EnsemblGenomes-Tr; EBT00001675072.
DR   EnsemblGenomes-Tr; EBT00001675073.
DR   EnsemblGenomes-Tr; EBT00001675074.
DR   EnsemblGenomes-Tr; EBT00001675075.
DR   EnsemblGenomes-Tr; EBT00001675076.
DR   EnsemblGenomes-Tr; EBT00001675077.
DR   EnsemblGenomes-Tr; EBT00001675078.
DR   EnsemblGenomes-Tr; EBT00001675079.
DR   EnsemblGenomes-Tr; EBT00001675080.
DR   EnsemblGenomes-Tr; EBT00001675081.
DR   EnsemblGenomes-Tr; EBT00001675082.
DR   EnsemblGenomes-Tr; EBT00001675083.
DR   EnsemblGenomes-Tr; EBT00001675084.
DR   EnsemblGenomes-Tr; EBT00001675085.
DR   EnsemblGenomes-Tr; EBT00001675086.
DR   EnsemblGenomes-Tr; EBT00001675087.
DR   EnsemblGenomes-Tr; EBT00001675088.
DR   EnsemblGenomes-Tr; EBT00001675089.
DR   EnsemblGenomes-Tr; EBT00001675090.
DR   EnsemblGenomes-Tr; EBT00001675091.
DR   EnsemblGenomes-Tr; EBT00001675092.
DR   EnsemblGenomes-Tr; EBT00001675093.
DR   EnsemblGenomes-Tr; EBT00001675094.
DR   EnsemblGenomes-Tr; EBT00001675095.
DR   EnsemblGenomes-Tr; EBT00001675096.
DR   EnsemblGenomes-Tr; EBT00001675097.
DR   EnsemblGenomes-Tr; EBT00001675098.
DR   EnsemblGenomes-Tr; EBT00001675099.
DR   EnsemblGenomes-Tr; EBT00001675100.
DR   EnsemblGenomes-Tr; EBT00001675101.
DR   EnsemblGenomes-Tr; EBT00001675102.
DR   EnsemblGenomes-Tr; EBT00001675103.
DR   EnsemblGenomes-Tr; EBT00001675104.
DR   EnsemblGenomes-Tr; EBT00001675105.
DR   EnsemblGenomes-Tr; EBT00001675106.
DR   EnsemblGenomes-Tr; EBT00001675107.
DR   EnsemblGenomes-Tr; EBT00001675108.
DR   EnsemblGenomes-Tr; EBT00001675109.
DR   EnsemblGenomes-Tr; EBT00001675110.
DR   EnsemblGenomes-Tr; EBT00001675111.
DR   EnsemblGenomes-Tr; EBT00001675112.
DR   EnsemblGenomes-Tr; EBT00001675113.
DR   EnsemblGenomes-Tr; EBT00001675114.
DR   EnsemblGenomes-Tr; EBT00001675115.
DR   EnsemblGenomes-Tr; EBT00001675116.
DR   EnsemblGenomes-Tr; EBT00001675117.
DR   EnsemblGenomes-Tr; EBT00001675118.
DR   EnsemblGenomes-Tr; EBT00001675119.
DR   EnsemblGenomes-Tr; EBT00001675120.
DR   EnsemblGenomes-Tr; EBT00001675121.
DR   EnsemblGenomes-Tr; EBT00001675122.
DR   EnsemblGenomes-Tr; EBT00001675123.
DR   EnsemblGenomes-Tr; EBT00001675124.
DR   EnsemblGenomes-Tr; EBT00001675125.
DR   EnsemblGenomes-Tr; EBT00001675126.
DR   EnsemblGenomes-Tr; EBT00001675127.
DR   EnsemblGenomes-Tr; EBT00001675128.
DR   EnsemblGenomes-Tr; EBT00001675129.
DR   EnsemblGenomes-Tr; EBT00001675130.
DR   EnsemblGenomes-Tr; EBT00001675131.
DR   EnsemblGenomes-Tr; EBT00001675132.
DR   EnsemblGenomes-Tr; EBT00001675133.
DR   EnsemblGenomes-Tr; EBT00001675134.
DR   EnsemblGenomes-Tr; EBT00001675135.
DR   EnsemblGenomes-Tr; EBT00001675136.
DR   EnsemblGenomes-Tr; EBT00001675137.
DR   EnsemblGenomes-Tr; EBT00001675138.
DR   EnsemblGenomes-Tr; EBT00001675139.
DR   EnsemblGenomes-Tr; EBT00001675140.
DR   EnsemblGenomes-Tr; EBT00001675141.
DR   EnsemblGenomes-Tr; EBT00001675142.
DR   EnsemblGenomes-Tr; EBT00001675143.
DR   EnsemblGenomes-Tr; EBT00001675144.
DR   EnsemblGenomes-Tr; EBT00001675145.
DR   EnsemblGenomes-Tr; EBT00001675146.
DR   EnsemblGenomes-Tr; EBT00001675147.
DR   EnsemblGenomes-Tr; EBT00001675148.
DR   EnsemblGenomes-Tr; EBT00001675149.
DR   EnsemblGenomes-Tr; EBT00001675150.
DR   EnsemblGenomes-Tr; EBT00001675151.
DR   EnsemblGenomes-Tr; EBT00001675152.
DR   EnsemblGenomes-Tr; EBT00001675153.
DR   EnsemblGenomes-Tr; EBT00001675154.
DR   EnsemblGenomes-Tr; EBT00001675155.
DR   EnsemblGenomes-Tr; EBT00001675156.
DR   EnsemblGenomes-Tr; EBT00001675157.
DR   EnsemblGenomes-Tr; EBT00001675158.
DR   EnsemblGenomes-Tr; EBT00001675159.
DR   EnsemblGenomes-Tr; EBT00001675160.
DR   EnsemblGenomes-Tr; EBT00001675161.
DR   EnsemblGenomes-Tr; EBT00001675162.
DR   EnsemblGenomes-Tr; EBT00001675163.
DR   EnsemblGenomes-Tr; EBT00001675164.
DR   EnsemblGenomes-Tr; EBT00001675165.
DR   EnsemblGenomes-Tr; EBT00001675166.
DR   EnsemblGenomes-Tr; EBT00001675167.
DR   EnsemblGenomes-Tr; EBT00001675168.
DR   EnsemblGenomes-Tr; EBT00001675169.
DR   EnsemblGenomes-Tr; Ssol_R0001-1.
DR   EnsemblGenomes-Tr; Ssol_R0002-1.
DR   EnsemblGenomes-Tr; Ssol_R0003-1.
DR   EnsemblGenomes-Tr; Ssol_R0004-1.
DR   EnsemblGenomes-Tr; Ssol_R0005-1.
DR   EnsemblGenomes-Tr; Ssol_R0006-1.
DR   EnsemblGenomes-Tr; Ssol_R0007-1.
DR   EnsemblGenomes-Tr; Ssol_R0008-1.
DR   EnsemblGenomes-Tr; Ssol_R0009-1.
DR   EnsemblGenomes-Tr; Ssol_R0010-1.
DR   EnsemblGenomes-Tr; Ssol_R0011-1.
DR   EnsemblGenomes-Tr; Ssol_R0012-1.
DR   EnsemblGenomes-Tr; Ssol_R0013-1.
DR   EnsemblGenomes-Tr; Ssol_R0014-1.
DR   EnsemblGenomes-Tr; Ssol_R0015-1.
DR   EnsemblGenomes-Tr; Ssol_R0016-1.
DR   EnsemblGenomes-Tr; Ssol_R0017-1.
DR   EnsemblGenomes-Tr; Ssol_R0018-1.
DR   EnsemblGenomes-Tr; Ssol_R0019-1.
DR   EnsemblGenomes-Tr; Ssol_R0020-1.
DR   EnsemblGenomes-Tr; Ssol_R0021-1.
DR   EnsemblGenomes-Tr; Ssol_R0022-1.
DR   EnsemblGenomes-Tr; Ssol_R0023-1.
DR   EnsemblGenomes-Tr; Ssol_R0024-1.
DR   EnsemblGenomes-Tr; Ssol_R0025-1.
DR   EnsemblGenomes-Tr; Ssol_R0026-1.
DR   EnsemblGenomes-Tr; Ssol_R0027-1.
DR   EnsemblGenomes-Tr; Ssol_R0028-1.
DR   EnsemblGenomes-Tr; Ssol_R0029-1.
DR   EnsemblGenomes-Tr; Ssol_R0030-1.
DR   EnsemblGenomes-Tr; Ssol_R0031-1.
DR   EnsemblGenomes-Tr; Ssol_R0032-1.
DR   EnsemblGenomes-Tr; Ssol_R0033-1.
DR   EnsemblGenomes-Tr; Ssol_R0034-1.
DR   EnsemblGenomes-Tr; Ssol_R0035-1.
DR   EnsemblGenomes-Tr; Ssol_R0036-1.
DR   EnsemblGenomes-Tr; Ssol_R0037-1.
DR   EnsemblGenomes-Tr; Ssol_R0038-1.
DR   EnsemblGenomes-Tr; Ssol_R0039-1.
DR   EnsemblGenomes-Tr; Ssol_R0040-1.
DR   EnsemblGenomes-Tr; Ssol_R0041-1.
DR   EnsemblGenomes-Tr; Ssol_R0042-1.
DR   EnsemblGenomes-Tr; Ssol_R0043-1.
DR   EnsemblGenomes-Tr; Ssol_R0044-1.
DR   EnsemblGenomes-Tr; Ssol_R0046-1.
DR   EnsemblGenomes-Tr; Ssol_R0047-1.
DR   EnsemblGenomes-Tr; Ssol_R0048-1.
DR   EnsemblGenomes-Tr; Ssol_R0049-1.
DR   EnsemblGenomes-Tr; Ssol_R0050-1.
DR   EuropePMC; PMC2944543; 20675475.
DR   EuropePMC; PMC4447912; 26021927.
DR   EuropePMC; PMC4725277; 26590281.
DR   EuropePMC; PMC5127849; 27965637.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01145; sR14.
DR   RFAM; RF01147; sR12.
DR   RFAM; RF01148; sR13.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01152; sR1.
DR   RFAM; RF01304; sR5.
DR   RFAM; RF01311; sR8.
DR   RFAM; RF01312; sR9.
DR   RFAM; RF01338; CRISPR-DR25.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001800.
DR   SILVA-SSU; CP001800.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024128
CC   Source DNA and bacteria available from David Mead
CC   (dmead@lucigen.com)
CC   Contacts: David Mead (dmead@lucigen.com)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Sulfolobus solfataricus 98/2
CC   GOLD Stamp ID         :: Gi02560
CC   Oxygen Requirement    :: Obligate aerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Hyperthermophile
CC   Temperature Optimum   :: 85C
CC   pH                    :: 2.0 - 4.5
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water
CC   Phenotypes            :: Acidophile
CC   Energy Source         :: Lithotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2668974
FT                   /organism="Saccharolobus solfataricus 98/2"
FT                   /strain="98/2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:555311"
FT   gene            105..1343
FT                   /locus_tag="Ssol_0001"
FT   CDS_pept        105..1343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0001"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: sin:YN1551_3171 isocitrate dehydrogenase,
FT                   NADP-dependent; TIGRFAM: isocitrate dehydrogenase,
FT                   NADP-dependent; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90307"
FT                   /db_xref="GOA:D0KMS7"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMS7"
FT                   /inference="protein motif:TFAM:TIGR00183"
FT                   /protein_id="ACX90307.1"
FT                   /translation="MQKIPEDGEVIKFENGKWIVPKKPIILYVEGDGIGHEITHAAMKV
FT                   INKAVEKAYGSDREIKWVEVLAGDKAEKLTGNRFPKESEELIEKYRVLLKGPLETPIGK
FT                   GWKSINVAIRLMLDLYANIRPVKYIPGIESPIKNADKIDLIIFRENTDDLYRGIEYPYD
FT                   SEQAKKIRDFLRKELGVEVEDDTGIGIKLISRFKTQRIARMAIKYAIDHKRKKVTIMHK
FT                   GNVMKYTEGAFREWSYEVATKEFRDYIVTEEEVTKNYNGVPPSGKVIINDRIADNMFQQ
FT                   IIIRPDEYDIILAPNVNGDYISDAAGALVGNIGMLGGANIGDTGGMFEAIHGTAPKYAG
FT                   KNVANPTGIIKGGELMLRFMGWDKAAELIDSAIMESIRQKKVTQDLARFMGVRALSTTE
FT                   YTDELIAIIDTLS"
FT   gene            1810..2106
FT                   /locus_tag="Ssol_0002"
FT   CDS_pept        1810..2106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90308"
FT                   /db_xref="GOA:D0KMS8"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMS8"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0001"
FT                   /protein_id="ACX90308.1"
FT                   /translation="MVIRRTFIKSTLAVSFSISYLLYLIARASFGSGKLAFVIALLQLY
FT                   PYFLIEYLPTGQVISLFFQSLLLLLFAIFVLLITYILFSFYKLYKMIKTSVLK"
FT   gene            2181..3365
FT                   /locus_tag="Ssol_0003"
FT   CDS_pept        2181..3365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0003"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: CDC6 domain protein; KEGG: sin:YN1551_0002
FT                   ORC1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90309"
FT                   /db_xref="GOA:D0KMS9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMS9"
FT                   /inference="protein motif:TFAM:TIGR02928"
FT                   /protein_id="ACX90309.1"
FT                   /translation="MHVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIA
FT                   IRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGG
FT                   TPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDI
FT                   VLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEY
FT                   GLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYE
FT                   QERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISEL
FT                   DMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSISIGDFDDVGEN"
FT   gene            3307..3666
FT                   /locus_tag="Ssol_0004"
FT   CDS_pept        3307..3666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0004"
FT                   /product="conserved hypothetical M protein"
FT                   /note="KEGG: sin:YN1551_0003 conserved hypothetical M
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90310"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT0"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0003"
FT                   /protein_id="ACX90310.1"
FT                   /translation="MRLLKIVLVLVILMMWEKIKRLEERLYELRKEIEEVEKELEGYPS
FT                   GHLEVKTINGNVYYYLRYWEDGKLRSKYVGKFANEIKEKLSKGEQLRRRLTQLKEEEKK
FT                   LSIIINKIEKIITDY"
FT   gene            3724..4569
FT                   /locus_tag="Ssol_0005"
FT   CDS_pept        3724..4569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0005"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: sin:YN1551_0004 conserved TM helix repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90311"
FT                   /db_xref="GOA:D0KMT1"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT1"
FT                   /inference="protein motif:PFAM:PF05552"
FT                   /protein_id="ACX90311.1"
FT                   /translation="MNIQRISVIIVSAQTSISQALSGIATSIIDAIPSIILFVIILLVG
FT                   YIIGNIVAYSIRTFLGRIFREEHVRASVDIIAGTVKALIILIALSIALSFLQLGAASGY
FT                   IQQIANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDLITAIFNVLRFGLYAA
FT                   IITVAAALAIFSVIPYVDPYVFYAVILGAVILYAAYALIDKVLVPFANSNPDLAYVANY
FT                   GRFILYIIVLLIAIAIIVEPFGNVTSIIYALSWGLAIAFAIALIPLVIALVKKFLAEIK
FT                   "
FT   gene            4617..4910
FT                   /locus_tag="Ssol_0006"
FT   CDS_pept        4617..4910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0006"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: sid:M164_0005 transcriptional
FT                   coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90312"
FT                   /db_xref="GOA:D0KMT2"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT2"
FT                   /inference="protein motif:PFAM:PF01329"
FT                   /protein_id="ACX90312.1"
FT                   /translation="MSGISSKELEELKINGWIVLENGKKIKKEFRFKDFKQSVDFLKDI
FT                   QPSADALDHHPDVCVYYNRVVVELTTHDVGGLTDLDYKLAIKLDELYKMKTS"
FT   gene            complement(4977..5486)
FT                   /locus_tag="Ssol_0007"
FT   CDS_pept        complement(4977..5486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90313"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT3"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0006"
FT                   /protein_id="ACX90313.1"
FT                   /translation="MSENVTPIFGLGNFVMDKLGNVTQYTFFYYYDPENYYVSLPREML
FT                   DKEMELVKENMQSFLDEEKIIINDRVTRAKVVSTDIFLLDTTHPVIEFIITFKGTLKEG
FT                   LNVYENFYEEEITEYPYEAIWRFPGKILNVKMKGQVSILENFLKIKVNKGIKVGGRERI
FT                   EFFLTS"
FT   gene            complement(5479..6195)
FT                   /locus_tag="Ssol_0008"
FT   CDS_pept        complement(5479..6195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90314"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT4"
FT                   /inference="similar to AA sequence:KEGG:M164_0007"
FT                   /protein_id="ACX90314.1"
FT                   /translation="MKCSTKSIREIRGFSFLVPNCDSTLLREKFESFRKLSNEENKTYI
FT                   IRIADSNYFKFEVLMLPNSLTLLTISTVRGTNNINLRDFEMLDELQTLACCAYQKEELK
FT                   NTTSNFLSPTAQIAEAEVVDLISTDEEFECQIECDNVSWNEIKLPESTEGKWTTTELAS
FT                   TSRLYLKALSGQAKFLTISTERPQNSIKFTSMERLGALCCFLTELKRKLNECPTLRDVL
FT                   QPYLQVKTGRKRKKNE"
FT   gene            complement(6229..7032)
FT                   /locus_tag="Ssol_0009"
FT   CDS_pept        complement(6229..7032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0009"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   sin:YN1551_0008 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90315"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACX90315.1"
FT                   /translation="MLILSKRLIDILSESLSLKEAYTQYKNKNLNYALKLLDELITQNP
FT                   DLKEAYSLKGKILFELGKLQEAYENFQKAEDKIGMAKVLIAQGLYRDALIYLNDNSKDS
FT                   RKLRGLIYLKLENYEKALDEIKVVEDEDPLVYKIRGISELKLGKYNDAIIDLSLAIEKY
FT                   PTDAELYFYRALAQRELGNYKEAENDLEIAINLNPYYAEVYFSLGELKESRGLLEEAVD
FT                   MYSKSININPLYRNAYVRRAKSLMKLGREEEAYADIRKANELNSS"
FT   gene            complement(7953..8783)
FT                   /locus_tag="Ssol_0010"
FT   CDS_pept        complement(7953..8783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0010"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: siy:YG5714_0009
FT                   AIG2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90316"
FT                   /db_xref="GOA:D0KMT6"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT6"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ACX90316.1"
FT                   /translation="MYLLVYGSLRYGFELNHLVAKSRFVGLGYIEGYEMYDLGNYPGVI
FT                   KGDGIVWGEVYEIDENLIKLLDEVEDYKGSPDDLYVREKTRVYFDQKRKYYLDNVYFYR
FT                   YNKEIVKNMEKIEDGDYSAWSGMPIIVNYFAYAENTNERILHQRGVDMILSETPAYTKG
FT                   YRLIFNIPCKYGYCANLIEDESGIICGYLQKVFLHTLNSLDKAEQHLIKYIREVVKVYD
FT                   RNGKEYFAYAYVSSYKENRKKPSEEYVKIIREGLMRGWGNECVSTGLYDEPGIS"
FT   gene            complement(8786..9070)
FT                   /locus_tag="Ssol_0011"
FT   CDS_pept        complement(8786..9070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90317"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0010"
FT                   /protein_id="ACX90317.1"
FT                   /translation="MKPVEYEKLVDMLTKRGFDVRENGEELLAIFYPPTIEEAGGEGEM
FT                   LNQRYYVIKFKIINGLAYYDSTTLMENDKPIKILKMEEVQPWLESLLGE"
FT   gene            complement(9051..9425)
FT                   /locus_tag="Ssol_0012"
FT   CDS_pept        complement(9051..9425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0012"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   sin:YN1551_0011 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90318"
FT                   /db_xref="GOA:D0KMT8"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT8"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACX90318.1"
FT                   /translation="MAHPVAITLIIIAILIAILVITGYISDPIIDIPTLALLGFLTYRV
FT                   INVVIKTRGRNLYSYEGKIGKAVDDIKSGQEGYVIVEGEYWRALALEDIKKNEDIVVVK
FT                   REGMKLMVRKKVSDIETSRV"
FT   gene            9461..10789
FT                   /locus_tag="Ssol_0013"
FT   CDS_pept        9461..10789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0013"
FT                   /product="Peptidase A5, thermopsin"
FT                   /note="PFAM: Peptidase A5, thermopsin; KEGG: sim:M1627_0012
FT                   peptidase A5, thermopsin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90319"
FT                   /db_xref="GOA:D0KMT9"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMT9"
FT                   /inference="protein motif:PFAM:PF05317"
FT                   /protein_id="ACX90319.1"
FT                   /translation="MYKVLLIIILLLPLSMPLSIPTTSQPSALAFPSGVTSYPLNTIIY
FT                   TDFVMGRINISYLNIGSSYLPGGEYFTTGNASLQLNAMVLGEYWAQNVILFHQISNNTF
FT                   YATLIVNLWNLSGPFSNTTSNSLVYQGLGVICYQGPTFKVTLPLSISLFMEIVNSTLNF
FT                   GYNINGQKGIYFRYPIIGLFQLGGLSLLGLPNDLELVWGGPGGGSVVFMNVSSIANLYY
FT                   FNGNTLTIVPNAYSIGFDTAESAYGVKVYSTFPSVFSPIVIETSGVNVPSVLWPIPPHV
FT                   LVNQTSNKITVKLSISNKSLSGQAVYLETGFPPSVISSAVTNSSGIAVFPNNNYSFYVV
FT                   YFPGNFTLSSTYYFSSPILNSLSSKFRSYYQDLLNFLNSAQNSFKKGIKSVLSKQETSI
FT                   TTTTLTSTTSSSSQFGVNLYIVLYILAFVIGMVISAILIRFKL"
FT   gene            10814..11617
FT                   /locus_tag="Ssol_0014"
FT   CDS_pept        10814..11617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0014"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   sin:YN1551_0013 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90320"
FT                   /db_xref="GOA:D0KMU0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU0"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACX90320.1"
FT                   /translation="MAISIGDIVGIVFLIIIIIIFIAMSFRVVREWERAVVLRLGRFLR
FT                   VKGPGIIFLIPFVDRPLVVDLRVNTVEVPPQTILTKDNVTVSVDAVVYYKVVDPQKAVL
FT                   SVFNYNVAVLNLAQTSLRDIVGQMELDELLSKREEINKRIQEILDVTTEGWGIKVTAVT
FT                   IRDIRLSQDLLSAMAKQAEAERLRRAKVILSEGERQAASILADASAYYKNNPSTLQLRF
FT                   LETLSDISQRGGLIIVVPAGNEIYPTLGTSAALSTLSKKFQTETK"
FT   gene            complement(11648..12739)
FT                   /locus_tag="Ssol_0015"
FT   CDS_pept        complement(11648..12739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0015"
FT                   /product="NurA domain protein"
FT                   /note="PFAM: NurA domain; KEGG: siy:YG5714_0014
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90321"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU1"
FT                   /inference="protein motif:PFAM:PF09376"
FT                   /protein_id="ACX90321.1"
FT                   /translation="MNTNEIIKKVNELASKDVNERGKINMAVNLIFDDIISNSIDLKIG
FT                   ILDEIIDSEHIACAVDGSKYEIELSDVTLILARAVKILGKKKDKKSVPSEIAEDFKIIE
FT                   NYYDKNVISNKSILFMLTLETSLIEKCEECDVIFIDGPIVDPPTYYEEDVEIENILSLD
FT                   KLALYRSTVLRRLKGKNKLIVGIVKNFSHRILIKEFLNNYPALMKARENYIIFSIMYKY
FT                   RLEKSEFNKPVYLGWISWDSLINNQIILDDLKGISKAYNRYKKVFNDSLSIYSLYYQYN
FT                   TTSPIVRIDVLAEREPDFTPIKYLNIWAMQSIREVTLLNKLADELSEINSQDAKKYALL
FT                   FNLARENYLDINDKLAELMMRKT"
FT   gene            complement(12736..13425)
FT                   /locus_tag="Ssol_0016"
FT   CDS_pept        complement(12736..13425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90322"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU2"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0015"
FT                   /protein_id="ACX90322.1"
FT                   /translation="MDLAEFMERLTQYKQNLDVERLREEDRKITETIEELEKSKQSLKE
FT                   SLKKLRTLEKKINELNKYEDKLEEVKADIEKLTKLNSAEEIIRYIDKIKSKVDSLEKDI
FT                   EQDLNKIIEEKIKSIEEINNRLILYAKILYHFLKIQKDAKTFSIPKERSLSKLNEVEIQ
FT                   AKQHLNELYGIIVDELRKINLNEKEISILILLIDKGEIKISRDNLEESIKVIKMLVEKN
FT                   ISIKVKV"
FT   gene            complement(13412..16450)
FT                   /locus_tag="Ssol_0017"
FT   CDS_pept        complement(13412..16450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90323"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU3"
FT                   /inference="similar to AA sequence:KEGG:M1627_0016"
FT                   /protein_id="ACX90323.1"
FT                   /translation="MSCSKRISETASDSSYIYQIFSCITENSLYINRLRFFKQVKDEID
FT                   RISKIKQSPEIISLVGDWGQGKSTFLDIIEEYAKNRNINVIKIPFVELLSRTEDLLTFK
FT                   NNVYLIDEVESSVDYFAEYQNEIKDFWSKVKELANSTGNSIIYLSMTPSAYSKIFGTGG
FT                   IIYNLFSETYPSLLERIRKVSIENPSKLEFLLMLKCMLNMANINDLKILQYMDLPYWVI
FT                   DQERRKYVKFFNDIVCDNLPNVDRIFNELARSDKGINLNSEGETVRLDMLTKLENEMDS
FT                   QELSKLYKVLMSRIFTDEKLVIKKLEGHVIKGVLIPYLKWIEMFPKGQEYVEDFLLTYY
FT                   QDDFHVFISDNIETILHESIDISKIKENVKKLSLFGKTDAYAISWSFFESIANTNIGGL
FT                   IVEFKSREIRDKALQFVNTYITDREKELESLEYLMEVLGIKVDSVNRSKDYIRFLKLIM
FT                   DNKKITIILANPANEDEIKNLIKEINESDELIHGLILIEPQIRKEELSKTLDGLSIPLI
FT                   ELKMTTPKKRQLLYLLFSKIYGQSRIRLDSIELRLGDLKNSISSLLLKIRDNLNLNQLP
FT                   IPRNKRLIQSFNWIIFYPSIKMVNANELFEKVNEIINEKFRMYGSKQFHLEDIETSNTF
FT                   VDDIITYFYGNRIIKIRSNYIDFEDLAGESLSSFAKLFAGLIRQKYKQEAEEVVFNYIM
FT                   YYVSPQDNKRKDNKNNPLVFAYQIFSPDKKIGQNPTLDFLVYSSIVSGEIAKYLNKDVI
FT                   YLKIDEQIRKIKEKLDNPYSTYGYFITAKKRGAAIRSLEEMREVIEAYEKSCTENKDIR
FT                   LCYDYLYLSNIYLELLRKTEESVIETDKIVEEIYKKLEVVEKAKRHVKINEKIEEIEKV
FT                   YEIIHELKDNFKMQMDKLVRKIQEINERGQTESFKRYLDYLLATIHVEDNSNLYFILFK
FT                   LLKEILNGVSISGDELKDTIIEEIASLGKVGIQLNNIEMIVNDLEKISPELPKLRENVE
FT                   RNTQKITQLIQEIKEVLEEYGFS"
FT   gene            complement(16455..18068)
FT                   /locus_tag="Ssol_0018"
FT   CDS_pept        complement(16455..18068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0018"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; HerA-ATP
FT                   synthase, barrel domain; KEGG: sid:M164_0017 protein of
FT                   unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90324"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU4"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ACX90324.1"
FT                   /translation="MVMERGEIIGIVLQKSEANEMQGLIRADEEISVGQLLLVDDSEKL
FT                   SLVRVENYEFLNEFFDEKGEIAKSILKEPSIYEILDMNTIIKATLHLIKKYDHNTTPKP
FT                   GSFVRRLPEIKSEKELLSFYGIKNKKGLIEYGALAGSEIPLLLDLNAITMHMGVFGETG
FT                   SGKSYNMRYLIKLLSNIKIGDKITALPMIVIDANGDYIDLASTNLDIVSKGRGWIKRYI
FT                   LKDPKEQNDIKLTIDLSIFTPRELSEFIMSLKYGEASYNTLQLNFLEQVLANHESKEYN
FT                   TLLGSAIGIETLRNEILTMAQNKDIGITTGTARGIASALEIFKNKVISRLQLVNSSASL
FT                   TENTLEVIWRNRGLAIIDFSADGSPGVDVLTKQLIVSYITRLIFNYLTRSKYNGNQRFL
FT                   GFVIEEAQNYIPSIDYPVNANLTKDVLVTLATQGRKFGASLILVSQRPAFIDKYVLSMI
FT                   NTFFFHRIYHEDVRYVMSASGGLPESLTKNLTSLDTGYVIVSGLMSIMKSPALVRIPWD
FT                   PRLGSYAGNVERIDLILSEG"
FT   gene            complement(18091..18681)
FT                   /pseudo
FT                   /locus_tag="Ssol_0019"
FT                   /product="hypothetical protein"
FT   gene            complement(18665..19537)
FT                   /locus_tag="Ssol_0020"
FT   CDS_pept        complement(18665..19537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90325"
FT                   /db_xref="GOA:D0KMU5"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0019"
FT                   /protein_id="ACX90325.1"
FT                   /translation="MKIILGIPDLKIPVWTFKQPLMINQLNWDRPSWENETWVDSGGYQ
FT                   IMVRGIKVEIEKVVEKYKILDATQYMSLDIPSIPCHKPSELNYKYFEYLYTVFDKKIVP
FT                   VIHAYDPESIKKSIDFYSQYTDLVAFGGIVPPTLNKSGNKKLAVAIYYLVRKLWKGKIH
FT                   VLGAGSPFMRKVYFNADSVDTSTYRVKGIHGMVIIPGKGERYVGNRKIVWGTKRASEEE
FT                   LEILLSFLDKTHYPFQIRFDNWIDRSLINAWVLLNSEYESNNPLIRYSKKLDTFAEDEI
FT                   EEEVNELCM"
FT   gene            complement(19558..19662)
FT                   /locus_tag="Ssol_0021"
FT   CDS_pept        complement(19558..19662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90326"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90326.1"
FT                   /translation="MKGCFTDVIYEIAFSISENVRKQVVLLYNQDLTQ"
FT   gene            19768..20448
FT                   /locus_tag="Ssol_0022"
FT   CDS_pept        19768..20448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90327"
FT                   /db_xref="GOA:D0KMV4"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV4"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0020"
FT                   /protein_id="ACX90327.1"
FT                   /translation="MSKGAVILILITLFVYTLNIISNAYLVNVKILSPFPITLMFSDSQ
FT                   GVKLVSSNQTLNVSSSNLRIQVFVLSPYSYCIFINGNKTDEFNVTLSNYSQFNLTVTVI
FT                   PKYAFLKVNVVGKGTAYIELDNGSIIAVRNSSVIRVYNGSSVLLEANGDLINWSNGANT
FT                   MTLWYTVGGNSTITAFFGNSSILPKSGTVKPTVNYTEVGLSLFAVGFFILYKIYSRKDQ
FT                   DTNV"
FT   gene            20490..22421
FT                   /locus_tag="Ssol_0023"
FT   CDS_pept        20490..22421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0023"
FT                   /product="protein of unknown function DUF255"
FT                   /note="PFAM: protein of unknown function DUF255; KEGG:
FT                   siy:YG5714_0021 protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90328"
FT                   /db_xref="GOA:D0KMV5"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV5"
FT                   /inference="protein motif:PFAM:PF03190"
FT                   /protein_id="ACX90328.1"
FT                   /translation="MNERLMNSQSGYLRKAVNHPINWYTWSNDVFEIAKKENKPILIDV
FT                   GAAWCHWCNVMDEDTYSNPEIAKIVNENFIPVKVDRDEMPDLDRLLQNAAMAITGESGW
FT                   PLTIFMTPEGKVFFGGTYFPPEDRYGRIGFKRLLLEILRIWREDRNQILLSSIDPNMLI
FT                   PKNTGGVLNSSVLDDAFSFITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGK
FT                   KLGLFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYIATN
FT                   DIEILDALRNSVDFVLRELYIDGKGFANSLDADSEGMEGKYYTWTEDELKDSLGNDYGI
FT                   AIRVFDLKNTVEVEGRKVLLRTIELRELCKATGLQVNDMIKKISEIRTKLLAYRKQNRK
FT                   MPYRDDNTYTYSNAKLAESMLYSSLILNKSIEEAKLVLSKLGKTVSRRLDGGKAGLPED
FT                   YAAALLATISAYEVLGEERYYDLAIELGRNIGVIKPNNFTDMPNESANSMYIRALFKLS
FT                   LLSDEFKVDEEKIKPLIPSLTAENSQFIAGIVNSISSYISGMAHVVVVDEKDGLAERLH
FT                   KVALLTYYPFKLVEKVDDSRTDYVSSVIRAMIKYNVGRSRAYVCIGNTCSMPVSEEEKI
FT                   KQLLKTKL"
FT   gene            22434..23153
FT                   /locus_tag="Ssol_0024"
FT   CDS_pept        22434..23153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0024"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sid:M164_0022 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90329"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX90329.1"
FT                   /translation="MGRLDNKKVAIIGVSEGLGYAVAYFALKEGAQVCINARNENKLKK
FT                   MKETLSKYGNIQYVVGDVSNIEGARNVLDKCASFLNGIDHLVVTVGGYIEDTIDHFSGL
FT                   EEMLTNHIKIPLYVINSSLRFLREGSSVVLVSSMSGIGKASPDQLSYAVAKAGLAKEVE
FT                   IIASELLGKGIRVNGIAPTTIGGEFEPERNWKKLRKLGDDMAPPEDFAKVIIWLLTDES
FT                   EWVDGVVIPVHGGARLK"
FT   gene            23163..23795
FT                   /locus_tag="Ssol_0025"
FT   CDS_pept        23163..23795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0025"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: sid:M164_0023
FT                   transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90330"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV7"
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /protein_id="ACX90330.1"
FT                   /translation="MGNVENLINGVGELWNKYVKHEFILKMRDGSLPLDIFRYYLIQDG
FT                   KYVEDMLRALLIASSKGPIDKVTKILNLVFSSRDKGLETHGKLYSKLDISRDVIVKTGY
FT                   NLINYAYTRHLYYYANLDWNKFLVAWTPCMFGYSIVGDYVIDSPNEVYKTWASFYASTE
FT                   YKKRIEAILYALDEVSITEDLLNIFINSVRFEIGFWDASLRKDPTVY"
FT   gene            23798..24460
FT                   /locus_tag="Ssol_0026"
FT   CDS_pept        23798..24460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90331"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0024"
FT                   /protein_id="ACX90331.1"
FT                   /translation="MSWIRDTSFLMECVKNENIKIEINSSNYFMSFNLLNGKYNLSLFS
FT                   SHDIRISYDGNRLIDMHNLRVLKDNEARVHISNMIRNIKVNMSNEINNLAIMYNIPVKI
FT                   LYENLEAIFNLDFSLLSCLDYGLDYFLLHLTNNFAKQSSQFEVVKKLKFILGNERGCIK
FT                   AILSLSNTYESDSFLFSSDCINFQTDVNAFSKFLRDYRTLNVKYIEVIDYLKQRLPH"
FT   gene            complement(24457..25167)
FT                   /locus_tag="Ssol_0027"
FT   CDS_pept        complement(24457..25167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0027"
FT                   /product="protein of unknown function DUF91"
FT                   /note="PFAM: protein of unknown function DUF91; KEGG:
FT                   sid:M164_0025 protein of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90332"
FT                   /db_xref="GOA:D0KMV9"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV9"
FT                   /inference="protein motif:PFAM:PF01939"
FT                   /protein_id="ACX90332.1"
FT                   /translation="MYSVLLNPSNTEIYSFLTDRIYRELIVIFATCKVNYKGRAESVAS
FT                   ESPRLIILKPDGTVIIHESVKREPLNWQPPGTKIEIMNDYPLKIVAQRNRPKEVIEIDL
FT                   KEVFYITSAEVKEGDFTIKGREIDIVNTIIQNPSMIEEGFVPLTREYNTPYGKIDLIGL
FT                   DKKGNFVIIEVKRSKAQLNAISQLYRYYLHMREIKGDKIRGILVAPDLTIHARELLQKL
FT                   GLEFIRYDIKNYSS"
FT   gene            25219..26277
FT                   /locus_tag="Ssol_0028"
FT   CDS_pept        25219..26277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0028"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sid:M164_0026 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90333"
FT                   /db_xref="GOA:D0KMW0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX90333.1"
FT                   /translation="MEYYNLILYLLVFGADMLIILQTYNEIKMWKTVKGNFVGKVSIIV
FT                   PIKGIDTRLERNIESLLSQDYPYPYEVIYVVEKGDEVENILKKYNVKIVYSDFNCDSCS
FT                   GKIRAQISGLLRASNDIIVFADSDTWYPRYWLRNLISPLDKYDTTTTFSWPFPSRITLS
FT                   NLIRAGFWTLGFESQSLQSSRFLWGGSMALRREFFDNEVLDELSKEWCDDCTLTRIIKR
FT                   RGGKIGFVMSAIPLNVYDENSLISWSSRQIITILAYSPRGARAYLVAGTFFALILIYSL
FT                   VYLNIVTFTPYILWIVKNVIRGVKYPKQALIASLMTILAIPYALFLLVFNWNRREVYWR
FT                   GKRYIVKPLREK"
FT   gene            26401..26964
FT                   /locus_tag="Ssol_0029"
FT   CDS_pept        26401..26964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90334"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW1"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0027"
FT                   /protein_id="ACX90334.1"
FT                   /translation="MQTTSVEIYLNIYSFRRELEHFTIEEERDEWLIVKDKANEKYIVK
FT                   EFADYGILIYPIYDLKDDILSSFSFQLSSVSKLKEVLYTPEKWIDRLDLRINDNSIEVT
FT                   SLILDYLTGIDIINSLISSFGFEYAQLDDNSLIIKIRISRPLNHTLLDSYIKAIWHMLE
FT                   LYYSVKKAQEDIASKITLNYIKSI"
FT   gene            26989..28041
FT                   /locus_tag="Ssol_0030"
FT   CDS_pept        26989..28041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0030"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sid:M164_0028 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90335"
FT                   /db_xref="GOA:D0KMW2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACX90335.1"
FT                   /translation="MLWLLMTTGKCNLKCDYCGGSFPDNVVPYGIKYDINSVKKLIEKD
FT                   KDSTIIFYGGEPLLNYKFVMAVLDNVRAKRYGIQTNGIAVRLLPERYWRKINVALLSID
FT                   GREEITNKHRGKGIYKAVLRSAKYLKDLGVETIARMTVTQDTDIFTDVMHLIDLGLFDK
FT                   VHWQLDVIWSEEWDFKSWSFSYLNGIKRLTDYFLSELRKGRVVKIIPILGVISAHFFEG
FT                   YKGSPCGAGYSSVTVTPDGRILSCPIAVREKWAELGNVNLGYRLLEDPLPDDCKRCEFK
FT                   RYCGGRCLYAQKERYWGEEGFKAVDEVNKEYLRTVLSIIPEIERLIRDGYIRLSDLYYN
FT                   PILDSTEIIP"
FT   gene            28067..28762
FT                   /locus_tag="Ssol_0031"
FT   CDS_pept        28067..28762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90336"
FT                   /db_xref="GOA:D0KMW3"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW3"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0029"
FT                   /protein_id="ACX90336.1"
FT                   /translation="MSVKFEESSRLLEAIKSMLASATSSILIVTYGIDQEAASEILTKA
FT                   ASGVNTVLVTADKDWARWLKNQAEAYKKDEEKRLYRELRRNETIYTQIIYFTLIISIAI
FT                   AIIDIILYFMMGTLVYYDVPLSIIAIGFLIYYGIRRRKEALSQISILRESAQNFVQEVG
FT                   QIRQKIKEKLKIIEIDNQVSFSIVSCDDKTILFSAPLKFSMEKSSVHVVMEISKQLADQ
FT                   LVNLILKIS"
FT   gene            complement(28892..29935)
FT                   /locus_tag="Ssol_0032"
FT   CDS_pept        complement(28892..29935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0032"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; KEGG: sid:M164_0030
FT                   nicotinate-nucleotide-
FT                   dimethylbenzimidazolephosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90337"
FT                   /db_xref="GOA:D0KMW4"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW4"
FT                   /inference="protein motif:PFAM:PF02277"
FT                   /protein_id="ACX90337.1"
FT                   /translation="MIKAYFGAETFTLNKDFAYILVIGTTDVSLIPGLTIAGATPELTH
FT                   FTPAADAEYVILGKCKSINTIPVSPTGIPTPALLTRASLSFTKSLKIVVNAGSRITPKI
FT                   PYIDLQGEPGKDIRKQALSIEKVNIIIENGIKLGEELSNEYELIMIGESIPAGTTTAMA
FT                   TLLALGYDAMDKVSSASPDNPKELKRKVVEEALRNLPTDPLQRLAKVSDPVLLGVAGIS
FT                   LGFRGKILLAGGTQMTAAAAIVNEFDKSKLKDIIIGTTKWIVEDKSADMLSLAKQVGVK
FT                   VLASMLDLSISIHEGIRTYEKGYVKEGVGAGGSTIMAFIRGVSNSTLVRKIDELYSELV
FT                   GSNNLNT"
FT   gene            29999..30340
FT                   /locus_tag="Ssol_0033"
FT   CDS_pept        29999..30340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90338"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0031"
FT                   /protein_id="ACX90338.1"
FT                   /translation="MVEKGTLVSIEEFKSNRKLKESVKNGIKGLVKLLFQEADKIIKFD
FT                   SNEDLIFQLMKLGLISPTLAQELLDILKIADNLDNVDDEILYSMLVRIMEDVEEAINNI
FT                   GKYMVKNSS"
FT   gene            complement(30333..31463)
FT                   /locus_tag="Ssol_0034"
FT   CDS_pept        complement(30333..31463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0034"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   sin:YN1551_0032 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90339"
FT                   /db_xref="GOA:D0KMW6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW6"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACX90339.1"
FT                   /translation="MRLRDPREFRENVPVTRKYVYLNHASVSPTPLPSLFEAYRYLYEV
FT                   ANRGSIAVNEEEEDELYHIRSKISNLVGAYSDEISLIPNTSYGVNLVAHGLEWKGDDNI
FT                   VTDNLEFPTVVYPFLKLTKKGVKINIVETNPYTFEEDIISHIDKNTRLVAISHVSFNTG
FT                   LKVDVRKIVKAARENNTLVLLDIIQSAGAVKINVKELGIDFAIAGGYKWLMSPQGSGFI
FT                   YVKRGLIEDPPFYGWKTSADYLDFNPNKFTLEKGPRRFEIGTVDLAANLSLAKSCEIIG
FT                   ENMELIESSVTNLSQFAIRLAKDHSMEVITPEDKRAGIVIVKVKKPKEIAKELLKENIV
FT                   VSPRGEGIRISTHFYNTEEEVQKTIEKISELERKFN"
FT   gene            complement(31435..33150)
FT                   /locus_tag="Ssol_0035"
FT   CDS_pept        complement(31435..33150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0035"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sid:M164_0033 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90340"
FT                   /db_xref="GOA:D0KMW7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX90340.1"
FT                   /translation="MDYYTLYDLSLEKPETYWETFANRLSFFKKWEKVIEKNKQLPIAK
FT                   WFINGTTNIAYNALNHGGKALIFYQENKHKGDEITFDELNNMSSMIAGLLLDKGVRRGD
FT                   RIAIYMPNSICTIATILAAARLGAIYTLIFAGLGINAIVSRISNLEPKLVISIDKTFRR
FT                   GKEIKLYTNLANIVFPRDSSQFDYTREYKEFEKIESNEPLKIMYTSGTTGKPKGVILPH
FT                   GAWMVGDYTVFDLMFSLKSDDIVLTTADVGWITFSRIMYGTLMHGSTLAFMEGAPDYPS
FT                   DRLPKIIDELQPKVLFTSPTLLRTLQKLDVKLPRVEFIATAGEIMDETAWKYALRFSDR
FT                   VADVYGQTELGYVIGYPYALDGVEPKIGYAGLPFPAAVIDTVDENGKSLRGHIGHLVAR
FT                   EPFPTQFIGIWKDEDKFLSYFEKFNSHDTGDLAIIDEKGYVKIVGRDDDMIKIAGHRIT
FT                   SGEVESVINSLQGIIESAAVGIPDEIKGEKLVVFYVGNVDERIVATKVREMLGPIYVID
FT                   KIYKVERLPKSRSGKIVRRVLRDLLLGKEIDETILEDPEILKEIKNEIKRSERI"
FT   gene            complement(33208..33684)
FT                   /locus_tag="Ssol_0036"
FT   CDS_pept        complement(33208..33684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0036"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   sid:M164_0034 nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90341"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW8"
FT                   /inference="protein motif:SMART:SM00670"
FT                   /protein_id="ACX90341.1"
FT                   /translation="MHIIFDTSGFLSGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAIS
FT                   SGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNIL
FT                   KQLGIQFSSVKINKKVEKSFKFKYVCVNCKREFNIDHGECPYCGGKVVKRRIME"
FT   gene            complement(33668..34417)
FT                   /locus_tag="Ssol_0037"
FT   CDS_pept        complement(33668..34417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0037"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: sin:YN1551_0035
FT                   NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90342"
FT                   /db_xref="GOA:D0KMU6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU6"
FT                   /inference="protein motif:PRIAM:2.7.1.23"
FT                   /protein_id="ACX90342.1"
FT                   /translation="MRVKIVSKPTSQLNYTVEKIKNISNKLGFEVVDIDFDYVIAVGGD
FT                   GTLLRAVKLGKPVIAIKAGRRGLLMDVPVDKIEDALLRLKKGDYNEEEYMLLEMVHNDK
FT                   VELGFNEIGILYDRPEAIKVGISFDTERVSVEGDGVLVSTPQGSSGWGMSATNSLLYKD
FT                   LNAIEIIFVNPIFYYLRSVVIPPKSLILRLEDKGYPQTARVVVDGEVVTLIKTNQEITV
FT                   RVSQHKAKILRFFKLDLIGEVLHAYHI"
FT   gene            34518..35585
FT                   /locus_tag="Ssol_0038"
FT   CDS_pept        34518..35585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0038"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sin:YN1551_0036 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90343"
FT                   /db_xref="GOA:D0KMU7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90343.1"
FT                   /translation="MKGIKIIVARVIYAIHWFYLAPLIPFLAGKLNLSLQIVGLIPLSF
FT                   FLGSGIMQIPSAFLSTRIGLRNTLLLGLFIMSISPLLIPLSSNFIELLIFYLMDGVGAS
FT                   MFFSTGGGILASLNRDSPSLALGLYNASFAVGGLIGLNWYIVFGNYLSFYILSILTFLS
FT                   LIINVNNSNLKPCWRIIRDNRIVILGISIAGIWGVYYVIGELYPTFAYYYLHLNLIDSS
FT                   LFTSLLLVSSVIGGSLTFLADRKIKKFNLLIISSLLGSVPSLLLYTKVYLLGIVITGIF
FT                   NELAISVLYSIIASLQRDANATMGLALVNSLNILIGMNFELLASYSGYYMWIAVNIIGL
FT                   LLFSLIVLVRQNISI"
FT   gene            complement(35563..35916)
FT                   /locus_tag="Ssol_0039"
FT   CDS_pept        complement(35563..35916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90344"
FT                   /db_xref="GOA:D0KMU8"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0037"
FT                   /protein_id="ACX90344.1"
FT                   /translation="MTDYTQLNIVILAVPLPILTYLWFKYYNIIITEGTKYVGEKYREE
FT                   EVLLLPSSTRTVKIDGKVSVLVYGVNPWITIRVNSGPKQKIFKIRLLNESGNLELINES
FT                   KVFQVRVKLRYSV"
FT   gene            36003..37001
FT                   /locus_tag="Ssol_0040"
FT   CDS_pept        36003..37001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0040"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: siy:YG5714_0038 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90345"
FT                   /db_xref="GOA:D0KMU9"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMU9"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACX90345.1"
FT                   /translation="MDEYDIVVIGGGPVGLFGTFYAGLRDMKTLLIDAQDELGGQLVSL
FT                   YPEKIVYDVGGLAGIQAYELAQRLIEQAKMFGPDIKVNELADMIEKTNDNMWIVKTDKA
FT                   TYKTKTIFIAAGIGKIVPSRLGAKGEIEYENRGVYYTVRRKKDFEGKRVLIVGGGDSAV
FT                   DWALTLAPVAKSVTLIHRRDQFRAHERSVKELFRVANVYVWHELKEVKGDGNKVTQAII
FT                   FDNRTKEEKVLDVDSVIISIGYKGDLGNIPKWGVTMKGRDIVVNGRMETNLPGVYAGGD
FT                   IVQMEGSPKLALIAVGFAHAAIAISVAKKYVEPNASLFAGHSSEMDKFKPK"
FT   gene            36946..37764
FT                   /locus_tag="Ssol_0041"
FT   CDS_pept        36946..37764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0041"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   sid:M164_0039 protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90346"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV0"
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /protein_id="ACX90346.1"
FT                   /translation="MHPYLPATVRKWTNLNLSNHSFSLNTMKTKRLSEFFPGVRSYYIV
FT                   GEIAIITPKRVNVDYNLVAEKIMQAHPKIKAVYLKKKVKGELRTNELEFLSGERISSTI
FT                   YKENGVLFYVDINKVYVNPSLSGDRLKNLELVEEGSTVLDAFTGYGAIALNIAHKKRVY
FT                   VVAGDINIDGLYMLKKSLSLNKIKGMIDIVQYDAHHLPFRDKVFKLSFGDNPTLIIDFK
FT                   EELCRVSENVVFYILCESEDKANSSLGRTSWIKINDYSKNLFIFKGLVRC"
FT   gene            complement(37687..38172)
FT                   /locus_tag="Ssol_0042"
FT   CDS_pept        complement(37687..38172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0042"
FT                   /product="Protein of unknown function DUF371"
FT                   /note="PFAM: Protein of unknown function DUF371; KEGG:
FT                   siy:YG5714_0040 protein of unknown function DUF371"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90347"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV1"
FT                   /inference="protein motif:PFAM:PF04027"
FT                   /protein_id="ACX90347.1"
FT                   /translation="MIAIDKVKIKGHHNVRAFHKTTLEITKDDYLTSRGDCIIGILANK
FT                   GARDLSEDLKKIARNDKSFIYGVIRVKEFLDVVHGRGSSKFTFENQNKIIFRKSTFIEG
FT                   STVMINSDKAARDINREIIDLLKTEIEGEIIILASDQPLEDKEILRIVVNLNPRSST"
FT   gene            complement(38156..38425)
FT                   /locus_tag="Ssol_0043"
FT   CDS_pept        complement(38156..38425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0043"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   sin:YN1551_0041 protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90348"
FT                   /db_xref="GOA:D0KMV2"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMV2"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ACX90348.1"
FT                   /translation="MYSQEIKDLIKKTRAERADIRIGKYGVTEGMINEIKRRLNEHKVV
FT                   KVKIGIKEIDDRKEFAKRVAEMVGAKLIEVRGYTFILAKIDSDR"
FT   gene            complement(38379..38699)
FT                   /locus_tag="Ssol_0044"
FT   CDS_pept        complement(38379..38699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0044"
FT                   /product="RNAse P, Rpr2/Rpp21 subunit"
FT                   /note="PFAM: RNAse P, Rpr2/Rpp21 subunit; KEGG:
FT                   sid:M164_0042 RNAse P, Rpr2/Rpp21 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90349"
FT                   /db_xref="GOA:D0KUA4"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUA4"
FT                   /inference="protein motif:PFAM:PF04032"
FT                   /protein_id="ACX90349.1"
FT                   /translation="MRRKNQIKKRIIELIELAYNTAKSGNLELAREYVKLAEMYSRKGK
FT                   VEIPLKYKRMFCRKCYTPLIIGVTERRRMRSKILIRTCLICNWQRRYVLSGNKRSDKEN
FT                   ES"
FT   gene            38721..39392
FT                   /locus_tag="Ssol_0045"
FT   CDS_pept        38721..39392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0045"
FT                   /product="Suppressor Mra1 family protein"
FT                   /note="PFAM: Suppressor Mra1 family protein; KEGG:
FT                   siy:YG5714_0043 suppressor Mra1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90350"
FT                   /db_xref="GOA:D0KUA5"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUA5"
FT                   /inference="protein motif:PFAM:PF03587"
FT                   /protein_id="ACX90350.1"
FT                   /translation="MLKYSMHLNIILLEASLELVPKEIVNHPAVIKNAKRRNKKPEDTL
FT                   LDISLHYHAMKYLENSHKRGRPDILHQALLVILTDPVIKGDIFIHTIQSKIIKVNPNMR
FT                   PPKNYLRFIGLMEQLLKYGKIPINGDETLMEVTNLTLDNIVNRYDLILLSEKGEKINPE
FT                   EICKLDEKWLLGIGAFPHGDFSDKILNLAKKIYSISGFPLETQQVLCRIFSACNSILGW
FT                   P"
FT   gene            complement(39373..39948)
FT                   /locus_tag="Ssol_0046"
FT   CDS_pept        complement(39373..39948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90351"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUA6"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0044"
FT                   /protein_id="ACX90351.1"
FT                   /translation="MPRVNIAAEADLIEQLENEAKKRGYTIYSLTNAALKALLKLLKEG
FT                   EDANTLESLVDYYTISKALDIVPVTSWFLENLTKLAYEKDNKQYENMCEEVGEQIGSFL
FT                   RSKASTLDELFDFYNAIKIALPIRNVSIKNTGDMIEFRITGTGFSLISTLCAGKIFSKI
FT                   AEEYDLSIQDVDVVPGGIVTIKAKANLK"
FT   gene            complement(40024..40170)
FT                   /locus_tag="Ssol_0047"
FT   CDS_pept        complement(40024..40170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90352"
FT                   /db_xref="GOA:D0KUA7"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUA7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0045"
FT                   /protein_id="ACX90352.1"
FT                   /translation="MSQKKNEIRSWTDLIRALFVNDNWYLGGFIVLLILFIIFDLIAFI
FT                   PHS"
FT   gene            40553..41437
FT                   /locus_tag="Ssol_0048"
FT   CDS_pept        40553..41437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0048"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   sin:YN1551_0046 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90353"
FT                   /db_xref="GOA:D0KUA8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUA8"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACX90353.1"
FT                   /translation="MISGKVLRRVSIIFLFSSISLIPIFLSELIAGILFKSYVLMADSY
FT                   HTLIDFLMSFIFYFTLIKINTRSKRFPWGLYNLESLVVLTASIFIVYLSTNLILSMFDN
FT                   AITLSISPWYSIILFVSSIYSLTLFLIERRYVEIQIVKNDMIHSLLDGVTEVVSGVTLI
FT                   LQNTVLMDTVTLLILAFTLSDVVREIKDSIVSILGASIDSPMKFQLINELRSKNIPIIN
FT                   LYLKKCGSFYAVYTYIGLPKDISLEKAYKIKRKTKRIIKKYDNIAYVDVILVPLTEIKK
FT                   KKILEQVNVLYSR"
FT   gene            complement(41405..42271)
FT                   /locus_tag="Ssol_0049"
FT   CDS_pept        complement(41405..42271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0049"
FT                   /product="protein of unknown function DUF191"
FT                   /note="PFAM: protein of unknown function DUF191; KEGG:
FT                   sid:M164_0047 protein of unknown function DUF191"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90354"
FT                   /db_xref="GOA:D0KUA9"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUA9"
FT                   /inference="protein motif:PFAM:PF02642"
FT                   /protein_id="ACX90354.1"
FT                   /translation="MVTIRVGALADSGDLYPFIPLMEGKVKPEGFNLEFEVIPTVQDIN
FT                   EAVLKKEVDVSVPSVAMYPYIQDDYYILSNAVATAVDGITGMPILAIKEMSEDEIKRSR
FT                   LIVHGPNTTAFTLYRLLIGKYGRLIIVRRVLDEIKALGKEGDVLVAVHEIKMMYALRKM
FT                   GISVVRIGSMWDMWKTISNNTPMPMGMVVISKEVGKDLALRFKETYEKSKKYAEKHLDE
FT                   IIPKDVQIMREAQKADLDEEIVRKTIWADIQEYNVPVDEIRRGLEFFFKITEEKGILPR
FT                   VKNIDLL"
FT   gene            42376..42906
FT                   /locus_tag="Ssol_0050"
FT   CDS_pept        42376..42906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0050"
FT                   /product="protein of unknown function DUF84"
FT                   /note="PFAM: protein of unknown function DUF84; KEGG:
FT                   sin:YN1551_0048 protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90355"
FT                   /db_xref="GOA:D0KUB0"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB0"
FT                   /inference="protein motif:PFAM:PF01931"
FT                   /protein_id="ACX90355.1"
FT                   /translation="MVTIALGSKNPVKISATKEALEILRLNWDLIATDIDSGVDKQPFC
FT                   DQTYVGARNRALNAIKATNADIGLGIEGGVCNVYGKFIANAVVYVITKEGVENFAISSS
FT                   FTLPSSIVSLILQGKELGEASDIIFKTINSKTKEGAVGLLTNNIIDRKTLYVQPIILAL
FT                   YPIYNTIINNTLF"
FT   gene            complement(42887..43540)
FT                   /locus_tag="Ssol_0051"
FT   CDS_pept        complement(42887..43540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90356"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB1"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0049"
FT                   /protein_id="ACX90356.1"
FT                   /translation="MNPLLLGIDGLSYTSFMKCNPRTLFTLFSSTYRGVVLNKKPQFPQ
FT                   TSWMSVLELKDIKDLSQVNLNSEVPRLLRETNAVAINLPITNPTYGKLSLPYDTSVNAE
FT                   EEINKVTQIVLESVKETPVVASITAIDRLLHKDATEKCKIYSLVDAAVRKILNNVDDFI
FT                   IFSIYGEPKSDNEDGNHEDYGVFLATIPRPSEHETVKLHEIGELFIKLVKKEYY"
FT   gene            complement(43553..43960)
FT                   /locus_tag="Ssol_0052"
FT   CDS_pept        complement(43553..43960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0052"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: sin:YN1551_0050 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90357"
FT                   /db_xref="GOA:D0KUB2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB2"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACX90357.1"
FT                   /translation="MNDELNDPELQKILSKKTTQILNNLKEKVKEPVKHLNSKNFDEFI
FT                   TKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPT
FT                   IMFFKNGELVDQILGAVPREEIEVRLKSLLE"
FT   gene            44017..44931
FT                   /locus_tag="Ssol_0053"
FT   CDS_pept        44017..44931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0053"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   siy:YG5714_0051 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90358"
FT                   /db_xref="GOA:D0KUB3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB3"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACX90358.1"
FT                   /translation="MTKLVIVGSGITGLITALKYGGDVIILEKNKIVAHNSKASLWSII
FT                   PPLCGNHREDCEKGIRFYEEICEKYGIYCKKTHVIRVSSKKLGGKIIDRKEIRSIEPQL
FT                   DIEEAELFDAGLFVEGDELFNTLGTEFNVESNSEVTDIIVRDNEIKSLITSKGEIKGEF
FT                   YIFATGYLTPKLFSKLGIEVNLFKGHLVITKKTSLNGILIVNDRIAVEGKNLYLNGDSK
FT                   PNSSSAVDYDEISKTINEIANVLKIDTNNLEIRVGFRSVSKDGEPIVKKIYSNGILITG
FT                   HRFGFALAPILAEKAIQMIKYGH"
FT   gene            44921..45637
FT                   /locus_tag="Ssol_0054"
FT   CDS_pept        44921..45637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0054"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="PFAM: Protein of unknown function DUF516; KEGG:
FT                   sin:YN1551_0052 protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90359"
FT                   /db_xref="GOA:D0KUB4"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB4"
FT                   /inference="protein motif:PFAM:PF04414"
FT                   /protein_id="ACX90359.1"
FT                   /translation="MDIKLVYSTLDPVGVTIKKLGYRFEEINEDVTDFHYENGEAIVIF
FT                   SRHESKAGIPSLTVHYPGNPSEEIMGGEPKKLGIAYPRLLTSILREIKKIDLNIEKTME
FT                   ATHHGPTYQNVPVIFVEVGSNETYWTNDTIVKALVDSTIRSIDKVDEIDCEYYISGFGG
FT                   PHYSRLFTKLADESCIGHVISKHYIDKLDDKVIIQTITNSVNTINKVVIDSLNSKQKER
FT                   IIASLKKLNNINIEFR"
FT   gene            complement(45608..46258)
FT                   /locus_tag="Ssol_0055"
FT   CDS_pept        complement(45608..46258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0055"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: sin:YN1551_0053
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90360"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB5"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACX90360.1"
FT                   /translation="MEKYNNYVMTIIIFIRHGQSTSNVSKILSHDTNTYPLTEEGINQA
FT                   KEAGKELTKLKVEKIYTSPVLRAYQTALIIGEVLGTLPIVDQRLRERFLGELNNTSFDP
FT                   NDHWKLKVFKKQIEIKGIESWEDITKRMKSFLESVINKDNRIITAVSHSDPIRAIITYL
FT                   LDMDDISGWGIRIPNASFTILRCDNNIDSCRIISIGSPLLTQQILSKLDINII"
FT   gene            46302..47279
FT                   /locus_tag="Ssol_0056"
FT   CDS_pept        46302..47279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:46419..46421,aa:Sec)
FT                   /locus_tag="Ssol_0056"
FT                   /product="metallophosphoesterase"
FT                   /note="Contains selenocysteine; PFAM:
FT                   metallophosphoesterase; KEGG: siy:YG5714_0054
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90361"
FT                   /db_xref="GOA:D0KUB6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB6"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX90361.1"
FT                   /translation="MVSLFKRNKHSLNSSTNLRLLFTSDLHASYTVFKKFINAUKIYKV
FT                   NALIIGGDIAGKVLLPIIDLGNNSYNVQEKIVTSSELNSLIERFKSEGTYYAILSKGEY
FT                   EEASQNKKAQDELFKKAIIETLHEWIKIAEERLKDYKIPIFINLGNDDPEYLFDVLKES
FT                   EIFKVGEGEVFDLNGYEIVSYGYVNPTPWNTFREKKEEDIYSDLSKIVSKINNYSKAIY
FT                   NFHAPPYNTNLDNAPLLDENLKPIIRGGEIVYTHVGSKSIRKIIEETKPLLGLHGHIHE
FT                   SRGFDKINNTIVINPGSEYSSGLLHAALVVLEGEFIKAHQFILG"
FT   gene            47423..47749
FT                   /locus_tag="Ssol_0057"
FT   CDS_pept        47423..47749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90362"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0055"
FT                   /protein_id="ACX90362.1"
FT                   /translation="MIIFYAIGERERAKELVRIITKTRWKTISKHAIKIASSSIGPSVV
FT                   IFKPTMAGLAVALWLKQRAEELGMTSAVGWFQPINQIPPQVEDAIRTDLNKILMKKLEI
FT                   PWSP"
FT   gene            complement(47751..49514)
FT                   /locus_tag="Ssol_0058"
FT   CDS_pept        complement(47751..49514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0058"
FT                   /product="BPS2 protein-like protein"
FT                   /note="KEGG: siy:YG5714_0056 BPS2 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90363"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB8"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0056"
FT                   /protein_id="ACX90363.1"
FT                   /translation="MKVRVFNIGGITQEYSLELEKGVTSYEAPNAYGKTSLVRSLISLL
FT                   TSSIKAEDLLNVFADSGYVEAELDNKLYYRRIKRIRNGLGEEKNLIMDDDRALLLTYFS
FT                   PENRLVTQILSGDGNVEWFISTTSKINEIKAKKEELQKLLTAEINARDELQKKYNNIRE
FT                   IQAKIRAIDEEIDKLEKERESSSNIVAKTTYTITLTRQNKINEILNKIKVKKDELANLE
FT                   FALKKIEEEIQNKESKVSPDIKTQLEKEMEEINEKLKLKTNDRSELEIELKVLERVLEE
FT                   VNESDRHHLDTCNVCGSKVDPSIWKERAEIISRELRDKTSLLDSLRNDIIGLQKRKEEI
FT                   DLRLKELQTLENEIAKLKAKKEELINRIGSVKFQIDDLERQRRETEERFSKSESLSGAI
FT                   ATNDDSASILKRIEELRKKREEYEYELQLLGIPSSILEELKEKEEHIEQLQKKVDELQV
FT                   EYIRRLTKAREEFNRIANQLLKRFEFDMDAEIDGNYRLIVKRKGAIIDIKKLSSSERTT
FT                   LALILVLSALRAYFKTPYFIIDESAMTFDQKRFNRLLEYLTEIADYVIVTRSSENTEIK
FT                   TLPPKQIELSS"
FT   gene            49662..50331
FT                   /pseudo
FT                   /locus_tag="Ssol_0059"
FT                   /product="hypothetical protein"
FT   gene            50539..50745
FT                   /pseudo
FT                   /locus_tag="Ssol_0060"
FT                   /product="hypothetical protein"
FT   gene            51146..52069
FT                   /locus_tag="Ssol_0061"
FT   CDS_pept        51146..52069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0061"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: siy:YG5714_0057 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90364"
FT                   /db_xref="GOA:D0KUB9"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUB9"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACX90364.1"
FT                   /translation="MRKVIVDSDTATDDTIAILLASRFFQLLGVTIVAGNVNYNQEVKN
FT                   ALFTLEYIGKQDVPVYLGSQRPILGNWRTVEEVHGSNGMSNWNYPEPNKRPEKEHAIDA
FT                   ILRLSKEHEGELEILAISPLTNIALAYLKDPSVVKRVKKIWIMGGAFSKGNTTPIAEFN
FT                   FWVDPEAAKIVLDAGFDITIVPWEVAEISGSLNERDWEYISKLNTKLSNFFINVNKTLK
FT                   EYTTKNQGISGSIHPDSLTVSIAHDNSIILDSSLKYVDVELCSKSRGAMLIDWYSLHKN
FT                   KPNAEIVLKADGGKFKNLLFNSLSQL"
FT   gene            complement(52043..52453)
FT                   /locus_tag="Ssol_0062"
FT   CDS_pept        complement(52043..52453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0062"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: sin:YN1551_0058
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90365"
FT                   /db_xref="GOA:D0KUC0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUC0"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACX90365.1"
FT                   /translation="MEVDLANLLRQRNLKVTPQRIAILKLIMRGGHYSGEQIYEELKKT
FT                   EPSISLSTVYNTLETLKESGILNSFEANGITWFEINRKPHVNVFCIDSNRIIDLDIEMD
FT                   NFMENLTKNGLDIKNVNIIVYADCSKLGKRVE"
FT   gene            52557..53021
FT                   /locus_tag="Ssol_0063"
FT   CDS_pept        52557..53021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90366"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUC1"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0059"
FT                   /protein_id="ACX90366.1"
FT                   /translation="MQNFRELSIDIVLSHKIRNYDQVVLDGTKKRDSCAFFIYGYCKKI
FT                   SPRSKVLASWISNGKIIPHPLFCYLCPFYSLRDDDKTVTVDLFDIYLTYKNLKTQIEKE
FT                   LEFIESRLSEFSFSTSIALRRRREDLIAFLDDISTKSKILLEIIRMSERT"
FT   gene            53018..53689
FT                   /locus_tag="Ssol_0064"
FT   CDS_pept        53018..53689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0064"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: sid:M164_0060
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90367"
FT                   /db_xref="GOA:D0KUC2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUC2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACX90367.1"
FT                   /translation="MRAEDLFNDPKSYKRWYELHSKLYENERNVVRSFNLKDCLDVGSG
FT                   PDIFHEEIGGRIVALDISLLMLKESKSDEKVLADALHLPFRDNSFKCVFSSVTVCFIED
FT                   VKGFIREMARITKERAIICFIARDSPWGEYYENLGKSGHKYYSHARFISRREFYVIIND
FT                   FMKISRIRSTLKKMSETEIDGVYNDDSGSFICVEAIPMKPEPLSLSLNRHSGADPADPI
FT                   S"
FT   gene            complement(54159..54253)
FT                   /pseudo
FT                   /locus_tag="Ssol_0065"
FT                   /product="hypothetical protein"
FT   gene            54372..55188
FT                   /pseudo
FT                   /locus_tag="Ssol_0066"
FT                   /product="hypothetical protein"
FT   gene            complement(55185..56204)
FT                   /locus_tag="Ssol_0067"
FT   CDS_pept        complement(55185..56204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0067"
FT                   /product="NurA domain protein"
FT                   /note="PFAM: NurA domain; KEGG: sid:M164_0062 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90368"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUC3"
FT                   /inference="protein motif:PFAM:PF09376"
FT                   /protein_id="ACX90368.1"
FT                   /translation="MIRKIYDKLVESHNEIKNQIYNIANYLKQEIQDKVNEYWNEYVIN
FT                   HEQSETCKFVAIDGGSFGRPMRIGIVYAVGAESVIGDNKGVKTLSEDGQIGIFKPGNDA
FT                   QERISLLMEALELSLALRDGSKGDYILMDGSLSKKIGNKVDIQQFSDEELKLIRNVDLN
FT                   GIISIKDERKMRDLLMLLNQFLVSKIIEEYDGNVLWISKVSRGRDLFGTDYPDITVLEL
FT                   FTEKRGFSKLIIKNIDIEKISEIPEIEVLRKMEYTTFYTRLDNGKRVIRVDIVGRVDEK
FT                   IVKEIMDRLSGVSIKGYPFPLLKAHMDVRFSAMDREKIIKLVGSKLHKDIEWWPSQFY"
FT   gene            complement(56201..58795)
FT                   /locus_tag="Ssol_0068"
FT   CDS_pept        complement(56201..58795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0068"
FT                   /product="Rad50 zinc hook domain protein"
FT                   /note="PFAM: Rad50 zinc hook domain protein; SMC domain
FT                   protein; KEGG: sim:M1627_0063 Rad50 zinc hook domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90369"
FT                   /db_xref="GOA:D0KUC4"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUC4"
FT                   /inference="protein motif:PFAM:PF04423"
FT                   /protein_id="ACX90369.1"
FT                   /translation="MRIDKITLTNFLSHEHSEIQFMGEINVIVGQNGAGKSSIIDGIVF
FT                   SLFRTHSRGNNDNLIRKGSNRGSVTLYLSNEKDKIEIIRDIRSTTEDRLIRNQFPIARS
FT                   ATVVSNEIEKILGIDKDIALSTIIVRQGELDKILENFQEIMGKILKLELIEKLIDSRGP
FT                   IVEFRKNLENKLRELDRIEQDYNNFKKTVEEKRARVLELKKDKEKLEDEIKNLEKRIKD
FT                   IKDQFDEYEKKRNQYLKLTTTLKIKEGELNELNRSIEELRKQTENMDQLEKEINELENL
FT                   RNIKLKFEKYEVLAKSHTEMSANVINLEKEIEEYEKAIRRKEELEPKYLKYKELERKLE
FT                   ELQPKYQQYLKLKSDLDSKLNLKERLEKDASELSNDIDKVNSLEQKVEETRKKQLNLRA
FT                   QLAKVESLISEKNEIINNISQVEGETCPVCGRPLDEEHKQKIIKEAKSYILQLELNKNE
FT                   LEEELKKITNELNKIEREYRRLSNNKASYDNVMRQLKKLNEEIENLHSEIESLKNIDEE
FT                   IKKINEEVKELKLYYEEFMRLSKYTKEELDKKRVKLDEMKKKKEEIEKEMRGLESELKG
FT                   LDRKALESKILDLENKRVKLDEMKKKKGILEDYIRQVKLLQEEVKNLREEVNIIQFDEN
FT                   RYNELKTSLDAYNLSLKEKENRKSRIEGELESLEKDIEEISNRIANYELQLKDREKIIN
FT                   AINKLEKIRSALGERKLQSYIIMTTKQLIENNLNDIISKFDLSIKNVEMEIMPKTGRGR
FT                   SSSGDILVYTNSGDTLPIVSLSGGERIALSIALRLAIAKALMSNTNFFILDEPTIHLDD
FT                   QRKAYLIEIIRAAKESVPQIIVVTHDEEVVQAADYVIRVEKRGNKSFVREET"
FT   gene            complement(58792..59937)
FT                   /locus_tag="Ssol_0069"
FT   CDS_pept        complement(58792..59937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0069"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: siy:YG5714_0064
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90370"
FT                   /db_xref="GOA:D0KUC5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUC5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX90370.1"
FT                   /translation="MVQILHISDTHLGKRQYSLVEREKDIYDIFSQLVDIAIKEHVDVI
FT                   IHSGDLFDVSSPTTNALVMAIKILKRLKDVNIPFLSIPGDHDTPKRKGYLIPHNILSEL
FT                   DLIKILNYEKPYIIKGIEVYGIPHIPTVSKSILVSALSALRPKSSRSILLLHQGVKQIL
FT                   PYDGSWQMELGSLPKGFGYYALGHIHTRWRLTQDDGSVIAIAGSPDIMREEEIEGYEKF
FT                   GKGAYLIDFSKDLPILSTINITVRPQKVVTINTKNIKKDILTIRDDLIEHNKSENNKPI
FT                   LHIIVEGERMRKDLLYKELLPLNDVALYYRIYKDETTQTVDNLSYTLPRDKGLDKIIIE
FT                   YLTKYEKFSEDEANLILQMIKNVESDEIVNEILKKLTGVNL"
FT   gene            complement(59940..61442)
FT                   /locus_tag="Ssol_0070"
FT   CDS_pept        complement(59940..61442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0070"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; HerA-ATP
FT                   synthase, barrel domain; KEGG: siy:YG5714_0065 protein of
FT                   unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90371"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ0"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ACX90371.1"
FT                   /translation="MIIGYVIGQATTQEALILAERPVRLGTYVVLEYDNVKALGLITNV
FT                   TRGSPMLDDNMNDIEIVQRLKQFNNSIPVYTKAKVKMLCDMNNHFLMPDIPPFAGTPAR
FT                   EAEDEELKSIYSQDGQIRIGSLIGKNVEVKLNINSFARHLAILAATGSGKSNTVAVLSQ
FT                   RISELGGSVLIFDYHGEYYDSDIKNLNRIEPKLNPLYMTPREFSTLLEIRENAIIQYRI
FT                   LRRAFIKVTNGIREKLKEGQIPFSTLNSQFYELMKDELETQGNSDKKSSAKDEVLNKFE
FT                   EFMDRYSNVIDLTSSDIIEKVKRGKVNVVSLTQLDEDSMDAVVSHYLRRILDSRKDFKR
FT                   SKNSGLKFPIIAVIEEAHVFLSKNENTLTKYWASRIAREGRKFGVGLTIVSQRPKGLDE
FT                   NILSQMTNKIILKIIEPTDKKYILESSDNLSEDLAEQLSSLDVGEAIIIGKIVKLPAVV
FT                   KIDMFEGKLLGSDPDMIGEWKKVEESEKIAKGFADFGTEIGD"
FT   gene            complement(61535..62083)
FT                   /locus_tag="Ssol_0071"
FT   CDS_pept        complement(61535..62083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90372"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ1"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0066"
FT                   /protein_id="ACX90372.1"
FT                   /translation="MALGKETEMGLKELFKANAEDFMSLMLVAEKLEQLGKKEEAKALR
FT                   EKALVELGHAKAIFETLLKNQELRGIVGEMAKEEQEQHVSEYNKVAMTAKQEGHEDIEK
FT                   MLCSFADQEAKIAETIAKVSKVLNEMAKEEQEQHVSEYNKVAMTAKQEGHEDIEKMLCA
FT                   FAEQEAKISETIKSVAKAL"
FT   gene            62341..63846
FT                   /locus_tag="Ssol_0072"
FT   CDS_pept        62341..63846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0072"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: YjeF-family domain protein; protein of unknown
FT                   function UPF0031; KEGG: sim:M1627_0067 carbohydrate kinase,
FT                   YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90373"
FT                   /db_xref="GOA:D0KUQ2"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ2"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ACX90373.1"
FT                   /translation="MISVKEMRALEINSSALGVSTLLLMENAGRSVKDEIVKRFNVKDK
FT                   VAYVYVGHGGKGGDGLVAARHLADEGAKVTVILLGENKHEDAILNLNVIEEMDYSITLV
FT                   EIKDMDELKPISADILIDAMLGTGFSGKPREPFRSAIKAFNNSKGFKVSIDVPSGINAD
FT                   TGEAYEDEYVKPDLVVTFHDIKPGLLKYNFNTVVTKIGIPVEAEIYVGPGDLIVNARSR
FT                   PYYSKKGDSGRVLVIGGSYTFSGAPTLAALGALRAGADLVYVASPEDTARIIAGYSPDL
FT                   ITIKLRGKNISPDNFEELKLWIDRADVVVIGPGMGLAEETIEASKLIVNYLKEKNKLAV
FT                   IDADALKAISGFDLYENAVITPHAGEFKIFFGEEPDKNIRDRISQVITYAKKCKCTVLL
FT                   KGYVDIISDGKRFKLNKTGNPGMTVGGSGDTLTGITATLMAQKIEPFIAAYLGVFINSL
FT                   AGTLAYNRLGAHLTPTDIINEIPNVINNPLDSFKRKLYKRVLS"
FT   gene            complement(63838..64287)
FT                   /locus_tag="Ssol_0073"
FT   CDS_pept        complement(63838..64287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0073"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: sid:M164_0068 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90374"
FT                   /db_xref="GOA:D0KUQ3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ3"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACX90374.1"
FT                   /translation="MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRE
FT                   LQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEKYGAKFPIVADDQKTISKLYSVLNE
FT                   RGTSAQRVTFIIDENGKIVNILKNLKKAEEHADKSLEIIKRQNST"
FT   gene            64368..65903
FT                   /locus_tag="Ssol_0074"
FT   CDS_pept        64368..65903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0074"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="KEGG: siy:YG5714_0069 phosphoenolpyruvate
FT                   carboxylase; TIGRFAM: phosphoenolpyruvate carboxylase;
FT                   PFAM: protein of unknown function DUF557"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90375"
FT                   /db_xref="GOA:D0KUQ4"
FT                   /db_xref="InterPro:IPR007566"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ4"
FT                   /inference="protein motif:TFAM:TIGR02751"
FT                   /protein_id="ACX90375.1"
FT                   /translation="MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGV
FT                   HEVMWDAEGKDVDTHVVRKLLSNYPDYFREHILGKDLFLTYRLPNPKVEGADRKVFAET
FT                   MESIPITYDLAEKFYGNGITIPVFEVILPMTTSSLEIISVARYYEKAVANEDELELYDG
FT                   VKVKDLVGEIYPKVIEVIPLVEDRDSLQNINNIVEGYYKVIKPKYMRVFLARSDPAMNY
FT                   GMITAVLSVKIALSELYKLSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYT
FT                   YTIQSAFKYDYDYDKVKSAISSINNSRISPARILEKYEEDVLRKITILYTERYQPIIES
FT                   LANAINDVSVLLPRRRARKLHIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGIS
FT                   SLSNLDEKEWDIFKQNYVNFKHDLQTAARFLNWESFKLIKDIWKISEDTIAKIKEDIDY
FT                   AESVIGIKLGGIDYDSRKHILMSSLFLLSFKEKILQESKKYLYEMALIRRSLG"
FT   gene            65900..66709
FT                   /locus_tag="Ssol_0075"
FT   CDS_pept        65900..66709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90376"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ5"
FT                   /inference="similar to AA sequence:KEGG:M164_0070"
FT                   /protein_id="ACX90376.1"
FT                   /translation="MRILVNGLLPLDSGKTTFSLSIIRLFNQVGIRLFPFKPIAGHNAW
FT                   YSFNTLIRSEELGILVGNDALKYYDETKYDIRRINPFAVLFVPIDLEKISYNVSLYNMI
FT                   MEYGFPYLIRLSDCINGTDQYFVNSSADIYVPKSMLKFTRNLALKFNAKLYDKMREIID
FT                   ASPQLVDNCTIDVFRNYENVIIESYNDSASPTYNSTNVDYVFTVSPTKAFLIKGQEFKK
FT                   ALSLFSIPPWNVRVSTLMKYLKIGKSFEIDVGERVAKDEILDILLKS"
FT   gene            complement(66706..67368)
FT                   /locus_tag="Ssol_0076"
FT   CDS_pept        complement(66706..67368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0076"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="PFAM: protein of unknown function DUF1641; KEGG:
FT                   sin:YN1551_0071 protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90377"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ6"
FT                   /inference="protein motif:PFAM:PF07849"
FT                   /protein_id="ACX90377.1"
FT                   /translation="MTNGEFYALDNLLKDEKLNSLNKILDVINTTDRLGILDVIKGILE
FT                   DENTIGKIIGSLTSDDVLELLVNWDKVIKTTKLFINEDNIYNIQFLINLIDKVRSKGIL
FT                   DPIIGLLEDEESLGKIINALINDFTLNLINHWEEIINDLSRIDLTNFKYYTLLVSATGE
FT                   ALKTENVKPITSIWEIYKLLKDPDIQRGLGVAASVLKRIGKLYVPDKGLAFEVEKKL"
FT   gene            complement(67375..68619)
FT                   /locus_tag="Ssol_0077"
FT   CDS_pept        complement(67375..68619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0077"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sin:YN1551_0072 FAD-dependent
FT                   pyridine nucleotide-disulphideoxido reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90378"
FT                   /db_xref="GOA:D0KUQ7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACX90378.1"
FT                   /translation="MRLRSMTKVLVLGARFGGLSAAYALKRLAGNKAEIKVINNTRFSY
FT                   FRPALPHVATGVINENDVMVDLTKALPEKRINFQQGTVEKIDASGGLVYYTKPDGDKAE
FT                   EDYDYLIIALGAHLGTELVKGWDKYGYSVCELDYALKLREKLKDFKGGTIAIGSGLFYQ
FT                   GKSPKPKVPENYVPVADAACEGPIFEMSLMLSGYFKKKGMLNKVKFVVFSPGEYLSDLS
FT                   TMSRKIVREMYKQMGIELVDNFRIKEIRENEIADEAGKTIKADLTILIPPYTGNPALKN
FT                   STPDLIDDGGFVPTDLNMVSINYDNVYAVGDANSLTVPKLGYLAVKTGNIAAQHLATRL
FT                   GVQVKVDQYYPTIICVADNPFEGFGIAVKDDTWYGGTTSIAAPSPINHIKKELFHKYFI
FT                   WTKGDMALEKFLASW"
FT   gene            68753..69346
FT                   /locus_tag="Ssol_0078"
FT   CDS_pept        68753..69346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0078"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   sin:YN1551_0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90379"
FT                   /db_xref="GOA:D0KUQ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACX90379.1"
FT                   /translation="MQQLIDKFINVKGRKIHYIESGDGSLVLLFHGARFNARTWVETNT
FT                   VDSISSIGYKAISVDLPGFGSSEKIEGISLSEFINLFMNSLGIDKAILLGASMGGKAVL
FT                   EFSLKYTESVSGLVLVGAVGVEEFEVQLSKLNKIPLLLIWGSRDTVSPKRNYKLILDKV
FT                   KNAKLEIVGKNHACYLDDPNTFNEKIVNFLKGMK"
FT   gene            69343..69984
FT                   /locus_tag="Ssol_0079"
FT   CDS_pept        69343..69984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0079"
FT                   /product="Protein of unknown function DUF2250"
FT                   /note="PFAM: Protein of unknown function DUF2250; KEGG:
FT                   sin:YN1551_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90380"
FT                   /db_xref="InterPro:IPR017139"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUQ9"
FT                   /inference="protein motif:PFAM:PF10007"
FT                   /protein_id="ACX90380.1"
FT                   /translation="MSDREELSAKLRIILRDIRYLTVLKHLKIANVDYGKSIMLNTKIP
FT                   LTEIVEILDDLEKLGLIERVHGATLKNTEAKFKLSSEVHKHHTYYRLTREGDHLLRHLD
FT                   DRMLIDVYMDIVKNDNLALNILRLADELNADHALTYAKLTHKRLEEITPKIEELVKMGL
FT                   LEEKNSKIIKFADRKAKPKKETRTHHKYYGLSRIGELVVREMKRRGILPK"
FT   gene            complement(69973..70920)
FT                   /locus_tag="Ssol_0080"
FT   CDS_pept        complement(69973..70920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0080"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="KEGG: sid:M164_0075 LAO/AO transport system ATPase;
FT                   TIGRFAM: LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90381"
FT                   /db_xref="GOA:D0KUR0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR0"
FT                   /inference="protein motif:TFAM:TIGR00750"
FT                   /protein_id="ACX90381.1"
FT                   /translation="MLNNNLSKLIEEALNGNELAIARLLTKIEYMTDEGISALGTLSKR
FT                   SGNAHVIGITGIPGSGKSTIIGGLIQEYVSRGHRVGVIVIDPSSPYTMGSFMGNRLRFQ
FT                   DKTMLKNVFVRSIGSRGYLGGISAEALMLTEALDGLGYDKIIIETVGAGQTDTEVEQSV
FT                   HTILVVSIPGAGDDIQALKAGIMEIGDIYVLNKADRQDAELAFNTLKFAIDSAEISYRN
FT                   GWKPLIVKTVAIKNEGIIELVNKIEDHLNYLKQKELFKKRIIDRRAKIVELIARRKIDE
FT                   IISEIVKKNYNTIINEDITEAIPKVIHNVKELLR"
FT   gene            complement(70910..71335)
FT                   /locus_tag="Ssol_0081"
FT   CDS_pept        complement(70910..71335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0081"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   sin:YN1551_0076 cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90382"
FT                   /db_xref="GOA:D0KUR1"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR1"
FT                   /inference="protein motif:PFAM:PF02310"
FT                   /protein_id="ACX90382.1"
FT                   /translation="MMITTKRIKVIVAKLGLDGHDRGAKVVARALKDAGMEVVYTGLRQ
FT                   TPEQIVRAALQEDADVIGISILSGAHLELIPKVVEIMKQNGLNDVGLIVGGVIPPEDIK
FT                   KLKEMGVDEVFLPGSSLKEIVEKVKKVAREKRGISVE"
FT   gene            71446..71733
FT                   /locus_tag="Ssol_0082"
FT   CDS_pept        71446..71733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90383"
FT                   /db_xref="GOA:D0KUR2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR2"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0077"
FT                   /protein_id="ACX90383.1"
FT                   /translation="MFKMWYLHISIAIIALILSSLVVLEFVRMRKEFRGKLTTVLVLLG
FT                   SFLIAQFGSFLLDFIMWSNDKNPLYIYPSLLTISLSFITILLFYYYVTKI"
FT   gene            complement(71720..72127)
FT                   /locus_tag="Ssol_0083"
FT   CDS_pept        complement(71720..72127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0083"
FT                   /product="regulatory protein, ArsR"
FT                   /note="KEGG: sid:M164_0078 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90384"
FT                   /db_xref="GOA:D0KUR3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR3"
FT                   /inference="similar to AA sequence:KEGG:M164_0078"
FT                   /protein_id="ACX90384.1"
FT                   /translation="MEEELTGTAKRIYLYLLRQRRPVGIRKIQKDLNLSSPSIVSYHIK
FT                   KLIEDGLVKEVDEGYIVTKVILEDYVRFRSALIPRSVFLTSFLASSLIILIYLIISHPF
FT                   SADIFSLIIIFIITMISVYDVGRKYKKLKSL"
FT   gene            72310..72870
FT                   /locus_tag="Ssol_0084"
FT   CDS_pept        72310..72870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90385"
FT                   /db_xref="GOA:D0KUR4"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR4"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0081"
FT                   /protein_id="ACX90385.1"
FT                   /translation="MNRYIYHVDIVVNVKQYLMVIAGVLVSLAIASLVVYISHMFIIYN
FT                   IKKPNIVERQSGYFPEMYELTVNITPAKASYANSYLIWSPLQSSLVVNKDPIFHVYPSI
FT                   IDLNSFNNSVIITLYYSVQDRVNIAITQQIFNVSVVNTTVINDEIVATQLKVTFYNASP
FT                   NTIYLIPIWNQYNVTYYVLVYYE"
FT   gene            complement(72955..73476)
FT                   /locus_tag="Ssol_0085"
FT   CDS_pept        complement(72955..73476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90386"
FT                   /db_xref="GOA:D0KUR5"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR5"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0082"
FT                   /protein_id="ACX90386.1"
FT                   /translation="MMRNKVIIYYIPISLMKNSEYYIWVLVGSIILTIILLSMAPLVPI
FT                   DEPLVYRASSGVTYNLTIPVGVSFSAFIALIIFIISILLISTFKNDYYNMIIDTSAISF
FT                   VFLNYLNYYLIWYVWRPQMQMLPFLIEIVYNHAATLQLDIGQIVIVIFLYRLYKRLRKP
FT                   RSLSGPDEKL"
FT   gene            73663..73968
FT                   /locus_tag="Ssol_0086"
FT   CDS_pept        73663..73968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90387"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR6"
FT                   /inference="similar to AA sequence:KEGG:M164_0081"
FT                   /protein_id="ACX90387.1"
FT                   /translation="MSTTKKFYELQDLILAKVSLEKVKLHIEERKDRTIFKWVRKELTG
FT                   FFRKFSNVEEFRELVNNINKGLEEENYEVVLENIKRSLDIISEEIEKFYQDLQKMQ"
FT   gene            complement(73951..74832)
FT                   /locus_tag="Ssol_0087"
FT   CDS_pept        complement(73951..74832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0087"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sid:M164_0082 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90388"
FT                   /db_xref="GOA:D0KUR7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR7"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACX90388.1"
FT                   /translation="MFQDPTFQITVTQLQYLLSIISGILVGFSLGLIGGGGSILAIPLQ
FT                   LYFVGLANGIPPGSPEYTYITHLTLGTTALAVGLNSYINSYMHFRRGNVRVPEGIIFTI
FT                   PGVIGDVIGAYLSHLMSGALILFLFGFLMIAVAIRMWRSKCNPNRSVLYNNSHKLSLRE
FT                   RIKVTKVIPAGFLVGFASGYFGIGGGFLVVPGLLFSTGLDMLRAVGTSLIAVGTFGVTA
FT                   AITYAVYGYVDIVISLLYLLGGVVGGYTGSTIASRMPRQTLRKLFAIIIIVVAIYTMYI
FT                   NRVGVVELLHFL"
FT   gene            75133..75387
FT                   /locus_tag="Ssol_0088"
FT   CDS_pept        75133..75387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sto:ST2005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90389"
FT                   /db_xref="GOA:D0KQ94"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ94"
FT                   /inference="similar to AA sequence:KEGG:ST2005"
FT                   /protein_id="ACX90389.1"
FT                   /translation="MHDGLSVYNAFDWFNVGHKRVTLGDYTEEGFRKLKYRVSSMDFAC
FT                   NSNKLMSWFSTFFLIYNLLYIQVYLVDKGVMINANISTT"
FT   gene            complement(75643..76041)
FT                   /locus_tag="Ssol_0089"
FT   CDS_pept        complement(75643..76041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0089"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; SMART: iron
FT                   dependent repressor; KEGG: siy:YG5714_0085 iron dependent
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90390"
FT                   /db_xref="GOA:D0KUR9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUR9"
FT                   /inference="protein motif:PFAM:PF01325"
FT                   /protein_id="ACX90390.1"
FT                   /translation="MSNLSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEEV
FT                   SHLEEKGLVKKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDY
FT                   LIPEEIIDKLYNYLGKPSYCPHGLEIPL"
FT   gene            76097..76966
FT                   /locus_tag="Ssol_0090"
FT   CDS_pept        76097..76966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0090"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   sin:YN1551_0084 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90391"
FT                   /db_xref="GOA:D0KUS0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS0"
FT                   /inference="protein motif:PRIAM:4.2.1.52"
FT                   /protein_id="ACX90391.1"
FT                   /translation="MKENISALVTPYDDKENINTEALQQLLDFLIKKGIKDFWVLGTSG
FT                   EFNMLSQDERILVVSKIREMVKGKIYVGVNENSTRNSLILAKKYYDLGVDYIFSVPPIY
FT                   HKPSEKGLISYFSELRNAIDLPLFIYNIPSFTGYNVPLHIIEKLAREYVLDGMKYSTTD
FT                   FVSFLKYLKALKGVNKNFKVFIGEDRMILSALILDTDGAVSGISNLVPELVTNLFLEFD
FT                   RGNIQRAIEIQRILNKLVDVVSLGDYPSGIKIGLRYRGINVGSVRKPLLEDSRAEGEIY
FT                   NVLKELGI"
FT   gene            77029..77679
FT                   /locus_tag="Ssol_0091"
FT   CDS_pept        77029..77679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0091"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   sin:YN1551_0085 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90392"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS1"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ACX90392.1"
FT                   /translation="MDNLDLIADEVRKCQKCKLWKFRKNAVPGEGNSKAEIMFIGEAPG
FT                   ENEDIEGKPFVGVAGKLLTRLINEILGLSREDVFITNLVKCRPPNNRDPEEDEILACSP
FT                   YLTRQIESIRPHIIITLGRHSTSYLFKKMNMKMESIGKVRGKFYTWNIYGYKILVFPTY
FT                   HPAAALYNPPIRKVLEEDFRKVKEALSSKPITLDNFLYGSGDKGEKGNSNSGK"
FT   gene            77630..78415
FT                   /locus_tag="Ssol_0092"
FT   CDS_pept        77630..78415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0092"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   siy:YG5714_0088 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90393"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX90393.1"
FT                   /translation="MDLGIKGKKVIVTAASKGIGLAIAKRFLEEGAKVIISSNDESNLM
FT                   KAYNKLKEIHSENVSYIKADLMNPHEVKSLVHEGYRKLGGLDVLAYVTGSPKPGNLFSL
FT                   SDKDWMDAFNLLLLSAVVAVREAGQLMQSGGRIILSTSTTLRQPIDNLDLSNVVRLSLA
FT                   GLIKVASRELGPKGILVNGVMPGWTKTERLLQIIRDRAIREGKSEDEVLKSIVADVPLG
FT                   RAGEPEEIANVVLFLASNLSTYVTGALIPVDGGSIKGVF"
FT   gene            78527..80014
FT                   /locus_tag="Ssol_0093"
FT   CDS_pept        78527..80014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90394"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS3"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0089"
FT                   /protein_id="ACX90394.1"
FT                   /translation="MRITEFYVSNFRSLSEVNLKDLGGFNIVVGYNGYGKTNLLSSIFL
FT                   FVKNLSAGIEKRSIEDRNQEFILLWQGYDVSKPIMIGGKVEFSPEESNKIVGKNQKITL
FT                   EIINKMRYNNKFVEWNLDTLYINGSPPGEDDLKVAKKLAEYASQAIEYVPIFDQTYFDE
FT                   TLKRMTEMNKSPINLRKYWYDFVNLVAATIPEVKGMEFWDGRRLVLNVYNLPIYIDLAA
FT                   SGFQRVILMLFIIWLSGNKILLIEEPEVNMHPTLQAKIMKLIKNWTDNNILQSFLTTHS
FT                   PYIVEMAADSYVVMRRVNGNSTAITVKPTPDLRGTISLLNASLSNILFSRIIILTSELA
FT                   EPSVIVNWLKRLNINVEDNGISIYKVSSDLELQHWLKLKNMLNLDVIFLGLCDKLDMSL
FT                   KDYCVPLSREVENFYSKQALLEVLRRLGIYPDEKEIRDLGKEENLRWIINVLRKRGIEY
FT                   EKLRMSIGELITDVDSIEIPKEIEILANKIKSLQATL"
FT   gene            80018..80266
FT                   /locus_tag="Ssol_0094"
FT   CDS_pept        80018..80266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0094"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="PFAM: Protein of unknown function DUF131; KEGG:
FT                   sid:M164_0088 protein of unknown function DUF131"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90395"
FT                   /db_xref="GOA:D0KUS4"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS4"
FT                   /inference="protein motif:PFAM:PF01998"
FT                   /protein_id="ACX90395.1"
FT                   /translation="MELNVLFDIGFLLIFIGIILLFVGMIREANKSSDNDQKAQVGGVI
FT                   FIGPIPIVFGSSKGIAKWMIIVAVILFVLIVIFYFLV"
FT   gene            complement(80288..81589)
FT                   /locus_tag="Ssol_0095"
FT   CDS_pept        complement(80288..81589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90396"
FT                   /db_xref="GOA:D0KUS5"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS5"
FT                   /inference="similar to AA sequence:KEGG:M164_0089"
FT                   /protein_id="ACX90396.1"
FT                   /translation="MIYGVLCMRSVTISILALIITWGILGSLIITQANTTIVNTTTIPT
FT                   SITYTVKLINSTTVANKTITHVYNYTLYYQVTKFVQNTVYVNISGNFTNGTLKLGNTVY
FT                   IKKGVYEVNLLYQPLSIYYPFIEPSIIFNTSYGIISPNETIALVYKGKTFNMINGVNYT
FT                   SYNYSGNVNGQQISVNILQNGIISKLENGSLELILESFSNLSTIPLTTVTNSQYMNFLN
FT                   RSYLYAVYNYSPLSNSLIPEGYLQISYPVVIGNNTITAQITQIQLRAGKQLALPASLLG
FT                   EPVNFVLYINQPQNIPTSFIVNVGAKNITWNSNVFTLVGESKVSTPIGTFIAYQYVHNI
FT                   SQNQAQQVLYFTPNGTLIKEEVVEIINSTTLPSFSLSFAGNTYISPFETYPNVFNYTNT
FT                   SLPYKVIAPNLSFTISIVITIIIVAILVVLHKRD"
FT   gene            81616..82041
FT                   /locus_tag="Ssol_0096"
FT   CDS_pept        81616..82041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0096"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sin:YN1551_0090 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90397"
FT                   /db_xref="GOA:D0KUS6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACX90397.1"
FT                   /translation="MDRPLVAVGCLIVEENKVLLVQRKNPPNAGLWAIPGGKVEYGETL
FT                   EEALKREMREETGLEVAVGNIISIVQVINEGFHYVILDFECKPIGGNLRASTDAVKVEY
FT                   VPFDKLNIIQTTKTTYDMLSMYFRGEKPPYFIIQISK"
FT   gene            complement(82022..83434)
FT                   /locus_tag="Ssol_0097"
FT   CDS_pept        complement(82022..83434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0097"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: sin:YN1551_0091 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90398"
FT                   /db_xref="GOA:D0KUS7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS7"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACX90398.1"
FT                   /translation="MDFRIRVYNSLGRKLEEFGTVEPNLVKMYVCGPTVYDYVHIGHGR
FT                   TFVVFDAISRYLRLRGYTVIRVQNITDIDDKIIKKSQEIGKDWNEIVDYFTKDYLDMLS
FT                   QLKVKIDIHPRVTQHIREIIDFVQRLIDKGHAYVAPSGSVYFDVDTYPNYGELSNTKKE
FT                   EWNQGEEFVKEKKHSYDFALWKAWKPGEPYWESPWGKGRPGWHIECSTMSTRYLGERFD
FT                   IHGGGADLIFPHHENERAQTEALIGEKWVTYWVHSAFVTIRKEKMSKSLGNIIPLNEAI
FT                   KKWGPSVLRYWYLTSHYRSPIDFSEEALEQAKSALQRIKDSMAIIRDVISEGPKFYVKD
FT                   DDIKVYREILNNLNNFHTAMSNDFDTSTALSYIHEIVRLVFSTLQYSRDFLGAMLAFET
FT                   LKQFNEVFGVMDEEFYPTYDKMYKIIDAVVDIRNQLRQMKLYEISDKIREELLKAGVRI
FT                   LDSKDKSTWRFE"
FT   gene            complement(83447..84337)
FT                   /locus_tag="Ssol_0098"
FT   CDS_pept        complement(83447..84337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0098"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="KEGG: siy:YG5714_0094 bifunctional
FT                   phosphoglucose/phosphomannose isomerase; TIGRFAM:
FT                   bifunctional phosphoglucose/phosphomannose isomerase; PFAM:
FT                   Bifunctional glucose-6-phosphate/mannose-6-phosphate
FT                   isomerase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90399"
FT                   /db_xref="GOA:D0KUS8"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS8"
FT                   /inference="protein motif:TFAM:TIGR02128"
FT                   /protein_id="ACX90399.1"
FT                   /translation="MDEIYLNWDKMFDEAFRIPIHEIKNDNIVFSGIGGSGIVGEIANI
FT                   LGVELSFKRKFTGKESLIAVSYSGTTSETINDVENAVKAGSEVIIITSGGILEKLAKEK
FT                   SLKLIKIPSGFQTRYAFPYLFTPLIKMTTKRRGIKINEMELKEGVIEAKEQIKADATRL
FT                   AELLINRIPVIYSSKYLAIAKRFKQEINENAKHPAFYGEIPEINHNEIESYVHGPSLVS
FT                   VIVESSEIDKITEDVLNSIVIKPYFNSDEKNISSLLALAGVTSLEMAKKLNEKPDKLYN
FT                   IPKARQLTSNLFKIN"
FT   gene            complement(84330..84767)
FT                   /locus_tag="Ssol_0099"
FT   CDS_pept        complement(84330..84767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90400"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUS9"
FT                   /inference="similar to AA sequence:KEGG:LS215_0093"
FT                   /protein_id="ACX90400.1"
FT                   /translation="MKAVERLDNTMVELNKINESELGINELDLLRFLKNQLSKSKSLFE
FT                   SFSKSIDEKRWDDVLSYTFQISQRVNSIFGYLVQPAVFSIISKSKLSENIENIIDSLAF
FT                   SISEMIIVLKQNNKSLGIDTITINMSSNPPSMSISVVIKGG"
FT   gene            84820..86145
FT                   /locus_tag="Ssol_0100"
FT   CDS_pept        84820..86145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0100"
FT                   /product="CoA-disulfide reductase"
FT                   /note="TIGRFAM: CoA-disulfide reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: siy:YG5714_0096
FT                   CoA-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90401"
FT                   /db_xref="GOA:D0KUT0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017758"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT0"
FT                   /inference="protein motif:TFAM:TIGR03385"
FT                   /protein_id="ACX90401.1"
FT                   /translation="MERLIIIGGGAAGMTAASWVRRLKPNMHVTVFESTKMVSHAPCGI
FT                   PYFTEGLFDDENLFMTYTPEYFIEKRKINVKTNSKVEEVDLRSRIVVVRENQEKRKYEF
FT                   DYLLFSTGARPKKINAEGDRIFYVHHPAEASYIRQKLWSFNRIAIIGGGILGIEMAEAL
FT                   RARGKKIVLIHRGRYLLNKMLDEDMGKIVTDKVESEIELKLNESLVSVIEEGRVVITDK
FT                   GKYDVDATVVAIGVEPNIDLVKDQLKIGQTGAIWADNHMRTSVENVYAAGDSTESINII
FT                   TKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVVGTMITKFEEFIIGKTGVTENEAKR
FT                   YNIKTVSAIVHHKTRARYYPGSKDIIVKLIAEADTMRIIGAQIVGEEEVLGRLNMMAAV
FT                   IQKGFTAEDLFFVETGYVPPVNRVWDVVTLAARKLFSGISGE"
FT   gene            86220..87341
FT                   /locus_tag="Ssol_0101"
FT   CDS_pept        86220..87341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0101"
FT                   /product="NurA domain protein"
FT                   /note="PFAM: NurA domain; KEGG: siy:YG5714_0097
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90402"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT1"
FT                   /inference="protein motif:PFAM:PF09376"
FT                   /protein_id="ACX90402.1"
FT                   /translation="MPKKLELQVLLKDIISKYIVNYLSSSSNISPNIENLVGEDDNRGI
FT                   LISPLNEFIRTVSFEKHSQSLIYSLDGSSRSFISSKGIVSLASVVVSSTISPILGVYPP
FT                   ISGFPELDLKKPFLALASSAHQSPLIPFFYSSEYVTTLSLDGSFFTSVNSPEEIETEIR
FT                   TILETEALKKIPNDGSIILDGPLIPPLIFLRSKPRDDILSLRLQAIKGRNVIGIVKRLD
FT                   KSRLLISSLYKLSSKFMEKFRVDPSRYFSDESFILDLLKANLSPPYSPISLGPILRNIG
FT                   NTPVYVNYLIYPLHPYVFKFAILRVESLNNDSGVVDQISSLKFTKDGIPFILAIADRTA
FT                   KEITNAILKIIMTSLESMGVQASFYSKLEQVRI"
FT   gene            87338..89167
FT                   /locus_tag="Ssol_0102"
FT   CDS_pept        87338..89167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0102"
FT                   /product="HerA-ATP synthase, barrel domain protein"
FT                   /note="PFAM: HerA-ATP synthase, barrel domain; protein of
FT                   unknown function DUF87; SMART: AAA ATPase; KEGG:
FT                   siy:YG5714_0098 protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90403"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT2"
FT                   /inference="protein motif:PFAM:PF09378"
FT                   /protein_id="ACX90403.1"
FT                   /translation="MSSDVPLYNDIKDRISRARALALTLGDLVGKVSRYIPNKLDEENN
FT                   VVNVTVDPNTYYKYPFLGKIGIFLGAIDIKTLYFVLLRVIGYERNDASSLFMGDSNVLN
FT                   NIGLSDDEPGSLITNVTLRCEMLTKVDFLSSSEPDGADIILEPQSPVIIPKAEVIERSL
FT                   GTTRGLLRLGFLDVAYSKVRVSTSLDDLNFHMLILGTTGAGKTSFIKDLIAGLNVTNEE
FT                   GSKIFILDATGDYYHIFLPPDKSDKVVMKGVEEFTQLYGAIVKGINVDIIYPISKSWVK
FT                   KYLDGAKSAGSITKMYFDMFVKPILNHLNNKGISIYASIINNKIIISNADWSSQVTVYP
FT                   FYFRFKDVKTILHKLNPYFTEQASHFIKIMIRKKGKDIANLDDLIDQFNENSLEGVEIH
FT                   KSTRENIVRGLYLLKETQLFDVGVERFPLGKILKDSSSSTLIFDLYNSELDDFSQKILT
FT                   YYFLDRLFEFRERQMRSGNVKGRNVIIIDEAHRFFPSSKGGEEDTNYIRRVAGKIATMM
FT                   RLGRRRKIGFVFATHNPNDLSDIIIQLANTKIIFRIKSEVAEALGLSKTEAKILNWERN
FT                   GVAYLLTPWLREGKIKIKAPVPPPLGHYDLSKT"
FT   gene            89192..89581
FT                   /locus_tag="Ssol_0103"
FT   CDS_pept        89192..89581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90404"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT3"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0099"
FT                   /protein_id="ACX90404.1"
FT                   /translation="MESNLGNVINTLKRKKDKEVVIEFLKTIRKYLPPSDDFSITLWKS
FT                   GIYEYILDRNGIAIMRIAEDEYLPYMTAYEKRMDYSQLPDNLVNNLDWKGILRQLRDIA
FT                   LEYAKRDKSFDKIADMVNNVILENL"
FT   gene            89559..90515
FT                   /locus_tag="Ssol_0104"
FT   CDS_pept        89559..90515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0104"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sin:YN1551_0098 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90405"
FT                   /db_xref="GOA:D0KUT4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT4"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACX90405.1"
FT                   /translation="MSYLKISDTIVETFRFIHYEQSNFLNRLHGGDMLFFLVETGMISA
FT                   SKVAMGTTLLASLDDVVFKKPVRLGDIVKVRAKTVYIGNTSLEVEVRAFVRDEEVVSAY
FT                   ATYVKVDDLLRPTPVNVKIMAESEDDKRKIDEAKKRRENRLSKIVNRQKMRFYVDDITD
FT                   GLRYRISNVIHVSPELTYDGRIMSAGKLLKLMDDLGGIICLRYLDHNSSNLYDNSFNAV
FT                   VTVAVKGLAFYSPIRLNDIILIRAGLVYVGNTSADILINVVREDLNGAKEHVATAYFTY
FT                   VRVDKDGKPIKIPEYTPVTEREKRLYEEALTRRGLRK"
FT   gene            complement(90476..91579)
FT                   /locus_tag="Ssol_0105"
FT   CDS_pept        complement(90476..91579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90406"
FT                   /db_xref="GOA:D0KUT5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT5"
FT                   /inference="similar to AA sequence:KEGG:M164_0099"
FT                   /protein_id="ACX90406.1"
FT                   /translation="MIRKYIGQYFIITSFTMIGLLFPVEFYSETKSLILLGVITGIYNA
FT                   LNALGSYIWGYLIDKTRLRKEYAVLLSLFGIIIGLTYHYNKLIAYELSGFVSALDGPIY
FT                   SAILLETTPQEKLVLGNTRLSQISLAGNVTGSLLSAFYHNDYLILIFFSISLAFNMIHI
FT                   PKYDGGINYDVADRNKILRILFIPIISYFWFNMAAEIFYTLYVPLNYLMLNPSYIIFIS
FT                   YTFLYIIEELIYSKGINIVKGKEEYFMLLVTFARSLIVMSIVYIILMGLKIYEGTMLLF
FT                   LVFGPLFPIYNISFFSLLIKGLKRNKATIIGIFNVSEDIANVVGGFLSGSTNNIVSSYQ
FT                   ISFYSFALSLFLLYFYLRRPRRVSASS"
FT   gene            91618..92398
FT                   /pseudo
FT                   /locus_tag="Ssol_0106"
FT                   /product="hypothetical protein"
FT   gene            92409..93152
FT                   /locus_tag="Ssol_0107"
FT   CDS_pept        92409..93152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0107"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: sim:M1627_0101 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III Xth; exodeoxyribonuclease
FT                   III; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90407"
FT                   /db_xref="GOA:D0KUT6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT6"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACX90407.1"
FT                   /translation="MKIVSWNINGLRSALKKNLVNFLESNTFDIVMFQETRGDIVPLDF
FT                   IMMGYEVISFPARRKGYSGVMTLTKIKPIKVIKGLQIKEFDDEGRTVSLELKDFYLINA
FT                   YFPRAGDNLERLDFKLKFNNGIENFLLKLREVKPVILCGDFNIAHQSIDAAFSDPKIPG
FT                   LTPQERAWFTHLLSLGFIDTFRYLHPNVRKYSWWSYMGNAREKNLGLRLDYCIVSEELK
FT                   DSIKMADILTDVQGSDHAPIILELT"
FT   gene            complement(93144..94808)
FT                   /locus_tag="Ssol_0108"
FT   CDS_pept        complement(93144..94808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0108"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related; KEGG:
FT                   sim:M1627_0102 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90408"
FT                   /db_xref="GOA:D0KUT7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACX90408.1"
FT                   /translation="MGRGIKDDKVRIALARNSVFVSTVIPFIGYVMYGIALGSLSSIGY
FT                   STLAGILYTFTLYSPFLLPPLLSLSAISYLLASIFLYKAFKCKTVRKYGIITVLLSISY
FT                   VVLYTYNFFIAELIQESIMIWILIGFYEIGNIVQLLAWRTGSRTIRIKIYGLPDNLKWN
FT                   INIDGKNYTFTSSQVKVKVRKKNPSFYVGNVLEGYNIYLPKPTYGIISSNLLEIYFTKS
FT                   SRLPDINNWDPKLWIGNKIGDYEVVDLIAIGGSSYILKVRKGNMFYAMKIPKINKSAPG
FT                   QTRISTNNIILDLSKEFINLQEVGSKTKNVVQLFAISEIDINNIIKIEKGESYLYLAKP
FT                   PYIVMELMEGGNALQLLNAKRSKNWYRIVGVLIRDVAKALDVIHSSGYVHLDVKPQNIY
FT                   FNRSPGNEEKEILSNLTSGKVTVKLGDLGSARKIGEDVREFTEFYCPIDQIEAAMLKNK
FT                   GALPSMDIFALGATAYKLLFDSYVYPKEYYEIVERAIEDFQMGRGSYLNYLKMARQYAV
FT                   LPKINTIPSWLNNLLYDMLLQRTNARAIYTTIEYNLC"
FT   gene            95039..96577
FT                   /locus_tag="Ssol_0109"
FT   CDS_pept        95039..96577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0109"
FT                   /product="amino acid transporter, putative"
FT                   /note="KEGG: siy:YG5714_0105 amino acid transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90409"
FT                   /db_xref="GOA:D0KUT8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT8"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0105"
FT                   /protein_id="ACX90409.1"
FT                   /translation="MERKQVFVRETSGLIKHVSLTDAVMLNIANMSIGIALFQSISPYI
FT                   TRGGVLWIASLIGLFLALPQALVYTIFNRKIGRTGGDYVWISRNLDGAIGTIFAVAYLL
FT                   ESTAFYAIISFFSASSVNSVLLTIGYLNHQNSLIYIAENVIVNPYATPTFQQRLIFYGI
FT                   SAFAFAIIVLINILHSKWGYKLVTGLGMFSMLTVILAMIVMAINAKRFDSLVLPLLKDF
FT                   NVTVSSNLPKTILPYSISIPATLFLLPLFALYTYPWMNAGPAVSSEYRGDRVSKLNVFL
FT                   SLLITGIFVTIGFLEMDLIAGYYFNLNAFPSAIYNFWTVAMALSLNPIIEWILGLGLIM
FT                   WNYYVLSYGVLVFSRYVFALSFDRVFPEKFSQLNANGSPVYAHVFDLTLTLLFLLIPVF
FT                   SIDAAVSLYGASIVGMLYFLAVGISAIIFGRKIRSGLMKIAGILMTVYFVYLTYEAARN
FT                   PLFGFSTTSGVNVTTLSFVLGSFIAGIVIWNITRYVNSKKGIDLSLTFKEIPPE"
FT   gene            complement(96548..97054)
FT                   /locus_tag="Ssol_0110"
FT   CDS_pept        complement(96548..97054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0110"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein; KEGG: sid:M164_0106 HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90410"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUT9"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ACX90410.1"
FT                   /translation="MEKFLDYDLVVYPLPKAINFLKALVSVKKIKKSNFIIRIVNLEPL
FT                   FQRANELLRASKFNFNSGFYEIAAIAAVESLYLLLNATLIRIGADIPWYLDFDGLFRVI
FT                   SRYSNDDRIAEIRIKERDIISLLDDIKIRLGYSIPLELNEKDTEKLIKFAERIFDLLWG
FT                   DLLKS"
FT   gene            complement(97199..97603)
FT                   /locus_tag="Ssol_0111"
FT   CDS_pept        complement(97199..97603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0111"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   siy:YG5714_0107 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90411"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU0"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACX90411.1"
FT                   /translation="MENIEYVFEDVVRIYDTDAQGIAHYAAYYRFFTNTIEKFIKEKVG
FT                   IPYPIVNENLWFVIAESHAIYHRPVKLGDKLTVLLNPKILSNKTIKFEFKVLKDGELTT
FT                   EGYVIQIAINPKIWKSTEMPKEIMDKLSIK"
FT   gene            complement(97663..98346)
FT                   /locus_tag="Ssol_0112"
FT   CDS_pept        complement(97663..98346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0112"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   sid:M164_0108 precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90412"
FT                   /db_xref="GOA:D0KUU1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU1"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ACX90412.1"
FT                   /translation="MRVSKITVYIVGVGPGDPEYLTLKGYKAIRDSVVVAGWKSVLERF
FT                   SPILEGKRTVVLTYKNESETLEEVIEIGKTENVAILDHGDPSVSDWQFVEKIKNIAASK
FT                   GVKVNIISGVSSLNIALSRLGLDINFIGFVTLHVRGDISKFLNDILNILRMGRVAIVIP
FT                   EPHKDGPQKVAKFLYDNNLNCRIVVFEKLSYDDEKRRVYDNLVSLMNEKNDFSDLTMMV
FT                   IFPKF"
FT   gene            complement(98333..99322)
FT                   /locus_tag="Ssol_0113"
FT   CDS_pept        complement(98333..99322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0113"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: sid:M164_0109 cobalamin (vitamin B12)
FT                   biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90413"
FT                   /db_xref="GOA:D0KUU2"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU2"
FT                   /inference="protein motif:PFAM:PF01890"
FT                   /protein_id="ACX90413.1"
FT                   /translation="MIENLWRGICIISASEDAFSAGETIKEKLKSFEIPVVHYRYKDAE
FT                   IETIWKCYDAIVFVMALEGATRIVCKYAKSKTEDPAIVCIDDKINYVIPLLGGHWGAND
FT                   IARELSVILNSTPIITTAAEIKGKLSIERIANILIAKIINPENIVKINAALLRDESICI
FT                   DGIDVNVNFPENIKVNSEECSYIISLRGDKEYKDKIVVWLKPLKISIGIGSKKDVKMEE
FT                   IRDGIYKVLERLNLKRERIGIIASIREEVKKIADEFNVRFRLVNEEEINNFMNPCLTPP
FT                   SKTLIEVGLKGVAEISALIAGGRNSKLILRKIAISRNSTIAVATYEGE"
FT   gene            complement(99325..100113)
FT                   /locus_tag="Ssol_0114"
FT   CDS_pept        complement(99325..100113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0114"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="KEGG: siy:YG5714_0110 precorrin-4
FT                   C11-methyltransferase; TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90414"
FT                   /db_xref="GOA:D0KUU3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU3"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ACX90414.1"
FT                   /translation="MIGKVVFIGSGPGDPELITIKAKKYIETADVIVYAGSLVNPEILK
FT                   WSRKDAEVYNSSSLTLNEIVEIMVKKASEGKLVARLKSGDSSIYGALFEEMWALEAAGI
FT                   PFEVIPGITAAIAAASVIPIELTVPKLSQTVIITRASLRVPMQGSIKDFAKMVKIGATM
FT                   VIYTGIHIIDRVVNDLKEGGLTDDTPVIVVYRATWPEQKIIKGTLADIVSKVREAKIYR
FT                   DSVIIVGLSADPQQIKNMVRSSVYDPKHNHSYRPWKVEED"
FT   gene            complement(100120..100788)
FT                   /locus_tag="Ssol_0115"
FT   CDS_pept        complement(100120..100788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0115"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: sid:M164_0111 precorrin-2
FT                   C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90415"
FT                   /db_xref="GOA:D0KUU4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU4"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ACX90415.1"
FT                   /translation="MKLYVVGLGPGDDELITLRGAKILKEVRTIFIPYSTGTNRSLAEN
FT                   IVKKYADNNSKLVLLGFPMAKDVSENELKKLGEKICSESEGDSAFVTLGDPTLYSTFFR
FT                   IKNKLPCSIDVEIVPGVSSITACASKAMISLANSEDSISIIPASRLDTIAKASEVFETI
FT                   IVLKANENIKEIADILSKKYDLIYARRCFMSDEKLVNMEREIINDKDYFSMIIALRKKR
FT                   "
FT   gene            complement(100785..101384)
FT                   /locus_tag="Ssol_0116"
FT   CDS_pept        complement(100785..101384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0116"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Methyltransferase
FT                   type 11; KEGG: sin:YN1551_0110 precorrin-6Y
FT                   C5,15-methyltransferase(decarboxylating), CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90416"
FT                   /db_xref="GOA:D0KUU5"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU5"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ACX90416.1"
FT                   /translation="MEWNYVIPGIPDNLFERDEEIPMTKEEIRALALSKLRIKKGDKVL
FT                   DIGCGTGSITVEASLLVGNSGRVYGIDKEEKAINLTRRNAEKFGVLNNIVLIKGEAPAI
FT                   LSTINEKFDRIFIGGGSEKIKEIISASWEIINKGGRIVIDAILLETVNNALSAMEKIGF
FT                   VNLEITEVIIAKGMKTKVGTAMMARNPIFIISGEKP"
FT   gene            complement(101385..102434)
FT                   /locus_tag="Ssol_0117"
FT   CDS_pept        complement(101385..102434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0117"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   sin:YN1551_0111 cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90417"
FT                   /db_xref="GOA:D0KUU6"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU6"
FT                   /inference="protein motif:TFAM:TIGR00312"
FT                   /protein_id="ACX90417.1"
FT                   /translation="MIINSLKRFGITTGAAASAAAKAAVIGLLNKEKRSTVVIPTPIGL
FT                   RLEIPVEKVEIDSEISCAEVKKFSGDNPDILDGLVIRCCAKLNENNEIVIIGERGVGKV
FT                   TRSGLKATMGEMAISPTVREMIINAIREVTDKGIQITIEVPNGETIAEKTLNKMVGIVG
FT                   GISILGTTGIETPVSDDDYLEHIRCELNVIRQSYDYVVIAPGNSAAKYAAELFDSNCII
FT                   KVGDRIGDSIKLASNLFKKVILAGLPAKLLKVYAGIFNTHYSQGDARLESLTHASVLAG
FT                   LPYGTLTKISNALSVEEAFTYMTKEQRRKVMNIVAEKILSRIKSFNDNINFCVIIFDYD
FT                   GESLSRVGC"
FT   gene            complement(102431..103183)
FT                   /locus_tag="Ssol_0118"
FT   CDS_pept        complement(102431..103183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0118"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: sin:YN1551_0112 precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90418"
FT                   /db_xref="GOA:D0KUU7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU7"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ACX90418.1"
FT                   /translation="MKMGRLYIVGIGPGSKEQRTIKAQEVLEKSNVIIGYNTYLRLISD
FT                   VLDGKKEVIGARMKEEIFRANTAIEKALESNNTVALVSSGDPQVYGMAGLVYDLIARRN
FT                   LDLDVEVVPGVTAALAAAARLGSPLSLDFVVISLSDLLIPREEILHKVTKAAEADFVIV
FT                   FYNLINENLLIEVMDIISKHRKPNTPVGLVKSAYRNNENIIITTLSSWKEYMNEISMST
FT                   TMIIGNSLTYRYKNYMITPRGYERKYEL"
FT   gene            complement(103180..104178)
FT                   /locus_tag="Ssol_0119"
FT   CDS_pept        complement(103180..104178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0119"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; cobalamin
FT                   (vitamin B12) biosynthesis CbiX protein; KEGG:
FT                   sin:YN1551_0113 precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90419"
FT                   /db_xref="GOA:D0KUU8"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU8"
FT                   /inference="protein motif:PFAM:PF02570"
FT                   /protein_id="ACX90419.1"
FT                   /translation="MDRQSNTAVILIGHGSRRETYNSDIENMINYLKEKISSPIYLTYN
FT                   EFAKPDWRSLLNNVVREGYRRIVIGLVFLGRGNHVFRDIMGELGIQRLNSWVVSKISGK
FT                   EVELYVTEPLSSSPLIGLALYYRLARALNALPTLEYTEDPYEIEESSMNLILSNLDVKD
FT                   EREKRIIGKAIFASGNPELARYLKLTNLDAGIEAIKAGSEIVADVKMVSVGIRWRKVTC
FT                   MIDNERTKELSKELGITRAAAAMRLSIGQGGKVVVIGNAPTALMETIKLVKEGIDIPFI
FT                   VATPPGFTNAKESKEALIETKIPSVVLTGTYGGSGIAVAIINEIIKMAMEG"
FT   gene            complement(104412..104507)
FT                   /locus_tag="Ssol_0120"
FT   CDS_pept        complement(104412..104507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90420"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90420.1"
FT                   /translation="MEFRKMKGFTVTSVKTSAEDLILNIVKFYEA"
FT   gene            complement(104781..104945)
FT                   /locus_tag="Ssol_0121"
FT   CDS_pept        complement(104781..104945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90421"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV0"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2944"
FT                   /protein_id="ACX90421.1"
FT                   /translation="MFCYKLILVDDKYFMYVYDGDKIIGLIPLDKNQSTSMSKVKEYEE
FT                   RFGWKQCTN"
FT   gene            complement(104966..106000)
FT                   /locus_tag="Ssol_0122"
FT   CDS_pept        complement(104966..106000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0122"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: siy:YG5714_0117 radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90422"
FT                   /db_xref="GOA:D0KUV1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022563"
FT                   /db_xref="InterPro:IPR023863"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACX90422.1"
FT                   /translation="MSTLKPMIFGNVKRALLGLGVRKLPLIAGHKLLYTCNLRCRMCPF
FT                   WRRKDEKLLSLEEEVLMLKSLEKAGVLFMGFEGGEPLLRRDLEDILEESYKRFYTSLVT
FT                   NGWLLKDRAKSISNYLDYLFVSIDGIGEVHDKIRGISGAFERAVEGIKEARKYLPVAIS
FT                   FTITKENMDQVKDVIELARKLNVNISIQVEYDYSTAEKLSPDKRRLYDALRLIIELKKR
FT                   GYQIIESSDYFEAIIKSWYNGIPWRCKPWLTINIDPQGRIVLPCYVLNEYSGTDKVWEV
FT                   DIVKLWNSYPWEKYESCNACALACYLEPSLFSWSNGKMVKEKIIDNMASYVYNASPIKF
FT                   LLSR"
FT   gene            106214..107032
FT                   /locus_tag="Ssol_0123"
FT   CDS_pept        106214..107032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0123"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   siy:YG5714_0118 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90423"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV2"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX90423.1"
FT                   /translation="MPTVKLTKNITIMTGSPNTLIYDNRVVIDLGGKNSSVDINAEVQL
FT                   ATHGHADHIAGLLKKDAKIRYLPKEDYWSLTLMGRRAMIYGCSSKDSDIFTFDYVKENI
FT                   ESIDIEVRTSEIEVIKLPGHTPGHSGYIVDNVLYAGDAFFGEKVLEGFSVPFYTDFWTA
FT                   LESLNKVKELAKSVNNIVISHGPVYTNKNKMVSILESNIIYAQNLIGKILDMLSNNELT
FT                   VEEIVVKLKQDLTPSNVLLNSVVVRSILFGLENIEYNVSQKGLVFRRRVH"
FT   gene            complement(107386..107962)
FT                   /pseudo
FT                   /locus_tag="Ssol_0124"
FT                   /product="hypothetical protein"
FT   gene            108164..109114
FT                   /locus_tag="Ssol_0125"
FT   CDS_pept        108164..109114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0125"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sto:ST1908 insertion element DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90424"
FT                   /db_xref="GOA:D0KUV3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV3"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACX90424.1"
FT                   /translation="MEAPVAGIDVSKDKLVVYFQGKYYEFQNNKQGFEGVKQVLPKGCK
FT                   VAIESTGVYHINLAKYLGKEYDVRIINPLVLKKFKNIRGKKSDKNDAKKLAELVISMGS
FT                   EFTTSEAKELTSQWDFITRSIVRVKNRLRRDLILLGYKDSLSKKNLNEVLRGEDNIVLS
FT                   EVRFLLDELERLEVRKREIEEELEDLVPKDSLIFTIPGIGRTLGCIILARVGDVKRFGD
FT                   KKRFVAYCGLDPLVESSGKSVVSRGISRRGDAVLRRAFYLAALTAIKVNPIIKRFYEEH
FT                   KENLKGKKLITACARKLAVITWAVLYYNKPFDASE"
FT   gene            complement(109175..109513)
FT                   /locus_tag="Ssol_0126"
FT   CDS_pept        complement(109175..109513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sis:LS215_0403 transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90425"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90425.1"
FT                   /translation="MNKKLTQKDFDNFKESIEDLIKLYKESRLSKIENNKESEEERLAR
FT                   LRRFGRELRQDLEEAKFVKIKKEQGRKSKLTPQEKAYILIIKEYLGLSNRETAELASLL
FT                   NLTKELPV"
FT   gene            complement(109936..111357)
FT                   /locus_tag="Ssol_0127"
FT   CDS_pept        complement(109936..111357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0127"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   siy:YG5714_0119 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90426"
FT                   /db_xref="GOA:D0KUV5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV5"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACX90426.1"
FT                   /translation="MLRIFSAKNEVDSKYIFMLAFMLALFSSGVPPEIVILHLSREDSF
FT                   EPYTKVFKKIRNLVSGYRYKFSSAITYSIKNLNIRFLKEFLIRLSQAVTFGDDMIEFLS
FT                   REIDFTLSEYNAYSARLIESMNNFLTIYATLNSSLTFLVADITILSLIYSGGTTLIIQL
FT                   TILSLALLGNLTLVMYLLYRPENYIRYNVIDKFVLTFTISLSIIFSVIYTSYIVLMGTG
FT                   IVLLGIGLRYRLYENKINRIERHFLLFIRYFSRNYAIVSNLKESLMAVLRGDLGDVRPL
FT                   IRRSLNRLNFGIDKEKIFRLIGDESGSILVSMLSKVLYETISMGGNAMIIGEILSKIGD
FT                   SVLNIRSRKEQNGRAFETSIYALQTASAGVSAALISIVGMLNNIFSTQNVSTVFSFSEV
FT                   NIDIISRIFLIILLILSFANGIAITLAYGKSLYVSLYFIGILIILSSISYHIVLILTGN
FT                   IFKELASPSGLLQTT"
FT   gene            complement(111341..112882)
FT                   /locus_tag="Ssol_0128"
FT   CDS_pept        complement(111341..112882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0128"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sid:M164_0119 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90427"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV6"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACX90427.1"
FT                   /translation="MSFIEDYLSRFPEKPVMIDDPNKLKGSKNYNAIYKVDKYIYIHVQ
FT                   STKAEDGYNQYTVIEPPRPKPKEIEEIEEKFAKTIGNTEPPPTVEEKEILMRRVLDKIL
FT                   TKIRISVPKEYAIYHFVRDKLYSGILEPLIRDPFIEDISIPGLGHIYIVHKVFGPMRTS
FT                   LLIENEEELDNLIISLSEKTYRPVSHNRPIIDASLPDGSRVNFVYGIDISRRGSNLTVR
FT                   KISKIPISVTQLISFGTLSPLLAAYIWMMLDEGMNLFVCGETASGKTTTLNAITAFIPP
FT                   NLKIVTIEDTPELTVPHSNWVAEVTRETGGEGSVKLFDLLKAALRQRPNYILVGEIRDK
FT                   EGNVAFQAMQTGHSVMATFHAANIRTLVQRLTGYPIEVPKSYINNLNIALFQTALYDKK
FT                   GNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDPTEDKIIFAGRGSSYLIENKVAIRRGI
FT                   ERRNIGILYDELNLRAEFLKILLSKKIFNYFEVWNQILRARQFGIEEEIRYAKNI"
FT   gene            complement(112885..113589)
FT                   /locus_tag="Ssol_0129"
FT   CDS_pept        complement(112885..113589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0129"
FT                   /product="flagellar accessory protein FlaH"
FT                   /note="KEGG: sin:YN1551_2939 flagellar accessory protein
FT                   FlaH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90428"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2939"
FT                   /protein_id="ACX90428.1"
FT                   /translation="MEGYTVIIKTGNEDLDRRLSGLPFPALIMIEGDHGTGKSVLSAQF
FT                   CYGLLIGGKKGYIITTEQTSKDYLKKMKDVKIDLIPFFLKGVLGIAPLNTNKFNWNSRL
FT                   ANKILEIIIDFIKRRKNMDFIIIDSLSIVATFAEIKQILQFMKDARVLVDLGKLILFTV
FT                   HPDVFNEELKSRITSIVDVYFKLSATSIGGRRIKVLERIKTIGGIQGADAISFDIDPAL
FT                   GIKVVPLSLSRA"
FT   gene            complement(113571..114059)
FT                   /locus_tag="Ssol_0130"
FT   CDS_pept        complement(113571..114059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90429"
FT                   /db_xref="GOA:D0KUV8"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV8"
FT                   /inference="similar to AA sequence:KEGG:M1627_0120"
FT                   /protein_id="ACX90429.1"
FT                   /translation="MGVSQVVAYVLIFFITISLGLIALEAYIKSQQLLLHAENLRQNME
FT                   LNQLNTRIFIKSIAINGNLLYITITNNGSTALFDFRDFAIIIKYYANISNISTLIISNY
FT                   NYSTNLGPYKWVSNTVLINPNMVGTFIADLPYPPYPNTMATVVVASNYGPEAIWRGIL"
FT   gene            complement(114062..114526)
FT                   /locus_tag="Ssol_0131"
FT   CDS_pept        complement(114062..114526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0131"
FT                   /product="flagellin"
FT                   /note="PFAM: flagellin; KEGG: sin:YN1551_2937 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90430"
FT                   /db_xref="GOA:D0KUV9"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUV9"
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /protein_id="ACX90430.1"
FT                   /translation="MASEVISETIMLIVAVTLVGVLAGSVFSVVSSISTNMVSYSMLQS
FT                   QRLVTDLQIDYVTNSSSTTVIVYLHNIGESIIFNLKNSVLYFGPQGNLQQIGYNSSTLP
FT                   YWVVNTNTLYPGSVAKIIIYLSSPLSTTQYYTVQLVTPNGYSVSYTFEAS"
FT   gene            complement(114519..115277)
FT                   /locus_tag="Ssol_0132"
FT   CDS_pept        complement(114519..115277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90431"
FT                   /db_xref="GOA:D0KUW0"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW0"
FT                   /inference="similar to AA sequence:KEGG:LS215_0121"
FT                   /protein_id="ACX90431.1"
FT                   /translation="MININLPELQQLVESPLFILLISISIPLAAFFISFFKIVLPRITR
FT                   PKNIQTTQTASTTQNQQQQGVTSNSTKEIEELLKNLIGRMDKYQNDLVNVLNTSIEDLK
FT                   QTLQKLNSSIEDAVLSLKSAQADSSSPFNIISEQSKGEQRPEGSKELKAVAEIVGTSNI
FT                   DLSVFIRNCVLLEILDYEDSKLTALYELGYISADDMFIVNKIQSYIRTNNGKIRAKDLA
FT                   NIAMSVAESYSSVTAEMKKYLLVLEVGKNG"
FT   gene            complement(115352..116284)
FT                   /locus_tag="Ssol_0133"
FT   CDS_pept        complement(115352..116284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0133"
FT                   /product="flagellin"
FT                   /note="PFAM: flagellin; KEGG: siy:YG5714_0125 flagellin,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90432"
FT                   /db_xref="GOA:D0KUW1"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW1"
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /protein_id="ACX90432.1"
FT                   /translation="MNSKKMLKMLKEYNKKVKRKGLAGLDTAIILIAFIITASVLAYVA
FT                   INMGLFVTQKAKSTINKGEETASTALTLSGSVLYAVNYPLNTRSYWIYFTVSPSSGVSS
FT                   VELSPTTTAISFTASAEGVTYSNIYKYTLLTVSPSELANVVYANGQYLDLVNQQTSAGQ
FT                   TYVYYPNPYYALLALNYTLYNYYLSTKTPSPIFINSSILSLSSLPSWLKNDNSFTFTLN
FT                   ISGKLVTYYVFVNQTFAFTYPVAGDPLIGSAIAPAGSVIGVILLFGPDLGSHVFQYQTI
FT                   TIQITPNIGSPLTISEYIYQPEGSVSVIG"
FT   gene            116407..116892
FT                   /locus_tag="Ssol_0134"
FT   CDS_pept        116407..116892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90433"
FT                   /db_xref="GOA:D0KUW2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW2"
FT                   /inference="similar to AA sequence:KEGG:M164_0125"
FT                   /protein_id="ACX90433.1"
FT                   /translation="MAPIFLEYKVVHDNITYYIIYVFIYNLSLKLVTMYTINPSSHTIL
FT                   NYNVSLEPEQIFSNITGVSTYYSLDGKKILAYEDNNGSIIVAYNGLILKKASNNSVRYL
FT                   IAANYPGIDNSKFPSLYKLAEISIFDSNIRVLVLGVLLTILSSFILKVMVGRYDKVR"
FT   gene            116876..118345
FT                   /locus_tag="Ssol_0135"
FT   CDS_pept        116876..118345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90434"
FT                   /db_xref="GOA:D0KUW3"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW3"
FT                   /inference="similar to AA sequence:KEGG:M164_0126"
FT                   /protein_id="ACX90434.1"
FT                   /translation="MIRLDKRNFIPWISIVLLLCAYSIGTGLYITIQRVTYYPIFESKI
FT                   VSVFLTIFSSSLITFYNYKKYVFLLPLSLLSFFSVSLTPLIISIFILYELKKVDRTVSI
FT                   ILLIINASMISWLILRLLLGINTYFSIPLMILEAGAPTVIPFIWFVGIILSAYKRNLSS
FT                   KSQLFINPLIPFIVVLLISLIPYLPFINPYKFPETVDFKYYYSWLLAPTFSGWFFDSRP
FT                   VYLMLLYALSLIFKPYTVAYYEFIFLSLLYTYSAYKLASAIDKSIASLSALLASVSPML
FT                   MTFLYSGLEANLFSISLMFISMSYLFKKEKLSLAILFSLLSMFSHIYAWAQLSTGITLY
FT                   YLLKSIIHRSRPDNYTLTYLSFSIPFIAIGLFLILSGVFPLPMELLNYTQLIYQIAVVS
FT                   WGSNNALLYFLLSSFGNRYVKEGVLNFVYSISVFGIIFVSSATNLIIDLPLFIPAAYTI
FT                   RNVNRRSTSILLVLSLILWGIYMSINSVPML"
FT   gene            118718..119119
FT                   /locus_tag="Ssol_0136"
FT   CDS_pept        118718..119119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90435"
FT                   /db_xref="GOA:D0KUW4"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW4"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0128"
FT                   /protein_id="ACX90435.1"
FT                   /translation="MIREIYKLLLVGVISFLIIVTVISRLYIVLVPIVLFSIYLINESR
FT                   IPEIKDLKSFHKYVEKVYGRDFAAIIKKRYNIIQGDLTLAYFPSSIEDNTVVIANTHLI
FT                   LKINSRVFVLSKYEGVDYLVDIIKGNVAS"
FT   gene            119153..119230
FT                   /pseudo
FT                   /locus_tag="Ssol_0137"
FT                   /product="hypothetical protein"
FT   gene            complement(119384..120349)
FT                   /locus_tag="Ssol_0138"
FT   CDS_pept        complement(119384..120349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0138"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90436"
FT                   /db_xref="GOA:D0KUW5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90436.1"
FT                   /translation="MQTIQVSKTELKSLAITLATNNINVISQDLDPEIVKAAPSLLTGN
FT                   RGKYYLKVVRRGEKVISKGQRTFKFYPIYREVKGEINVVAVDETGLTVGEKEQEKAEGF
FT                   LLYNWKRKGVKMRSLDLVYPLRLPLLVEIADLRSDSPSQFLLRSVMEVNQYMEIDYVVA
FT                   DAGFLNLGVIKEMPVKTIVRGKSNLKGFKELSNVPLVEKRYEVKDKVYVAYRVLKFEGL
FT                   YYYDVVYVKGKPRHFMFVTNFEGDPYELAELYRLRWQVEEGFKVRKARIRYVRKLSNKI
FT                   FLFLYYTVLDSAWNLVNHLLFNFKSTCKKVLSFDSFVKLL"
FT   gene            complement(120442..120630)
FT                   /locus_tag="Ssol_0139"
FT   CDS_pept        complement(120442..120630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90437"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90437.1"
FT                   /translation="MIYLNIDYNQWCFTNFTQNDTISMEEKNIRAELEKSAYFNTRSKK
FT                   FSYLLKKLTENEFIYKE"
FT   gene            120650..121462
FT                   /locus_tag="Ssol_0140"
FT   CDS_pept        120650..121462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90438"
FT                   /db_xref="GOA:D0KUW7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW7"
FT                   /inference="similar to AA sequence:KEGG:M164_0128"
FT                   /protein_id="ACX90438.1"
FT                   /translation="MSYNVFDVLRELDSIVDFARAKLQWDILFFINSRGPSSISEIAEG
FT                   TNNSKKAVIDAIRKLVEKELIIKVKYDVYDLSEKGKQVLNKLNYFTSHTVSTQKGVDGD
FT                   NNVLSNNADNPSQNYYLLELIKMSLLNNGTLPIDKVSRELGISKQTVKYYLELFMRKKI
FT                   FKKVNKKSLLGKSVQTVVLTSEGRKIAYKVPSLIKIRNNLFLRLLLKITFSISYESALM
FT                   KLMVFFALSSPIIIYYDGDPPVRILGIVWLYMLVFTSLLSIFAYLTMR"
FT   gene            121476..121964
FT                   /locus_tag="Ssol_0141"
FT   CDS_pept        121476..121964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90439"
FT                   /db_xref="GOA:D0KUW8"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW8"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0130"
FT                   /protein_id="ACX90439.1"
FT                   /translation="MELINVSLLYLVTGNYTHYLMLITILNVSKNFAIINMTEISHNIT
FT                   LSYVVAYPIFLLYIPNVTQQSIVTQFEGISTTIVNILNFTIYVDVYNSIVVHYIGNGIN
FT                   VTLIGATIPLGPGVYKPIPSYILGHQRTGSTVEEYEIFLLTIVLVVSFYVIFERMNKK"
FT   gene            121961..122143
FT                   /locus_tag="Ssol_0142"
FT   CDS_pept        121961..122143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90440"
FT                   /db_xref="GOA:D0KUW9"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUW9"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0131"
FT                   /protein_id="ACX90440.1"
FT                   /translation="MKIYNLGRALVLTGIIELILASLFYSDKKVILSVLLGDYSYFCLL
FT                   IGVIVIAVYGAITKN"
FT   gene            122777..122995
FT                   /locus_tag="Ssol_0143"
FT   CDS_pept        122777..122995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0143"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: siy:YG5714_0132 putative transcriptional
FT                   regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90441"
FT                   /db_xref="GOA:D0KUX0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX0"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACX90441.1"
FT                   /translation="MEKIVKVNDTTYILENERSVVITFKLEENNLSTVDEIVKKLGYEH
FT                   RSDFIRDAIEKYISYLKSSSNNSKKDY"
FT   gene            123181..124084
FT                   /pseudo
FT                   /locus_tag="Ssol_0144"
FT                   /product="hypothetical protein"
FT   gene            124200..124952
FT                   /locus_tag="Ssol_0145"
FT   CDS_pept        124200..124952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90442"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX1"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2734"
FT                   /protein_id="ACX90442.1"
FT                   /translation="MEVVYVLGVKGGIGKTTFSLYFANQLSLTGKKVLYIDHDYFSFGS
FT                   LILGHNDLGLLEEIENNLPIFSRSLKNINNLYILKLFSNPLDANKDYSLLSNSIPQVVN
FT                   SIAKMGLDYVILDSSVGILPDNDIVIGLLEELDVEKKGVFLSDMLSVNSTIKYAKLWEN
FT                   AIKYKILVINMVPPIPEDLSEAMKIANKVYDDNNSKLFNTVVVVPFDEKMYNYKPLGNE
FT                   YENERLNQLCFTKLSHLKDIVLILSKGN"
FT   gene            complement(125106..126071)
FT                   /locus_tag="Ssol_0146"
FT   CDS_pept        complement(125106..126071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0146"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90443"
FT                   /db_xref="GOA:D0KN41"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN41"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90443.1"
FT                   /translation="MQVYETGFKTELKSLASYFIVNNLNVISQELDTRIADAAPFLLTG
FT                   NRGKEYLKVVREGEKVMSQGERSFKFYPHVKVEGETTIVAVDETAITVGEKESRKVEGF
FT                   QLYNGKRKGVKLRSVDLVFPLRLSLLEEIADLRSDTPSQFLMRAVSEVAQHLKIDYVVA
FT                   DAGFLNLKVIKEMPVKTVVGGKTNLKGFKELSNVPLTEKKCEVNDRVYVAYRVLKYNDL
FT                   YYYEVIYVKEKPRHFIFVTNFNGDPYKLAELYRLRWQSEEGFKVRKARIRYVRKLTNKI
FT                   FLYLYYTVLDSVWNLVNYLLFNFKSTKRKPLSFNSFVRLL"
FT   gene            126807..127574
FT                   /locus_tag="Ssol_0147"
FT   CDS_pept        126807..127574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90444"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX3"
FT                   /inference="similar to AA sequence:KEGG:M164_0135"
FT                   /protein_id="ACX90444.1"
FT                   /translation="MIRINVVGFKGGSGKSTISYHLARQLSEYYNVVLVDKTYSGTISR
FT                   IYNINNNIFSFLKGRNELFYINKNNLSVINMSFLNEDDLNGIDFNAFKYLYSKLTKDSD
FT                   IVIVDHSSIPHDFATEIELKAFMENFRNFAYNTVLVLSGDEIPIKKYLNYTVLLNDFVK
FT                   NYAEKILGISLPTDVKFLKIVAVIINKILKGQESKLEEFIRGDEILQRSARFIIPYYLS
FT                   LTQRHFKDIDPPKEISDITRYILDFLREPTSIL"
FT   gene            complement(127569..128564)
FT                   /locus_tag="Ssol_0148"
FT   CDS_pept        complement(127569..128564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0148"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sis:LS215_0133 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90445"
FT                   /db_xref="GOA:D0KUX4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX90445.1"
FT                   /translation="MKALVFDKSGLENLKVKEVQEPQLGPHDVLIRVVKSGLNPIDYFV
FT                   INAIPVTPMPHIPGAELAGVVEKVGDHVKGLNKGDKVVVYNRVFDGTCDLCLSGREMLC
FT                   RNGGIMSVITNGGWSEYFSVPDKNIFKIPESMSWDVAASLPVAALTSYHSLKELEVGPN
FT                   DIIVIFGASGNTGLFAVQLAKKFGATVIAVSRKNWLKEFGADYIVGYDDVVQKVKEITN
FT                   GKMADVVINSLGSSMWENSLQVLGLDGQLAFFGTLTGSEVKVNLSSLYGRHIKVVGTTG
FT                   GSRKELMELINLCKDCKVKVHKTYKLDEGVEAVKEIMNENREGRIMLQVS"
FT   gene            complement(128617..128976)
FT                   /locus_tag="Ssol_0149"
FT   CDS_pept        complement(128617..128976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90446"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2737"
FT                   /protein_id="ACX90446.1"
FT                   /translation="MSVIEKFVKNIEKLNDNEEVIMLENLWIKKITNFPINLQVIEEED
FT                   GEKLHLFVLKGAEAILLHKPTNIFLYITNLTSVELETLRYITIKKKCEEADEDFVSLAY
FT                   EYISFKNKAKIGIRG"
FT   gene            129065..129685
FT                   /locus_tag="Ssol_0150"
FT   CDS_pept        129065..129685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90447"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX6"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0140"
FT                   /protein_id="ACX90447.1"
FT                   /translation="MITNIIRLLSIKGGVGKSSIAYALARIISASGYKVLFLDMDNLHT
FT                   ISRVLGVKDCELTYTRDFFVFACDDFSKISFNSYEYVIIDTYSGISSETLSAISGDHVY
FT                   NIFISDFSSIDNTLNYIKEWNGKKTTNFLVVNMVIREDNENDILLRRFFDSLLLKINVA
FT                   INKIFLFFFDENYYGSYKVDLNHIELLASYVLGEMSESDLNLG"
FT   gene            129798..129941
FT                   /pseudo
FT                   /locus_tag="Ssol_0151"
FT                   /product="hypothetical protein"
FT   gene            complement(129943..130027)
FT                   /locus_tag="Ssol_R0001"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(129943..130027)
FT                   /locus_tag="Ssol_R0001"
FT                   /product="tRNA-Leu"
FT   gene            130709..131698
FT                   /locus_tag="Ssol_0152"
FT   CDS_pept        130709..131698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0152"
FT                   /product="transport protein, putative"
FT                   /note="KEGG: siy:YG5714_0141 transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90448"
FT                   /db_xref="GOA:D0KUX7"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX7"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0141"
FT                   /protein_id="ACX90448.1"
FT                   /translation="MVGNKVKSFMLPIISYAVPTFVLVYPSFFVSWLSESMHLAYWEVF
FT                   AIVALPFLGRIIGSFIYQVFKNSVISYCFPFLGFLVILQNFLGALIFVRFLVGVIFGLL
FT                   TSYAVESAVKSGRNVLVGFTTAGWPIGWVISYVAYVLLKNWNVINISGILIMLLALFEL
FT                   NGKEFGERSKISVSFPRLTSILIYVSALTPAFILQVMPSFLEVIKLTWLILPSYLLSIP
FT                   TYVLLPIISEKVGIRKVLVISSIIVILSCVITFLLLPMMVIVFTSIGLGILGITPKYLA
FT                   IRGEDPKRMGLALNIGSVMGLILPVVYGLMPFSSEFLLSILMVLMILI"
FT   gene            131790..132863
FT                   /locus_tag="Ssol_0153"
FT   CDS_pept        131790..132863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0153"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: eRF1
FT                   domain 2 protein; eRF1 domain 1 protein; eRF1 domain 3
FT                   protein; KEGG: sin:YN1551_2741 eRF1 domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90449"
FT                   /db_xref="GOA:D0KUX8"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX8"
FT                   /inference="protein motif:TFAM:TIGR03676"
FT                   /protein_id="ACX90449.1"
FT                   /translation="MKALIKELKKWKAPATVLLSLYIPPGRPIPDVVNLLRQEYSIAQN
FT                   IKLKRTRDAVLSAIGAAIDRLNKIPKIDGNGLVLFCGENFDTEDFKCFMFSPPDKVPLF
FT                   FYRTDKEFHLEFLEDMVEDTAVYGLIIVERDEATIGLLKGARIEILEEIEGFVPGKHMM
FT                   GGQSQRRIDRIIDEMYHNFLKEVGEKVNAYFMPFVQNGKMKGVLLGGPGYAKEDFYKED
FT                   YVDYRIKNLILQPLIDVSDQGEVGLREMIMKAEDLLKNQQYIEVEKLLEELKYHLAKDD
FT                   GLIIYGKEQIKKAMEIGAIEAIVIHEDSTDKELEKLAQDAENYGVKVFVVGDEVPEAEW
FT                   VKKTFNGIVGKLRYRLY"
FT   gene            complement(132864..133481)
FT                   /locus_tag="Ssol_0154"
FT   CDS_pept        complement(132864..133481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0154"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: sid:M164_0158
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90450"
FT                   /db_xref="GOA:D0KUX9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUX9"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACX90450.1"
FT                   /translation="MKVVTWDEIVSLSTKLAEKIKADEYNVNVIVAIARGGLVPARLVA
FT                   DVLGVFDILSIKIEHWIETASHTPEAKVKYPFKVDLSDKNVLIIDDITDTGDSIELARK
FT                   YVMENFRPTEVKTATLQYIKPAAKIIPDYYAEEIVSWAWFMYPWNYWEDEINLVNKILI
FT                   ERKTKDIDINELKRNFVESYGIENPPISLDKILTEMKRRKIV"
FT   gene            133581..134393
FT                   /locus_tag="Ssol_0155"
FT   CDS_pept        133581..134393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0155"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /note="TIGRFAM: methylthioadenosine phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1; KEGG:
FT                   sin:YN1551_2743 methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90451"
FT                   /db_xref="GOA:D0KUY0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY0"
FT                   /inference="protein motif:TFAM:TIGR01694"
FT                   /protein_id="ACX90451.1"
FT                   /translation="MIEQNEKASIGIIGGSGLYDPGIFSESKEIKVYTPYGQPSDFITI
FT                   GKIGNKSVAFLPRHGRGHRIPPHKINYRANIWALKELGVRWVISVSAVGSLRMDYKLGD
FT                   FVIPDQFIDMTKNREYSFFDGPVVAHVSMADPFCNSLRKLAIETAKELNIKTHESGTYI
FT                   CIEGPRFSTRAESRTWREVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVFAEIT
FT                   VTAEEVTRVMAENTEKAKKLLYALIQKLPEKPEEGSCSCCNSLKTALV"
FT   gene            134363..135139
FT                   /locus_tag="Ssol_0156"
FT   CDS_pept        134363..135139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90452"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY1"
FT                   /inference="similar to AA sequence:KEGG:LS215_0172"
FT                   /protein_id="ACX90452.1"
FT                   /translation="MQQSEDSTSIKKLVRFFNINFPQMDLIVYGRGLELPAFTLGRALS
FT                   SLKNKMINVLNIYDFLFICNPYIEVSNVVAFTGDENELRDLLDGLESLRVNGRIYFCGI
FT                   TNIKPRYNFVSITSFDKSFCEINLSLSILKILSNDNIKREKMILDQLNDISDLDDYVKN
FT                   YANVFSLDQPILLSPIMLPAKSFLESLGVNVSSYFDTKILDSVQIVYTGVDMHIIKRVI
FT                   FSLRSKGKKVTDILIDADPLLAPIYLSMIMFYLKKK"
FT   gene            135156..136001
FT                   /locus_tag="Ssol_0157"
FT   CDS_pept        135156..136001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0157"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: siy:YG5714_0146
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90453"
FT                   /db_xref="GOA:D0KUY2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY2"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ACX90453.1"
FT                   /translation="MSIIEFWLEAKATIDRLIEQFLNSNRDWDLVDISSYILKDGKRFR
FT                   GTLNMFFTVALGGDIKDSYGGALAIEILHSASLALDDIVDLDATRRGDKAAWVVYGNRK
FT                   VIFITNYLIPTALRIIQTSYGDDALNTSIELWKDTSVGALRDMYDNSDYIRTIELKTGS
FT                   LFKLSTVLSAYASKHYNTKQQMLDVGKYLGIIYQVIDDFVDYKTKKVEEIDGSAKQLFK
FT                   YYREGKLEEYVRSVYLEYKQKYDELISNIPFQSKYLSEIRSLPEFLANGLLKEANIDKI
FT                   "
FT   gene            136037..136924
FT                   /locus_tag="Ssol_0158"
FT   CDS_pept        136037..136924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0158"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: RimK domain protein ATP-grasp; KEGG: siy:YG5714_0147
FT                   alpha-L-glutamate ligase, RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90454"
FT                   /db_xref="GOA:D0KUY3"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY3"
FT                   /inference="protein motif:TFAM:TIGR00768"
FT                   /protein_id="ACX90454.1"
FT                   /translation="MRLAVIHESEKVTKASKQLLLEVKSRNHSAYYIRISKLNAEITEH
FT                   GIEFTYSGRKVDIDGGLIRNLGFISTTEQFIKRFDVLRELERNGVVLMNRPDSMLLARD
FT                   KFASLMRMRRAGIPVPNTALVEDPFEVMRLAERWGEVVIKPVVGSLGLGSVKVSDPDIA
FT                   FRVAKAILSVNQPVYVQKYVKKPDRDIRVIVIGDKVLGSIYRISKSGWKTNIAQGATAQ
FT                   VLIPDAELEEISLKSVRVLGLDYAGIDIIEDVENGGYKIIEVNAAPLWDGFEAATNINP
FT                   AKYIVTHLIEKIRR"
FT   gene            complement(136972..137433)
FT                   /locus_tag="Ssol_0159"
FT   CDS_pept        complement(136972..137433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0159"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: Transcription regulator, AsnC-type-like;
FT                   Helix-turn-helix type 11 domain protein; SMART:
FT                   Transcription regulator, AsnC-type; KEGG: sin:YN1551_2747
FT                   transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90455"
FT                   /db_xref="GOA:D0KUY4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY4"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACX90455.1"
FT                   /translation="MNSSFYYLDDIDKKILNILQQDSRIPFSRLAKMLNLSEATIYVRI
FT                   KRLKENGVIKGFYTEIDFDKIGLSVVAFILIKADPKKYDNILKQLVEMKEIYEIYDVTG
FT                   EYYAVLKVRVPTREDLAKVLDKIGNMDGVTSTYTMLVLRSIKDKKELDL"
FT   gene            complement(137430..138428)
FT                   /locus_tag="Ssol_0160"
FT   CDS_pept        complement(137430..138428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0160"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sin:YN1551_2748 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90456"
FT                   /db_xref="GOA:D0KUY5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY5"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACX90456.1"
FT                   /translation="MTRIAIVGAGPAGLSLAYFLKGSRKVEATVYESMPEPGLKPCAWG
FT                   LITGIENIIPIPNETIISEIRGFRIYLDNKLVFDIRTDNKLGYIIDKPLFLKRLSQEVN
FT                   VEFNSKVVKKDDKYYINDKSLDHDKVIFATGHYSVSKSMSIPAIQYITDYEIDKEVVEF
FT                   YFYSGFLGYAWVFPDREGSKIGIGGYAEVPELKERLKQILKGRIRTFHGARVTDYGVIE
FT                   DRLDGNYTGEALGTVYAITGEGIRPSIISSKILADSILNRKDFKKEFKKSKLYWSLNWH
FT                   AKIIKMTKENDPGTARLSKALLNNDPQLILKFAIGEFNRVDLIKIFGRSLI"
FT   gene            complement(138436..138948)
FT                   /locus_tag="Ssol_0161"
FT   CDS_pept        complement(138436..138948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90457"
FT                   /db_xref="GOA:D0KUY6"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY6"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2749"
FT                   /protein_id="ACX90457.1"
FT                   /translation="MKASYTLPLSILMIILPVIPGLIDSFIGFLVGAIIDFVIAVYILI
FT                   SEKPWSNDIKTAISTLYFTTLSTFADVAGIFFAMAYQDEYKFAIVTLALSIPFIYNLFL
FT                   VLKSILPNLIKADILDIGNGFFAFILVLIVGAIIGRVFITNFYALLPLYTGFLILAIIA
FT                   LFYFRKK"
FT   gene            139006..139836
FT                   /locus_tag="Ssol_0162"
FT   CDS_pept        139006..139836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0162"
FT                   /product="peptidase T2 asparaginase 2"
FT                   /note="PFAM: peptidase T2 asparaginase 2; KEGG:
FT                   sid:M164_0166 peptidase T2 asparaginase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90458"
FT                   /db_xref="GOA:D0KUY7"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY7"
FT                   /inference="protein motif:PFAM:PF01112"
FT                   /protein_id="ACX90458.1"
FT                   /translation="MRYNLPVLVVHGGAGSWQIADQDKAKLTISEALERGYYEFRKGSA
FT                   IEAVVEAIYYMEESGVFDAGKGSVRNSAGYIEMDAGIMVGNTLQVGGIMGLREGSAIKK
FT                   ALEILFQNRHVLMIGSNYNSSNSNNSAIYESKVSGDTVGAVALDQHGNLVAGTSTGGIK
FT                   GKLPGRVGDSPIPGAGYYATSNVAVSSTGIGEIILRILPAKEVDILVSLGFTIDDALRA
FT                   VVNKVTKTFGKDNIGMIGLDKYGNASAYYNTKGMARGVISSDGVKKVYVFEGDI"
FT   gene            139837..140376
FT                   /locus_tag="Ssol_0163"
FT   CDS_pept        139837..140376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90459"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2751"
FT                   /protein_id="ACX90459.1"
FT                   /translation="MKILVMSNIRFPEPHVESTLSSIIKKEEPEVIVLNGDTTQCYWDY
FT                   ECPRVIDVLYVIRSIAPWAQIIYVQGDMDPHAIKCITAEPRYREEIIGTTMYIAEAASV
FT                   KYHIIHGHQGEIDQLRKSIGAGPWDWLVIGQYKRLEIDKLARVLYSGGITREFPPEARG
FT                   YVVITDSNFYIRNLRT"
FT   gene            complement(140373..140609)
FT                   /locus_tag="Ssol_0164"
FT   CDS_pept        complement(140373..140609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90460"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUY9"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2752"
FT                   /protein_id="ACX90460.1"
FT                   /translation="MIVVVKYRIIDKNIRGIINSLRKIPFIKEILFYSGEKNSIFANGY
FT                   MIWEEGSDLNPIEEVYDVKIIELSRRLYFPICG"
FT   gene            140703..141086
FT                   /locus_tag="Ssol_0165"
FT   CDS_pept        140703..141086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90461"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ0"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2753"
FT                   /protein_id="ACX90461.1"
FT                   /translation="MQLENKPIIVISSTNSEEIPNFVRAMFKDCRLNGSKKLVINFVSS
FT                   ISYPEFVQNAREALLDNIDLGVYIYIWKPEEVDQMMRRIMENHKDMKGMIIYCDDNNKH
FT                   MIEKILPKIPNSIKANIIKDYCK"
FT   gene            141126..142487
FT                   /locus_tag="Ssol_0166"
FT   CDS_pept        141126..142487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0166"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM: FAD
FT                   dependent oxidoreductase; KEGG: sid:M164_0170
FT                   geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90462"
FT                   /db_xref="GOA:D0KUZ1"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ1"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ACX90462.1"
FT                   /translation="MKRAEYDVLIIGLGIAGASLAWKLSQSNLKVLAIDSKPWNRFGDK
FT                   PCGDAISKEHFDNLGMPYPQGKELEEKVEGIRLYSPDMKTIWTVKGEGFEIDSPSYVQR
FT                   LAKEARDRGVEILDLTTAMKPIVIGNKVEGAVLFNRRTNETIEAKAKITVDATGYSTSF
FT                   RNKLPFEFPVTETLDDKDADIAYREVLNTKDEIEEYPYLRIFITQKASPGGYWWYFPKG
FT                   PNKVNVGLGIQGGMGYPSIHEFYNKYVDYYAPDIDKNRLLVKGGALVPTRRPLATIVWD
FT                   GVAVIGDSAFTVNPVHGGGKGSAMISAYCVGKAILNAFEVNDFSAKGLWDANECYIERY
FT                   GAKQASLDLFRRFLQRLSDDEINYGMNRKVIREEDLLEASANGDLQLSTAEKAMRVIMA
FT                   LGKPSLLFKLKTVAEYMKKVKDVYKHFPAEPKDLMKWKHSVDSIILEFNKALEK"
FT   gene            complement(142458..144074)
FT                   /locus_tag="Ssol_0167"
FT   CDS_pept        complement(142458..144074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0167"
FT                   /product="Protein of unknown function DUF2070, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2070, membrane;
FT                   KEGG: sid:M164_0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90463"
FT                   /db_xref="GOA:D0KUZ2"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ2"
FT                   /inference="protein motif:PFAM:PF09843"
FT                   /protein_id="ACX90463.1"
FT                   /translation="MDMDTENLTRKYYGYLKTLPSIKIFATTFSVESLLILLRSFQLTF
FT                   DYLFSFVLYSILLIIIFKNKIKIALFMMNLTAIPYLLLSLLPITPFYAFGFFMPLMAYI
FT                   LLGSYKEIPSIVLSGITSYVPIIFYFKYSIIFLLYILIIGLIFHFYIYTVNRKGVKILG
FT                   LKSTQVAVPFITAITEKNKVPLENFLNLISVKTTLNVFMYKLDDFLFMIPQIHFGVFDN
FT                   VGSSRFVYDIEKALRNNIVTVFHGPGSHELDLPSSAEVNKVIEAISKSTIERNDWNKAT
FT                   FYGISIERRSTFDITSLEFDKFRVSFMERPEFGIDDLPSSLWKYMLSSNNYLIDCHNSF
FT                   LEREYDSHEINSLKDFIADQRGIKSTRRLMVGYSEGKLGKACDGLCDNRIRVFTFDDGV
FT                   KRVSIVYIYANNSTKELNYAISNAVRQIVDKVILVTPDDHSCTGVSLGITYSPATFCED
FT                   LVNIASELIKRSTENMKEINRVEYKVVKIKGVKILGKIISIMLKALEDVGNYTSKTFWI
FT                   PLITPYVLLIVILLFQSFIKF"
FT   gene            144105..144395
FT                   /locus_tag="Ssol_0168"
FT   CDS_pept        144105..144395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90464"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ3"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2756"
FT                   /protein_id="ACX90464.1"
FT                   /translation="MSINKEKLGADKVIKNSLDYCDLYIIQKGDKVFLLYLFERRGYYY
FT                   FKIMPEIVGKWEDCENVVYTAFGLFGFVSNQEELEQKIKEKIEVLMRNVST"
FT   gene            144382..145176
FT                   /locus_tag="Ssol_0169"
FT   CDS_pept        144382..145176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0169"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   siy:YG5714_0158 HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90465"
FT                   /db_xref="GOA:D0KUZ4"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ4"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACX90465.1"
FT                   /translation="MSVLNGYQLIISDVDGVIVREGDPIWENIQALRNIQNNGVKIIFV
FT                   TNNSGFSRILLSRQLSYLGLKVTPDMIITSGLAAAIYMKEKLNVKSVFAVGEEGLIEEL
FT                   KNHGFLVFSSAESERILPDAVVMGLDRLSTYDKLSLAMRCISKGSKFIVTNMDRLWPAK
FT                   DGLKLGAGALASSIIYALRRDPDFIAGKPNTWIVEIAMRISNVKKLDKILVIGDQIETD
FT                   IQMGYNIGADTALVLTGISNVDDVDRSNVKPKYVVNTLLDLL"
FT   gene            145224..146924
FT                   /locus_tag="Ssol_0170"
FT   CDS_pept        145224..146924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0170"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: sid:M164_0174 succinate dehydrogenase or
FT                   fumarate reductase,flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90466"
FT                   /db_xref="GOA:D0KUZ5"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ5"
FT                   /inference="protein motif:TFAM:TIGR01812"
FT                   /protein_id="ACX90466.1"
FT                   /translation="MEKIEYDAVVIGGGLAGLMSAHEIASAGFKVAVISKVFPTRSHSA
FT                   AAEGGIAAYIPGNSDPNDNPDYMTYDTVKGGDYLVDQDAAELLSNKSGEIVMLLERWGA
FT                   LFNRQPDGRVAVRYFGGQTYPRTRFVGDKTGMALLHTLFERTSGLNVDFYNEWFSLDLV
FT                   TDDKKVAGIVAMQMKTLTPFFFKTKAVVLATGGMGMLYRHTTNSYINTGDGFGIALRAG
FT                   AALKDPEFVQFHPTALYPSDVLISEAARGEGAILKNIKGERFMTRYAPKKLDLAPRDIV
FT                   SRAIITEIKEGRGFPGGYVGLDLTHLGEEYIKERLALAVEAAKSFAGVDAFTEPIPVRP
FT                   AQHYYMGGIDVDIEGRNPDIVGLFSAGEAACVSVHGANRLGSNSLLDTLVFGQVTGRAV
FT                   VQFLKSNSSNPTSNYEKEAEKVVDDAYKLVKSESGVHFGQILEKLRDTMWDYVGIYRDE
FT                   GGLLNAMSEINKLRGMISNMYVTDKSKVYNTEFFNALELRNMLDLAFVIAKSALERKES
FT                   RGAHYRTDYPDRDDNNWLKHTIAYLRGNTVEVTFKPVKITRWKPEPRVY"
FT   gene            146926..147876
FT                   /locus_tag="Ssol_0171"
FT   CDS_pept        146926..147876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0171"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: siy:YG5714_0160
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90467"
FT                   /db_xref="GOA:D0KUZ6"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ6"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ACX90467.1"
FT                   /translation="MTQSQEEEVILKVKRFNPEKGYWWAEYKLKVDRFTQFTEALRRIK
FT                   SEQDPTLSYRASCHMAVCGSCGMKINGEPRLACKTLVLDVVKKYNNNVITIEPMDYFKP
FT                   IKDLIVDWDEFYERMFKIKPRLYQAKEVLEGKAEHRLKPEDQRELWKFAQCIWCGLCVS
FT                   ACPAVVIDQQFLGPAAHAKGYRFLADPRDTITEERMKILIDSSWRCTYCYQCFNVCPRD
FT                   IEPVTAIKKTRSFTKTYKDKSEIAERGEKHVEAIHESILKTGKLAEAPVYLKTYGVLQS
FT                   LVDLVYMSKTGKLKYALVQERPVQNINEIKKIIGE"
FT   gene            147882..148754
FT                   /locus_tag="Ssol_0172"
FT   CDS_pept        147882..148754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0172"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: sin:YN1551_2761
FT                   CoB--CoM heterodisulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90468"
FT                   /db_xref="GOA:D0KUZ7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ7"
FT                   /inference="protein motif:PRIAM:1.8.98.1"
FT                   /protein_id="ACX90468.1"
FT                   /translation="MKIAYYPGCATHGLSKDVDIATKKVAEVLGVELVEVPDWNCCGGG
FT                   FYDEYDEVGHVALNLRNLSQVEKMGLTKMVTPCSVCLHSHRLATYKYKEDKDIKRKTDK
FT                   RLEGTSVKYEGKVDAEHIVWVLLRDVGLENIKKHVKKPLTALKVGTYYGCQMLRPEQIM
FT                   GFEKAYNPSSLSELVAVTGATPVPFPAMTSCCGFPLVGSNPKGALKLAFNVLNSAKQSG
FT                   ADLVIHPCSLCHLQLDSLQLKVKAEFNIGWTMPAIYVTQLLGLSFGFSPEELGIGKLAI
FT                   EVLRSKGVI"
FT   gene            148755..149120
FT                   /locus_tag="Ssol_0173"
FT   CDS_pept        148755..149120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0173"
FT                   /product="succinate dehydrogenase subunit D (SdhD)"
FT                   /note="KEGG: sin:YN1551_2762 succinate dehydrogenase
FT                   subunit D (SdhD)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90469"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2762"
FT                   /protein_id="ACX90469.1"
FT                   /translation="MSEEIKKVIQDIGGKPDEWVNVSERPGKEPFAKELNYSLEDYFWG
FT                   KVHVRNEGDIYVLVISKDVFNWKERIKDLKLNGNVIDAAGGLMWIQEFNIQGLKRDFEF
FT                   LKTFIEDIRKQKQQKTS"
FT   gene            complement(149208..150566)
FT                   /locus_tag="Ssol_0174"
FT   CDS_pept        complement(149208..150566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0174"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   siy:YG5714_0163 von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90470"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0KUZ9"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ACX90470.1"
FT                   /translation="MSEEEGVLRGIDYRDPLVKYRGERISYTLKKLLGRDVQLNETFLV
FT                   DTYYVHYLPLPITKGKSEIEKNQEIAYSLVNSTLSSDIVLKNREYSIVNSAVSLALTVS
FT                   YVQNLIEELERIKKTSQSMEEREAAEEILNGLMKGSSSKEGKEQKNSNQQSMEKVLRQA
FT                   HEKAMSKAIEDANSVRNMQKIVGGNGAGTGSVLTFEGEIHEVLRLARNTEIKKILEFLS
FT                   GIPKLGSITKRRTTRFSKGELYGYEEGSDIERIVYSELALPDMLFYLKLAEGQLLLYQK
FT                   QIKETLGPIYLLLDKSGSMDGEKILWAKAVALALYSRAKRENRDFYLRFFDNIPYPLIK
FT                   VQKNAKSKDVIKMIEYIGKIRGGGGTDISRSIISACEDIKEGHVKGVSEIILLTDGEDK
FT                   IAETTVRRSLKEANSQLISVMIRGDNADLRRVSDEYLITYKLDHEDLLKVVES"
FT   gene            complement(150563..151711)
FT                   /locus_tag="Ssol_0175"
FT   CDS_pept        complement(150563..151711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0175"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: siy:YG5714_0164
FT                   ATPase associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90471"
FT                   /db_xref="GOA:D0KV00"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV00"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ACX90471.1"
FT                   /translation="MSEKTLLELPKKFMEALMAPFIGREEEAKVITLALLSKEHVILIG
FT                   EPGTAKSALARRAAELLNAKFFMYLLTKYTEPAELFGALDINALKDGQYKRITKDRLPE
FT                   SQIAFLDEIFNANSAILNALLSLLNERVIYDGYNVIKVPLRTLISASNRVPDEPELEAL
FT                   YDRLLLRHYARPVGEELWKQLLDATWEIEFTNRWAVKEPIMNIEHLDKLYSYLSQVDLS
FT                   GVKNKLLKLYAMLEEKGIHLSDRRKGKVLKVVSAHAILNSRLKATEEDLIVLKYIAPRE
FT                   IDDFEKVAALLSEELKTPIKYMKELNEIYNNIKEAAKYVEAANESDPRLIELIRSLRAT
FT                   RDRIVALGKESGDEKVEEFSKEVLSEIDKLIEKVARKLGIYP"
FT   gene            152148..152594
FT                   /locus_tag="Ssol_0176"
FT   CDS_pept        152148..152594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0176"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type; KEGG: siy:YG5714_0165 nucleic acid
FT                   binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90472"
FT                   /db_xref="GOA:D0KV01"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV01"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ACX90472.1"
FT                   /translation="MEEKVGNLKPNMESVNVTVRVLEASEARQIQTKNGVRTISEAIVG
FT                   DETGRVKLTLWGKHAGSIKEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDGFPES
FT                   SQIPENTPTAPQQMRGGGRGFRGGGRRYGRRGGRRQENEEGEEE"
FT   gene            152591..152872
FT                   /locus_tag="Ssol_0177"
FT   CDS_pept        152591..152872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90473"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV02"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2767"
FT                   /protein_id="ACX90473.1"
FT                   /translation="MNFEDVKDKKPKKIGELIDRSEESDNYIVKVAEDKVYELAPIAYY
FT                   IWAMCDGNRSVDEIVNELSKEANLDISQVRDPVVMVLDELEKASLITF"
FT   gene            152898..154538
FT                   /locus_tag="Ssol_0178"
FT   CDS_pept        152898..154538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0178"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II;
FT                   molybdopterin binding domain; MoeA domain protein domain
FT                   IV; KEGG: sid:M164_0182 molybdenum cofactor synthesis
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90474"
FT                   /db_xref="GOA:D0KV03"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV03"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACX90474.1"
FT                   /translation="MRVFVKDELLYSIEEAIRVYLSSLNFIPKTVEVEVKDSFGYVSAE
FT                   DLNSPIDYPPFSRSNVDGYALKSSCTPGELKVIDRIEIGEFKEVHINECVAVEVDTGAI
FT                   IPMGADAVIKVEDVKIISGNLIKVDKKMTFGQNIGWIGSDIPKNSIILRKGEVISHEKI
FT                   GLLASLGISKVKVYEKLKVYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLKQNYQIV
FT                   GLSLLRDDIESIKNEIKRAISLADVLILTGGTSAGEKDFVHRAIKELGSIIVHGIKIKP
FT                   GKPTILGVVDNKPVIGLPGNIVSSVVVFDTVISEILRNLYPSRKEIVELGKIKAKLALG
FT                   TKADKYRNTLIPVYLFKSVDSSYYALPVKFESYMIGTFSLTEGYIMLNPNEEIEEGKEV
FT                   EVNVKKFDDSISIIGEEDKRILNSDTKNVLLGSLPAKKAIEYKFGDVAVISSLYSSSVD
FT                   NYDRVFCRQILVNGEGEEIGYDDWIGMSKIVKNPVVKLRSPSTIYSLLGKAKVYAPEGY
FT                   IIGKKVFEECLYMIGISERGKRYLSTIKV"
FT   gene            154777..155712
FT                   /locus_tag="Ssol_0179"
FT   CDS_pept        154777..155712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0179"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="KEGG: sid:M164_0183 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90475"
FT                   /db_xref="GOA:D0KV04"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV04"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ACX90475.1"
FT                   /translation="MECKRARAYSSSANLGSGFDILSIAHTAFFDTVEICVENKNLNNI
FT                   IVESNSKIPLEPNKNSATYPIVKIMEEIGIKASLKVRVIKGIPEGLGLGSSGASAAAAV
FT                   MAFNNLFNLNLSKEDLVRYAMYGEIASSGSPHPDNVAASVFGGVVSVVSVSPVKVVEIP
FT                   INYSFDILLFTPLNVHIEEKTKKAREMVPKTVTLSDYINNSRYISSLLLGFIKGERELI
FT                   RLGLNDKIVEKARLPLFPYYPKIKEVAIKYDAIGACVSGAGPSILVLTDKMTDENKIVE
FT                   EGTKTCNEFNVECKVIKAKIAGGVGIEGRD"
FT   gene            155696..156826
FT                   /locus_tag="Ssol_0180"
FT   CDS_pept        155696..156826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0180"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG:
FT                   siy:YG5714_0169 cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90476"
FT                   /db_xref="GOA:D0KV05"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV05"
FT                   /inference="protein motif:PRIAM:2.5.1.48"
FT                   /protein_id="ACX90476.1"
FT                   /translation="MKDATRAVREDIDDLTGAITTPIYQTSAYHYPEGEKYRYSRESNP
FT                   TVLELAKKIVELENAEMGIAFSSGMGAISTTALALLKPGNSVLVHRDMFGRSYRFFTDY
FT                   LKNWGVNVEASYPGNNNIIEKAKSKRYDVIFVENITNPLLRVIDVAELSKVAKEQGSIL
FT                   IVDATFSTPINQKPLELGADIVVHSASKFLAGHNDVIAGLAAGYSKYLNVIDQMRRTLG
FT                   TSLDPHAAYLTLRGIKTLKIRMDVINRNAEQIAEFLEGHPKVVKVYYPGLKSHVDYDIA
FT                   RKVLKGFGGVLSFEVNGGQESALKVMKSLKLIIPAQTLGGVNSVISHPATMSHRTLSLE
FT                   ERKIVGITDSLLRLSVGIEDVNDLIEDLDRALSTLY"
FT   gene            complement(156823..157137)
FT                   /locus_tag="Ssol_0181"
FT   CDS_pept        complement(156823..157137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90477"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV06"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2772"
FT                   /protein_id="ACX90477.1"
FT                   /translation="MDSGITIIAEKLIDPSVKKACKMMVKDDEIIKLVGISSKKLALNV
FT                   IDKVSFWLVYENNNLLYCKLCNRGPFTKKGLYLHLSRVHRREIREMLEEELRHEIRTII
FT                   "
FT   gene            complement(157116..157655)
FT                   /locus_tag="Ssol_0182"
FT   CDS_pept        complement(157116..157655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90478"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV07"
FT                   /inference="similar to AA sequence:KEGG:M164_0186"
FT                   /protein_id="ACX90478.1"
FT                   /translation="MSTEIDSKNSSIDMFTTYEEELRVGEALAHILAAASIVLELEGES
FT                   EEVRNTIMKYIDLWISKLSPIDYSPGMAEVIGSKVRRKITSVFNEISENELGDILDFII
FT                   DVKRKLDIGTLETEILELEVKVERILRVLGIDINDVKQFFDFTNLEKRANRLIALATVS
FT                   IGIASVWDEKWTVELQ"
FT   gene            157793..158800
FT                   /locus_tag="Ssol_0183"
FT   CDS_pept        157793..158800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0183"
FT                   /product="protein of unknown function DUF1152"
FT                   /note="PFAM: protein of unknown function DUF1152; KEGG:
FT                   sid:M164_0187 protein of unknown function DUF1152"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90479"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV08"
FT                   /inference="protein motif:PFAM:PF06626"
FT                   /protein_id="ACX90479.1"
FT                   /translation="MKAFVFGIGGGGDVVSAIVAYNYLRKLGYDVLLGSVVWERYVEDP
FT                   IPGPICFDNIRNGVLVNQGLYKVNRDTYAIRGNRRVVPQLVRAVRALNLGEAYGICNKD
FT                   GVIGLYSSLKEFVNKEKIDLIVGVDAGGDVLAKGCEETLGSPLIDFISLASLVKLEEDG
FT                   YNVMLGVIGSGSDGELQYDYFLKRISEIASLNGLLDIKGYDRETANLVGRILNEVTTEA
FT                   SKIPFDAFKGLYGEITIRNGTRKVLVTPISAVMFFLDPIKIAETSPLYSLVKDSISIDD
FT                   AKKNLNEVGIYTEYNFEEDLYNEFGLNASHASAYDVDRIRVEGKRKLGGVKIKC"
FT   gene            158831..159373
FT                   /locus_tag="Ssol_0184"
FT   CDS_pept        158831..159373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90480"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV09"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0173"
FT                   /protein_id="ACX90480.1"
FT                   /translation="MDLIHELKSEYGFDEDEISYALSRARGIIFGFAMEYRARRILQEM
FT                   NFENIRSVDMPTHDIEAEKDGVKYYVEVKASKKSPTREYSAYKVAMIALLDGVHLTLSM
FT                   IPKPNLLLTEEILSEPKRILYRFFKLAYLKQLEELKVFLENEKNKEVLDSYSNVIRTIS
FT                   NRYHLSIILDLANPFSS"
FT   gene            complement(159332..159901)
FT                   /locus_tag="Ssol_0185"
FT   CDS_pept        complement(159332..159901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0185"
FT                   /product="KH domain protein"
FT                   /note="KEGG: sis:LS215_0201 KH type 1 domain protein;
FT                   TIGRFAM: KH domain protein; PFAM: K Homology, type 1,
FT                   subgroup; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90481"
FT                   /db_xref="GOA:D0KV10"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV10"
FT                   /inference="protein motif:TFAM:TIGR03665"
FT                   /protein_id="ACX90481.1"
FT                   /translation="MIILFITVEDEKLEVVKKVIGKLEQFTDTKIIYDERTKTFNILPK
FT                   GQNQYETLKAVSVIRAIGLGFDEQSAFRLLSDEYTLDVIDLKALIGSNPDTIRRVKGRI
FT                   IGENGKTKRIIQEYTGVDISIYGHYIGVLGPYDQVQIAKKAIELLIDGKEHSSVYKFLD
FT                   KAEKDLIIYKTSKLRRKGISEIKDNG"
FT   gene            complement(159898..160662)
FT                   /locus_tag="Ssol_0186"
FT   CDS_pept        complement(159898..160662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0186"
FT                   /product="RIO-like kinase"
FT                   /note="PFAM: RIO-like kinase; SMART: protein of unknown
FT                   function RIO1; KEGG: sin:YN1551_2777 non-specific
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90482"
FT                   /db_xref="GOA:D0KV11"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV11"
FT                   /inference="protein motif:PFAM:PF01163"
FT                   /protein_id="ACX90482.1"
FT                   /translation="MTELPKKTKDEKRRKDEDLFKVVDSTIDYRTYLNLIQIARRLNIK
FT                   EYLGAISSGKEARIYPARTFDDTYYAVKIYYTSTAQSKRAIKKYTIGDIRFEDIKVTNT
FT                   KQLINTWAKKEFKNLSRLYEAGTRVPKPILVFENVLVMEFIGENGIRAPLLKELSDEEI
FT                   TQGLYEDLIQQVEIMVKGAKLIHGDLSEYNVIVYDNKCYIIDVGQAVPIDYEDAITLLK
FT                   RDLDNINRFFENKGINIRPTEELLIKYGVTGD"
FT   gene            complement(160665..160991)
FT                   /locus_tag="Ssol_0187"
FT   CDS_pept        complement(160665..160991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0187"
FT                   /product="translation initiation factor eIF-1A"
FT                   /note="KEGG: sin:YN1551_2778 translation initiation factor
FT                   eIF-1A; TIGRFAM: translation initiation factor eIF-1A;
FT                   PFAM: S1 IF1 family protein; SMART: initiation factor 1A
FT                   (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90483"
FT                   /db_xref="GOA:D0KV12"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV12"
FT                   /inference="protein motif:TFAM:TIGR00523"
FT                   /protein_id="ACX90483.1"
FT                   /translation="MPKKDRAQEAPSRDVPRPEEGQTICVVKKMLGGDHLIVLCMDGKE
FT                   RLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVID
FT                   QLRG"
FT   gene            complement(161039..162232)
FT                   /locus_tag="Ssol_0188"
FT   CDS_pept        complement(161039..162232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0188"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: sin:YN1551_2779 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90484"
FT                   /db_xref="GOA:D0KV13"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV13"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACX90484.1"
FT                   /translation="MPESVYIASAVRTPIGKFGGALRNLSPVDLGSIVIREALRRANVE
FT                   PGKIDMAIMGNVLRAGHGQDIARQCAISAGIPFEIDGFSVDMVCSSGMISVITASQMIK
FT                   SGDADIIVAGGTENMSQAMFAIKSDIRWGVKMLMNRNIELIDTMLYDGLTDPFQYKVMG
FT                   QEADMVAKSHNISRKELDEVAYQSHLRAHKATVNGYFKSEIVEIKADGKVINTDEGIRA
FT                   DTSLDKLSSLPPAFTDDGLHTAGNSSQISDGAAALVLVSEKAAKELKIEPIARILGYSW
FT                   VGIESWRFTEAPIFAIKKLLSKLDTDINHFDYFENNEAFAVNNVLINRYLGIPYDRLNV
FT                   FGGAIALGHPIGASGARIIVTLLNVLSKMHGTRGIASICHGIGGSTAIAIELLKEMK"
FT   gene            complement(162268..163533)
FT                   /locus_tag="Ssol_0189"
FT   CDS_pept        complement(162268..163533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0189"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: sin:YN1551_2780 RNA modification enzyme, MiaB
FT                   family; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   MiaB-like tRNA modifying enzyme; PFAM: Radical SAM domain
FT                   protein; Protein of unknown function UPF0004 ;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90485"
FT                   /db_xref="GOA:D0KV14"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV14"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACX90485.1"
FT                   /translation="MKNIYVETYGCALNRADTYVMMTLLKSEGYNFVENPENADIIILN
FT                   TCAVRLETEERMKQRIKELNTLSKKLVVAGCMSSAEPATVLSIAPNASLIGPQSVERIV
FT                   DIVKSEERKIVIEGDRALITPRTFDGKIAIIPVADGCAGNCSFCITKLARRKLRSYPLR
FT                   EIVNAARDAIQSGAREIELTGQDTAAYGLDLGGSISLVDVVNKVADIDGDFMIRIGMMT
FT                   PEQAMRIMDDLIEAIRNPKVYKFIHLPVQSGDDRVLKLMNRKYTVDEYKELISEIRHKI
FT                   PFVNITTDIIVGHPGEDEEAFNNTLLLMKELRFERIHLAMYSIRPNTRSASMPQVPDSI
FT                   KKKRIQIANKLYEDLALSIHLDYVGSTSRVITTELGRKGSVIGRLMNYIPVVIRSENVE
FT                   LGKWYDVKITEASFYDLRGILA"
FT   gene            163579..163998
FT                   /locus_tag="Ssol_0190"
FT   CDS_pept        163579..163998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0190"
FT                   /product="Translation initiation factor IF2/IF5"
FT                   /note="PFAM: Translation initiation factor IF2/IF5; SMART:
FT                   Translation initiation factor IF2/IF5; KEGG:
FT                   sin:YN1551_2781 translation initiation factor IF2/IF5"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90486"
FT                   /db_xref="GOA:D0KV15"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV15"
FT                   /inference="protein motif:PFAM:PF01873"
FT                   /protein_id="ACX90486.1"
FT                   /translation="MSSEKEYVEMLDRLYSKLPEKGRKEGTQSLPNMIILNIGNTTIIR
FT                   NFAEYCDRIRREDKICMKYLLKELAAPGNVDDKGELVIQGKFSSQVINTLMERFLKAYV
FT                   ECSTCKSLDTILKKEKKSWYIVCLACGAQTPVKPL"
FT   gene            163995..164291
FT                   /locus_tag="Ssol_0191"
FT   CDS_pept        163995..164291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0191"
FT                   /product="Protein of unknown function DUF424"
FT                   /note="PFAM: Protein of unknown function DUF424; KEGG:
FT                   sin:YN1551_2782 protein of unknown function DUF424"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90487"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV16"
FT                   /inference="protein motif:PFAM:PF04242"
FT                   /protein_id="ACX90487.1"
FT                   /translation="MKVLLNIIRAQGMTLINICQEELLGKVFREGEIILDISEKFYGGE
FT                   SVELDYALSLIDEATVMSIVGNYAVEEAIRRGLVHKDSVINVAGIKFAQVYNV"
FT   gene            164297..165010
FT                   /locus_tag="Ssol_0192"
FT   CDS_pept        164297..165010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0192"
FT                   /product="NMD3 family protein"
FT                   /note="PFAM: NMD3 family protein; KEGG: sid:M164_0196 NMD3
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90488"
FT                   /db_xref="GOA:D0KV17"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV17"
FT                   /inference="protein motif:PFAM:PF04981"
FT                   /protein_id="ACX90488.1"
FT                   /translation="MSGKFCVLCGKQNVDLIDSLCVDCYVKSKKLIETPKRVTGKYCKI
FT                   CGAQWIRGKWIRTSATSLASVVEDIIARELGSKMRIDKNVDEFAFDIKSIWKDPSGNSF
FT                   ATIEFRGKVRGKSFSQEAVISLEMERELCDSCFRKKTRYYEAIVQLRSKGKIGVDDKKR
FT                   AFFESFFSTSIVDNISDVIEGREGVDYYFMSKSVARKLVSMISSIVDVEVNESYQNEKM
FT                   KNGKREAKLVISLRI"
FT   gene            165007..165645
FT                   /locus_tag="Ssol_0193"
FT   CDS_pept        165007..165645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0193"
FT                   /product="ribonuclease HII"
FT                   /note="TIGRFAM: ribonuclease HII; PFAM: ribonuclease
FT                   HII/HIII; KEGG: siy:YG5714_0182 ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90489"
FT                   /db_xref="GOA:D0KV18"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV18"
FT                   /inference="protein motif:TFAM:TIGR00729"
FT                   /protein_id="ACX90489.1"
FT                   /translation="MRVGIDEAGRGALIGPMIVAGVVISDTKLKFLKGIGVKDSKQLTR
FT                   ERREKLFDIVANTVEAFTVVKVFPYEIDNYNLNDLTYDAVSKIILSLSSFNPEIVTVDK
FT                   VGDEKPVIELINKLGYKSNVVHKADVLFVEASAASIIAKVIRDNYIDELKQVYGDFGSG
FT                   YPADPRTIKWLKSFYEKNPNPPPIIRRSWKILRSTAPLYYISKEGRRLW"
FT   gene            165639..166694
FT                   /locus_tag="Ssol_0194"
FT   CDS_pept        165639..166694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0194"
FT                   /product="TGS domain protein"
FT                   /note="PFAM: TGS domain protein; KEGG: sim:M1627_0179 TGS
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90490"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV19"
FT                   /inference="protein motif:PFAM:PF02824"
FT                   /protein_id="ACX90490.1"
FT                   /translation="MVTNLPAEAKAKWLKVMDAKTPEEKFQALQEFLKEVPKHKGTENL
FT                   VYWAKRRMAELREEMEVRKSKKSGGFSLFVEKEGAGQAILIGDMLLRSFIMRKLTNVKQ
FT                   EFNELPVPGMVKYEDVQIQLVNPPKSLPLSKTIGLIRNADEVIIAINNKEDLSLIKSLL
FT                   EDNNILLRKPKGRVVIERTRYGISGIRVVNLGKLIGIDEKVVRDYIESFGIKSAIVKII
FT                   GEVTLDDIEKSMFEAVSYKPTVVISKDRFDTGELPMLTIDQIDKLPKHLFDMLEVIRVY
FT                   TKEPGEEPTKDPLILKKGSTVLDVARKLHSSLAENFRYARVWGKSVKFQGQKVGPSHIL
FT                   EDRDIVEIHVK"
FT   gene            166744..168594
FT                   /locus_tag="Ssol_0195"
FT   CDS_pept        166744..168594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0195"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   sid:M164_0199 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90491"
FT                   /db_xref="GOA:D0KV20"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV20"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACX90491.1"
FT                   /translation="MSIFNRRNSRQYVNKQGPSKIELLFYNSSIIDSLAKSIGVKMKKA
FT                   GINQDPRLFASRLFLTLILSIVISVMLVVFAVRFFELYRLTLLTKYLAGFLTMMIFGII
FT                   IPPIAYLIQILQLSQSTENRRIGLDSEAPAFAAVFNVFLRSGLSARYVFDYLSKSTAMQ
FT                   YASQIASYVNKRVKYLGESVESAIVESLNYSPSKIFNEFLTTYVTAVRTGAPVLETMEA
FT                   KTKDILKNIETLASTAAENLSGIAEGFVIWLSSGFITFFLVLLLQAIFPSLFGSVPFPV
FT                   MAIFAMIMIPLINLLFIWVVDQTQFRFPERSLKAYKVFYVTFPIGLIISFIILYLIKEP
FT                   IPLLLYLLFLNAGVQQIPFSVLAFTIGLLIAAIPPAVIAMRELKEGTGYDVYVVSFLRA
FT                   VAEGLRAGLNPATVVKNLKDSPEMGKFRDILNTIYAYSLLGVPIKDAFKIASERILDFS
FT                   SKVSLISLADMIEIGSLTPETVESLAEQVDAQIRIRRNYNAKIRVLLYAPYIGIILALV
FT                   ASILLGNAMFTLISHQSYSFAYGPLSSATVVLPKSLYVISISALFNSFLAGLLVGKIGY
FT                   GKTAAGFTHAAVLVVITAVLVIISLHISLIPSISPSSTSL"
FT   gene            168618..170351
FT                   /locus_tag="Ssol_0196"
FT   CDS_pept        168618..170351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0196"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sid:M164_0200 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90492"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV21"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACX90492.1"
FT                   /translation="MSKIFKFPLQIGRGSVKQLPITDLPITLYPVTPLPEEVTTIVADY
FT                   EVNILNLVPEDIKSNLTRNNIELILPNPHVFITFDERKGIYKYVLLEPPVNEMIYNIYN
FT                   IFIEEVERELLSKNPSLDLAKIIFELDKKRSGLKIIQEKRGDIYVLSTNARVTLYYLLR
FT                   NMFGYNVLTPLVADKNIEDISVPGLNNPVYVYHRSYEYIPTNIIFTKNMQVSPQLNIMI
FT                   DGEELLDQLVLRMLSTTGKSISVAEPIQDGMLPNGDRVAATFRREVSASGSSVVIRRFS
FT                   ERPITILGLINSGTLSPELAAYLWYGMDLRMSVMSIGVTGAGKTTLLNAVLNLVKESMK
FT                   IVSIEDIPEIRLAHTNWVQLYARPAYAGVGKEISLMDLLKLSLRYRPDIIVVGEIRGQE
FT                   AYVLFQATSTGHGGATTFHAYNTDSAIKRLMNEPLNIPQEWIPMMNIIMTIRRLPVYIG
FT                   EKIVLRRRVVAVDEIVSWNDYRRVSSWDPKSDAFTINLDAARVLKNRIEEAGLNLDDVK
FT                   REMERRALFLKLLASSREIIQNEESYKLVKSYIIKYSLKPEEALKEAQAMARTKTIELK
FT                   E"
FT   gene            complement(170332..171612)
FT                   /locus_tag="Ssol_0197"
FT   CDS_pept        complement(170332..171612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0197"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   siy:YG5714_0186 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90493"
FT                   /db_xref="GOA:D0KV22"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV22"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACX90493.1"
FT                   /translation="MIREIFEILLFISSFFTSLWILLQAFYYKVSNQNIIQFSTKNDKN
FT                   SNKRIDIIVAIKDEDEKTIKELINNLSGLDYRFYKVIIVSDDTEETFKKIIESLDKLPD
FT                   NFVIIRRPENKGRKAGALNFATNISDAEMLVYLDAEARVEKDFLRKISQLDYDAVAFRL
FT                   KVRDVNTQVQKIYSYTNEFVMNALFKARDKLGLIIFANGSAFGIKRDILRKIGGWKENS
FT                   VAEDLELGIRLALSNIKVKYVDDITVYTLAPYTHTDLYNQIKRWAYGSGELISYSMRLF
FT                   KLGIRGIEGFIYSQQWGIYPLYLLLFLIIISIQFILNINYFYVFTSLIPILVSNGIYIA
FT                   LIKPKGDYKSGIVTLIASLIGYIQGIFKVRFKWKVTPKSLVGKEEEILSIKILGIILAI
FT                   MAYINSLFNNTISSLLIILFSLILLTL"
FT   gene            complement(171609..172127)
FT                   /locus_tag="Ssol_0198"
FT   CDS_pept        complement(171609..172127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0198"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG:
FT                   sin:YN1551_2789 inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90494"
FT                   /db_xref="GOA:D0KV23"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV23"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACX90494.1"
FT                   /translation="MKLGPGKKAPDEINVFIEIPMGSNIKYEYDEEEDIIKVDRVLYTS
FT                   MVYPFNYGFIPETLEEDGDPLDVLVLGNYSLMPGTVIEARPIGMIYMRDEEGEDAKVIA
FT                   VPRNKTDPSFSNINDVKDLPEAIRNKIVHFFEHYKELEPNKWVKISGWGSVAEAKERIK
FT                   KAIERKKQG"
FT   gene            complement(172144..172692)
FT                   /locus_tag="Ssol_0199"
FT   CDS_pept        complement(172144..172692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0199"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: sid:M164_0203 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90495"
FT                   /db_xref="GOA:D0KV24"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV24"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACX90495.1"
FT                   /translation="MKLERLLEGAKNLVRTGWMQNGIPSAMGETVASHSFEASILAYVL
FT                   ATELKRKGIEINPEHSALIALFHDAGETLLGDLPKWATSRINKRDAEVEAFDELGIGKE
FT                   LFLELKDLNTNEAKVAKLSDRLSTYLQGLRYKRIGFNVDEIISSYAEEIDKLLSIEPLN
FT                   QIRELVTRIMNSLNKLNPK"
FT   gene            complement(172710..174044)
FT                   /locus_tag="Ssol_0200"
FT   CDS_pept        complement(172710..174044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0200"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: siy:YG5714_0189 phosphomethylpyrimidine
FT                   kinase; TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1;
FT                   Phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90496"
FT                   /db_xref="GOA:D0KV25"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV25"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ACX90496.1"
FT                   /translation="MIKPVGMSIAGLDTGNGAGGETDLRVFEVLGIHGVFAITAITAQS
FT                   TKGIKDITVVNPEFLKKQIETLLEDFKVEAVKIGMIYTKEQFQVVNELLNDYFLVADPV
FT                   LYAKDGTPLIRDIEEYKKIILPKVKVITPNIIEASAISGVKIEKESDVVIVCKKLRDSY
FT                   NIPYVIIKGGHSKGDYSFDYMCNDEGLYKIGYKRLQAKDTHGTGSVFATALTAEYIKIR
FT                   DLKLAFRKARDFVQTSIEYGLNIGKGIGPVNVSVEIMKKSMKYEAVEEMRRFADFAENN
FT                   DRFWILIPEVQSNLAHSIKPEYVRDLNDIATFRGRIIRRWDKKVIVGHPVVFGNPTHTA
FT                   RMLLSLILKGKDSTCLMNIRYDDKIVESFKRIGYETIEINRELEPAHGEGKTMQWIIEY
FT                   VSSEYGGIPNVIYDKGTKGKEAMIRFWTKNMEEMIEALDNLLKML"
FT   gene            complement(174041..174736)
FT                   /locus_tag="Ssol_0201"
FT   CDS_pept        complement(174041..174736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0201"
FT                   /product="MoaD family protein"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein; molybdopterin biosynthesis MoaE protein; KEGG:
FT                   sia:M1425_0186 MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90497"
FT                   /db_xref="GOA:D0KV26"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV26"
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /protein_id="ACX90497.1"
FT                   /translation="MKKVKVLYFAFIKDITHKSNEVLETECETVDCFIEQLGKIYGSEL
FT                   VNFLKSGINGIKVSILVNGSASTKNIKDGDEVALLPPPSGGDLIIGKKFDLLEEIRKFR
FT                   EKAPPEAGSLVVYVGFVKGIVDNHRVFELKYEAYEEYTRKRFLEIKDEIKKKYNDLIEI
FT                   EIIHVIDSMKPGENVLLIMAIGKGRKDAIDAVKETLELVKHSTGIWKLEIRDDGEYWVV
FT                   AGNTRVKKQ"
FT   gene            174774..175229
FT                   /locus_tag="Ssol_0202"
FT   CDS_pept        174774..175229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90498"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV27"
FT                   /inference="similar to AA sequence:KEGG:M164_0206"
FT                   /protein_id="ACX90498.1"
FT                   /translation="MSEDEIIDLLFNTQRDIRQGITIKKENNEVLNKLNEIEKLLQYLI
FT                   KNKERASQQNGSLCEQVLSSTYVILDENMGDIPRKYFIIDLNSSRKLVTFKDTIDLLNL
FT                   YFSQTINEQDLDDKLPKRLVPLFRFMRRNGLIYFDYDKKRYFIVDYK"
FT   gene            complement(175220..177442)
FT                   /locus_tag="Ssol_0203"
FT   CDS_pept        complement(175220..177442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0203"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sid:M164_0207 iron-sulfur protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90499"
FT                   /db_xref="GOA:D0KV28"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV28"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACX90499.1"
FT                   /translation="MIGGYDVKKIESNDKNELVVGRLTGLYGDVLKYTNLKIIRAPDRF
FT                   DDGSVFREVEGKNIYKIFEVPAGVTFDKLIDELSKINYYPAIFPLYLKGTIGGFTASNG
FT                   SGFGSYKFGFAKGKKTINELIDYKVVRVLAVKYPELLETEGENRFAWSALIYKDTTRYY
FT                   IPSFYNKVIKGNFKSVSINNLIKSINMEISSIFKRNYVPIILMTNYDKNVEFNFDFKMG
FT                   YIINYNSPRKYKVMIGSLEETRLPELFEFLRKNPDILPFPYLKEYEEFHKDIIRNFKKY
FT                   EIKIRSKRINKNTIVEASKCINCSLCLDSCLAYNTTNNILYSPLGRFNRLLTGEGNFEF
FT                   CFGCASCQEACPVGINISNLMEILPQFNEKKETIELETIDVPRTIYELEKNLGSRYRNR
FT                   PVFLLFVGCAAKYDPLGLEGFLNYLLINGDKLPQELSPRVRLVTGICCGFNDYLAGNLE
FT                   GARNSVEKINRLRIEQNAAGIYFLCPEGLYIYNKFSEQKGIFAYEVIKHELKDKEVHLG
FT                   CWAKKLGYSSQYNECAGLFLTSYKGSPIRATKKGFLTVCPFSTWKFGTISAYSLFLEKK
FT                   EVKYLEEEKVMINENIIFDLLVRAVADGLIASKDEIAEKVVMWSLGGSQYFLLLTIPIF
FT                   SKYISSELIRKLSSDSRVKEFLSKLSQDTPLLNQKISTYKDYLSYYNFSNEINTLRDEI
FT                   AKSNKLDYSVRDLVKTSEFLNVLKEALRRSINENLIGNAINNIIYL"
FT   gene            177460..178272
FT                   /locus_tag="Ssol_0204"
FT   CDS_pept        177460..178272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0204"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; KEGG: sin:YN1551_2795 GHMP
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90500"
FT                   /db_xref="GOA:D0KV29"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV29"
FT                   /inference="protein motif:PFAM:PF00288"
FT                   /protein_id="ACX90500.1"
FT                   /translation="MRLKSQLLLVKIINNSFIVLGVEIKVPISISGIWYPVIEKENLIK
FT                   SGSIGLTLTLEPYITAEIRNGSGIEFNGIEIQLPNYEILKKKLGEYKLSVYSEVPLGYG
FT                   YGLSGAISLAYALGVKELTPISEEDAVNTAHLSDVLSGNGLGDVIAQYYGGGLVYRKKA
FT                   GGLGYGEVEVINMDWSYYPIFSQPISQLPTKSIIKRSEIALKLIDDFLKNPSPLKFIEV
FT                   AQQFTSSLGFSSEYPYSYRKKGIIVKIFEPEYGVWIKHKIASRGAYVI"
FT   gene            178227..179027
FT                   /locus_tag="Ssol_0205"
FT   CDS_pept        178227..179027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0205"
FT                   /product="Protein of unknown function DUF137"
FT                   /note="PFAM: Protein of unknown function DUF137; KEGG:
FT                   sid:M164_0209 protein of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90501"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV30"
FT                   /inference="protein motif:PFAM:PF02006"
FT                   /protein_id="ACX90501.1"
FT                   /translation="MDKAQDSKPWSIRDLIPENHPRRESLLIREKLIEAMEKSILVPQG
FT                   LIAHGRGECFDYLIGEKTQDFAEKAIEAAAATLLLAKTPTISVNGNMAALVPEGLIRLA
FT                   EESNAKLEINLFYRDERREKAIAEVLYKGGAKEVLGVGEDASEVIPELFSQRRRVSPKG
FT                   IYKADVVLLGLEDGDRTEALVKMGKKVIAIDINPLSRTSRTATITIVDNIIRAVPRLVE
FT                   KVKELKSKSKEELEQIVFNYDNKTILAESLKFIANRLTQLSLSL"
FT   gene            complement(179006..179809)
FT                   /locus_tag="Ssol_0206"
FT   CDS_pept        complement(179006..179809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0206"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: siy:YG5714_0195 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90502"
FT                   /db_xref="GOA:D0KV31"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV31"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ACX90502.1"
FT                   /translation="MKKVTIRDFIKKKSMKEKITMLTAYDYPTAKIISNTTLDSILVGD
FT                   SLGMVVLGYTNTLNVTMRDMISHTRAVARANPPQLIVSDMPFLSYEIDVKSAVKNAGLL
FT                   VKAGSDAVKLEGGEEIKDIIRAIVKAGIPVMGHIGLTPQRFLRLGGFRTIGKTKQEEEQ
FT                   LIKDSLELEDAGVFSIVIENTYVDIAKRITEKLNVPTICIGAGPYCDGQVLVIHDLLGL
FT                   SEVTPYFAKSYVNLKEIISSAINQYIIDVKTNKFPEKQHYKERES"
FT   gene            complement(179706..180389)
FT                   /locus_tag="Ssol_0207"
FT   CDS_pept        complement(179706..180389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90503"
FT                   /db_xref="UniProtKB/TrEMBL:D0KV32"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2798"
FT                   /protein_id="ACX90503.1"
FT                   /translation="MIGTVKDRTLEAILRYGDKAKYILKAIIEITEENENRELGDFNYK
FT                   RLVEKLEEWGINYDPRMILRALEKDFGIIETTYKSANQHWWKLIDIEQTKLAISGEIEN
FT                   GEEDAEISLIIIQYNSLNPKEVEKKLLFLLKKPKLLDLDKKNFMKFSFEILPLIVKLYY
FT                   KASQHEETFEIAEKLKKIINLAKRISSRINNEKGDNKGFHKEEINEGENYDVNSLRLPH
FT                   SENNI"
FT   gene            180437..181183
FT                   /locus_tag="Ssol_0208"
FT   CDS_pept        180437..181183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0208"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sid:M164_0212 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90504"
FT                   /db_xref="GOA:D0KMW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMW9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX90504.1"
FT                   /translation="MSMTEKQFAVSVTNLRKRIGNKEILKGLSFDVESGEVFGIVGPNG
FT                   AGKTTTLRILAGIIKNFNGDAKVFGLRPIEAKQNGYISYMPEDAFPYEKLTGYENLDFY
FT                   AELYAKGDKELKEKYLKLGIEIANLGERIYDKTAEYSRGMKRRLIIARTLMVMPKLSVL
FT                   DEPTSALDVESAVRIRNIILEMARRYNMTIILSSHNMLEVEYLCDRITLINDGRIVANG
FT                   KPKEIIKSTNSKNLEEAFIKLVFGDQ"
FT   gene            181183..182373
FT                   /locus_tag="Ssol_0209"
FT   CDS_pept        181183..182373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90505"
FT                   /db_xref="GOA:D0KMX0"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX0"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2800"
FT                   /protein_id="ACX90505.1"
FT                   /translation="MLRTMIKKEILDLKRDRKLLLGTIVLPFVLLPLIGIILYASIAVS
FT                   PPVIEIINYNQSNLPYIQIISNYITRNGGTVIYNNTNTSIVPDAVIIFPNDFNINASNI
FT                   SRQTFVYEKILISSNQEASNLVNNAIGYLSYTLVYNRIERLINSSNLQHVVNPDDVINP
FT                   LLVKNFVVTITGRNASQSQANLSEMARIITLVLFPSATPVIFYVTDGIVGEKERKTLES
FT                   LLASPISINSFIFSKVIIAVILGVLSSLGDILGIVIFSSLMSFTFGLPLSLSTPFILIV
FT                   ILTYLLAVLLTAALSVILLLALGGSMRNMQVINFLILSFGLIASFSALFINVANLQSPL
FT                   NLVLLIPYEQLSLSLLYFVSGSTFVSLSLLLGVFAVCVIILIVSSRLFNSERLLLK"
FT   gene            182406..182639
FT                   /locus_tag="Ssol_0210"
FT   CDS_pept        182406..182639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0210"
FT                   /product="Transcription regulator, AsnC-type-like protein"
FT                   /note="PFAM: Transcription regulator, AsnC-type-like; KEGG:
FT                   sin:YN1551_2801 regulatory protein AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90506"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX1"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACX90506.1"
FT                   /translation="MAEVVRAYILVSTTVGKEMEVADMAKKVSGVIRADPVYGEYDVVV
FT                   EVEAKSSDDLKKVIYEIRRNPNIIRTVTLIVM"
FT   gene            complement(182866..183180)
FT                   /locus_tag="Ssol_0211"
FT   CDS_pept        complement(182866..183180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90507"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX2"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2804"
FT                   /protein_id="ACX90507.1"
FT                   /translation="MPTIHLSLPEWMYDELKQKADELGIQMTDLVKLFIKKGLEGDFER
FT                   EEENEEKRTNAKYDESIAFLEAKVAQLDALLVEVLKKLEMLEEKDEEEEQVEVVDSNQR
FT                   "
FT   gene            183330..183506
FT                   /locus_tag="Ssol_0212"
FT   CDS_pept        183330..183506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0212"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: sin:YN1551_2805 CopG domain protein
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90508"
FT                   /db_xref="GOA:D0KMX3"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX3"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACX90508.1"
FT                   /translation="MRVVTFKVEEDLLELLDRYAIKYGLNRSEAIRKAIEKMVRDELSK
FT                   ERVPVARVEKIKL"
FT   gene            complement(183503..184138)
FT                   /locus_tag="Ssol_0213"
FT   CDS_pept        complement(183503..184138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90509"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX4"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0203"
FT                   /protein_id="ACX90509.1"
FT                   /translation="MVLKYFGHSCVLIDDRILIDPHDGGSIGLPKPDIKKVDLILVTHD
FT                   HYDHNAYQIFEYKDVKINFYGSLTYSNYTIKGIKSYHDKYNGKLRGENSIYVLQRSDGK
FT                   KIVHLGDLGHLLEENTYKELYGADVLLIPIGGVITINFKEALEIINKISPKIIIPIHYW
FT                   IKGHYMPLDPPEEFLANLKYEIRRIDLKNNLIDENVEESKKVVYALSY"
FT   gene            complement(184147..185190)
FT                   /locus_tag="Ssol_0214"
FT   CDS_pept        complement(184147..185190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0214"
FT                   /product="isopropylmalate/citramalate/homocitrate synthase"
FT                   /note="TIGRFAM: isopropylmalate/citramalate/homocitrate
FT                   synthase; PFAM: pyruvate carboxyltransferase; KEGG:
FT                   sin:YN1551_2807 isopropylmalate/citramalate/homocitrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90510"
FT                   /db_xref="GOA:D0KMX5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX5"
FT                   /inference="protein motif:TFAM:TIGR02090"
FT                   /protein_id="ACX90510.1"
FT                   /translation="MIARKLADLGVDVIEAGFPASSEGEFIATRKIFEEIGDQVEVIGL
FT                   SRSNKNDIDKTISTGISSIHLFIATSELHMKYKLKMTKEEVLNKIYESVKYAKDHGMIV
FT                   EFSPEDATRTEEDFLFTAIRTAIEAGADRINIPDTVGTMHPFKYYDMIKKIVNFVGERI
FT                   IVSVHCHNDFGLATANSLAGVYAGARQAHVTVNGIGERAGNASLEEVVMGIKKLLNYET
FT                   NVKTWKLYEVSRFVAEMTGVPVPYFKAIVGDNAFGHESGIHVHGVIENPFTYEPISPEE
FT                   VGNFRRLALGKHSGIHGLRKLLEEQGIYLSDDKLKIVLAEIKKLAESGNKVTVEDAKNI
FT                   ALKLMNS"
FT   gene            complement(185339..185953)
FT                   /locus_tag="Ssol_0215"
FT   CDS_pept        complement(185339..185953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0215"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   sin:YN1551_2808 protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90511"
FT                   /db_xref="GOA:D0KMX6"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX6"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ACX90511.1"
FT                   /translation="MIRSWFGFKERDDYISASILNYLITKEYDEAELKELIKGREIAIV
FT                   GAGPQLDKINKLKEDVIIAADGAANYLVDIGIVPDIIVTDLDGLQTFPKNPIYVVLAHG
FT                   DNINLLHKVKEMDKVIPNSQVMPFGRLRLYGGFTDGDRAVVLAKYMKASKIRLYAMDFQ
FT                   SGIVGKFSKPYYQRNVPASMIKRKKLEIARMIIEQVLNYNE"
FT   gene            complement(185965..186171)
FT                   /locus_tag="Ssol_0216"
FT   CDS_pept        complement(185965..186171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90512"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2809"
FT                   /protein_id="ACX90512.1"
FT                   /translation="MTNFTIDLDSYTCSSDPLEAIEYLFNNNNVIFKIKSANPYFEIIK
FT                   DRYTINIIKQEGDTIYFIIRYGG"
FT   gene            complement(186152..186544)
FT                   /locus_tag="Ssol_0217"
FT   CDS_pept        complement(186152..186544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90513"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2810"
FT                   /protein_id="ACX90513.1"
FT                   /translation="MDKSLVAAEYLLRARRTLKEAQIAFEDGDLYYTVIRTLDTVENLA
FT                   KVLLSLRDVFKYDLFWNTALFLNDGSMLEKKLRDLEYRLIPITLINESSLKTPTVVIRN
FT                   KEAEMLVDEISKILEEVEKIYDEFHD"
FT   gene            complement(186537..186914)
FT                   /locus_tag="Ssol_0218"
FT   CDS_pept        complement(186537..186914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90514"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMX9"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2811"
FT                   /protein_id="ACX90514.1"
FT                   /translation="MKLLLRVIEDLSSLFIEWYGDYVKKIIVGGKSFEKNDETEETIFL
FT                   ITLDKVSKISLYARGEIFSFFYNKVRNKETTKDFILNYGILPKIYGLLLSPKELEYEIP
FT                   LLEYLNTHGRVIYSVEEEKNG"
FT   gene            186947..187450
FT                   /locus_tag="Ssol_0219"
FT   CDS_pept        186947..187450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90515"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY0"
FT                   /inference="similar to AA sequence:KEGG:LS215_0236"
FT                   /protein_id="ACX90515.1"
FT                   /translation="MNGDAQSYLMERISIALPILEISVPCNTTCVMMTKYKHLLSIENF
FT                   KAQLEILDSLINLIEDKIYTLRHEIEDKFSQYKANVNIDNLVYAIYKMIEEGGNMILGE
FT                   KVYFGNKEVAYGEYTVLIGFHNLVEKIVKSDSNIRSLCDEIRYLSESTWEHFDKNIRRS
FT                   LNES"
FT   gene            187440..187856
FT                   /locus_tag="Ssol_0220"
FT   CDS_pept        187440..187856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0220"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: sin:YN1551_2813 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90516"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY1"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ACX90516.1"
FT                   /translation="MKVRVGIEGITMDSAHYTLSSYADSQIHGHTYIVNVEVEGEVNEK
FT                   SGFVVDFNLLKKIIKETIQEWDHKLIIPKVDLDKSRFEGPFRVDYKVIDAPFPTAEYIG
FT                   IEIAKDIYLKLNKKYRILLKIYEGKDSYAIIEYP"
FT   gene            complement(187900..188343)
FT                   /locus_tag="Ssol_0221"
FT   CDS_pept        complement(187900..188343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90517"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY2"
FT                   /inference="similar to AA sequence:KEGG:M164_0226"
FT                   /protein_id="ACX90517.1"
FT                   /translation="MIISIPSTIRKEVNDFTFVFSVIPPIITLKNADEDVKEFLLQLSK
FT                   SFRIDIACENRDKKLCYPAIFGGIFVFNHDVIIKRYEITGYLCNGKEETVKNVNQLFKR
FT                   LEEGKDWCFKFNDNSILCYKTTKESKECKWIDNIGLRFLILST"
FT   gene            complement(188303..189799)
FT                   /locus_tag="Ssol_0222"
FT   CDS_pept        complement(188303..189799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0222"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /note="TIGRFAM: dihydropteroate synthase-related protein;
FT                   PFAM: dihydropteroate synthase DHPS; KEGG: sid:M164_0227
FT                   dihydropteroate synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90518"
FT                   /db_xref="GOA:D0KMY3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY3"
FT                   /inference="protein motif:TFAM:TIGR00284"
FT                   /protein_id="ACX90518.1"
FT                   /translation="MKVLVVTGTLAAPILSEVAKNIKDTKVEIKVLNYPVASLMSTKFI
FT                   AENLKQTKFDADYILLPGLVYGDAKIVEEVTGVRTFKGTEEAWDLPRVIEALKNGIQLS
FT                   TTESADKIIGKMDNIEEKLRKMEEEAKISFEINGIKITTYPPPFRIFLEIDNKQEFEKL
FT                   DRIRKNVDVVVLGFPVGHYDLDEVKNKVKQLVDYGYVVGIDAESPRELKEGVRAGASFV
FT                   FNLNENNFEELEEIRKEAAFVVAPFNTENRGEITIDLVKKAKQKGFDKLIADPVLSPPL
FT                   RGLVSSIIGYKYVRETLQDIPILMGILNVTELIDADSIGMNALLTAIAGELGISNLLIM
FT                   EKGKTRWSSWEVSQATKMISVALKENRLPKDIGIDLLVLKDKRRFRESFNADVIVNRRI
FT                   EPEMDNTGFAKIFVSEDGFGVEWIGKNKITIKGKDGLSIGRELIRRVKDISKEHAVYIG
FT                   YELAKAEIAYQLDKNYIQDKPLFKKIINDNLHTEHDKKRG"
FT   gene            189891..190862
FT                   /locus_tag="Ssol_0223"
FT   CDS_pept        189891..190862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0223"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   sid:M164_0228 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90519"
FT                   /db_xref="GOA:D0KMY4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY4"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ACX90519.1"
FT                   /translation="MSLLPRTTSVKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIG
FT                   ETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENRGDEFVV
FT                   KTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGG
FT                   DSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVV
FT                   KQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPG
FT                   VFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEKKGKK"
FT   gene            190859..191653
FT                   /locus_tag="Ssol_0224"
FT   CDS_pept        190859..191653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0224"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: sid:M164_0229
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90520"
FT                   /db_xref="GOA:D0KMY5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY5"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACX90520.1"
FT                   /translation="MINLLNKVAIDATRYLNEIKNEKDLDKVIGFHAGDTTRVIDKKSE
FT                   EYIFQLLNDTGLKFKFVSEESGVRVPSNSYDYVALIDPLDGSNNFVLGVPWYSISVAIY
FT                   GKSSNSLLDSLGGFVSHISIDKIYSYDTSSAYLNGNPLKAEIIGNSPSNVVITYFDERG
FT                   IDKILKVLSALKGYKIRSFGSASLDMILTCMGKAKLYFDIRGKLRNVDIAASANFCKRL
FT                   NSIPSTLNGKEISSGIDDIYKIDEIIVSRDQSLMKNLYSIFS"
FT   gene            complement(191598..193421)
FT                   /locus_tag="Ssol_0225"
FT   CDS_pept        complement(191598..193421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0225"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: sid:M164_0230 microtubule-severing ATPase;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90521"
FT                   /db_xref="GOA:D0KMY6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY6"
FT                   /inference="protein motif:PRIAM:3.6.4.3"
FT                   /protein_id="ACX90521.1"
FT                   /translation="MIEPVLNLAIIFISLAVLVIILMKIFGKSTAKFAYSDKALQLQNK
FT                   SQKKKVEIEDKKITWDDIGGYEDAKKEIREYIELPLKNKDVATKYGLKPPKGMLLFGPP
FT                   GCGKTMMMRALANESKLNFLYVNISDIMSKWYGESEARLRELFNNARKNAPCILFFDEI
FT                   DTIGVKRESHTGDSVTPRLLSLMLSEIDGLHSEDGVIVVGSTNVPQMLDKALLRAGRFD
FT                   KLIYIGPPNKEARKQILQIHCRGKPLAEDVDFDKLAEITERYSGADLANLCQEAARKVA
FT                   SEAIEKGADRKITMADFIELIKKYKPSITLQMIEDYEKFRLDFERRVRKGEEENELEEK
FT                   LTLNDIGGYNEIKTELKELLELQLYHYKLLEQLRVPPIRGILLYGPPGVGKTMMAKALA
FT                   KTLNVKLIALSGAEIMYKGYEGAIAAIKEVFNRARENKPAIILLDELDAIASKRSYKSY
FT                   GDSSKIVNQLLTEMDGIRSLKEVVVIGTTNRLKAIDPALLRPGRFDKIIHMPLPNREER
FT                   LDILMKYIGKEECEKVDCGILADQTEGYSGADLAALAREAKMKVLKSILRGESNRTLTR
FT                   EDLIDALNKIHPSVKKRLSKGSSSNSDHETR"
FT   gene            complement(193503..195059)
FT                   /locus_tag="Ssol_0226"
FT   CDS_pept        complement(193503..195059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0226"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sid:M164_0231 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90522"
FT                   /db_xref="GOA:D0KMY7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACX90522.1"
FT                   /translation="MIDVAIIGGGHNGLVTAAYLAKAGLKVAVFERREIVGGASVTEEL
FT                   WPSIKVSTGAYVLSLLRPKIIEELKLREFGLKVYLKDPGLFLPFENGKKLYIWSSLEKT
FT                   KKEIEKFSKNDAKNYKKWVKFWDLFAEMADFFMLNPPPHIDEASNLINIFRGNVNEELA
FT                   LSFLRTFMQDAKSLLDEYFETDEVKSALAEDSVVGTFASPSTPGTAYVLAHHVIGEVNG
FT                   VKGAWGYVEGGMGEVTQALKRSAEHLGVEIYTNAEVDEVLVKNGRVEGIKLKNGKTINA
FT                   KIIVSNADPKTTFFKLLRNAELEEDFLRRVRALKNVGVSFKIVGYLEELPDFGNGKSLS
FT                   PEHIASELIMPNMEYIEKAYDDARALGYSREPWLSINIQSSVDPIVAPPGKFSFSIFGQ
FT                   YLVYDSKRNDEMKEKIAEITFEKIKEFAPNFKPIKYEVLTPLDIERRFGINGGNIFHLD
FT                   MTPDQLYFFRPLIGYSDYTTPIRGLYLCGSGTHPGGGVTGAPGYNAHVKILEDLRKGIY
FT                   K"
FT   gene            195183..196352
FT                   /locus_tag="Ssol_0227"
FT   CDS_pept        195183..196352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0227"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: sin:YN1551_2820 type I
FT                   phosphodiesterase/nucleotidepyro phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90523"
FT                   /db_xref="GOA:D0KMY8"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY8"
FT                   /inference="protein motif:PFAM:PF01663"
FT                   /protein_id="ACX90523.1"
FT                   /translation="MANTVIDNIDINLKINTYNLIANMDLILPDYSGENIYTLSCFVAE
FT                   YLGVKRQCLNKMNLNVNNRLVLALFDGLGWNVFSQAGVNLKAKKITTVFPSTTSTVLTT
FT                   LFTALTPAEHSVLGYNTFSKRLGGVVNTLRYTYPTVSDRDSIKDSVPFSSSFPHVKSYL
FT                   KEVQDKKTISIVPKGIENTEFSNATHGASGESKTYVNFWDAFYQLSQVLQQDTYDFIYF
FT                   YIPDVDTLSHRYGPYAEPTIKSARDILTSILEISQKHKKYSFLITADHGHVPVTETIIF
FT                   NNDQELLNMLDVPPYGDSRAIFLRTRYDVSTYLNRKYVSLKIFGKSDFERLLGKINDIT
FT                   ALPDYIAVPTDYRAFIFNFKDKDEYDKLKGHHGGLLQEEFEIPLVILNG"
FT   gene            196345..196884
FT                   /locus_tag="Ssol_0228"
FT   CDS_pept        196345..196884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0228"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   sin:YN1551_2821 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90524"
FT                   /db_xref="GOA:D0KMY9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="PDB:4Z1O"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMY9"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACX90524.1"
FT                   /translation="MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAK
FT                   LLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEA
FT                   VSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDK
FT                   KERFLNLYNQLLKIRK"
FT   gene            complement(196874..198535)
FT                   /locus_tag="Ssol_0229"
FT   CDS_pept        complement(196874..198535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0229"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: sid:M164_0234 methylmalonyl-CoA mutase, large
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90525"
FT                   /db_xref="GOA:D0KMZ0"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ0"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACX90525.1"
FT                   /translation="MDVEDRIKEWEEKVYSSWVKKRGERKKEFKTFSGIHIKPVYTPLD
FT                   VKGNYMEKLGLPGEYPFTRGIYPNMYRGRIWTIRQYAGFGSAEETNSRFRKLLEAGQTG
FT                   LSMAFDLPTQLGLDPDHELAYTEIGVVGVSMFHWKEMDIVMSGIPLDKVTTSMTINATA
FT                   MELLSMLIATSESRNINKSVLDGTVQNDILKEYIARKNFIYPPSPSMRYAIDIIEYSAK
FT                   YLPKWHPISISGYHIREAGADAVLEVAFTLADGMEYVRKTMERGINVDEFAPHLSFFFA
FT                   AYSDIFEEVAKFRAARRMWAKIMKEVFNAKKPESMMLRFHTQTGGAELTAQQPEINIIR
FT                   TTLQALAAVLGGTQSLHVNSYDEALALPTEKAAKIAIRVQQIIANESGAADVVDPLGGS
FT                   YYIEWLTDEIEERAWKIIDQVEKMGGMIKAIENGYPQAQIAESAYKIQKRIEEGDLGKV
FT                   GVNMYYEPEWIGTTEIFRVNPEVRERVISRLKKYKQERDEMKLRESLNNLRKIAEKENE
FT                   NLFPYMIDAIRAGATVGETSGVLRDIWGEYKEPSIF"
FT   gene            198615..199043
FT                   /locus_tag="Ssol_0230"
FT   CDS_pept        198615..199043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0230"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /note="TIGRFAM: methylmalonyl-CoA epimerase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; KEGG:
FT                   sin:YN1551_2823 methylmalonyl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90526"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ1"
FT                   /inference="protein motif:TFAM:TIGR03081"
FT                   /protein_id="ACX90526.1"
FT                   /translation="MQIENLDHIGIVVGNLDEAIKFYQNTFGMKLVHYELIPERGIKVA
FT                   FLVSNEKNETSIELLEPIDHNDMSNTVAKFLKNRGQGLHHLAIKVSDINRALEELTAKG
FT                   LQLVDTSPRKGARGHLVAFLHPKSVMGVLLELVQAKEL"
FT   gene            199117..199647
FT                   /locus_tag="Ssol_0231"
FT   CDS_pept        199117..199647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0231"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   sin:YN1551_2824 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90527"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ2"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACX90527.1"
FT                   /translation="MPKREEKDIFDLMDEWIREMEEEFERIEREFMRGFRGKGEGIRQF
FT                   GPYVYGFRITVGPDGVPKIEEFGNVRKIRGKPMISEEREPLADVIEKGDEIKVVAEVPG
FT                   VNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKK
FT                   ASSSDSGVDIKVE"
FT   gene            complement(199660..200184)
FT                   /locus_tag="Ssol_0232"
FT   CDS_pept        complement(199660..200184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0232"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /note="TIGRFAM: ZPR1-related zinc finger protein; ZPR1-like
FT                   zinc finger protein; PFAM: ZPR1-type Zinc finger domain
FT                   protein; KEGG: sin:YN1551_2825 ZPR1-related zinc finger
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90528"
FT                   /db_xref="GOA:D0KMZ3"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ3"
FT                   /inference="protein motif:TFAM:TIGR00340"
FT                   /protein_id="ACX90528.1"
FT                   /translation="MTVSEEPKVIFEETLICPVCKSKTLKAVDYLYNTPHTGKLVLSNW
FT                   YCENCGYKFRDVKPYETREPKLVEMKIENEDDLSALVYRSAFAKIVIPELGIEIEPAGM
FT                   SQGYISTIEGILEILLDQVGNFCDKECEDRIRSAMEGKIKFTLIIEDESGLSFIKSEKA
FT                   STRPLILTNSD"
FT   gene            200246..201817
FT                   /locus_tag="Ssol_0233"
FT   CDS_pept        200246..201817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0233"
FT                   /product="protein synthesis factor GTP-binding protein"
FT                   /note="PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein; KEGG: sid:M164_0238 protein synthesis
FT                   factor GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90529"
FT                   /db_xref="GOA:D0KMZ4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035531"
FT                   /db_xref="InterPro:IPR039263"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ4"
FT                   /inference="protein motif:PFAM:PF00009"
FT                   /protein_id="ACX90529.1"
FT                   /translation="MKLPRENDEGKVEYKLILSSVTPDRLQELATQMKYRLEEGDGEAF
FT                   YVIGVSDEGEIIGLSKGQLEESIATLNMITRLVNAKIVYRRDVEVRRDKYVAELLVRRY
FT                   KENLPVEVNVAVMGHVNAGKSTVTGALVLGRLDDGNGGLRTAIARHLHEVLSGRTSSIT
FT                   LRVIGFDDSGKIVNWQLKDPLDEAETTIKSTKIVRLIDLGGHERYLRTTLKGLLGYEVN
FT                   YVMLVVGADDGLSIMGKEHLALASVLKFPIFVVITKVDKYPEDRIKGIVNDIKSVLKIP
FT                   GINRLALEVEDEDDVVNSILAIKTRRVVPIFKISNVSGKGLDLLIKFLNLLPPEAKNLD
FT                   DRGAPLVYIDEIYNVTGVGTVVLGSVVRGKLNNNESVLIGPNKLGEFKEVKIKSIQVNK
FT                   VFVDSVLAGNIATFAIQGIEKESLRKGMVMVKGIPKVVRRFKARVFILHHPTTIREGYV
FT                   ATLHSYTIRQAVKFEKIQTGFLRTGDTSEIVLYFLYRPEYLEKGQIFVFREGRTRGVGI
FT                   VLEPIG"
FT   gene            complement(201807..202214)
FT                   /locus_tag="Ssol_0234"
FT   CDS_pept        complement(201807..202214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0234"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   sin:YN1551_2827 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90530"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ5"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ACX90530.1"
FT                   /translation="MTKTEGEITIKDLNKAKQFFSDYKNLLGCIPGVKEINGNNFKAYV
FT                   KFSFLTIEINGTVKKHEINGDNIDTLITIEGPGIIANISTLLTIIGNKIKWSSDYEVGG
FT                   PLANSLKKHIGSQAEEISKQIIECSVGKINQ"
FT   gene            complement(202211..202630)
FT                   /locus_tag="Ssol_0235"
FT   CDS_pept        complement(202211..202630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0235"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   sin:YN1551_2828 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90531"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ6"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ACX90531.1"
FT                   /translation="MKYEGSISINATKDQILKLLDNPDQVAQCFPGIKSFSKEGEEYKV
FT                   VGVTGIGFIKGEYRANVRFEKIDDNKRKIIAKGTGMNSNVDIDAIAEALDGKINYSADV
FT                   KVAGVLASVGARLMGSAVEKIINDLFNCIKERVIK"
FT   gene            202657..203226
FT                   /locus_tag="Ssol_0236"
FT   CDS_pept        202657..203226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0236"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; KEGG: sin:YN1551_2829
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90532"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ7"
FT                   /inference="protein motif:PFAM:PF01128"
FT                   /protein_id="ACX90532.1"
FT                   /translation="MNIGVIILAAGEGKRFGGDKLLAKIDNTPIIMRTIRIYGDLEKII
FT                   IVGKYVNEMLPLLMDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDMPFVTKED
FT                   VNKIINTFKPNCKAVIPTHKGERGNPVLISKSLFNEIEKLRGDVGARVILNKIKIEELC
FT                   FIECSEGVLIDIDKKEDLMRLRDFHP"
FT   gene            complement(203197..203703)
FT                   /locus_tag="Ssol_0237"
FT   CDS_pept        complement(203197..203703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0237"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: sin:YN1551_2830 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90533"
FT                   /db_xref="GOA:D0KMZ8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ8"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACX90533.1"
FT                   /translation="MKVFEKDQKVKVHLKVNGQDYEVETEPRRLLVHVLRELGFTGVHI
FT                   GCDTSNCGACTVIMDGRSVKSCTILAVEADGAEITTIEGLAKDGKLHPIQEAFWEKHGL
FT                   QCGYCTPGMIMEAYWLLKENPNPTEEEIREGISGNLCRCTGYQNIIEAVKLASEKLRME
FT                   IPKAH"
FT   gene            complement(203709..204545)
FT                   /locus_tag="Ssol_0238"
FT   CDS_pept        complement(203709..204545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0238"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   sin:YN1551_2831 molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90534"
FT                   /db_xref="GOA:D0KMZ9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D0KMZ9"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACX90534.1"
FT                   /translation="MYPPKFSYVIPDNVKEALEFLETHDDAKPLAGGHSLIPMLKLRIF
FT                   RPSYLVEIRRLPELKYIKMEGNVVKIGPIVTHYDIIKANIPLLSETASKIADPQVRNMG
FT                   TIGGSISHLDPSADYPAALIAMNAKVRIRSTKGERVENFSSFAKDMFTPDLNPGELVTE
FT                   IEVPLLKDYKFSYQKLERRAGDFAIVGVAVALKVNGDVIEDARIGLTAVNKTAVRASEA
FT                   EKILLSGKISEKLIEEAATKAMDYANPTSDIRGSAEYKKKMVKVMTKRAILAALNR"
FT   gene            complement(204635..204772)
FT                   /locus_tag="Ssol_0239"
FT   CDS_pept        complement(204635..204772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0239"
FT                   /product="Zinc finger, MYM-type"
FT                   /note="PFAM: Zinc finger, MYM-type; SMART: TRASH domain
FT                   protein; KEGG: sis:LS215_0256 TRASH transcription regulator
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90535"
FT                   /db_xref="GOA:D0KN00"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN00"
FT                   /inference="protein motif:PFAM:PF06467"
FT                   /protein_id="ACX90535.1"
FT                   /translation="MKCTVCGDEIRRKPYSFNYKGNVYYFCSPMCMAEFKKRPEKYVKK
FT                   "
FT   gene            complement(204778..205506)
FT                   /locus_tag="Ssol_0240"
FT   CDS_pept        complement(204778..205506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0240"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: sim:M1627_0226 uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90536"
FT                   /db_xref="GOA:D0KN01"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN01"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ACX90536.1"
FT                   /translation="MSGKVYLVGAGPGDPELITVKGLKILQRADVVVYDRLISKELLNF
FT                   CKIEAEKIYVGKNIGDYVIQDEINELLVKKAMENKVVVRLKGGDPYVLGRGEEECLYVI
FT                   SKGIECEVIPGITSAIAVPAYAGIPVTSRIYSASGFTIISGTKAEDKLIDEDYIPRKGT
FT                   LVILMGLRKIENMVNILIKLRNEREPVAVIENGTTENQRVFTGELKDLVNIVRSNNVTS
FT                   PAVIVIGEVVKFREYLWKFK"
FT   gene            complement(205506..206093)
FT                   /locus_tag="Ssol_0241"
FT   CDS_pept        complement(205506..206093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90537"
FT                   /db_xref="GOA:D0KN02"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN02"
FT                   /inference="similar to AA sequence:KEGG:M164_0245"
FT                   /protein_id="ACX90537.1"
FT                   /translation="MDVVQIAKYIGFSLLIISIIVYVFVDPVDRLLSYQGPILSGGLLG
FT                   WYTLISNTPREKFIENDGEKIPVVSLLMRKRAIIFVTLGLVLIIPWLMPQIYPVVLKIQ
FT                   WLFVISFLCEFLGGFVIGYIIPSLKFTEKLLLFSLGFAGDTIYLLLLYLASDIFNIPYQ
FT                   LLLNSVIILVYGIKFPEGIVFAIYIMRKIGGI"
FT   gene            complement(206093..206332)
FT                   /locus_tag="Ssol_0242"
FT   CDS_pept        complement(206093..206332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90538"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN03"
FT                   /inference="similar to AA sequence:KEGG:M164_0246"
FT                   /protein_id="ACX90538.1"
FT                   /translation="MEELDLTKAESGCGANSASIRLLRFWLEVGGNKEIKVIALKGTQE
FT                   EQVNMWIDVMSEKGVKLIQKKDEKDKIVYTIFLP"
FT   gene            complement(206334..207161)
FT                   /locus_tag="Ssol_0243"
FT   CDS_pept        complement(206334..207161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0243"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sia:M1425_0229
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90539"
FT                   /db_xref="GOA:D0KN04"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN04"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACX90539.1"
FT                   /translation="MYADLIEREITQDYKVNLDLKLDNAYIAGAGDSYAVALTIEGKTN
FT                   GRFKALDPFEGLHYENLDRPLVIVSVSGRPKSNILLATKFKGKTRLYVITANEDSQLAR
FT                   LADYLILIPYKPIIPLPGTLSFLMSLSAVYSLAGEQADEIKESGRLLNLANNPFFVGHK
FT                   ENYGIAYYAMLKFAEIFGYATNSERFEQFCHSPIFMTANRQIVLFRSDNEREKELINSI
FT                   DYTDTQATDCSGAFCNSIILIKSIVNKMRKEKWDKIYFLENKKILNISSKMIY"
FT   gene            207207..208358
FT                   /locus_tag="Ssol_0244"
FT   CDS_pept        207207..208358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0244"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: siy:YG5714_0233
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90540"
FT                   /db_xref="GOA:D0KN05"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN05"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACX90540.1"
FT                   /translation="MKVLIKTDLVLGAPKTLRDVYIGIDEGQIKVISKEKPEDYDYAEY
FT                   VIGGKNRVVAPGFVTTHSFLYLYPFRYRVFSGKANAFQLMSTLTPNDIYYFSLMGAYHL
FT                   LKTGVTTVVTSGPNLDMIARAISEVGLRPVLAVGVDCPDSKEDWEREFTTLYNRWSSKN
FT                   ENRVILRLCSNEYSKEVFELSQQYDFPVLLERFVSLENISGNPINVIGLGGGARKDLDI
FT                   IKQKGFHLASTPSYEVSQFPLSQYKPSISLDLSPTFDIRHEVSTSITRLILTPEEALNA
FT                   MTIWGLLQLKYNDRGVLENGKVADLVIFEVKEPPTFPLDYESPYESIVFNLSTPETVLV
FT                   SGEAILDGGVPLNIGIKHIEKAIERLEDIDKKVTRPARYMEKD"
FT   gene            208312..209091
FT                   /locus_tag="Ssol_0245"
FT   CDS_pept        208312..209091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0245"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   sin:YN1551_2838 protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN06"
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /protein_id="ACX90541.1"
FT                   /translation="MIKRLQDQQDIWKRIEIVGDIVIIGVPFNKKPEDLVEIANEILST
FT                   FPYVKSVWGRHRDVNGTYRLSTYVHLAGEKRSETVYKEHKCKYFLDFTKVFFSEKLSYE
FT                   HLRVATQVKRDEIIINMFSGFGPFSILSAVLGRPKIVYSIDLNPYAYYYMMVNVELNKA
FT                   YEVLPIYGDAFKRIYELEDADRIIAPLPELADKAYEVALQKVKKGGIIHLYTEVETNKG
FT                   EDPVRIAMNKYRGSYFGRIVRSVNPHKYHVVVDIKAN"
FT   gene            209289..210566
FT                   /locus_tag="Ssol_0246"
FT   CDS_pept        209289..210566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0246"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   sin:YN1551_2839 glutamine synthetase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90542"
FT                   /db_xref="GOA:D0KN07"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN07"
FT                   /inference="protein motif:PRIAM:6.3.1.2"
FT                   /protein_id="ACX90542.1"
FT                   /translation="MSKENIFDALKSGKIDYVRVEFVDILGNTKGRSLRRAEFENVIND
FT                   NKGVDYPESLALMDYKDRPIKSRYEDIIAIPDLNTFVAIPYLERTARVLSFLAQPDGLP
FT                   YPYCSRSILNKAIEKLKEAGYTLQVSFEPTFYLLNSALNPADYSKAFSLEGLLEQQNFL
FT                   KLLIKYLEEIDIKVETINKHYGPGQYEVKLSQKPVLEAADSLISSREVIRDTAKMNNVI
FT                   ATFMPKPFKDYPSSSMDITLSLQTVDGKDIMYDPNDSKGIGLSKIAYNFISGILEHLPS
FT                   ILSIAAPTVNSYKRFKEVVTPNMPGIGSERHYIVRLPSYYKDTHQVEFRLADPLANPYI
FT                   LLASMIYAGLDGIERNLMANVNEYYGTLPQTLKESLSRLENDTYMKYNLGQDLISIYIN
FT                   IKNIEIEEYESQITEWERDYYLKAGW"
FT   gene            210567..211553
FT                   /locus_tag="Ssol_0247"
FT   CDS_pept        210567..211553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0247"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   siy:YG5714_0236 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90543"
FT                   /db_xref="GOA:D0KN08"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN08"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX90543.1"
FT                   /translation="MLGAILKNFGEELSLEDVREPSNGIVLKVLATGLCHGDLHVINGD
FT                   WRYEIKVELPKILGHEIVGEVVKGNGTFKEGDKVLVYNSIGCGKCKYCASKKYQYCEKV
FT                   KIIGLNINGGFAEYVSVPSDNILLRVDGEPVKLAPLADAGITAYSSAKGITNEDSVLII
FT                   GTGAVALLALQILKLKGARVTVIGHNKNKLEKAKELGADEVINIKYDSTIASEVKESKF
FT                   DYIIDYVGSDYTLSDSMWLLNREGELRIIGEFGGTITVPEQLLVLKGLKVRGILYGSFD
FT                   DLISVYKLYNEGKIRPIVNTYKLRDINKAIRDLRDGRVIGRAVIVPP"
FT   gene            complement(211550..211882)
FT                   /locus_tag="Ssol_0248"
FT   CDS_pept        complement(211550..211882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0248"
FT                   /product="Ribosomal protein L13e"
FT                   /note="PFAM: Ribosomal protein L13e; KEGG: siy:YG5714_0237
FT                   50S ribosomal protein L13e"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90544"
FT                   /db_xref="GOA:D0KN09"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN09"
FT                   /inference="protein motif:PFAM:PF01294"
FT                   /protein_id="ACX90544.1"
FT                   /translation="MLKLRLAVRGHLDLKLKSFKGTTLLDYGGTPMEFPKAVIKRPNYH
FT                   FEYPHKRKYKRIGRGFSVGELEKAGLNINKARKLGIFVDIRRKSVHEENVETLKKFSEQ
FT                   LSNQKP"
FT   gene            complement(211824..212837)
FT                   /locus_tag="Ssol_0249"
FT   CDS_pept        complement(211824..212837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0249"
FT                   /product="RNA 3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="KEGG: sid:M164_0253 RNA 3'-phosphate cyclase;
FT                   TIGRFAM: RNA 3'-phosphate cyclase; PFAM: RNA 3'-terminal
FT                   phosphate cyclase; RNA 3'-terminal phosphate cyclase insert
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90545"
FT                   /db_xref="GOA:D0KN10"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN10"
FT                   /inference="protein motif:TFAM:TIGR03399"
FT                   /protein_id="ACX90545.1"
FT                   /translation="MIEIDGSFGEGGGQILRTSLTLSVITGKPFRIFNIRANRPNPGLQ
FT                   RQHLWAVRAMKMISNAETKGDEVGSKELTFIPHEIKGNSIIDIDIGTAGSVTLIMQTMI
FT                   PAIINKNMRIKIKGGTDVPKSPTIDYIRLVYLEILRKIGIESKVNLIKRGHYPEGGGEV
FT                   IIENVNGNPSDFSLLELGKLIMIKGISHVSSLPSHIAERQKDSAKAILSKLGVQIEIET
FT                   DVRQGEVSKGSGIALAAIGEKSIIGADSLGERGKRAEIVGEEAARKLIDNLNTKAAVDV
FT                   HMSDMLMIFTSLFGGEYIGAELTSHAYTNMEIIRKFLDVKIEISGKRPFRFKAKIF"
FT   gene            212851..213294
FT                   /locus_tag="Ssol_0250"
FT   CDS_pept        212851..213294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90546"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN11"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2843"
FT                   /protein_id="ACX90546.1"
FT                   /translation="MKIKLKSLVRVIGEEELAVIPLAENEYYVECLNFYEDVEGGRQAR
FT                   LVVVVDKYGIIRQDQVNFIKGKKTFVDAIGVEDDFRKINSVLKLDRVARMFKVPLYFDI
FT                   EIVEKPDVSKRGIRGLYNYLSVHKEIDIGKLRGLVNLSIEELV"
FT   gene            complement(213271..214329)
FT                   /locus_tag="Ssol_0251"
FT   CDS_pept        complement(213271..214329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0251"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   sis:LS215_0268 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90547"
FT                   /db_xref="GOA:D0KN12"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN12"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACX90547.1"
FT                   /translation="MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVAT
FT                   ANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIEIASI
FT                   DEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPNGI
FT                   KVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKA
FT                   KYLISLARDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIP
FT                   KAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKF
FT                   IEAIGLDKFFDT"
FT   gene            complement(214326..215177)
FT                   /locus_tag="Ssol_0252"
FT   CDS_pept        complement(214326..215177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0252"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sid:M164_0256 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90548"
FT                   /db_xref="GOA:D0KN13"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN13"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACX90548.1"
FT                   /translation="MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAV
FT                   AVTKLGHSAKLLAKVGKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRNDGTLS
FT                   MVRRLGASILLTREDVKRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESV
FT                   DVDILYVNEKEYEMIEDKNIRARFIVIKMGKKGAKIITETEECSVEPIQVEKIVDTTGA
FT                   GDTFDAAFNVTYSEDKDIVKSLQVASVASGLKVSRIGGISSPTLEEVREYLRKKKPNVI
FT                   CK"
FT   gene            215406..216764
FT                   /locus_tag="Ssol_0253"
FT   CDS_pept        215406..216764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0253"
FT                   /product="TIP49 domain protein"
FT                   /note="PFAM: TIP49 domain protein; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase; KEGG: sid:M164_0257
FT                   TIP49 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90549"
FT                   /db_xref="GOA:D0KN14"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN14"
FT                   /inference="protein motif:PFAM:PF06068"
FT                   /protein_id="ACX90549.1"
FT                   /translation="MSEIRELKKPIREKASIHSHIKGLGLDSNGKAKFIADGLVGQAEA
FT                   REAAGVVVQLIKQGKMSGKGILFVGPPGTGKTALAVAIARELGEDTPFTAINASEIYST
FT                   ELKKTEILTQLIRKSIGVRIREKRLVYEGVVKNRKIKVARSRLNPYSQAPVEAQITLTT
FT                   KDDERTLSVGEEIAQQLVSLGVKKGDVIMIDAQTGQVIVEGKAKGFEGAKTYDIETTKV
FT                   LEMPTGPVRKEKEITTTLTLNDLDLNLAARNLAVTAIFSFFTEREINEDVRKEVDRLVK
FT                   DWINQGRAELVVGVLFIDDAHTLDLEAFSFLTRALESELAPILILATNRGITKIRGTDI
FT                   ESPHGIPLDLLDRLLIIPTRPYNADEIKEIIKIRADELEIELDPQALEELTKIGVENSL
FT                   RYSVQLLEPSLVIAQRNNRSVIKVEDVLEASKLFSDVKRSVKFVKEYENLLLK"
FT   gene            216846..217412
FT                   /locus_tag="Ssol_0254"
FT   CDS_pept        216846..217412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0254"
FT                   /product="GMP synthase, small subunit"
FT                   /note="TIGRFAM: GMP synthase, small subunit; PFAM:
FT                   glutamine amidotransferase class-I; KEGG: sid:M164_0258 GMP
FT                   synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90550"
FT                   /db_xref="GOA:D0KN15"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN15"
FT                   /inference="protein motif:TFAM:TIGR00888"
FT                   /protein_id="ACX90550.1"
FT                   /translation="MKVGLVYYGGQYNHLILKNVKYLGAEIEVVPPHKPVEELRKFDCV
FT                   IFSGGPYSVSEEIHKMGNSPLYIRELKVPMLGICLGHQLIAYVLGGIVRRALNPEYGLT
FT                   RINIFDEDTILKGFSQQLNVWESHNDEVVEPPSGFRVLASSANARVQAMVNSSNSIFGV
FT                   QFHPEVKHTERGIEVFKNFLGVCRK"
FT   gene            complement(217415..218203)
FT                   /locus_tag="Ssol_0255"
FT   CDS_pept        complement(217415..218203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0255"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: Circadian clock protein KaiC central region;
FT                   KaiA binding; SMART: AAA ATPase; KEGG: sin:YN1551_2848
FT                   putative circadian clock protein, KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90551"
FT                   /db_xref="GOA:D0KN16"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN16"
FT                   /inference="protein motif:PFAM:PF06745"
FT                   /protein_id="ACX90551.1"
FT                   /translation="MVSRLSTGIPEFDKLVQGGIPQGFFIALTGEPGTGKTIFSLHFIA
FT                   KGLKEGDPCIYVTTEESRDSIIRQAKQFNWDFEEYIEKKLIIIDALMREKEDQWALVNL
FT                   TPEELINKVIEAKQKLGYGKSRLVIDSVSALFLDKPAMARKISYYLKRVLNKWNFTIYA
FT                   TSQYAITTSQAFGFGVEHVADGIIRFRRMVKNGELHRYILIEKMRQTDHDKHVWEIDIV
FT                   NGKGIVLKGRLEERREDYTLPEKVKRQIVESGKKAEEELK"
FT   gene            218282..218767
FT                   /locus_tag="Ssol_0256"
FT   CDS_pept        218282..218767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0256"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="PFAM: tyrosine specific protein phosphatase; SMART:
FT                   Protein-tyrosine phosphatase, catalytic; KEGG:
FT                   sid:M164_0260 dual specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90552"
FT                   /db_xref="GOA:D0KN17"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN17"
FT                   /inference="protein motif:PFAM:PF00102"
FT                   /protein_id="ACX90552.1"
FT                   /translation="MYWVRKRIIGGSGLPYIENEILEWRKEGVKRVLVLPEDWEIEEGW
FT                   GDKEYYLTVLKKNELQPLHVPIPDGGVPSDSQFLTIMRWLLSVKEGNLVHCVGGIGRTG
FT                   TILASYLILTEGLDAESAINEVRLVRPGAVQTYEQEMFLLRVEGRRKYWLKSIFSNS"
FT   gene            218737..219333
FT                   /locus_tag="Ssol_0257"
FT   CDS_pept        218737..219333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0257"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="PFAM: Endonuclease V; KEGG: siy:YG5714_0246
FT                   deoxyribonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90553"
FT                   /db_xref="GOA:D0KN18"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN18"
FT                   /inference="protein motif:PRIAM:3.1.21.7"
FT                   /protein_id="ACX90553.1"
FT                   /translation="MVEKHFLEFLEKFQYLISKNVKITHYGVENVKKICAVDVAYKGNL
FT                   GFSVGVSMDIRSEEYNYKSYVGEVNFPYIPGFLFMREAPLMIKAIEGLECQLLLVDGHG
FT                   IAHPRKSGIAAVIGVLLDFPTIGVAKSRLTGELVNENEITYVYLNGEKVGVKFGRYFYS
FT                   PGNGVDLQDCIELGKRGYPKVLKIADMLTKKIKKE"
FT   gene            219344..219955
FT                   /locus_tag="Ssol_0258"
FT   CDS_pept        219344..219955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0258"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   siy:YG5714_0247 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90554"
FT                   /db_xref="GOA:D0KN19"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN19"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACX90554.1"
FT                   /translation="MVNLIMKIEVPTIPEHKEIVLDPTNTALIIVDMQNDFVRKNGKLS
FT                   VPTAEATIPYIKRLIEKARSSNALVIYTQDWHMKDDPEFKIWGEHALAGTWGAEIINEL
FT                   APEKEDFIIKKYRYDAFFESSLDYILRVKNIKNTVITGTVANICVLHTAGSAALRWYNV
FT                   IMPKDSISAITEFDYYAALRQVDFLYKGIITTADGIKFER"
FT   gene            219964..220953
FT                   /locus_tag="Ssol_0259"
FT   CDS_pept        219964..220953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0259"
FT                   /product="phosphoesterase DHHA1"
FT                   /note="PFAM: phosphoesterase DHHA1; phosphoesterase RecJ
FT                   domain protein; KEGG: sin:YN1551_2852 phosphoesterase
FT                   DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90555"
FT                   /db_xref="GOA:D0KN20"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN20"
FT                   /inference="protein motif:PFAM:PF02272"
FT                   /protein_id="ACX90555.1"
FT                   /translation="MEYYAIVHNDFDGTASAAVYARAVKALPKNVFFTEPNKLHSLLAS
FT                   LELRGVYNIMIADLGINASTFNEIVKNLKKLIDQGANVEWFDHHVWKDEWKEELRKIGV
FT                   SVYHDTSTCGAGVIYKYKNPNDEFSRKLSSADCSVDIWLHDDPMGEKLRRIVENNKDYS
FT                   WKNELIKMFYNGILWNNTFDKTLEDVVSKELEGYKKVMKSYKLIQINGHKVVVAVRWKG
FT                   PPDISYASQFLMTRTNASVFASANGKSISFRSKEIDVRQFAVKLGGGGHPLAAGAQLKV
FT                   PIIYRFLNRIGIKGPMLNWVTKVVQNTIAEVGFVGYQESKKSSTPSPY"
FT   gene            complement(220950..221636)
FT                   /locus_tag="Ssol_0260"
FT   CDS_pept        complement(220950..221636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0260"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sid:M164_0264
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90556"
FT                   /db_xref="GOA:D0KN21"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN21"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX90556.1"
FT                   /translation="MLIISTSDIHSPRYLTEFFLAVRELGNIKADLALLAGDLVERGEY
FT                   VHFTPVYNALKNRVRQIVSIFGNEDFIENRRYYRENYGDIIWLEDSKVETEIDNKKIII
FT                   IGSEGVLEKPTVWQVSNGITEDFYMKRLEKITEMTCNSKADIKILLTHYATTFQTVFGE
FT                   RKSVYPHLGYRVLEELSTKGKDCLPNIAIHGHAHYAKRTLSVVKNVRVYNVALPANRKI
FT                   ITIHTL"
FT   gene            221668..222807
FT                   /locus_tag="Ssol_0261"
FT   CDS_pept        221668..222807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0261"
FT                   /product="protein of unknown function DUF763"
FT                   /note="PFAM: protein of unknown function DUF763; KEGG:
FT                   sid:M164_0265 protein of unknown function DUF763"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90557"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN22"
FT                   /inference="protein motif:PFAM:PF05559"
FT                   /protein_id="ACX90557.1"
FT                   /translation="MEVEGIADLPLHTGHVPPWLVPIMKRLSKAIVEIMVLELGPQKVV
FT                   ERFSNPLWFQAFNNIIGMDWDSSGSTTVTLGILKDIVNPKAHGFAVLGGKGKNALKVPE
FT                   EVDALVFDIDRNKIKNISKIVAKVDSTLVQDGHQLYHHSMLVTEDGRWSIIQQGMNLET
FT                   KFARRYHWKETENFIVEPHSAISGIKTDIAVNVIDKEKDKTRKLILDLLRENPNKIVSL
FT                   YTQAMAMLKGQTTLDLWIKGGSIAFVSKGARLIYMKPVDVNRIKQVLREIYEVNPLTFE
FT                   EALVSGLGPSTARALYLVADLIYNEPPSYKDPVNYPYDPFKYAFAIGGKDGIPYPVNRK
FT                   VAWEVIFTLEDFITRAKLEESDKRLALRRLMELSKGIKK"
FT   gene            222854..223576
FT                   /locus_tag="Ssol_0262"
FT   CDS_pept        222854..223576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0262"
FT                   /product="Putitive phosphate transport regulator"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   sim:M1627_0248 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90558"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN23"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACX90558.1"
FT                   /translation="MGNCISRKVLKYSCLQYSLRMFKLKLNNKEEEIFERITFTAELIG
FT                   EAVKILQNEVDHVRKGEYDQVPADLIKIKSIHERAGMLREEILSTLYGEAFLPDFKESM
FT                   VMLAQALFNTLSSVKDAARALGSRKVDAKCITILSDMLITYLALVNEASFKIHELTRHL
FT                   GSDVEVSLKLSREIQAMEREGDDIKDTLLQRLYEIEKQIDIISILQMKDVIIFIDDILD
FT                   SLEDATLSVEIFYATLKS"
FT   gene            complement(223565..224551)
FT                   /locus_tag="Ssol_0263"
FT   CDS_pept        complement(223565..224551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0263"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: sis:LS215_0280
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90559"
FT                   /db_xref="GOA:D0KN24"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN24"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACX90559.1"
FT                   /translation="MAITIIISTQTVIEYILFIVGLVSCYVIGANNNATSLGILFATNA
FT                   VKKRYAYILNMISIFVGVVLGSLTMLHSVYGVVYGNSLYVIIAILTSLSSSIITFYYLN
FT                   KSGIPSSLSQTFYPSIAILTLISHGFVKLDWVKLWVIVSSWIISPIIAIGFSLLFYLML
FT                   NKVVSGEIRIIKQIAIYRNLILFSSAFTSFIVGANAIGIIVSASLVTAPAYFVIPLYGL
FT                   AAALGVLTSQRIAIRVGFRITKLGYLGASSALIGSNVINEIFTILGIPLSITQTIVGGI
FT                   IGLSFRSFTSDVKKQVMQIFRSWSTSPIFAIVLSLAIFGVIKSILGL"
FT   gene            complement(224511..224780)
FT                   /locus_tag="Ssol_0264"
FT   CDS_pept        complement(224511..224780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0264"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: sid:M164_0268 putative transcriptional
FT                   regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90560"
FT                   /db_xref="GOA:D0KN25"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN25"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACX90560.1"
FT                   /translation="MFMYLYHILFMIHMTTLKKVDEQTFELEITGTVTISFKLEDEFIR
FT                   KVDNIARNLGYANRSDFIRDAIIYYLGYLKRNGNNNNNFDTDRY"
FT   gene            complement(225037..226089)
FT                   /locus_tag="Ssol_0265"
FT   CDS_pept        complement(225037..226089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0265"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   sto:ST1957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90561"
FT                   /db_xref="GOA:D0KN26"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN26"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90561.1"
FT                   /translation="MKHENTTKPAKFNRDFARSALKIIYSVLTKILFPEELLSALLKAS
FT                   GSYLSRLGKDGRRALRKLNAVQVEDVRDALRKMGRMTLRGVRDRRVAVDFHAIPQYHAD
FT                   KSFLSRIKPTKGTSWGLVQAAIFLLGRKRSFLDVIPVTVKNVAEGFKAVMEVIVKELEE
FT                   DKLRLVMVFADREFAVNEVIRYLLELGLDFVISAKAQMYKKYKGMLQDVDVSFGGVRYT
FT                   GFLCVRHGSGAYLIILRKEDDKIIAFLVRKEMDLYDAILLAEMYRERWGIENAFRSLEE
FT                   FRIRTRTCDVRKELVLVLLSYLLLNVWFLIRSWRKVKLWEFSVSLSNLLDREVRVEQGR
FT                   AFREVKTPFP"
FT   gene            226272..228419
FT                   /locus_tag="Ssol_0266"
FT   CDS_pept        226272..228419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0266"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: sim:M1627_0251 DEAD/DEAH box
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90562"
FT                   /db_xref="GOA:D0KN27"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2VA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0KN27"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACX90562.1"
FT                   /translation="MSLELEWMPIEDLKLPSNVIEIIKKRGIKKLNPPQTEAVKKGLLE
FT                   GNRLLLTSPTGSGKTLIAEMGIISFLLKNGGKAIYVTPLRALTNEKYLTFKDWELIGFK
FT                   VAMTSGDYDTDDAWLKNYDIIITTYEKLDSLWRHRPEWLNEVNYFVLDELHYLNDPERG
FT                   PVVESVTIRAKRRNLLALSATISNYKQIAKWLGAEPVATNWRPVPLIEGVIYPERKKKE
FT                   YNVIFKDNTTKKVHGDDAIIAYTLDSLSKNGQVLVFRNSRKMAESTALKIANYMNFVSL
FT                   DENALSEILKQLDDIEEGGSDEKELLKSLISKGVAYHHAGLSKALRDLIEEGFRQRKIK
FT                   VIVATPTLAAGVNLPARTVIIGDIYRFNKKIAGYYDEIPIMEYKQMSGRAGRPGFDQIG
FT                   ESIVVVRDKEDVDRVFKKYVLSDVEPIESKLGSERAFYTFLLGILSAEGNLSEKQLENF
FT                   AYESLLAKQLVDVYFDRAIRWLLEHSFIKEEGNTFALTNFGKRVADLYINPFTADIIRK
FT                   GLEGHKASCELAYLHLLAFTPDGPLVSVGRNEEEELIELLEDLDCELLIEEPYEEDEYS
FT                   LYINALKVALIMKDWMDEVDEDTILSKYNIGSGDLRNMVETMDWLTYSAYHLSRELKLN
FT                   EHADKLRILNLRVRDGIKEELLELVQISGVGRKRARLLYNNGIKELGDVVMNPDKVKNL
FT                   LGQKLGEKVVQEAARLLNRFH"
FT   gene            228379..228555
FT                   /locus_tag="Ssol_0267"
FT   CDS_pept        228379..228555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90563"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN28"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2859"
FT                   /protein_id="ACX90563.1"
FT                   /translation="MSKKLQDYLIDFINLQNGETFIVRDECEKLKKLKLILLALGQEVQ
FT                   LKDCEELICTKRV"
FT   gene            complement(228557..230128)
FT                   /locus_tag="Ssol_0268"
FT   CDS_pept        complement(228557..230128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0268"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: siy:YG5714_0255
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90564"
FT                   /db_xref="GOA:D0KN29"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN29"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACX90564.1"
FT                   /translation="MSLYEKPPMDKLIEDLKILKEKAYKGGGEERVNFQHSKGKLTARE
FT                   RLNLLFDEGTFNEILTFATTRATEFGLDRNKFYGDGVIAGWGKVDGRQVFAYAQDFTVL
FT                   GGSLGETHANKIVRAYELALKVGAPVIGINDSGGARIQEGALSLEGYGAVFKMNVMASG
FT                   VIPQITIMAGPAAGGAVYSPALTDFLIMIKGDAYYMFVTGPEITKVSIGEEVSYQDLGG
FT                   AIVHATKSGVVHFVAENEQDAINIAKRLLSYLPSNNMEEPPYIDTGDPADREVQGAESI
FT                   VPTDSVKPFDIRDLIYNIVDNSEFLEVHKLWAQNITVGFGRINGNVVGIIANNSAYYGG
FT                   AIDIDAADKAARFIRFCDAFNIPLISLVDTPGYVPGTDQEYKGIIRHGAKMLYAFAEAT
FT                   VPKITVIVRRSYGGAHIAMSIKSLGADLVYAWPSAEIAVTGPEGAVRILYRREIQNAQN
FT                   PEEFLKQKIAEYKKLFANPYWAAEKGLIDDVIEPKDTRKVISRGLEILRNKREFRYPKK
FT                   HGNIPL"
FT   gene            complement(230153..230662)
FT                   /locus_tag="Ssol_0269"
FT   CDS_pept        complement(230153..230662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0269"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: sid:M164_0271 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90565"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN30"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ACX90565.1"
FT                   /translation="MRLFRIYSELGDTFLVSYDQIGNNVDKIKIGDNIYEVKYLGPGNR
FT                   ENEYLFEVNGKKYYVYMEQDGTLIFNNQDFLRLDKVTEIPVKGEERVEEIIRGKEGEIV
FT                   SPLFGRVVKIRVKEGDAVNKGQPLLSIEAMKAETVLSSPIGGIVQKILVKEGQGVKKGD
FT                   ILVVIK"
FT   gene            complement(230662..232182)
FT                   /locus_tag="Ssol_0270"
FT   CDS_pept        complement(230662..232182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0270"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   siy:YG5714_0257 carbamoyl-phosphate synthase L chain
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90566"
FT                   /db_xref="GOA:D0KN31"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN31"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACX90566.1"
FT                   /translation="MPPFNKVLVANRGEIAIRVMKAVKEMGMKAVGVYSDADKYALHVK
FT                   YADEAYWIGPPPALESYLNIERIIDAAEKAHVDAIHPGYGFLSENASFVEAVEKAGITF
FT                   IGPSASVMNKIKDKLEGKMIAKKAGVPISPGPLTPVDNVNEALKIAEEIGYPIMLKAAG
FT                   GGAGVGIIKVDNPSELAEAFERSKRLAYSAFGRAEIYIEKAAIKPKHIETQLIGDKYGN
FT                   YVVAFERECTIQRRNQKLIEEAPSPSIKEEERKEIIEASIRFGKEINYFTLGTMEFVFS
FT                   PVTREFYFLELNKRVQVEHTVTEFITGIDLVKLQIRLASGEYLPFSQEDLKIRGHAIQF
FT                   RINAEDPLNNFTPQSGYITYYREPTGPGVRVDSGIESGSWVPPYYDPLVSKLIVYGQNR
FT                   DYAIQVGLRALNDYKIGGVKTTIPLYKLILQDPDFWEGNFTTAYISEKMEYFTTKLKEE
FT                   QEMQIAMAISIFNRGLIKRKKTEQKVLTSKSNWKTYGIISQSSPKVLW"
FT   gene            complement(232443..234053)
FT                   /locus_tag="Ssol_0271"
FT   CDS_pept        complement(232443..234053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0271"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: siy:YG5714_0258
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90567"
FT                   /db_xref="GOA:D0KN32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN32"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX90567.1"
FT                   /translation="MNEIVIILLASLASLGRVFLTIGLSIITGWFLGYIAIKNKAFENI
FT                   YISVLEVFESVPVISFFPVVLIFFVYRIGGYLGIELAVDFLVFTAVVWNIWIGIYQAFK
FT                   TVPSDLLEVSENYRLGFLGKMAKLYIPYSWPRIAANLIPSFADAFFYITVSEVFSIGSS
FT                   SYHVFGIGTIIAAFTASQEYNLALEGLGVLAILITIFTYLLRRFANYTVSKYGLDTEIK
FT                   VAKRGRMRIRYTTRMSNTIAPFVKLSKYVTRIGSRTTISEEETRRNLPWRYLGIGISVF
FT                   LLGLLVYGAFSTISSVPKSVLLYLISNTPNVLFNLLIDYVRVLFIAIVSLVFSIFLGYF
FT                   IATHERVEGMLIPIIQAYASFPAPAYFPLLLMATISFIHSVFGSWTNEFYVILLGFIST
FT                   FYYVFYSYWLGIKNMPNQYWEIMKNYNFSFWQKLRYVIVPSTFPYIIAGLSSTINSAWG
FT                   GLAIGEYWTNIVNGYTLQVSHGIMKNIAVATANGNVPLAAWDSLIFGIVVIIYSIFFTR
FT                   KMMDLAREKYVAEEGIYLA"
FT   gene            complement(234046..234744)
FT                   /locus_tag="Ssol_0272"
FT   CDS_pept        complement(234046..234744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0272"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: siy:YG5714_0259 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90568"
FT                   /db_xref="GOA:D0KN33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN33"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX90568.1"
FT                   /translation="MYTKDKELIAIVGPSGIGKSTLLRVLGGFVKPLKGEIRLLGKKII
FT                   NPTPKIALIHQSIATFPWLTALENVKLGLKYRKLPKEEEDRLAKHMLEVVGLQGFEDFY
FT                   PKQMSGGMRQRIAIARALAANPLVLLMDEPFSHLDELTAEGLRQEVHSMLFNESTTLHS
FT                   VVLVSHNLSEVVELADRVYVLNGRPATVIGEVEIKLERPRNPKDESFQEYLDILYALLT
FT                   PVKKGGNSNE"
FT   gene            complement(234886..235092)
FT                   /locus_tag="Ssol_0273"
FT   CDS_pept        complement(234886..235092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90569"
FT                   /db_xref="GOA:D0KN34"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN34"
FT                   /inference="similar to AA sequence:KEGG:M164_0275"
FT                   /protein_id="ACX90569.1"
FT                   /translation="MLTFVDYKIGMESVRVVYGYTVYHLLTTIPFNIIYLCLIFLTELL
FT                   ILNSFIKIRRIFNIFRRRDKSPT"
FT   gene            complement(235160..235657)
FT                   /locus_tag="Ssol_0274"
FT   CDS_pept        complement(235160..235657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0274"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   sid:M164_0276 3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90570"
FT                   /db_xref="GOA:D0KN35"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN35"
FT                   /inference="protein motif:TFAM:TIGR02087"
FT                   /protein_id="ACX90570.1"
FT                   /translation="MIIEGPVIKFGDKIDTDIIIPARYLKYTDPQYLAQHAMEPLDPEF
FT                   YKKASKGVVIVAGKVFGMGSSREQAAIALKAAGVKAVIAESFARIFYRNAINNGLPVIT
FT                   LPNSTREINENEYVRINVETGEILVGNKVLKGKGITGMALEILQAGGIMEYLKKIQTVN
FT                   RN"
FT   gene            complement(235658..236905)
FT                   /locus_tag="Ssol_0275"
FT   CDS_pept        complement(235658..236905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0275"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase;
FT                   homoaconitate hydratase family protein; PFAM: aconitate
FT                   hydratase domain protein; KEGG: sin:YN1551_2867
FT                   3-isopropylmalate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90571"
FT                   /db_xref="GOA:D0KN36"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN36"
FT                   /inference="protein motif:TFAM:TIGR02086"
FT                   /protein_id="ACX90571.1"
FT                   /translation="MSAKTLTEKILSRASGKDVSPGDVIEAKVDLVAFHDLTGYHVIEV
FT                   MEKANMIKVFDKSKLVIAFDHLAPPPDVRSAEIQGYIRKFVKSEGIPNFYDINYGILHE
FT                   VMIEQYANPGQVILAADSHTTTSGAVGAFAQGMGASDIAAAVITGKTWLVVPQPFKVVL
FT                   EGKPAKWITGKDVALKLLGDFKADYFNGMTLEIFVKDPLSFPMDYRATVSNMGIEMNAD
FT                   ALMFVPDQETKRYIKEMRGYEPELVTPDNGAKYVDEYTIQLDKMEPLVAAPHSVDNVKV
FT                   VNELEGTPVDQVYIGSCTNGRLSDFEIAAKIMKGKKVKSRCIAIPASYRMFKEALERGY
FT                   IQTLVDAGCIVTYGTCGPCLGGHFGIAGPGENIVSTSSRNFKGRMGSNEAKIYLSGPAV
FT                   AAISALEGKIADPRVV"
FT   gene            complement(236994..238289)
FT                   /locus_tag="Ssol_0276"
FT   CDS_pept        complement(236994..238289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0276"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein; KEGG: sia:M1425_0260 deoxyribodipyrimidine
FT                   photo-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90572"
FT                   /db_xref="GOA:D0KN37"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN37"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ACX90572.1"
FT                   /translation="MLCLFIFRRDLRLDDNTGLIKALGNCEKVIPTFILDPRQVGDENQ
FT                   YKSEFAINFMINSLNELNDELGKRGSRLYVYFGLAEEVIKSLLKDVDAVYLNEDYTPFS
FT                   KMRDERIRKYCEERGKVMKSFEDYLLTSKNDFKNYKNFTTFYNAVKNKQVRKPIQNNYT
FT                   NYYKNSLGDEYELPPSQGERGGRKEGLKLIDRAKQIDYSRRDFVAEDNRTFLSPHLKFG
FT                   TLSVREVYYSLVDNQAIIRQLYWRDFYTLLAYYNERVFYEPLRREYSCIEWGNNEKLLQ
FT                   AWVHGKTGYPIIDAGMRQLNQTGDMPNRVRMLTAFFLVKVLLIDWKIGERYFASKLIDY
FT                   DPSVNNGNWQWIASVGTDYIFRVFDPWKQQITYDPEAKYIKRWVKELEDYDAKIIHNAY
FT                   KYTLKNYPNPIVDWRIRINLAKRLYERCKDQK"
FT   gene            238359..240206
FT                   /locus_tag="Ssol_0277"
FT   CDS_pept        238359..240206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0277"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   sim:M1627_0261 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90573"
FT                   /db_xref="GOA:D0KN38"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN38"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ACX90573.1"
FT                   /translation="MYYMTRYLILGNGSLTVLYDNNFTVREIYWPLTTTNNLHRGRFGV
FT                   FVNGKFSWLDNLNPKIGYSDDTLAVYSSFSFEGIDFNLEDVIDMAYDIWIRKVSAKNVE
FT                   DKDVRVFTAFDFHVGGTPDGNTALFDPYSESMIQYKGSRWFLLSSSIPFYQYATGIKEY
FT                   KGLLGTWKDCEDGELSGNPIAQGSVDFASSFKLYGEDFYIWLVAGKNYNEVRGLNDYVR
FT                   KRTPQILFKRVKDYWRAWLSKVSDYGEYNSILKRSLLILQSHIQNNGAIVASLDTDIMK
FT                   FNRDTYNYVWHRDAVFCILALELMGYFDRSRQFFEFTRRLFTINGALFHKYTVDGHFGS
FT                   TWHPWTLDYLPIQEDETALVLYALWFHFSRWKDVDFIKTYYRPMVKGIADFLVNYREKV
FT                   TGLPLLSFDLWEERIGIHFYTTITVIAGLRAAANFARYFGEDDLAQKYESVADQMRSAL
FT                   DLFWVSDHYARTIYIRESQVYKIDKTVDSSTLLAPIFNVIPIDNSRFVKNLETVVETLG
FT                   IRGGLARYEGDQYLRGGNNPNIWFISTLWLSEVYSLIGDKEKAKEKIDWVLSKSLSTGV
FT                   IPEQIDENNNYPSVSPLAWSHAELIRAIYALRNNILDQR"
FT   gene            240297..240692
FT                   /locus_tag="Ssol_0278"
FT   CDS_pept        240297..240692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0278"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; SMART:
FT                   regulatory protein ArsR; KEGG: sin:YN1551_2870
FT                   transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90574"
FT                   /db_xref="GOA:D0KN39"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN39"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ACX90574.1"
FT                   /translation="MQGKSEISMPDGRVADVFNVVKFLYGLSDRDIEILKLLIKSQSSL
FT                   TMEEISSELNITKSVVNKSILNLEKKNIVIKEKVESSKKGRRAYTYRVDVNYLTRKLVT
FT                   DLDQLIKDLKVKIADVIGIQIEKTASV"
FT   gene            complement(240708..240998)
FT                   /locus_tag="Ssol_0279"
FT   CDS_pept        complement(240708..240998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90575"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN40"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2871"
FT                   /protein_id="ACX90575.1"
FT                   /translation="MAKKRSKLEIIQAILEACKSGSPKTRIMYGANLSYALTGRYIKML
FT                   MDLEIIRQEGKQYMLTKKGEELLEDIRKFNEMRKNMDQLKEKINSVLSIRQ"
FT   gene            241146..243328
FT                   /pseudo
FT                   /locus_tag="Ssol_0280"
FT                   /product="hypothetical protein"
FT   gene            241564..242529
FT                   /locus_tag="Ssol_0281"
FT   CDS_pept        241564..242529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0281"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90576"
FT                   /db_xref="GOA:D0KN41"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN41"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90576.1"
FT                   /translation="MQVYETGFKTELKSLASYFIVNNLNVISQELDTRIADAAPFLLTG
FT                   NRGKEYLKVVREGEKVMSQGERSFKFYPHVKVEGETTIVAVDETAITVGEKESRKVEGF
FT                   QLYNGKRKGVKLRSVDLVFPLRLSLLEEIADLRSDTPSQFLMRAVSEVAQHLKIDYVVA
FT                   DAGFLNLKVIKEMPVKTVVGGKTNLKGFKELSNVPLTEKKCEVNDRVYVAYRVLKYNDL
FT                   YYYEVIYVKEKPRHFIFVTNFNGDPYKLAELYRLRWQSEEGFKVRKARIRYVRKLTNKI
FT                   FLYLYYTVLDSVWNLVNYLLFNFKSTKRKPLSFNSFVRLL"
FT   gene            243457..243651
FT                   /locus_tag="Ssol_0282"
FT   CDS_pept        243457..243651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0282"
FT                   /product="membrane protein"
FT                   /note="KEGG: sin:YN1551_2873 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90577"
FT                   /db_xref="GOA:D0KN42"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN42"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2873"
FT                   /protein_id="ACX90577.1"
FT                   /translation="MVSGKNIIAGILLIIPFIAYFAIPTYNKVEPDLGGLPFFYWYQTL
FT                   WLALSTILFSIAALILTRR"
FT   gene            243657..246403
FT                   /pseudo
FT                   /locus_tag="Ssol_0283"
FT                   /product="hypothetical protein"
FT   gene            244411..245505
FT                   /locus_tag="Ssol_0284"
FT   CDS_pept        244411..245505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0284"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   siy:YG5714_0326 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90578"
FT                   /db_xref="GOA:D0KN43"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN43"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90578.1"
FT                   /translation="MRKPVLSRGEDKVITPGLPHQNNIQQVGYKLLSMLSFKGRKAEEV
FT                   SRVLVSACLWNDSVESKSKGYNVSPQTVRNYVEEQGTEVIEKLLESMRRISMEILKGVK
FT                   EVDISIDWTTKTWYGKPVEGLGSSAKGNSWNYATATTKYQNMVLLLAFVPQVNGMSKDE
FT                   IVKLLMEQIVGMGLKVGLVTLDAGFYTVEVLKFISQFKFVIGVPVGDVKIYEEFDGEYT
FT                   TNSKRHKKEEQVKFRLLVYGKEIVKKRKKTVVYFARATNLDLPKREVLKLYNKVRSPIE
FT                   TSYRNIKAFLPFTSSTKFIFRELIFVLAMIFYSLYTVFKNVMTREEFRLLLILCFLDDL
FT                   SDLKDFIFNLEETLINTIDLFLWR"
FT   gene            246469..247212
FT                   /locus_tag="Ssol_0285"
FT   CDS_pept        246469..247212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0285"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: sid:M164_0285 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90579"
FT                   /db_xref="GOA:D0KN44"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN44"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACX90579.1"
FT                   /translation="MEYEKIAEELISSSYAIAFTGAGISTASGIPDFRGPQGLWKKYSP
FT                   ELATVEYFEKDPKKFWEFYSLRMRGLFKAQPNKAHYSLAALEKMGLIKVIITQNIDGLH
FT                   QKAGSKNVIELHGTMRRSYCVSCLKTYDSLDVLDMIEKGVLPPKCGCGGTIRPDVVLFG
FT                   EPVKNIYEALSIAYQSDLVISIGSSLTVYPANMIPQTVKERGGKLIILNMEETPLDSVA
FT                   DYVIREPIEISLPKIEEAVRQKILS"
FT   gene            247232..247447
FT                   /locus_tag="Ssol_0286"
FT   CDS_pept        247232..247447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90580"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN45"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2876"
FT                   /protein_id="ACX90580.1"
FT                   /translation="MTNNNMIEEEEELKLIKQIFLVIKENVPDDCRDLVINRLVDKLMN
FT                   DIKDLGVKETMKKWLGEEEDELILVH"
FT   gene            complement(247468..248172)
FT                   /locus_tag="Ssol_0287"
FT   CDS_pept        complement(247468..248172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0287"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: sin:YN1551_2877
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90581"
FT                   /db_xref="GOA:D0KN46"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN46"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ACX90581.1"
FT                   /translation="MHAVILAGGYGKRLRPLTDDKPKPLIEVAGKPIIEWQISWLKQFG
FT                   ITSFVILTGYKWEVLIKWLSENEKRLGISTYFSIEEEPLGTGGALRKVERLLSTENAFI
FT                   VINGDIITNLDISKLRVPSENIMAMSLVPLKSPYGIVETKDDKIVDFKEKPILENYWIN
FT                   AGVYLMKNEIFKYLPEKGDMEKLTFPKLAKESLLIGVKYYDAYWRSIDTIKDIEEASQD
FT                   LIKMKNGLSTER"
FT   gene            248762..248950
FT                   /locus_tag="Ssol_0288"
FT   CDS_pept        248762..248950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90582"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN47"
FT                   /inference="similar to AA sequence:KEGG:M164_2513"
FT                   /protein_id="ACX90582.1"
FT                   /translation="MNSILMTGYAHEVLGATNTDGRVVVFPSTSPNELRVSVYEPSRGV
FT                   PVAELEVVKSKQKLRHG"
FT   gene            complement(248963..249418)
FT                   /locus_tag="Ssol_0289"
FT   CDS_pept        complement(248963..249418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0289"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: siy:YG5714_0282
FT                   methylated-DNA/protein-cysteine methyltransferase; TIGRFAM:
FT                   methylated-DNA/protein-cysteine methyltransferase; PFAM:
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90583"
FT                   /db_xref="GOA:D0KN48"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN48"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACX90583.1"
FT                   /translation="MVVYGLYKSPFGNITVAKDNKGFIMLDFCDCVEYNSRDDTSFTDF
FT                   FHKLDLYFEGKPVDLKEPVSLKTYPFRLSVFKEVMKIPWGKVNTYKQIADSLGTSPRAI
FT                   GMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKLPD"
FT   gene            complement(249456..251093)
FT                   /locus_tag="Ssol_0290"
FT   CDS_pept        complement(249456..251093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0290"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; KEGG: sim:M1627_0272 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90584"
FT                   /db_xref="GOA:D0KN49"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN49"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ACX90584.1"
FT                   /translation="MESYKPMWLKGAIILAINLMERGYKPVAVGLGERDFYIDIKSDTS
FT                   ITLDEVKKAISKNVLANVPIENNQVVYKGNKVSIVEDKVSIPTNLNPKYFEILNISTHH
FT                   PNPNEQYVRIRGVAFETEEQLKDYLTWLEKAEETDHRLIGEKLDLFSFHEEAGSGLVLF
FT                   HPKGQTLRNELITFMREINDSMGYQEVYTSHVLKTDIWKISGHYTLYRDKLIVFNMEGD
FT                   EYGVKPMNCPAHILIYKSKPRTYRDLPIRFSEFGHVYRWEKKGELYGLLRVRGFVQDDG
FT                   HIFLKEDQLKEEIKMLISKTVEVWHKFGFKDDDIKPYLSTRPDESIGSDELWEKATNAL
FT                   ISALQESGLKFGIKEKEGAFYGPKIDFEIRDSLGRWWQLSTIQVDFNLPERFKLEYIDK
FT                   DGTKKRPVMVHRAIYGSIDRFVAILLEHFKGKLPTWLSPVQVKVLPITDEVNEYAEKVL
FT                   NDMRKRRIRAEIDYAGETLSRRIKNAYDQGVPYILIVGKKEASQGTVTVRARGNIEVRN
FT                   VKFEKFLDLMITEITQRDVEQTTAKALK"
FT   gene            251145..252101
FT                   /locus_tag="Ssol_0291"
FT   CDS_pept        251145..252101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0291"
FT                   /product="Oligosaccharide biosynthesis protein Alg14 like
FT                   protein"
FT                   /note="PFAM: Oligosaccharide biosynthesis protein Alg14
FT                   like; KEGG: sim:M1627_0273 oligosaccharide biosynthesis
FT                   protein Alg14 like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90585"
FT                   /db_xref="GOA:D0KN50"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN50"
FT                   /inference="protein motif:PFAM:PF08660"
FT                   /protein_id="ACX90585.1"
FT                   /translation="MTRILIIASGGGHTGFARAIAQYITEKIDFVIPTNDSYSRQMISQ
FT                   YANKIYEIPKGREPDESSLVLFKRLFSIIVKSANIKKYDLIIATGSNHSIFPSFFQYLK
FT                   GGKVYGIESQDRLITKGKAISIISNYAKGIFLHWQEQKKLYEKKGIVVGPIVEKPKYES
FT                   KDEGYILVTTGSMGFKRLFDVIVKYVIGKRIVIQTGKIDPSIYRNQNITTFSFDPDLEK
FT                   WIANASLVITHQGKTAMEAVVMYRKPVIIVYNNDWKSATSISDTEKYAEILGATFLRDP
FT                   ITWNDYNVLLDAIENVKKPNVFDIGTPNLVKHILSEL"
FT   gene            252101..252784
FT                   /locus_tag="Ssol_0292"
FT   CDS_pept        252101..252784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0292"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; iron-sulfur cluster
FT                   loop; SMART: HhH-GPD family protein; KEGG: sid:M164_0292
FT                   HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90586"
FT                   /db_xref="GOA:D0KN51"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN51"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACX90586.1"
FT                   /translation="MLRQLLEILLEIFENNKTILKEKGWIVSSKTSYEWWDGLKSEEEI
FT                   IISAILVQMSRWEIVKNKVEEMRNKGLTDFYKLYNTSEEELYSVLKGINFYKTKVKRLI
FT                   NISKIVVDLGTIEKFYDRNLLLSIDGIGQETADSILLFAGHKPNFPPSEYGKRVLSRVL
FT                   GTSIKKKDEVKRMVEENLEPDVYKYKLLHAGIVTVGRAFCFTKKPKCEDCILKKVCKYY
FT                   GENSL"
FT   gene            252869..253882
FT                   /locus_tag="Ssol_0293"
FT   CDS_pept        252869..253882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0293"
FT                   /product="Succinate--CoA ligase (ADP-forming)"
FT                   /EC_number="6.2.1.5"
FT                   /note="PFAM: ATP-citrate lyase/succinyl-CoA ligase;
FT                   ATP-grasp domain protein; KEGG: sid:M164_0293
FT                   succinate--CoA ligase (ADP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90587"
FT                   /db_xref="GOA:D0KN52"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN52"
FT                   /inference="protein motif:PRIAM:6.2.1.5"
FT                   /protein_id="ACX90587.1"
FT                   /translation="MKLYEYEGKSLFKRVGIPVPNGIVTTEPIKWGGKAVVKSQLLEGA
FT                   RGKRGLVRVTDDVYNTILELKKLGVEKFLVEEFVPHEKEFYASVLLDRESAEPMLVLSR
FT                   EGGIDVEQAKDVKKMIIPLERGVRSYDIIEAEKYLGVKGLGQIIQGLYKLFVEYDAELV
FT                   EINPLALTSDGRLLALDSKVILEDNALFRHEDLLKELGRQEIHDSYVELDGDIGIIGNG
FT                   AGLTMASMDLVKLNGGNPANFLDVGGGASREHVKESVLKVGSNPKVKKVVINIYGGITR
FT                   CDEVALGIVDALKEIKKPIFVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS"
FT   gene            253948..254730
FT                   /locus_tag="Ssol_0294"
FT   CDS_pept        253948..254730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0294"
FT                   /product="Succinate--CoA ligase (ADP-forming)"
FT                   /EC_number="6.2.1.5"
FT                   /note="PFAM: ATP-citrate lyase/succinyl-CoA ligase;
FT                   CoA-binding domain protein; KEGG: sin:YN1551_2883
FT                   ATP-citrate lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90588"
FT                   /db_xref="GOA:D0KN53"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN53"
FT                   /inference="protein motif:PRIAM:6.2.1.5"
FT                   /protein_id="ACX90588.1"
FT                   /translation="MLKYGTKIVAGVTPGKGGTQVNSVPVYDTVKDAMKEHEADASIIF
FT                   VPAKYAVDAIYEAVDAGIKLIVTITEHIPVLDMAKAIKYARARGSRIIGPNCPGIIAPE
FT                   ESLVGILPARAFKKGKIGIVSRSGTLTYEVSELLKNHGMGQSTVIGIGGDPIIGTSILE
FT                   VTKMFDQDPETEKIVVIGEIGGTMEERLAEAYKRREIKKPVIAYIAGMTAPREKRMGHA
FT                   GAVVYMGMGTFESKIKAFKEAGIPVANTPYDIPKLLLS"
FT   gene            complement(254716..255756)
FT                   /locus_tag="Ssol_0295"
FT   CDS_pept        complement(254716..255756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90589"
FT                   /db_xref="GOA:D0KN54"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN54"
FT                   /inference="similar to AA sequence:KEGG:M164_0295"
FT                   /protein_id="ACX90589.1"
FT                   /translation="MKRYLILFLVLSSIIFVPTTYSSNQFSFLNIGNTISYNIYETSSR
FT                   LGTYLTFNISMNLVWNGTAFVINGKSINKVFPAINTNNLTIENISGSYPYPLSVWINTA
FT                   AAGTPSGFLETGKEFTNYNGIPAVEFLDYNNYTYISLQYMIPLKSYYSININPASNLTY
FT                   SATTTLTEGDLNFYTGPYNLYNVSFNYVYQNYTVNLFFIVASSSAEINLLNYSNHVAFN
FT                   ITGSKFISLLVPITTFNDLLGVSKFIYNESPYVIVLTSTGNAYYYNTSVPIIGSYIPGT
FT                   NYYMISIPYSGNLIIIFGNHYSNYVDGSFNIKNNGIGNGPSIIYIVFAIILVAVVALVT
FT                   YRLRKK"
FT   gene            255850..256206
FT                   /locus_tag="Ssol_0296"
FT   CDS_pept        255850..256206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90590"
FT                   /db_xref="GOA:D0KN55"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN55"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2881"
FT                   /protein_id="ACX90590.1"
FT                   /translation="MKKKALGLSNDGYYVIFFISESEIGYKRTRINEMYYISFIITLLV
FT                   SILYVVFRYIFILVLFIIPILIYLLTIAISLHIYKPEIYEKIIRVEMKEKIVKIHTASK
FT                   TFIIRRGKILGFTD"
FT   gene            complement(256196..256396)
FT                   /locus_tag="Ssol_0297"
FT   CDS_pept        complement(256196..256396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90591"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN56"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2880"
FT                   /protein_id="ACX90591.1"
FT                   /translation="MKEREVEAKRLVGKKNVRGKIYEYEYFTLPLNLYLPKSMVEKFGT
FT                   KYMLQVDEDSGTITIKPKSSQ"
FT   gene            256941..257672
FT                   /locus_tag="Ssol_0298"
FT   CDS_pept        256941..257672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0298"
FT                   /product="sulfocyanin"
FT                   /note="TIGRFAM: sulfocyanin; PFAM: Sulfocyanin; KEGG:
FT                   sia:M1425_0280 sulfocyanin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90592"
FT                   /db_xref="GOA:D0KN57"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010532"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN57"
FT                   /inference="protein motif:TFAM:TIGR03094"
FT                   /protein_id="ACX90592.1"
FT                   /translation="MNSSIIIAIIVIVIIIAGVAAYLTLGHHPATTSSTTSSATTTFLT
FT                   SSTSNSVPPTSSSTSSTTSSSTTTTTQTATQTVTLPPGANVLPYNPNNKTVFIYLTVTV
FT                   TGPSFNYNGTAYGQMKLYVPAGWNVMIILTNDQSIPHNANIVLNETPIPNNSNISADGK
FT                   ILLYVGDSPSNFMSNGVQPGQTVIGMLDNISAGYYWIACGIYGHAESGMWADLIVSSSV
FT                   SVPYSIISSSTSSTSSTHSWG"
FT   gene            257712..258476
FT                   /locus_tag="Ssol_0299"
FT   CDS_pept        257712..258476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sia:M1425_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90593"
FT                   /db_xref="GOA:D0KN58"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN58"
FT                   /inference="similar to AA sequence:KEGG:M1425_0281"
FT                   /protein_id="ACX90593.1"
FT                   /translation="MFKRLAISPIFLILSLIAYYLSKTDILLYSTISTIFFWTFIILIL
FT                   PTPFYNYIRSGIAKYWKRKIFWLIVGLYMAYHVILYSFFFYLLLPGSIKNISFNFSFNA
FT                   GIGYSIPPPITYFLEWVSNSPAIWFFVGPYEGDIIPFSTFMGIVLALLIGLNVMEILEL
FT                   WGISNKLSKSIVLIPSLGVVSGSSCCVFLPSIVMYSIALSISSITATILSILSSFAYFI
FT                   LAYYALPIVSALVLFHNLAMLNKLIKKLSFTM"
FT   gene            258520..260735
FT                   /pseudo
FT                   /locus_tag="Ssol_0300"
FT                   /product="hypothetical protein"
FT   gene            complement(258893..259852)
FT                   /locus_tag="Ssol_0301"
FT   CDS_pept        complement(258893..259852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0301"
FT                   /product="Transposase, ISC1234/ST1916, Sulfolobus"
FT                   /note="PFAM: Transposase, ISC1234/ST1916, Sulfolobus; KEGG:
FT                   sim:M1627_0628 transposase, ISC1234/ST1916"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90594"
FT                   /db_xref="GOA:D0KN59"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN59"
FT                   /inference="protein motif:PFAM:PF05457"
FT                   /protein_id="ACX90594.1"
FT                   /translation="MGVEGSTMARTLRHIPNLMYYPLPPIEDMPWREKWLTEIKPVLDA
FT                   MDLERVLGEGALVYLKLLIVMVLYSCSYRDAVKMVNVNVVVAWFVGRKVGKSTLHDFVG
FT                   RLYGVRKKLLEISFKLEEKCLPSYLPASAHLVDFMAWLVDSFLLDLPPGKRSVETFREK
FT                   AELERREGNLERARKLLSLGRTKRRFEGRWTKKRGVSHYGLKAIAVISVSLFVRSITVK
FT                   PANFSDKRFKSPLKGIKIADRGFSPSPTQLIAREKPFTTLRAHVEFFGTYLNAFWRPYG
FT                   TTTWRNDVFLHVLGVIYNIKMFLAIQRRTPPGRRAVQL"
FT   gene            260737..261189
FT                   /locus_tag="Ssol_0302"
FT   CDS_pept        260737..261189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90595"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN60"
FT                   /inference="similar to AA sequence:KEGG:M164_0301"
FT                   /protein_id="ACX90595.1"
FT                   /translation="MIAWKGFGKRWGKCEECWLAYERGVQHENSLKCYKLGIPIDNLKI
FT                   PLDQFLSITRDMPGKYALFRFPLNLLSKGVIILYFDTKIEMENFIENIRDYIKDEVSLR
FT                   EKKFYDIFGNVEWVGGMNWRRGCPEYDKKFGDWRVWRNATSKTNST"
FT   gene            261335..261955
FT                   /locus_tag="Ssol_0303"
FT   CDS_pept        261335..261955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90596"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN61"
FT                   /inference="similar to AA sequence:KEGG:M1627_0284"
FT                   /protein_id="ACX90596.1"
FT                   /translation="MSISIFILSLKGGIGKSRLSYELSKYISKKKFKKVLLIDNDSLST
FT                   LSNLLGHYGDGLLDGFDLGSSLKEIDGIFILKLRNKIWFLEKFYDEERLEQLKFVLSRN
FT                   WDYIIVDNYVGINEQNPIVRTVYDFSPIKIGIFLTDELSLDSTVEYSNCWNHLDSKHVL
FT                   LINKSFDVNNVIDRTIIDNILNQDIPKKNEQFTIERTNKIKVF"
FT   gene            262070..263325
FT                   /pseudo
FT                   /locus_tag="Ssol_0304"
FT                   /product="hypothetical protein"
FT   gene            263414..264424
FT                   /locus_tag="Ssol_0305"
FT   CDS_pept        263414..264424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0305"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sia:M1425_0286 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90597"
FT                   /db_xref="GOA:D0KN62"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN62"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX90597.1"
FT                   /translation="MKAVVLPAHNQGYRIEEIADPKPYKGEVVIKVNKAALCYRDLLQI
FT                   KGFYPRSKYPLILGHEVVGTVEEVGENVNDYREGDRVTSMLFVPDWSCEYCKSGEEVYC
FT                   KNRVLYAQELDGFFAEKARVKASSLVKIPENVSDEGAVIVPCVAAMVYRGLKKAGIKEG
FT                   ENVLVTGASGGVGIHAIQVAKALGAKVIGVTSSESKARIVSKFADYVIVGDKFSEEAKK
FT                   IGDISIVIENVGPYTLEESMRSLRSGGKIIQIGNLDPSITFNLRLGYVILKDLSLIGHI
FT                   GANKKDIVETLNLVKEGKIKPVIGSEFRLEDFGKALDLLKENKNRYGKILISNSF"
FT   gene            complement(264410..265597)
FT                   /locus_tag="Ssol_0306"
FT   CDS_pept        complement(264410..265597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0306"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: sin:YN1551_2896 acetyl-CoA
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90598"
FT                   /db_xref="GOA:D0KN63"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN63"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACX90598.1"
FT                   /translation="MLEDVYLVDYVRTAFTRFSRKDYQKDPFYNIRPEELAGMVINRLI
FT                   EKNGIKAEEIDEIITGCALQVGEQWAFGGRHEVFAARLPYNIPTMAVDRQCASSLTTVS
FT                   IGAMEISTGMADIVLAGGVEKLSRTPMFDNPHIEINTKFLTDSKYIEYDLTTGYVMGLT
FT                   AEKLAEEAKITREEMDRWSLRSHQLAWKAIQEGYFKDEILPIEVEVEGKKTVVNLDQSV
FT                   RPDTSMEKLAQLPPAFKPNGTITAGNSAPLNSGASYVLLMSKNALKKYGLTPMAKIKSF
FT                   GFAGVPPAVMGKGPVPASKKALEKANLSTRRIDLWEINEAFAVVVLYAIKQLELDENTV
FT                   NKKGGAIAIGHPLGATGARLVGTLARQLIMEGKDYGVATLCVGGGQGGAIVLERV"
FT   gene            complement(265635..266534)
FT                   /locus_tag="Ssol_0307"
FT   CDS_pept        complement(265635..266534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0307"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   sia:M1425_0288 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90599"
FT                   /db_xref="GOA:D0KN64"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN64"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACX90599.1"
FT                   /translation="MILDLNFEISEDLKLILNSLNELLDSRWSTKKLRSIMEGNKEYTE
FT                   ELWREIIKLDILPYLSTLSLRDNVIINEVIGRKLLPGIVISSVVASRGIKTKDVLNRLY
FT                   SGEIKIAMSDSNFVPSADDADYIVIGNKLIKRDNCTIHTFNSLDNSMKISKVKHVGNHE
FT                   DIEVNNAEIALSLASQMVGSGEEVVSMSIKYSKERVAFGKPIGSYQAIKHRVVNDAIDV
FT                   ELARSLVLEAAENIKYAWVAKDLVNKKIPKVILSGIQVHGGIGFTDDLDIHLHLRRALT
FT                   LSKLYNSKVNISEFLQPI"
FT   gene            complement(266540..267466)
FT                   /locus_tag="Ssol_0308"
FT   CDS_pept        complement(266540..267466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0308"
FT                   /product="ribonucleotide reductase"
FT                   /note="PFAM: ribonucleotide reductase; KEGG:
FT                   sin:YN1551_2898 ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90600"
FT                   /db_xref="GOA:D0KN65"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN65"
FT                   /inference="protein motif:PFAM:PF00268"
FT                   /protein_id="ACX90600.1"
FT                   /translation="MGMSFEEYKHEYFKSIRHGGLNWSLFPMKLYQLGKRLFWDPANID
FT                   LSKDAEDWKKLNDLEKMFIINVGSKFAAGEEAVALDLHPLIVTLVKEGKVEEVMYLEQF
FT                   VYEESKHVEAFRRFFDAVNVIEDLSAYTKDLSPNYRKIFYEELPKAMWNLSKDPSPENQ
FT                   VKAVVTYNLVVEGIAAEGGYNIFRRITNTRKILPGLAKMINLIATDESRHIAFGVYLIA
FT                   RLVKEHGEGIYKVAMDHINYLAPYAIGIFSEPTMPQVTNLPFDLTNMELVDYAKKLLNT
FT                   RIDAINRARQMRLDVLLPRDLDVIESW"
FT   gene            complement(267559..268317)
FT                   /locus_tag="Ssol_0309"
FT   CDS_pept        complement(267559..268317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0309"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sin:YN1551_2899 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90601"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN66"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX90601.1"
FT                   /translation="MYSLKDKVVVVTGSGRGIGRAIAVRLAKEGSLVVVNAKKRAEEMN
FT                   ETIKIIKENGGEASGVLADVSTREGCETLAKETLDRYRVVDILINNAGLGLFSPFLNVD
FT                   DKLLDKHISTDFKSVVYCSQIFAKEMRDGGAIVNVASVAGVSPAYGLSIYGAMKAAVIA
FT                   LTKYLALELAPKIRVNAIAPGFVKTKLGESMFQVLGMSEKEFSEKFTLMGRILDPEEVA
FT                   EFTAAILKIESLTGQVFVLDSGESIKGGIK"
FT   gene            complement(268353..269399)
FT                   /locus_tag="Ssol_0310"
FT   CDS_pept        complement(268353..269399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0310"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   siy:YG5714_0294 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90602"
FT                   /db_xref="GOA:D0KN67"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN67"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX90602.1"
FT                   /translation="MKAAIYKGHGLQLEIEEVPNPTPKEGEILVKVASTGICHSDLHLL
FT                   SGELVGPLPNGFIIGHEIAGWVEKIGKNVRNPYGLKEGDPVLVSWIVPCGICSYCASGK
FT                   ENYCKENAKRLVGLIGINGGHAEYIIVPEIAVIPLAKNLDPYYSSPIACAYGTAYNALK
FT                   SANTTSGKSVVIVGSGGVGSAAIQLANAMGLNPIIAVDIDENKLKKAKELGATYTINAT
FT                   ENDARSKVLEVLEDGADIVYETKPYPDLKLPLEIVKSGGTIVVTGLGGFSTLAQIPVTL
FT                   FVSRGITLIGSLGYRPRIDLPELVSLASSGKIDIKKLVSHIYTPDKINDAYENLKKGLH
FT                   IRAIIRWN"
FT   gene            complement(269682..270086)
FT                   /locus_tag="Ssol_0311"
FT   CDS_pept        complement(269682..270086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90603"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN68"
FT                   /inference="similar to AA sequence:KEGG:M164_0310"
FT                   /protein_id="ACX90603.1"
FT                   /translation="MELTFPTQHDIQALVKILSDPVFTLHKILGAETVTVKGNEFDALI
FT                   SMGVTSVILHGTVYVGSNKISYKFYSVGTEKGEGGILEFGLFKEGELKLVLDYEGRFGS
FT                   IIRFSLRRRIEKNMKRLDEEVRVERIKRKI"
FT   gene            complement(270146..271537)
FT                   /locus_tag="Ssol_0312"
FT   CDS_pept        complement(270146..271537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0312"
FT                   /product="Vinylacetyl-CoA Delta-isomerase"
FT                   /EC_number="5.3.3.3"
FT                   /note="PFAM: 4-hydroxyphenylacetate 3-hydroxylase; KEGG:
FT                   sin:YN1551_2902 vinylacetyl-CoA delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90604"
FT                   /db_xref="GOA:D0KN69"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN69"
FT                   /inference="protein motif:PRIAM:5.3.3.3"
FT                   /protein_id="ACX90604.1"
FT                   /translation="MRSRDDFLNSLKDGRSLYYRGKLVEDITAHHILKTAALHAAKLYD
FT                   YADRVYEDNKMGKISKFFKIPLTSQDLLDRHKLIYDLTMYCNGIFNISQAIGSDAIFAL
FT                   MITAKQVDRKYGTDYSKRVEKYFERVAKEDLTLATAQTDVKGDRSKRPSEQVDPDMYVR
FT                   IVDVKSDGIVVRGAKAHTTQSAVSDEIIVIPTRAMRDSDKDYAVAFAIPANTKGLKMYI
FT                   RPIDEIEGNSSSVLSRKDYELETLTVFDDVFVPWDRVFLFREYDYAGTLAMLFATFHRF
FT                   TALSYRSATMNLYLGASKVASQVNGIENEKHVRDDIVDIILYKEIMRSSAIAAAVYPVN
FT                   MEGIAVPNPLFTNVGKLYSNMHFHDVVRDLIDIAGGIIATMPSQEDLESNEGKNIVKYL
FT                   RGSVDGEERAKVLKLAKELGASTFTGYLLTGMIHAEGSMEASKIELFRSYNYKEAESLV
FT                   KRILS"
FT   gene            complement(271649..273118)
FT                   /locus_tag="Ssol_0313"
FT   CDS_pept        complement(271649..273118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0313"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sin:YN1551_2904 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90605"
FT                   /db_xref="GOA:D0KN70"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN70"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90605.1"
FT                   /translation="MTFIRYFYELTDLRNFMSSKLDEYLARIDRLPTWGLSYALLWAIG
FT                   FSYFITLYDAVGNIGAALPYIPFINASQASLIASLGLFGYIPGSLGLGYLADRIGRRTV
FT                   LIITVLLTAIGSLGMALSINFPMLAIFRFIEGAGIGGDLNLAMVYVSEFAPSAKRGKYA
FT                   NWIYLAGWIAVGVGATIAALLVTGLPSVGWRLAFGIAAIMAVAALVFRIRAPETVRFLV
FT                   KKGRINEAESIVRIMEETAMKRARVQSLPEPKIINYSYQTTNPFSILAKRVFAKRLIGL
FT                   ILFWFFIYFVQYTFSTLWDYYGKFIGYSGAMFNQYVLFTGFAALGDTLMAFLLLTFIER
FT                   TDRRMITQIGSIGWLVGMIVASYFAIHFNLLGMTLTLGLITNAIGGGMSYLAGYLMSSE
FT                   SFPTAARSTGFAITDGIGHIGGAIGPLLLFPLVVATGPINAWAIEAFPVVIAAVILWFT
FT                   VPRTVGVRLEEINEIHLTPQQPQGGIIKSEK"
FT   gene            273392..273979
FT                   /locus_tag="Ssol_0314"
FT   CDS_pept        273392..273979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0314"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sin:YN1551_2905
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90606"
FT                   /db_xref="GOA:D0KN71"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN71"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACX90606.1"
FT                   /translation="MYRYPKTEKGKESLNKIINASLDLISEKGFLNTSISDITNKAGVA
FT                   YGLFYFYFKSKHDILDELIRKFNTDMRYYLKVNTMGIRNRIEMEKEGLAKFLEWMSQNK
FT                   KYYKVFVEAQVHRPEMYIWHFTKLAERYKIGLKEAMDRGEIVKVDPELLAYVLIGIGEM
FT                   IGRRYILWTNQGLTKKQYNDLAILIENMLRPK"
FT   gene            complement(273981..274424)
FT                   /locus_tag="Ssol_0315"
FT   CDS_pept        complement(273981..274424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90607"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN72"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2906"
FT                   /protein_id="ACX90607.1"
FT                   /translation="MAEFLYPSREWAEEWCKLLNESKEYNDAGKGWVSPILFVVTDIPT
FT                   QVLEHLGVKGTNTLAMKLYLNNGKCQGIEFFTDVTKADAPYVLEASYNSWKDIISGKLQ
FT                   VVSALLSGTIKLKKGSLFDLARYTTASVVMANVSNKINTKFLV"
FT   gene            274815..275957
FT                   /locus_tag="Ssol_0316"
FT   CDS_pept        274815..275957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0316"
FT                   /product="acetyl-CoA C-acetyltransferase (acetoacetyl-CoA
FT                   thiolase) (AcaB-6)"
FT                   /note="KEGG: siy:YG5714_0303 acetyl-CoA C-acetyltransferase
FT                   (acetoacetyl-CoA thiolase) (AcaB-6)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90608"
FT                   /db_xref="GOA:D0KN73"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN73"
FT                   /inference="similar to AA sequence:KEGG:YG5714_0303"
FT                   /protein_id="ACX90608.1"
FT                   /translation="MIVGFAGKLYKNYEKDGIELLKEVTDEALDIAGLNYADVDGIMAN
FT                   IGRGSFHGNRTYLNPPAQISEYFGIKPKIIEHVQYGGPSVLSMIYRAYKAIKAGDAETI
FT                   LCIQGGKISHLRDNHFQKTDIIDSPFDEYIKIYDQMSPISDYAMVAYRHSKLFGTTDEQ
FT                   RARIAVIQRYNASYNPKALFRNPITVEDVLKSRIVSYPLHLLEIVYPIDGFHVFVVSKR
FT                   SSKSALRNIDILAYGEAHWPNPPAEWDDIIYTPTTESAKRASFDLNRVDAFQLYDSFTI
FT                   TVMLQMEDIGLVEKGKVGQFVESHDLSFKGDVPINTGGGSLNTGQPAYMSGGVILEEAL
FT                   LQLNDMANGHQVKGANVIFLNGIGWWSRRHSVTLVLGERK"
FT   gene            275954..276328
FT                   /locus_tag="Ssol_0317"
FT   CDS_pept        275954..276328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0317"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   sis:LS215_0328 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90609"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN74"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ACX90609.1"
FT                   /translation="MREEEIRELYFKYFDENKLPFIQCNKCGHKFYYPRVLCPKCGSSD
FT                   IEVRFSKGLGKIFAMTKVYRKDGSYVIYGIVELEEGFRMYSNIIEESQADINRKVEVIF
FT                   KEINGKKYPLFKTVTHLHNF"
FT   gene            276404..276592
FT                   /locus_tag="Ssol_0318"
FT   CDS_pept        276404..276592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90610"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN47"
FT                   /inference="similar to AA sequence:KEGG:M164_2513"
FT                   /protein_id="ACX90610.1"
FT                   /translation="MNSILMTGYAHEVLGATNTDGRVVVFPSTSPNELRVSVYEPSRGV
FT                   PVAELEVVKSKQKLRHG"
FT   gene            276671..278329
FT                   /locus_tag="Ssol_0319"
FT   CDS_pept        276671..278329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0319"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   siy:YG5714_0305 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90611"
FT                   /db_xref="GOA:D0KN76"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN76"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX90611.1"
FT                   /translation="MEIIKGFPSTMMDDYQLNVTQILEHAGKWIGEQEIISRKKDGTIF
FT                   RYNYGEAFRRVKKLASSLKSLGVKVGDRVGVLEWNTHRFYELYFAIPATGAVMLELNPR
FT                   LHPLQLAKIINHSKVSFLFLNEDFIPLVESISNNIPLVKKFILISDIEKTPQTNYYNYE
FT                   SLVEEGNEEYEIPMFDERTSCYAAYTTGTTGDPKGIYYSHRSIVLNTLVISRNITIDDT
FT                   FMQLVPMFHVNGWLGFMAATLVGAKLVLPGRYTVDNPKPLVDLMINEKVTVTAGVPEVF
FT                   SSILNYLRSMENKPLFVNSRILIGGSEPPLSLVIGLMEFGFQVGQGYGATETTPSVAGS
FT                   VVKPRIREKYSDKDMLDLLRKQGIPTFGVDIRVIDPSTGKDVPHDGKTIGELWIRGPWI
FT                   ASAYYNDPRTVESFVGDGVDRWWRSGDLAVVDELGYIKIVDRIKDVIKSGGEWISTVDL
FT                   ENHLMAHPAVAEATVIGVPHPKWGERPLAFVVLRQGFENKVSKEELLGHLGQRFARWQL
FT                   PDDIIFVKEIPKTSVGKFDKKVLREKYRDFFISSR"
FT   gene            278365..279477
FT                   /locus_tag="Ssol_0320"
FT   CDS_pept        278365..279477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0320"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   sin:YN1551_2910 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90612"
FT                   /db_xref="GOA:D0KN77"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN77"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ACX90612.1"
FT                   /translation="MSKNEDELEEYRIKVREWIRNNVPEEIRAKGDMAPPDVLREWQRR
FT                   IYEAGYLGVSWPKEYGGWGENPIKEIIVREEFAKAGVPYATVGLGVSVVGPAIILNGTE
FT                   EQKKKHIRRILTAEDVWCQGFSEPQAGSDLAGIKTKAEDKGEYFLVNGQKIWSSYAHLA
FT                   NYCLLLTRTGDVSERHKGLTMLIVDMKSEGIRVSPIKQITGRSEFNTVYFNNVKVPKEN
FT                   VVGKIGEGWKVAMSTLNYERLNIGTILFTVERLIRELSINNDQLFNTAEEIVALKSFYK
FT                   RILERLKKGYIAGPEAAVIKLVASEAIQRVYENAMANMGIEGLVMEREPGFRPEIAYGF
FT                   LASRSITIAGGTSEILRNLLGEVVLGLPKG"
FT   gene            complement(279495..281486)
FT                   /locus_tag="Ssol_0321"
FT   CDS_pept        complement(279495..281486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0321"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; Enoyl-CoA
FT                   hydratase/isomerase; KEGG: sim:M1627_0303 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90613"
FT                   /db_xref="GOA:D0KN78"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN78"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACX90613.1"
FT                   /translation="MKVEDIKKILVVGAGTMGHGIAEIAAISGYKVYLSDISQDILNNA
FT                   LERIRWSLSKLQERGQIKESVDTIMSRITTIVGLDKTVSDADFSIEASTERMDIKRQVF
FT                   SKLDELLPPHAILATNTSSLPISKIAEATKRQDKVVGMHFFNPPVLMQLVEVMKGDKTS
FT                   DETAKITYDLAKKFGKQPIMINKDVPGYVVNRILGQINIASCILVEKKVADYREVDAVA
FT                   RYKLGFPMGVFELIDYTGVDVAYYVSKSREELGIRDDIPICSLIEQKFKNNELGVKTGK
FT                   GFYTYPAPGKYVKPELPKELADKLNPALILAGGVNEATRLLREGIASRDDIDLGVRLGL
FT                   GLPKGIFQYADELGVDTVLKALEDLKALSGYNTFNPDPMITQMIRENKLGIKTGSGFYQ
FT                   YGKVEEKKMNTLIIRIEPPLAWIILNRPERLNALNPELVSELDKSLDELESRSDVRVVI
FT                   ITGNGRAFSAGADVSSFITLRPIDVIRLRTLRNVVNKIALYTKPIIAGINGFALGGGLE
FT                   LAMACDIRIASEVAQLGQPEINIGIIPGAGGTQRLPRLVGKGKAKLMIYTGDMVSAEDA
FT                   YKMGLVDLVVPSNRFEEEVRRVALKIAEKSPISLLAAKLAIELGYESNIWTGQTLESTL
FT                   FGLLFTTKDVEEGVKAFLEKRKPQFKGE"
FT   gene            complement(281568..282500)
FT                   /locus_tag="Ssol_0322"
FT   CDS_pept        complement(281568..282500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0322"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sin:YN1551_2912 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90614"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN79"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX90614.1"
FT                   /translation="MTIFTLKLPMQGPLKYINSYLVKGNEESVLIDTGLPTQEDVTTLS
FT                   NYLKAYGYPNFVVITHYHPDHMGLVRLFKDKSIILISDRELEYVTYLLSEEYEKEMRKY
FT                   LLANGFPEEFIQRMFRNRSRFSEIIDGVNFNTVKDGDVIKLGQEQMRVLLTPGHTMGHI
FT                   CLVYEKVVFCGDHILQDITPNISLLRLEDNPLKAYLESLDKVQKLDIELLYPAHGEVLK
FT                   DVSKRVEEIKEHHKRRLEEIMNIIRTLGKTSGFNIASRISWYKKWDELSAFDKQLAMGE
FT                   TLAHIKYLVEEGFIREVNASGSIYYTMSS"
FT   gene            282707..284173
FT                   /locus_tag="Ssol_0323"
FT   CDS_pept        282707..284173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0323"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sin:YN1551_2913 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90615"
FT                   /db_xref="GOA:D0KN80"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN80"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90615.1"
FT                   /translation="MYKARKLTFIRYFYELTGVSTSMSSKLDEYLARIDRLPTWGLSYA
FT                   VLWALGIGYFATLYDAVSNLGYALPFIPFINATQASIIVSVGLAGYIAGSIGFGVASDR
FT                   IGRRPILITTFALLGIGSLGMGLATNYFMLFIFRLLEGIGIGAALNLAMVYVAEFSPSM
FT                   KRGKYANWIFISGWTAVGVGTVAAAFIVTINPTVGWRIIFLLPAVLSLMTTVVLTILSP
FT                   ESVRILVKKGKVQEVEKIVNKMEEISMRRARMESLPQPKIIHYEETPSSSQLKILRESK
FT                   YLKRLISLTVFWFFIYFIQYTSTGLGPTFVKVVIGFSTAQYAEYIRLSGFAAIGATIVS
FT                   FILLSVVEKTDRRLLTQIGGIGFLVSSFVSTYLLLNKELIVWFIAYFLLEFVVNPPYLA
FT                   GYLMSSEAFPTAARSTAFAITDGIGHLGGVIGPLLLFPLIRIIGPLPAWVVLGLPVPFA
FT                   AALLWFTIPKTVKVRLEEVNEAYREGTAQT"
FT   gene            284293..285219
FT                   /locus_tag="Ssol_0324"
FT   CDS_pept        284293..285219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0324"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: sai:Saci_1105 esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90616"
FT                   /db_xref="GOA:D0KN81"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN81"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACX90616.1"
FT                   /translation="MPLDPEVRKFLDYFYKANILDFTKYSLQEVREKLNKLLAEATPKD
FT                   SVYKIEDRKIKGLETEIPIRIYYPDNKRDHPIILHFHGGAWILGSIETEDSVSRILANS
FT                   CNCIVISVNYRLAPEHKFPAAVTDCFDSIKWTYENAESIGGHPNRIAVFGISAGGNLAA
FT                   ATSILSRDQGIKLRAQALVVPFVYLDLASTSMTEYRKGYFLDINVPIDYGIMMYIRDEK
FT                   DLLNPMFVPLIAEDLSNLPQAIIVTAEYDPLRDQGEAYAKRLMEAGVLTLSFRVNGMVH
FT                   GFLGSPNISRLVSVMVGSALKDILMRG"
FT   gene            285225..286286
FT                   /locus_tag="Ssol_0325"
FT   CDS_pept        285225..286286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: siy:YG5714_0310 esterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90617"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90617.1"
FT                   /translation="MYEEWKIVKREAPILGNDQLIENIWKMKREDSPYDIISLHKVNLI
FT                   GGGNDAVLILPGTWSSGEQLVTISWNGVHYTIPDYRKSIVLYLARNGFNVYTIDYRTHY
FT                   VPPFLKDRQLSFTANWGWSTWISDIKEVVSFIKRDSGQERIYLAGESFGGIAALNYSSL
FT                   YWKNDIKGLILLDGGPTKHGIRPKFYTPEVNSIEEMEAKGIYVIPSRGGPNNPIWSYAL
FT                   ANPDMPSPDPKYKSISDFLMDSLYVTGSANPYDYPYSKKEDMFPILASFDPYWPYRLSL
FT                   ERDLKFDYEGILVPTIAFVSERFGIQIFDSKILPSNSEIILLKGYGHLDVYTGENSEKD
FT                   VNSVVLKWLSQQR"
FT   gene            complement(286294..287220)
FT                   /locus_tag="Ssol_0326"
FT   CDS_pept        complement(286294..287220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0326"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   siy:YG5714_0312 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90618"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN83"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX90618.1"
FT                   /translation="MEVQYKFERISDNVYAFIQPNGDWFLSNAGVIIGKNYAVVVDSLT
FT                   NEKMARQFISEIKKITDKPIKYLINTHEHEDHLWTNHLFPNAITICHKNCREKVVEGAK
FT                   RRINPYENLFNAIDFSGYQYTPQEVVIKDEMRIFIDNDEEIKIAYVGYAHTTSDIYVYI
FT                   PDQKVVFTGDLLFSPPCTPFALMGYIQGYINALENLANLDAEIFIPGHGEVSYGRNALY
FT                   ESRDYLIFVRDEARKIMRTISDPIRAAYEINLGKYDEWISKERIVGNLVRAYSELKGNP
FT                   PASKLENIDKVLLEMIRYREKKGGGKK"
FT   gene            287263..288219
FT                   /locus_tag="Ssol_0327"
FT   CDS_pept        287263..288219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0327"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   sin:YN1551_2917 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90619"
FT                   /db_xref="GOA:D0KN84"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN84"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACX90619.1"
FT                   /translation="MKLISFIRDNRIRSGVLVNDEFIADLNTSCYLMLIEKGEEEQFAE
FT                   RYCNAIVPPDMLGVLQAGDKGFEVVKEILEWSKKRNDILYNINQVKLKAPLVRANMLRD
FT                   FLAFRGHVEATYKRRGQPIPEEWFRIPIYYKGDPAIFYGHLEEVPWPKYSKLVDIELEI
FT                   AAIIYKRGKDIDKIRARDYILGFTIFNDFSARDIQMAEMKGLLGPAKGKDFANGLGPWI
FT                   VTKDELSDIKGLRVYAKVNNEIWCDTKAEDMQWSFEDMIAYVSQDEYIRPGDVFGSGTV
FT                   SGCTGLDIGKSLKPNSSIELYVEKIGILKNIIVKNHQ"
FT   gene            complement(288213..289148)
FT                   /locus_tag="Ssol_0328"
FT   CDS_pept        complement(288213..289148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0328"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: sim:M1627_0311 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90620"
FT                   /db_xref="GOA:D0KN85"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN85"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACX90620.1"
FT                   /translation="MPLDPQVKELLTKINLLLPTTPLTPQEFRKVRNELFIKMFNNEKV
FT                   GLYNIRDMTIPVRNGDIKVRVYFPNQRENLPAVVYYHGGGFVYGNLDTHDSVCRLISKL
FT                   SNTIIVSVDYRLAPEHKFPTQVYDAYDVVKWLANNGGKLSIDTSKIAVAGDSAGGNLST
FT                   VVSILDRDNGENVVKYQIMIYPVVNMLDSSPSMYNYGDGYFLTYERILWYNKQYVKEDS
FT                   DYYNPLASPILAESHNLPPALIITAEYDPLRDQGEMYAHKLKVSGVKTISLRYNGMIHG
FT                   FVSFYEYLDTGKEAIHHIASSIRKMFNVFY"
FT   gene            complement(289183..290127)
FT                   /locus_tag="Ssol_0329"
FT   CDS_pept        complement(289183..290127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0329"
FT                   /product="Aryldialkylphosphatase"
FT                   /EC_number="3.1.8.1"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: sid:M164_0332
FT                   aryldialkylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90621"
FT                   /db_xref="GOA:D0KN86"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN86"
FT                   /inference="protein motif:PRIAM:3.1.8.1"
FT                   /protein_id="ACX90621.1"
FT                   /translation="MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEE
FT                   FRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPF
FT                   YFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIANKET
FT                   KVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLD
FT                   RYGLDLFLPVDKRNETTLRLIKDGYSDKIMISHDYCCTIDWGTAKPEYKPKLAPRWSIT
FT                   LIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS"
FT   gene            290206..291885
FT                   /locus_tag="Ssol_0330"
FT   CDS_pept        290206..291885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0330"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sin:YN1551_2920 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90622"
FT                   /db_xref="GOA:D0KN87"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN87"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX90622.1"
FT                   /translation="MNQSILYDRPWFKYWPPRLPKTLDYPKVPLFNIVEVSSQRYPNKT
FT                   AIIYYGNRITYKELWESIIKFSAFLSNKLGVRKGDRIALFMPNSIQWIIAYFGILRANA
FT                   ILVPINPLLAEDELNYILKDSGSVGVVTLSSYLSKVMKAKENTQVKWVIAGRFKDYLPD
FT                   NPEIKVHPLMLREPELSNDVIPWKETLRNNYTPPSVEVDAEDIAVIPYTSGTTGVPKGC
FT                   IHTHSTIWPTILGSVIWNTLAPSAVVLTSLPVFHVTGFIHSLNAPLYVGSTMVLLSIWD
FT                   REAALDAIAKYRVTHWTNISTMVVDLLATPGIEKRDLSSLMLVGGGGAPMPEAVARKLK
FT                   ELTGLDYIEGYGLTETMSQTHVNPPQRPKLQCLGIPHFGVDALIIDPSTGEVLPPNREG
FT                   EIVVRCPSLFKGYWNKEEETRKSFITINGLEYFRTGDLGYMDDEGYFFILDRVKRMINR
FT                   AGYKVWPTKVENKLYQHPAVLEACVVATPDPRVNEEVKAYIVLKPEYKGKITADEIREW
FT                   CKQHMSAYEYPRIIEFVDSLPKSGSGKILWRVLQEKEKGANK"
FT   gene            complement(291938..292384)
FT                   /locus_tag="Ssol_0331"
FT   CDS_pept        complement(291938..292384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0331"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   sid:M164_0334 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90623"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN88"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ACX90623.1"
FT                   /translation="MEFKGTFDVKRTIEAVKGFLINPKQFAECLTGLQSYETNNNVFKA
FT                   IFKLDVSQMKIPHMTTLTASINANIIEKENSVEINGDGRSAGVGIKFNIILGLKKDEGI
FT                   TRVNWFAKINLGMLSRLLGEENIRRIAEPNINHIINCISSKLSY"
FT   gene            complement(292387..293724)
FT                   /locus_tag="Ssol_0332"
FT   CDS_pept        complement(292387..293724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0332"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sid:M164_0335 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90624"
FT                   /db_xref="GOA:D0KN89"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN89"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACX90624.1"
FT                   /translation="MSTFLMLNPLHIIMEIKSTVTVIGGGVSGLFTALDLALRGIDVTL
FT                   VDRGDIGYGTSGKFHGLLHSGARYAVTDPDSARECIQENKIISKIAPHTVKDTGGVFLG
FT                   ITDDDLQFSETFIKALNKVGIESKVIDVKEVLQKEPFINRDTKMAIWVPDKVVYGYDLL
FT                   ASVAITASLNGAKILTYNEVVEIIRENNNVKGVKVLDKINNNTNVIKSDIIVNTAGPWS
FT                   FNIIKMAGLEEIPIMPTAGIIVVFDKRVNNMVINRLRPPSDGDIIVPYADSSILGTTAT
FT                   IIEDPDNFTISDEDIAMLVNEGAYLIPKLKNMRVVRSYASVRPLIKSEVSAREASRDFR
FT                   IIDHEKENGLSGLVSVIGGKFTTGRLAGERVADLVSSKLGIKSASKTATTKLLSPNDIN
FT                   LLNYAEKIRLPKVIVRSILDRKGSLDEERYLSSLYILLSLISRGTM"
FT   gene            complement(294141..295364)
FT                   /locus_tag="Ssol_0333"
FT   CDS_pept        complement(294141..295364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0333"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: sin:YN1551_1879
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90625"
FT                   /db_xref="GOA:D0KN90"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN90"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACX90625.1"
FT                   /translation="MDLGIKNGNVFNGKGVVGKVNIYVKDGKIVEISKENKQAKIEIDA
FT                   KDMFVMPGLIDAHIHLTGIKGGSLLKTMFEKPEYRVLRASKWLEKLLLAGFTTVRDCGE
FT                   TISLALKRGVSEGIINGPRIIAAGKPISQTFGHGELSHDVPLEFSMALSFSEFCDGVES
FT                   CIRASRKVLRDGADFIKIFATGGVLSQRDRPEHPQLSYEEISAIVNEAEKINTYVAAHA
FT                   HGDKGARIAVEAGIKTLEHGTLLRDETLKLMRERNVTLTPTLTIQELIYKYGKQIGVDE
FT                   WGLQKINEVRESVVNVVKKAEEYGVMIITGTDLGFETGLEEIDIGKNWMESVLLVERGG
FT                   LSTISSLRASTYNSAFAIGINAGAIEVGKDADIIVIDGDPTENIRDLSKVRRVVKNGKL
FT                   TVEDGKFL"
FT   gene            complement(295372..296652)
FT                   /locus_tag="Ssol_0334"
FT   CDS_pept        complement(295372..296652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0334"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sim:M1627_0710 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90626"
FT                   /db_xref="GOA:D0KN91"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN91"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90626.1"
FT                   /translation="MKDETKVSIAAMIGIAFEFYDFLIFGFVSSILASLFFPSTNKIVS
FT                   LLDTLAVFATGFAGRPLGAIVFGHLGDKIGRKYTLIVTMSLMGLSSLFTGLLPSYAVLG
FT                   ILAPTLLTVLRLLQGFSLGGEFGGGITLSAEFAKPTNRAFYIGIAQMAQGVGPLMATGL
FT                   IFIFSSIMSPPAFASTGWRILFIIGAFIAVIGVIIRLKISESPVFKNVREMGQISKFPL
FT                   AEAFRLYWKRILLGLGFIIGGTTLTYATSVFAASYLETVIGVPAKTVSLALTIGYIVEA
FT                   ICILAFSLLADKIGRKPMMITTAVGLLILVYPYFYLISTGQFSLILLAQILYSTIGSFS
FT                   TAAYAAALTELFPTKVRYTALSFDYHVGVAVFGGTTPFIASYLIYATGYKLAPVYWGIA
FT                   GMVITLIAYLLYKETKGTIFEGQERVR"
FT   gene            296856..296987
FT                   /locus_tag="Ssol_0335"
FT   CDS_pept        296856..296987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90627"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90627.1"
FT                   /translation="MMSKINYEHILKKLGKVSRIDLPKIVSAFRKFIALGKGYTTRS"
FT   gene            complement(297261..297629)
FT                   /locus_tag="Ssol_0336"
FT   CDS_pept        complement(297261..297629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0336"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: sid:M164_1040 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90628"
FT                   /db_xref="GOA:D0KN93"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN93"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACX90628.1"
FT                   /translation="MGKAKSALKSQVELVKVAIEFINDISNEIRIEDVYVVGSRARGDY
FT                   LETSDIDLVIISRDFEGLRYIDRLEKLGKHLRARVEFFAFTPEEWKEPKSLLIKEMKKE
FT                   AKRLEDLAKEIGLSFLNN"
FT   gene            complement(297605..297994)
FT                   /locus_tag="Ssol_0337"
FT   CDS_pept        complement(297605..297994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0337"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein; KEGG: sid:M164_1041 HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90629"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN94"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ACX90629.1"
FT                   /translation="MREEAQKWFRQALEDLATAKDTITTGHYYASAFWAEQAAEKALKA
FT                   LLIENGKIERTHDLNQLLYVIKEEIGLPVEEIRSEVNKLTLHYTISRYPDAANTIPYSL
FT                   YTKEDAEELVKKAEKVIEWVRRNLH"
FT   gene            complement(298201..298773)
FT                   /locus_tag="Ssol_0338"
FT   CDS_pept        complement(298201..298773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0338"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sin:YN1551_2528
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90630"
FT                   /db_xref="GOA:D0KN95"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN95"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX90630.1"
FT                   /translation="MREISIEWDGKILILSDIHYPYCNTEEINKIMLSEKPSLTVLLGD
FT                   IVVSKSEDYRNFINSLKIRKNIIYVRGDEDKFRGDFDLVKIKNNGRRFILLHGHQYFNE
FT                   SDEYSIAKILKKINDNIPPFLFCIFFRIMLMNFNATIILGHSHALRYFKSINCVNAGTL
FT                   SNVENLYNDRGYVVIEKGNVKLVQSKT"
FT   gene            298815..299228
FT                   /locus_tag="Ssol_0339"
FT   CDS_pept        298815..299228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0339"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   sin:YN1551_2717 protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90631"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN96"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ACX90631.1"
FT                   /translation="MKVYFDDIYVSTARQFELVDITDQVEQIVEKSGIKNGICLIFVAH
FT                   STAAIVANEHERGLMEDILTKIKEFTEPSRSWKHNLIDDNAHAHLGATFLGAERVFPVR
FT                   EGKLVRGTWQNIFLVELDGPRSERHITVEILGE"
FT   gene            complement(299217..300185)
FT                   /locus_tag="Ssol_0340"
FT   CDS_pept        complement(299217..300185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0340"
FT                   /product="glycoside hydrolase family 12"
FT                   /note="PFAM: glycoside hydrolase family 12; KEGG:
FT                   sid:M164_0358 cellulase (endo 1,4 beta glucanase), putative
FT                   (CelB)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90632"
FT                   /db_xref="GOA:D0KN97"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN97"
FT                   /inference="protein motif:PFAM:PF01670"
FT                   /protein_id="ACX90632.1"
FT                   /translation="MNKLIPIFVVVIIVLGIIVSIEFGKFHQNASLTRSTERFTLFPAH
FT                   NRPFSVLGNYSSNSADALAILNSSTNATLMVSPFLWNIGYALGNVNMTININYLHVAIN
FT                   LSQISKISSNVVDGYPGLMYGQELWWPFMYRTTQLQFLSLPMIVLRLPNFYSILNYSVY
FT                   LINGSIDDFSYDIWLSQNPNITSLQYGDFEIMIWMYWNENLSHTPYFIYVGNMSIPTLI
FT                   NGKIENLSWEVYVLPRTGSANGWTGVYFLSPLKEPKAEFGVPIGYILKNMGSYIEKAGV
FT                   NIYNVNTYYLDAIQVGMEFSDNQGTAIMGYYLYSWQIWLLS"
FT   gene            300560..301300
FT                   /locus_tag="Ssol_0341"
FT   CDS_pept        300560..301300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0341"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   sia:M1425_0393 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90633"
FT                   /db_xref="GOA:D0KN98"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN98"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACX90633.1"
FT                   /translation="MTKILLEKRKDVCWITLNRPEKLNALDKESWSLLANHLGECNNDQ
FT                   SISAIVLTGNGRAFSAGDDINAMLELKDQKDALDFFNTLYSAVESLVDLKKPLVCAVNG
FT                   LAYGGGCEILLFCDIVIAVKDATFSIPEGRLGLIPPIAISLGYLILGRSIARLALTGDS
FT                   ITAEEAKMIGLVDIVVANEDLLTEVERQLEKIKSIDRSSILTIKNWLRDDKEKIRKAVM
FT                   ELALMALGNSAKEKMKEFMNRKRS"
FT   gene            301437..302480
FT                   /locus_tag="Ssol_0342"
FT   CDS_pept        301437..302480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0342"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sin:YN1551_2640 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90634"
FT                   /db_xref="GOA:D0KN99"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN99"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX90634.1"
FT                   /translation="MRAVRLVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMR
FT                   QGRFGNLRIVEDLGVKLPVTLGHEIAGKIEEVGDEVVGYSKGDLVAVNPWQGEGNCYYC
FT                   RIGEEHLCDSPRWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV
FT                   RKASLDPTKTLLVVGAGGGLGTMAVQIAKAVSGATIIGVDVREEAVEAAKRAGADYVIN
FT                   ASMQDPLAEIRRITESKGVDAVIDLNNSEKTLSVYPKALAKQGKYVMVGLFGADLHYHA
FT                   PLITLSEIQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAI
FT                   GRQVLIP"
FT   gene            complement(302550..304361)
FT                   /locus_tag="Ssol_0343"
FT   CDS_pept        complement(302550..304361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0343"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   sid:M164_0433 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90635"
FT                   /db_xref="GOA:D0KNA0"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNA0"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ACX90635.1"
FT                   /translation="MKSSLDFLNNFIQRDAVKKLESINNYPLIEFLNSVVKLCEPDSVY
FT                   LITGSDEEKEYIRKKALESKEEIRLQTSGHTIHFDHPLDQARAREDTFILSDTKIPYVN
FT                   TKPRNEGLSEMLTLLKGSMRGREMYVGFYSLGPRNSPFQILAVQVTDSPYVIHSENILY
FT                   RIAFEDFSNNTKFLRFVHSKGEPDIKKRRIMIDLANNTVYSVNTTYAGNSVGLKKLALR
FT                   LTIMKAVEEGWLSEHMAIVGFNGDKGIHYFTASFPSGSGKTSTSMIGNLISDDLAFIRE
FT                   FEGLPKAVNPEIGVFGIIQGINARDDPIIWEVLHKPGEVIFSNVLMTEDGDVYWEGSEL
FT                   PKPERGYNHEGRWDRESGKPASHPNARFTVPLTSFSNLDKNWDNPNGVIIDGIIFGVRD
FT                   YSTLVPVVEAFSWSHGVITIGASMESARTSAVIGKSDELEFNPMAILDFMPISLSRYLR
FT                   NYLNFGKRLRKSPKIFGFNYFLKDDNKFLNSKEDKKVWVSWAVKRVEETANAIYTPIGL
FT                   IPFYEDLKALFKRVLGKEYGKEEYEKQFTIKLRKYLEKTERIIEIYLKFEDIPSEVINE
FT                   LKMQKERIVDYINKYGDSVSPFRLEKD"
FT   gene            complement(304895..306292)
FT                   /locus_tag="Ssol_0344"
FT   CDS_pept        complement(304895..306292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0344"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sim:M1627_0410 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90636"
FT                   /db_xref="GOA:D0KNA1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNA1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX90636.1"
FT                   /translation="MIVSVTAEIGLDIGQNFAGGLGILEGDKFYAAARLGINYTVITLL
FT                   YRRGYADGEGKQRELLSHLNKEWENEITVGDQRIMVEYLAYTLNTAKVIFANPLNTNLN
FT                   DQLYVENSNDERFYKCLLLAKVAENYISERIGWDKVKFVDMQEACPAFLPLLRYFPRYR
FT                   IVVHTPAPWGHPTFPSHLFKKEFSFEFPLDHVVMTDIGLSASIEGIVVSKKMLKHVSRT
FT                   FPQHMHKIRAVTNGIEISRWRNPSLNMVKDLDDFMKKRIEVKRDSIKKLGKDTDKPTIA
FT                   WLRRITGYKRPDFILRLIDDLKDDVFFIIGGLAHPKDYSAVEIERKFKEISDKRNNVIY
FT                   IRGADANFMKLAIWASDIWTFTPYSGWEASGTSFMKAGINGIPSVASRDGAVTEIINDG
FT                   YNGWLYGEDRDILLPFNVYDDNKEYEEFINKIKVALNKYYEVGYNAYKTFPAFCSIDRL
FT                   MKEYGYY"
FT   gene            complement(306338..306931)
FT                   /locus_tag="Ssol_0345"
FT   CDS_pept        complement(306338..306931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90637"
FT                   /db_xref="GOA:D0KNA2"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNA2"
FT                   /inference="similar to AA sequence:KEGG:M164_0435"
FT                   /protein_id="ACX90637.1"
FT                   /translation="MKKAELLFDAYKSRKEIEPFPLAEDEAKKVKDEFVEMLINSEGLG
FT                   GYKLSAFGEGVLTKPMITRENIVELWFRNHKLEVEIVALVKNGEVKRTFLGLEIPAPRF
FT                   TTWDLPQHYIIADDIFAARLHVGPEIDPPFGSFKLYINDRFIGDGEPKYKPEEKVREYM
FT                   EGYVSLGVFIGPISVKRRDKIRVEGKKSISVSLI"
FT   gene            complement(307268..308233)
FT                   /locus_tag="Ssol_0346"
FT   CDS_pept        complement(307268..308233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0346"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90638"
FT                   /db_xref="GOA:D0KNL8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNL8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90638.1"
FT                   /translation="MQTIQVSKTELKSLAINLATININVISQDLDPEIVKAAPSLLTGN
FT                   RGKYYLKVVRRGEKVISKGQRTFKFYPIYREVKGEINVVAVDETGLTVGEKEQEKAEGF
FT                   LLYNWKRKGVKMRSLDLVYPLRLPLLVEVADLRSDSPSQFLLRSVREVSQYMEIDYVVA
FT                   DAGFLNLGVIKEMPVKTIVRGKSNLKGFKELSNVPLVEKRYEVKDKVYVAYRVLEFEGL
FT                   YYYDVVYVKGKPRHFMFVTNFEGDPYELAELYRLRWQVEEGFKVRKARIRYVRKLSNKI
FT                   FLFLYYTVLDSAWNLVNHLLFNFKSTCKKVLSFDSFVKLL"
FT   gene            complement(308326..308487)
FT                   /pseudo
FT                   /locus_tag="Ssol_0347"
FT                   /product="hypothetical protein"
FT   gene            complement(308514..309347)
FT                   /locus_tag="Ssol_0348"
FT   CDS_pept        complement(308514..309347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90639"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNL9"
FT                   /inference="similar to AA sequence:KEGG:M1627_2814"
FT                   /protein_id="ACX90639.1"
FT                   /translation="MEIEIKTPFASVRINNDNKQSEIINGKDRIVIGRIYYYLTKTIFL
FT                   IPRLYGIIAKDPLVDWKNEFERQFTHILTNELTLAKLLTLELYFRITSLKMSITGSIQN
FT                   GKVEAKVELKTLPEIKQQEDKIRSLVRIDSFYFSDINKKRPHIIPAIRAGLIASFYKFL
FT                   PIKFEGAPGIPKTLGIISDFINSMVLPQGYSEEVLGHKIYIKDDEVYCDDNILYNADPT
FT                   VLSLFPIVYFIKNSSENDIIVIEEHEVHLEEFKEILKEILNKSRAKLVLVSNKVI"
FT   gene            complement(309687..311593)
FT                   /pseudo
FT                   /locus_tag="Ssol_0349"
FT                   /product="hypothetical protein"
FT   gene            310109..311059
FT                   /locus_tag="Ssol_0350"
FT   CDS_pept        310109..311059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0350"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sto:ST1908 insertion element DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90640"
FT                   /db_xref="GOA:D0KNM0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM0"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACX90640.1"
FT                   /translation="MEAPVAGIDVSKDKLVVYFQGKYYEFQNNKQGFEGVKQVLPKGCK
FT                   VAIESTGVYHINLAKYLGKEYDVRIINPLVLKKFKNIRGKKSDKNDAKKLAELVISMGS
FT                   EFTTSEAKELTSQWDFITRSIVRVKNRLRRDLILLGYKDSLSKKNLNEVLRGEDNIVLS
FT                   EVRFLLDELERLEVRKREIEEELEDLVPKDSLIFTIPGIGRTLGCIILARVGDVKRFGD
FT                   KKRFVAYCGLDPLVESSGKSVVSRGISRRGDAVLRRAFYLAALTAIKVNPIIKRFYEEH
FT                   KENLKGKKLITACARKLAVITWAVLYYNKPFDANE"
FT   gene            complement(311730..312023)
FT                   /pseudo
FT                   /locus_tag="Ssol_0351"
FT                   /product="hypothetical protein"
FT   gene            312136..312630
FT                   /locus_tag="Ssol_0352"
FT   CDS_pept        312136..312630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90641"
FT                   /db_xref="GOA:D0KNM1"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM1"
FT                   /inference="similar to AA sequence:KEGG:M164_2742"
FT                   /protein_id="ACX90641.1"
FT                   /translation="MDMASRRKNARGLSGAVTALILVIASVIIALVVVGFAFGLFGAFT
FT                   GQGTVTQVGTATLRASTLTLTVTLKNTGASTQVTGVLINGNSGSVSGMTTISAGVNTYT
FT                   ITISIGSISTTLRGLVGSTISLTLILSNGETVTVSAIAVVFHQIISLERYCVNSFKREL
FT                   I"
FT   gene            complement(312779..313744)
FT                   /locus_tag="Ssol_0353"
FT   CDS_pept        complement(312779..313744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0353"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90642"
FT                   /db_xref="GOA:D0KN41"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN41"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90642.1"
FT                   /translation="MQVYETGFKTELKSLASYFIVNNLNVISQELDTRIADAAPFLLTG
FT                   NRGKEYLKVVREGEKVMSQGERSFKFYPHVKVEGETTIVAVDETAITVGEKESRKVEGF
FT                   QLYNGKRKGVKLRSVDLVFPLRLSLLEEIADLRSDTPSQFLMRAVSEVAQHLKIDYVVA
FT                   DAGFLNLKVIKEMPVKTVVGGKTNLKGFKELSNVPLTEKKCEVNDRVYVAYRVLKYNDL
FT                   YYYEVIYVKEKPRHFIFVTNFNGDPYKLAELYRLRWQSEEGFKVRKARIRYVRKLTNKI
FT                   FLYLYYTVLDSVWNLVNYLLFNFKSTKRKPLSFNSFVRLL"
FT   gene            314036..314758
FT                   /locus_tag="Ssol_0354"
FT   CDS_pept        314036..314758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90643"
FT                   /db_xref="GOA:D0KNM3"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM3"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3126"
FT                   /protein_id="ACX90643.1"
FT                   /translation="MKFFVFFLFIFLFQLALSLTLVAMSESSLISGTFVIYNGTSTYYL
FT                   QNGSILFQKFSIIQVINKTFNNGTVLVGISIISWNTSMQSKFLYSVMNSTLPLPFYYVS
FT                   PYLLGEENISVNEVELFYVNHTNSYYVYLGKGNIDGVIIKTYFYFKPDGLADKVINLQL
FT                   GANGKIVSETTLALWITNFNNTSIGIPHFKGITTASASNEISVSLFPVYAKIMEYIIMA
FT                   GAILVMIILLFRGTKRVR"
FT   gene            314761..315456
FT                   /locus_tag="Ssol_0355"
FT   CDS_pept        314761..315456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90644"
FT                   /db_xref="GOA:D0KNM4"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM4"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3125"
FT                   /protein_id="ACX90644.1"
FT                   /translation="MSSPLWFLFVIVLFPHAFVEYSLHIQVDYNNQVYHLSELLFENVT
FT                   KVYYSNSTFVYNLTVYVLNFSQILTSSAILDNFSLPKTFFYIPNPGEPVVERSVILSLL
FT                   SSNDSNYIYYGKTFIGYVELEYFYYVNSTGVPYKIIILQIGESGQLVSNTTYILVKSNL
FT                   VNPNEQPILPEGFKIANGSEVVNVPISLGLNSALDQLVGKYISFVTLLLVFVFLTVRFY
FT                   ASRKKTSSN"
FT   gene            315425..319005
FT                   /pseudo
FT                   /locus_tag="Ssol_0356"
FT                   /product="hypothetical protein"
FT   gene            complement(317238..318197)
FT                   /locus_tag="Ssol_0357"
FT   CDS_pept        complement(317238..318197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0357"
FT                   /product="Transposase, ISC1234/ST1916, Sulfolobus"
FT                   /note="PFAM: Transposase, ISC1234/ST1916, Sulfolobus; KEGG:
FT                   sim:M1627_0628 transposase, ISC1234/ST1916"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90645"
FT                   /db_xref="GOA:D0KN59"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN59"
FT                   /inference="protein motif:PFAM:PF05457"
FT                   /protein_id="ACX90645.1"
FT                   /translation="MGVEGSTMARTLRHIPNLMYYPLPPIEDMPWREKWLTEIKPVLDA
FT                   MDLERVLGEGALVYLKLLIVMVLYSCSYRDAVKMVNVNVVVAWFVGRKVGKSTLHDFVG
FT                   RLYGVRKKLLEISFKLEEKCLPSYLPASAHLVDFMAWLVDSFLLDLPPGKRSVETFREK
FT                   AELERREGNLERARKLLSLGRTKRRFEGRWTKKRGVSHYGLKAIAVISVSLFVRSITVK
FT                   PANFSDKRFKSPLKGIKIADRGFSPSPTQLIAREKPFTTLRAHVEFFGTYLNAFWRPYG
FT                   TTTWRNDVFLHVLGVIYNIKMFLAIQRRTPPGRRAVQL"
FT   gene            319010..320509
FT                   /locus_tag="Ssol_0358"
FT   CDS_pept        319010..320509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0358"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   siy:YG5714_2934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90646"
FT                   /db_xref="GOA:D0KNM6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM6"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACX90646.1"
FT                   /translation="MTKLFVRETSGLTKNVSLLDVTMLNVANMGAGLAIFIGISPYIVE
FT                   GAVLWIASLLTFLFTLPLVFLYTYFISRIPRTGGDYIWLSRKLNGPLGAIMGVALAFNM
FT                   PPFFALSAFFSVSAINSVLLTIGTLNSQPYLVNLANNVFTTSNAVLAYGLAAVAFLIII
FT                   LINILRPRWGYTLTSALGMFSLLGTLVAILVLTLNISDFHTVIQPFIKDFNLTVQLYKG
FT                   PTFSLSSTFYMIPYFASFAYIWLYAGPAVASEIKNKSGIRYNLILGSLLTLIFITVPFL
FT                   LMDVAAGYGFNYSLYLSGTYNFWTVAIALSRNYALEWFIGISLIAWEFFVMAFGVVVFA
FT                   RYVFAFSFDRLFPEVFSRLNKQGSPAYAHLLDFVVTLVFLAVPIISPNGYEALYSYTPL
FT                   AIAYLVLVSIAGIRQALSERNLGMLISALLSIGFLGFMGYEAFTNPYFGVISDNGVPYW
FT                   PGIAYITSLIGLGVITFVSSYYYRKKSGIDLRLVYKEIPPD"
FT   gene            complement(320506..320799)
FT                   /locus_tag="Ssol_0359"
FT   CDS_pept        complement(320506..320799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90647"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3122"
FT                   /protein_id="ACX90647.1"
FT                   /translation="MTMAEALNKIMKNRTTTLKLSYYPFLLAVKDNVPELDIMLKRKRE
FT                   LNYYLDKLYSESKKYLLKYAKDKYYCVCGRTFPSAYDFYTHVFREHKLSIRN"
FT   gene            321100..321294
FT                   /locus_tag="Ssol_0360"
FT   CDS_pept        321100..321294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0360"
FT                   /product="DNA-binding 7 kDa protein"
FT                   /note="PFAM: DNA-binding 7 kDa protein; KEGG:
FT                   sin:YN1551_1897 DNA-binding 7 kDa protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90648"
FT                   /db_xref="GOA:D0KNM8"
FT                   /db_xref="InterPro:IPR003212"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM8"
FT                   /inference="protein motif:PFAM:PF02294"
FT                   /protein_id="ACX90648.1"
FT                   /translation="MATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGA
FT                   VSEKDAPKELLQMLEKQKK"
FT   gene            321437..325363
FT                   /locus_tag="Ssol_0361"
FT   CDS_pept        321437..325363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0361"
FT                   /product="Peptidase S53 propeptide"
FT                   /note="PFAM: Peptidase S53 propeptide; KEGG: sis:LS215_2917
FT                   peptidase S53 propeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90649"
FT                   /db_xref="GOA:D0KNM9"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR017001"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNM9"
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /protein_id="ACX90649.1"
FT                   /translation="MESRIIQVVVISTFLVLSVLFPLLSLAYSTTSINPSYPQSNVISA
FT                   LPSNTNIILYFFIPPKNLNELYLIAQEVANHQIKPLSNAQLVSMFSNQDKVNESIKYLE
FT                   SKGFTIIYRSPFEIMAEAPVSLVSSVFETSFVLAKSTNGEIYYKPAGNVKIPSTLNNLL
FT                   IGGLTNFTNVSLPLIQLGKLENGNLIPNKQAYSSFVYTFQFSATWYTPKVIEGAYNITP
FT                   LLNSTADKKVTIAIIDAYGDPEIYQDVNLFDARFGLPPINLTVLPVGPYHPENGLFTGW
FT                   FEEVALDVEAAHAAAPYSNILLVVAPSATLEGLFSAIDVVVSEDLAQVVSMSWGLPGIL
FT                   FGASGFYAVFNGIIFPNYPYYDYYFELGSAEGITFLASSGDLGAYNDLPTVYGSANYPA
FT                   SSPFVTAVGGTSLFANITSGYISTYNSTGNFGAEIAWSVNPLYFGVIQGGVSSGGGYSQ
FT                   LFPAPWYQRYVTHSNYRAIPDVAADANPYTGFTIYALGQEVVIGGTSLSAPLWAGIIAD
FT                   IDGIIGHPLGLVNPILYEIYQNTTLYHQAFHQISLGYNGYYYANSSYNLVTGLGSPNAG
FT                   MLGVIIKHSLSKSLAISVSTFETGVFQPWYFYGSTFTIAAYITYPNNTIVSQGSFNAYI
FT                   YTSEGYLATVPLSFNGSYWVGNYTITPNNPPNLWEIVVNGSSDQFTGVGTVEVDVGESI
FT                   NIVSPIPYPYSFPIPYNSPFGIEAWIYYPNGTPVVNQSVTAYLVSNDGKLLASIPLTMM
FT                   APGLYEGSYALLPPLPQGTYLLIVNDSYGSAFSYVYFGEYNFGAILTPINDGFPAASPG
FT                   QNITIIDEVLTPELTGLFTSNVTAYIYNQHGNLIDQVKLTPAPDEIQFGVYLLFFLYYA
FT                   NFTIPFDASPGFYNVVIQSISNTSTGLVKADFITSFYVSPANLTLNVKVNNVVYEGELL
FT                   KIFANITYPNGTPVKYGMFTATILPTSLNYEQLIIGFEAGIPLQYNSTLGEWVGIYSIP
FT                   SIFYGSIFQGSSVYSLAGPWNVIVSGVSWNGYNLYSTPSSFNFVNVMPYTFINNIVVSS
FT                   KSLDSPLLSKINSTTYMLSNVKSNNITINGMNVILSNVIANTVTVKNSNIMITSSTINQ
FT                   LVLDNSSVSIIGSKIGGDNIAVVANDSNVTIVSSVIQDSKYAFLQPNSVISLSGVNMYN
FT                   VTSLSSIPAPRITYLSTTNVTTSKESIIVNITGEYLRLLGVSMNNKPVGYSVISSSPSS
FT                   ISLSIPFNASQLSDGQYIFTVSISDGLPYNLTFNLLNNYHLIIVQDHLKALQGSVNLLT
FT                   VIAIISLIIAIIAVALLFVFTRRR"
FT   gene            325368..327200
FT                   /locus_tag="Ssol_0362"
FT   CDS_pept        325368..327200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90650"
FT                   /db_xref="InterPro:IPR021102"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN0"
FT                   /inference="similar to AA sequence:KEGG:M1627_2804"
FT                   /protein_id="ACX90650.1"
FT                   /translation="MRKNIALILLFSILAGIIVVPISSSQTSSSISHPLILGNISVLNS
FT                   GKIPYDPTYYSFEAYQIHPPNVTPVVIRIATNAVFNNSGLTPYIVHVNIPKGNYSMEIL
FT                   NVSIAESNGAQYDRPVYIFANGVPIFWGSTQEFFNSTAETDVTMFENLLSGNVTFQLVL
FT                   ENFYDAKIGITGIYKMNVTLYLYPGNPPKGLPNYFIPLFLNNHNYSYIILNPLNDYISQ
FT                   NVTIPNGTYRMTLLLYEEGGGLDEFWYANEPATREIQVFYDNRLVGVVNPYQTIYTGGI
FT                   DLFWWKPVTSINTLSFHSPYIIDLTPLLAISLPNNTIAVTVTNLETALQLTGTAAYDWD
FT                   IAGVLMLWVNESNPLVSAKLLTAYNRFIDSSPIFNSGLVGEYYQEGGAYLLNYSAILQF
FT                   KDGIEYSDVVQQGRFYAYQTFNALYEKAYLGEKFMEYASERGSLYNATLYYNIYYPIFM
FT                   QFSVFEAPISNPHVIPFNLSYAQNGTLDLWLYYNYTNIFDKQNLTIRTMENVSAVGGFS
FT                   GIIEVINRYGGAVLVSITSNNAVTAKNLINYILLNGNGYKEIFSAKGLQNSTSHFAGYY
FT                   IYYKVQFIPITNGDPPNAHSEFLIEPIHFLRIIV"
FT   gene            complement(327162..328181)
FT                   /locus_tag="Ssol_0363"
FT   CDS_pept        complement(327162..328181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0363"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: sid:M164_2733
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90651"
FT                   /db_xref="GOA:D0KNN1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN1"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACX90651.1"
FT                   /translation="MSEKEFIMASAESWLENEISTDTFTMNSLRPFYLYLRNELKLLLG
FT                   VNFIEERNKLIKNDPVNYMRLLFDDAGIDGFVIDTGFGKKEMEIPAKLKLLFRIESIIN
FT                   DDIFQMSFDKALEYFEETLRRKITKEGYAGFKSIIAYRTGLKVNCNIEEARRDFHSNEK
FT                   DWFGKVAKGFRDYLLCETLRIAKELRVPVQIHTGAGDRDIKLELSRPSYLTNIVRKYEG
FT                   KVIFVHAGYPYHRETAWMSYLFPSVYLDTSQVIPFAPLAAYNILNEIFEVAPLNKVMHG
FT                   SDAFHIPEISWLAAKLAKKAIQKTTELMIEKNILDEKHAKEMVERFLYYNSKEMYGFD"
FT   gene            complement(328217..331739)
FT                   /pseudo
FT                   /locus_tag="Ssol_0364"
FT                   /product="hypothetical protein"
FT   gene            329061..330074
FT                   /locus_tag="Ssol_0365"
FT   CDS_pept        329061..330074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0365"
FT                   /product="helix-turn-helix Psq domain protein"
FT                   /note="PFAM: helix-turn-helix Psq domain protein; KEGG:
FT                   sid:M164_0862 ORF2 in transposon ISC1078"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90652"
FT                   /db_xref="GOA:D0KNN2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN2"
FT                   /inference="protein motif:PFAM:PF05225"
FT                   /protein_id="ACX90652.1"
FT                   /translation="MPKSRMHGIRLNKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIF
FT                   TVYKWLRKGDLSAKPRKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEF
FT                   GIKYNPRSLSPVLKKLGFKYKKGKRTYVRDDNAVERWVKEQGEKLFKKIREGYKVHIFD
FT                   ESYVSYINKGKGWMKVGGGIKVNPKRKRFAVVGGITISKEGITFSYSTYKKPSLNSKDI
FT                   ILYLRKVIKDEKTVIVMDNARIHGNEVREFLEENGVEFVYLPPYSPDKSPAEGPWAVLK
FT                   KRLYSKIYTDFETLMWDATRFLRSISKRVNDLTYSVKRCGEPWTSILSEVFLPFKV"
FT   gene            complement(330237..331301)
FT                   /locus_tag="Ssol_0366"
FT   CDS_pept        complement(330237..331301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0366"
FT                   /product="Transposase, ISC1217"
FT                   /note="PFAM: Transposase, ISC1217; KEGG: sto:ST2181
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90653"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN3"
FT                   /inference="protein motif:PFAM:PF04693"
FT                   /protein_id="ACX90653.1"
FT                   /translation="MTKELTREEYYKALEKAVNEVILSMTGTRKDVAKRLVLGAVVGRN
FT                   ATEIAQEAEMDYETVLNNLDKAAQAKLIEVVKKLVGDHPVLLIVDDTHDHKLYARAMPV
FT                   SRNGAQIFYCRAHKRFESAIQLLVIGVKDLVNNQIYVIHIIAYIPRKVEEELKRRGEEV
FT                   KFKTKIDALLEFLSSLSGLNVKSKVFDSWYVNSRTLQGNTVGELKANARVVEGGRSVPV
FT                   GEFPQGEYLVEYLGTPIKLLVIDDYKGYGRRYFFSTDLNDTAEDIITTWENRWDIEVLI
FT                   RELKALGLEGGSFLTWVRNSGFVALKALSLLVVQYFKYSTGLRLGAKRLARLIKSIYHE
FT                   VGGIKKLFKRRRKP"
FT   gene            complement(331777..332532)
FT                   /locus_tag="Ssol_0367"
FT   CDS_pept        complement(331777..332532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90654"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN4"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2927"
FT                   /protein_id="ACX90654.1"
FT                   /translation="MTLTKEQLLNRGIEVIDKAENEGITLRVIGGAAIALIAKKGSELY
FT                   PRVYKDIDYFGLSSQSTKISRFLEGIGLIPNKRFNALHGHIRLMFFDPIINSTVDVFLD
FT                   EFVMCHKLVLKDRLRIMKYTIPTSDLFLTKMQIIQLTENDKKDIAALLYDVELGERDDE
FT                   KTMNYNYIAKILSEDWGFYKTYTINHDRVLEFMKNDKNREIIEPKLVKLREIIEKHPKS
FT                   IKWKMRAKIGEKVKWYEEPEEVNTNFTQQ"
FT   gene            332665..333036
FT                   /locus_tag="Ssol_0368"
FT   CDS_pept        332665..333036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90655"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3114"
FT                   /protein_id="ACX90655.1"
FT                   /translation="MEPLIAIDLNSNMSISQLESSVKKLFETFGALDVVFIIDDDSIVE
FT                   LDGNLVLTFYSVKELVETYKVLKKLSEVKSNRLRVTSVIRLERDLKRFPLVVITDRKIV
FT                   GLNKNLIFVYDGDKVKARY"
FT   gene            333247..334464
FT                   /locus_tag="Ssol_0369"
FT   CDS_pept        333247..334464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0369"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sis:LS215_2911 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90656"
FT                   /db_xref="GOA:D0KNN6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90656.1"
FT                   /translation="MKAENWSNVVGGYISWVMDGYDLGAVVITATILGKLFYPGIGLLS
FT                   AVLPIVFTVISRPLGGFVFGYVGDKYGRRVSLLISVLGYSLSIGLTSILPTYAQIGILA
FT                   AVIISILRFIQGIFIGGDVAGSFTIVMESLNNYRGLFSGIMQSGVLVGFVGVDFLFTYL
FT                   ASVTGAQFISTYWRLIFAIGVIPAILAALIRFRMTEPSVWLKIKHSANPLKGLRELPQP
FT                   FLVMVGFWLAIYAGPQLVPTLFGQVMKLPPSYYGPLVLYMNLIGIPSMLVAGVLSDYIG
FT                   RRMMGIIGSIFAAIGSLTFYYFIQIHNINLLYLILLFGFLVNLPSSITPAFLSERFKTF
FT                   TRALGVGTAYNGAYIIAGFAPIYVSILSNFMNPFNAATTVAVIGFIIAITGLIAGPETY
FT                   KTSLEE"
FT   gene            334498..335727
FT                   /locus_tag="Ssol_0370"
FT   CDS_pept        334498..335727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0370"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: sim:M1627_2798
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90657"
FT                   /db_xref="GOA:D0KNN7"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACX90657.1"
FT                   /translation="MKIAVIGSGPAGVSASLELAKNNKVVLVEKEERLGGTCVLYGCIP
FT                   SKAMLHPIHLASELEKLGKNITFDLGELRKLGQDASYRLSKGVEYMLEDNGVEVIHGIA
FT                   SLRSGQLIVNNETIQVDYVVLATGTYREVVKGIIYSEDLPYLNKDFKSVIIVGGDVGGV
FT                   EFGWMLRKLGKEVVLVDKQSSLLPYLDKEVSNAITNYFSKIGVRLYLNRSVKEMKEKEV
FT                   ILENGEKLTADVVYMTFGRKPSIQGFEEINHNPFVIVDEYLRTSLSNVFAAGDIIGTHT
FT                   AHEAMYAGKIAATNIMGGKKVFNKQGIPKVVYTHPTIAYVGSMEGKCVKINLVELGRAI
FT                   TEKEIDGFLKLCIKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVNEIKDYVAPHPSYI
FT                   EALTELLNRL"
FT   gene            335800..336483
FT                   /locus_tag="Ssol_0371"
FT   CDS_pept        335800..336483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0371"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /note="TIGRFAM: cob(II)yrinic acid a,c-diamide reductase;
FT                   PFAM: nitroreductase; KEGG: sin:YN1551_3111 cob(II)yrinic
FT                   acid a,c-diamide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90658"
FT                   /db_xref="GOA:D0KNN8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN8"
FT                   /inference="protein motif:TFAM:TIGR02476"
FT                   /protein_id="ACX90658.1"
FT                   /translation="MDVYEAIRKRRDIRSYYKPDPIPDEVLAKILSAAHMAPSVGYSQP
FT                   WNFIIIRDDEIRKKIKQVVEEERKRFESVLDEERKLIFSKIKVEAILDTPVNMAVTYDP
FT                   NRFGPNILGRSTMPETSLYSTVLAIGNLWLAATAEGIGVGFVSFFNKEKVKEILNIPKE
FT                   IELVSYLTLGYVREFPKIPELEEKGWNRRLMLSDLVFEDIFGKKTNNNFRLLLDRTFEE
FT                   IFNNF"
FT   gene            complement(336470..337018)
FT                   /locus_tag="Ssol_0372"
FT   CDS_pept        complement(336470..337018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90659"
FT                   /db_xref="GOA:D0KNN9"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNN9"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3110"
FT                   /protein_id="ACX90659.1"
FT                   /translation="MKNFTLSRAVFLLPFLLWWVPIIGPFFTGLLLSYRFKTNYRLSIV
FT                   SSVAYSVFLSVLTTYIFYIVRITILGYPFYYLVLVFNLIGSITCIATAYMSSRHGTFAR
FT                   MMRNTIELEFTVNSMNEIDEILSQYLDVSLCSKPNIRFISEDQIEITRSCNNLQINYEV
FT                   IKMGRALRVKAKFENLRNY"
FT   gene            337152..341641
FT                   /pseudo
FT                   /locus_tag="Ssol_0373"
FT                   /product="hypothetical protein"
FT   gene            337488..341038
FT                   /pseudo
FT                   /locus_tag="Ssol_0374"
FT                   /product="hypothetical protein"
FT   gene            complement(338425..339489)
FT                   /locus_tag="Ssol_0375"
FT   CDS_pept        complement(338425..339489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0375"
FT                   /product="Transposase, ISC1217"
FT                   /note="PFAM: Transposase, ISC1217; KEGG: sto:ST1952
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90660"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP0"
FT                   /inference="protein motif:PFAM:PF04693"
FT                   /protein_id="ACX90660.1"
FT                   /translation="MTKELTREEYYKALEKAVNEVILSMTGTRKDVAKRLLLGAVVGRN
FT                   ATEIAQEAEMDYETVLNNLDKAAQAKLIEVVKKLVGDHPVLLIVDDTHDHKLYARAMPV
FT                   SRNGAQIFYCRAHKRFEPAIQLLVIGVKDLVNNQIYVIHIIAYIPRKVEEELKRRGEEV
FT                   KFKTKIDALLEFLSSLSGLNVKARVFDSWYVNSRTLQGNTVGELKSSARVVEGGRSVPV
FT                   SEFPQGEYLVEYLGTPIKLLVIDDYKGYGRRYFFSTDLNDTAEDIITTWENRWDIEVLI
FT                   RELKALGLEGGSFLTWVRNSGFVALKALSLLVVQYFKYSTGLMLGAKRLARLIKSIYRE
FT                   AGGIKKLFKRRRKP"
FT   gene            339683..340642
FT                   /locus_tag="Ssol_0376"
FT   CDS_pept        339683..340642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0376"
FT                   /product="Transposase, ISC1234/ST1916, Sulfolobus"
FT                   /note="PFAM: Transposase, ISC1234/ST1916, Sulfolobus; KEGG:
FT                   sim:M1627_0628 transposase, ISC1234/ST1916"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90661"
FT                   /db_xref="GOA:D0KN59"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN59"
FT                   /inference="protein motif:PFAM:PF05457"
FT                   /protein_id="ACX90661.1"
FT                   /translation="MGVEGSTMARTLRHIPNLMYYPLPPIEDMPWREKWLTEIKPVLDA
FT                   MDLERVLGEGALVYLKLLIVMVLYSCSYRDAVKMVNVNVVVAWFVGRKVGKSTLHDFVG
FT                   RLYGVRKKLLEISFKLEEKCLPSYLPASAHLVDFMAWLVDSFLLDLPPGKRSVETFREK
FT                   AELERREGNLERARKLLSLGRTKRRFEGRWTKKRGVSHYGLKAIAVISVSLFVRSITVK
FT                   PANFSDKRFKSPLKGIKIADRGFSPSPTQLIAREKPFTTLRAHVEFFGTYLNAFWRPYG
FT                   TTTWRNDVFLHVLGVIYNIKMFLAIQRRTPPGRRAVQL"
FT   gene            complement(341643..341924)
FT                   /locus_tag="Ssol_0377"
FT   CDS_pept        complement(341643..341924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90662"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP2"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3109"
FT                   /protein_id="ACX90662.1"
FT                   /translation="MDIFEKARKLKGLGDEYEKLLNSLLNDLFKLIPDCLALNLDDSLL
FT                   PVYAVSGLKTKGLLAFPYKCRGRVGYVVIGEDGILYFEDTEGNVIELK"
FT   gene            342049..343107
FT                   /locus_tag="Ssol_0378"
FT   CDS_pept        342049..343107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0378"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125
FT                   transmembrane; KEGG: siy:YG5714_2920 protein of unknown
FT                   function DUF125 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90663"
FT                   /db_xref="GOA:D0KNP3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP3"
FT                   /inference="protein motif:PFAM:PF01988"
FT                   /protein_id="ACX90663.1"
FT                   /translation="MENIILKNYEEELFDHEVYSKLAEVERDPELKKTLFKLAEMEKKH
FT                   SEFWREIAEKRGLKVKGKLSTLNKIKVDFYSLLRKILGLDITIKVLESSEEDDIEKYRK
FT                   LSEMEMFSSEEKQRLKDIMVDEAVHEKVLGNVEAKSVGDFVYGISDGLVEVLAAVSGLS
FT                   GAISSPLFVAVGGLIVGVSGTLSMAIGAYLSTKSEKDVKIQERKRLELEKNVDQHSVQL
FT                   RLVNFFTELGVNLNLAKKVSLSLVNVAEDILYPEVKENPVKSALITGLSYITGAIIPIL
FT                   PYLIGLSGLTGLITSYIVAGLSTFIVGSIIGILSGISPFKKGIQMASLALLAALGTHGL
FT                   GYLASRFLNVSI"
FT   gene            343147..344139
FT                   /locus_tag="Ssol_0379"
FT   CDS_pept        343147..344139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90664"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP4"
FT                   /inference="similar to AA sequence:KEGG:M1627_2793"
FT                   /protein_id="ACX90664.1"
FT                   /translation="MPSLFGKKVKVIHHIDQLHSTMKLAIKTILDSYLPDVVRGYGFKY
FT                   ADPIWGEPIFIPYGYLDGEFKDTIDAFKKIMEEINERKEDGLAKFKEWYPDAKFFDIYR
FT                   FIQYSIPGTEEGYTPGIAVDPLMPYNYFKDGLNEVKDEVKGEVVVASPSLSSFTEFKFY
FT                   DPIIGRRNEIVDAYIWINKLFHEQYDKDKMYDEKLGRHYMNTILDFLEGYSKKGRVNEI
FT                   EGGDVLLIPMFIWGKDKLFNDNSNIVSAWQNSKLLTSSMFHEIEALPVILNKQYFDSIV
FT                   NRCSQTFTKIILLSNKKLPQIDKCNECPSSLRLLKLQKEGNFSKVFITK"
FT   gene            complement(344144..344968)
FT                   /locus_tag="Ssol_0380"
FT   CDS_pept        complement(344144..344968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0380"
FT                   /product="protein of unknown function DUF929"
FT                   /note="PFAM: protein of unknown function DUF929; KEGG:
FT                   sim:M1627_2792 protein of unknown function DUF929"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90665"
FT                   /db_xref="GOA:D0KNP5"
FT                   /db_xref="InterPro:IPR009272"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP5"
FT                   /inference="protein motif:PFAM:PF06053"
FT                   /protein_id="ACX90665.1"
FT                   /translation="MMAKRKKSQQNENKLIYIPFVVLAVVIVFLVAFPYFSHSSSLITA
FT                   NANTPLFNLYKISNTNYASNNSVEIYFVSWYGCPNGATTSWPLYLALSKYGNLSVVPHS
FT                   SVYESNFGGEIPGLLFLNYTPFPNSRVYFHPIYIYGQYLNETTNGTLINTDDVTFGLKE
FT                   LKSELPSWAYNLVVYYEVNQTYTQLNNVAPAYFGNYPHIITVLIITGPGGTWVDLGYPN
FT                   SISPSTLATLNSTLLYNIILNKATPSGQYLQAYNEILNASSQITNAINEALA"
FT   gene            complement(344984..345706)
FT                   /locus_tag="Ssol_0381"
FT   CDS_pept        complement(344984..345706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0381"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="TIGRFAM: sugar fermentation stimulation protein;
FT                   PFAM: sugar fermentation stimulation protein; KEGG:
FT                   sin:YN1551_3105 sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90666"
FT                   /db_xref="GOA:D0KNP6"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP6"
FT                   /inference="protein motif:TFAM:TIGR00230"
FT                   /protein_id="ACX90666.1"
FT                   /translation="MNESNSQDLTRVSPFYIKEGFSVYEFTEKLFEAYVIERINRFLVK
FT                   VTLDGEEILVHLHDPGRLKELIYPGNLVLIRETKGNKTKFSITAAYANSRFIVLDSRLH
FT                   NIIASKFIPKIYEKEVKVGNSRIDFKYDNTYLEVKGCTLVENEIAYFPDAPTERGRKHL
FT                   KELRELMRKGFNAILLILVMRNDAKCFLPNEKTDPKFSVEFWDSIKEGLKVYIKTFSLI
FT                   GNKIVYVGDIPLCKTNLT"
FT   gene            complement(346052..346651)
FT                   /locus_tag="Ssol_0382"
FT   CDS_pept        complement(346052..346651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90667"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3104"
FT                   /protein_id="ACX90667.1"
FT                   /translation="MRLKITSIEDLFIPPLQEYSYLCNGIITDMKCKGMEIFRDPDFIT
FT                   FTVNDILSSMSLQGLIKMKTRGRKRERWLRYISKYKMELEPKEFSTILRLGALLTIYVD
FT                   GYEIEGSQGDVVVKEFRVSGTGSNTEHVKKMLLELSPRLVVIQNKNNIWYIVTGYKVTF
FT                   VDSQLKKLEKLLVSSDRMECNEIQEEYNTRICVNPS"
FT   gene            complement(346693..347082)
FT                   /locus_tag="Ssol_0383"
FT   CDS_pept        complement(346693..347082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90668"
FT                   /db_xref="InterPro:IPR014572"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3103"
FT                   /protein_id="ACX90668.1"
FT                   /translation="MNLREKILAYLYQNRDSTLEKISEGLKEDKYEVEATLRYLERDGL
FT                   VIKRSKGIIFKKTIYDLTAAGLEEAKRIYETLKEKSIKLQELLQSGRLDPSKLPEEYVD
FT                   IIPLLITMSLINMMLLEDLMLSDMF"
FT   gene            347279..347593
FT                   /locus_tag="Ssol_0384"
FT   CDS_pept        347279..347593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0384"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sin:YN1551_3102 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90669"
FT                   /db_xref="GOA:D0KNP9"
FT                   /db_xref="InterPro:IPR009157"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNP9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACX90669.1"
FT                   /translation="MGIDPNYRTNFPVSGEHSGHKVYGTVEPPGKLGIHGTIVGVDFDL
FT                   CIADGSCINACPVNVFQWYDTPGHPASEKKADPVNEQACIFCMACVNVCPVAAIDVKPP
FT                   "
FT   gene            347627..349147
FT                   /locus_tag="Ssol_0385"
FT   CDS_pept        347627..349147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0385"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein; KEGG: siy:YG5714_2913
FT                   peptidase M61 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90670"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR039382"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ0"
FT                   /inference="protein motif:PFAM:PF05299"
FT                   /protein_id="ACX90670.1"
FT                   /translation="MRFYINPRNKYIEVYGEGREGIIIFPTWVPGSYVIRDTERYVVEI
FT                   DGIRIGKNRFFVKDKFRYLIQALSKDQREAISTSDYLFINPASVFPFQTIEEEYCVKIN
FT                   VRWPIHTTLKKVGDWFCADNYNEFADSPIQASPKLKLIEIDRNHKISTIDELDKPIVES
FT                   LGKCTFEIDQNIFSDSSTNEYIFFFRRSDTDFGGIEHERSSSIVISWNYKDLIRLFIHE
FT                   YFHRYNVKKIRPKDLKINYESETYTELLWVAEGLTEYIAVIVPLRTKVVKVDDTLNYIA
FT                   NTLAWLTFPGIRRMSLAESSYTTWIKYYRRDNNFLNVGISYYQLGLIVGLIMDLEMIDS
FT                   GNSIYNFFRELYKIREYTYGNVRDIAEGLGVQNIDELVFSRNPPIFNRLSKFFKLSFVD
FT                   KGFPYCGLMLDNKKVTFVEDDSPADKAGIIPGDEIVGINGISSSNLNLECKDKLELVIN
FT                   REGRLIEFTIIPDGNPGHNLVIKGNGEIFKKWSGGIEYGEGKSNIRII"
FT   gene            349214..350093
FT                   /pseudo
FT                   /locus_tag="Ssol_0386"
FT                   /product="hypothetical protein"
FT   gene            350238..350522
FT                   /locus_tag="Ssol_0387"
FT   CDS_pept        350238..350522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90671"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ1"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3099"
FT                   /protein_id="ACX90671.1"
FT                   /translation="MEPFYFKSYNRTVGIAHDINELEKEIERLGRDDPGCVEWHLREGH
FT                   IVVWLNYIGERGLAEMLRGVGNVKEALARIREFKALKSRQRKRTRYYSK"
FT   gene            351169..351408
FT                   /locus_tag="Ssol_0388"
FT   CDS_pept        351169..351408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0388"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: siy:YG5714_2911
FT                   transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90672"
FT                   /db_xref="GOA:D0KNQ2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ2"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ACX90672.1"
FT                   /translation="MMVTKVHKKGIVVIPKEIREKFNIKERDEVIIYSDEYGIHILPKK
FT                   SPEELFGIDRGKSLEELAKEHIKERETERAKVHP"
FT   gene            351389..351769
FT                   /locus_tag="Ssol_0389"
FT   CDS_pept        351389..351769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0389"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   sid:M164_2714 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90673"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ3"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACX90673.1"
FT                   /translation="MRKYILDANIIFQFFSGSPNVKKYLLNNDEKFVNAVNLSEFAYHY
FT                   ARKFGLRASSVKLNYLLTFINLVEIDKTLAEIASKIRLKYNLSLDDSFLIATAEVIEGI
FT                   VVASDHELAERTAKDYNVEFIL"
FT   gene            351947..352144
FT                   /pseudo
FT                   /locus_tag="Ssol_0390"
FT                   /product="hypothetical protein"
FT   gene            complement(352153..352920)
FT                   /locus_tag="Ssol_0391"
FT   CDS_pept        complement(352153..352920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0391"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="KEGG: sid:M164_2713 putative transcriptional
FT                   regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90674"
FT                   /db_xref="GOA:D0KNQ4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ4"
FT                   /inference="similar to AA sequence:KEGG:M164_2713"
FT                   /protein_id="ACX90674.1"
FT                   /translation="MDSIDKGILKILLKDARTPQRKIAIMLGISPPAVSYRMEKLFGDI
FT                   IKRFTVYVNPNFLGRYHGYVAFNNLYDWDGDYIAKIECLEEINVYEIDSKSRVELDEKI
FT                   RKMSEKLGEPRMIYIPNQMPYSPSKFDLKVVSILKEKPLIKPIELAEELGVSSKTIRRH
FT                   LRYLYSKKFIRLIPIIDLNKAEISIFAVFTSKVEDGKNFFAKYAFTEIEDDKAGIFVNV
FT                   VDSMDEARDLALKFKREYDKDAEIMITTKYEFL"
FT   gene            complement(352979..353578)
FT                   /locus_tag="Ssol_0392"
FT   CDS_pept        complement(352979..353578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90675"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ5"
FT                   /inference="similar to AA sequence:KEGG:M1627_2781"
FT                   /protein_id="ACX90675.1"
FT                   /translation="MSWFFGKIYLNSDQKSRMVENSLKKKLGYFINYKDIEYEVLSQYY
FT                   ILELRMPSNGKLGQLLHEYLQEYLINGIIRINEKYLPFYYNLNKALELLYEVVNERKLY
FT                   YCDKRIERIGNIKLVGQADICSDDLVIEIKSKPELKKVDLMQALIYTFLYERDVILFMY
FT                   GIYSGEYTIIKLPFNERNTNSLFEGLKKISEKEEIL"
FT   gene            complement(353641..354807)
FT                   /locus_tag="Ssol_0393"
FT   CDS_pept        complement(353641..354807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0393"
FT                   /product="UDP-sulfoquinovose synthase"
FT                   /EC_number="3.13.1.1"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sid:M164_2711 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90676"
FT                   /db_xref="GOA:D0KNQ6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ6"
FT                   /inference="protein motif:PRIAM:3.13.1.1"
FT                   /protein_id="ACX90676.1"
FT                   /translation="MKVIILGADGYLGWALALRLAKRGHEVIGVDNLYTRDAVREVGSD
FT                   SAFPLPDPEERISAARKLLDVDITFYRADVKDFDKLHEIIQRHKPEAIVHFAEQRSAPY
FT                   SMIDVNHANYTLINNLTSTINLIYSIIKVDPSIHILKMGTMGEYGTPNYDILESPFVEV
FT                   EINGKKDKIPFPKWASSWYHWSKVYDSYNLMWANKVWNLTITDIMQGPVYGTRTEEIID
FT                   EKLRTRFDFDEVWGTVVNRYCVEAVLGLPLTPYGKGGQTRGFISLEDSMQALTILLEHP
FT                   PSQGEYRVVNQIHEVYSVGQIANMVKEVGESMGLTVKIQNVNNPRVEKEEHYYNVETKI
FT                   LPSLGFSPKKNLKNEIRNIIEDLIPYKNRLESFKHVILPKTDWRRGRT"
FT   gene            complement(354901..355827)
FT                   /locus_tag="Ssol_0394"
FT   CDS_pept        complement(354901..355827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0394"
FT                   /product="Lactate/malate dehydrogenase"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   sid:M164_2710 lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90677"
FT                   /db_xref="GOA:D0KNQ7"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ7"
FT                   /inference="protein motif:PFAM:PF00056"
FT                   /protein_id="ACX90677.1"
FT                   /translation="MVKIAFIGVGKIGQTIAYSVIFDGLASEAILYDIVPELPEKFEHE
FT                   LRHAIATRGLSTEVIGTNSLDDVTNADIILIMAGKPRKPGMSRRDLFIDNAKIQIDLAK
FT                   QLPPKNPGALYIMVANPVDMMASVFMRFSKQFTISTGDAVETMRLRSYIAKKLKVPANK
FT                   VTGYVAGEHGEDAVVLWSTVKVNGKPFEEVAKGLTKEEVENYVKSIPGEIIRVMGGTTW
FT                   GPATIIKDIVRSVVFNEGRVMSIATPRTYQGEIIHISVPIVVGAEIGPSLEGVLPESDR
FT                   QRLNKSVEDFYRVYKENLDHLLQTVKQ"
FT   gene            355925..357232
FT                   /locus_tag="Ssol_0395"
FT   CDS_pept        355925..357232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0395"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG:
FT                   sin:YN1551_3091 2-methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90678"
FT                   /db_xref="GOA:D0KNQ8"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ8"
FT                   /inference="protein motif:PRIAM:4.2.1.79"
FT                   /protein_id="ACX90678.1"
FT                   /translation="MEIAEKIAEFVSSVNYQNLSEKVIHEAKRRIIDAIAVARGALNSP
FT                   PHLVNKNVVTYFLGSVPLLFGGNATPDFAAFYNTFLIRYLDFNDTYLSKEPLHPSDMIG
FT                   AFLSLGSLFNLEGKDVIEAVAIGYEVGVKLCDATSLRKKGFDHVTFLQVGAAAGLAKML
FT                   KLDEKSTVNAISLTLVPNIALRETRSGELSMWKAGAAADASRKAVFGALLAKFGMTSPS
FT                   KPFSGRLGFVNVVAKDFDSTVFNRLEDDGILKTSLKKYPVEYHAEAVVEAGKSFNVNVD
FT                   DIIKIEVETYEAAKTIIADEEKWNPTNKETADHSLPYILAYTLIKKDFWLDAYDKEMIF
FT                   NEKIRNLMKKITVIEDEKYTSIYPKELPVKVTIYTTKGKDTIEVRNPRGYYNNPMTDAE
FT                   VEEKYLRLKGRKEELNILWNMEELKVKEIVSSIKGS"
FT   gene            357207..358064
FT                   /locus_tag="Ssol_0396"
FT   CDS_pept        357207..358064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0396"
FT                   /product="methylisocitrate lyase"
FT                   /note="TIGRFAM: methylisocitrate lyase; PFAM: isocitrate
FT                   lyase and phosphorylmutase; KEGG: sin:YN1551_3090
FT                   methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90679"
FT                   /db_xref="GOA:D0KNQ9"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNQ9"
FT                   /inference="protein motif:TFAM:TIGR02317"
FT                   /protein_id="ACX90679.1"
FT                   /translation="MSQVLREADFLMVPGVFNPFTAILAKKVGFKAVYLSGAALTSSYG
FT                   LPDIGLITLDEVAEMIRRIKEVVDIPIIVDSDTGFGEAMNVYRTVRVLEKAGADAIQIE
FT                   DQRMPKKCGHLEGKEVVEPLEMVQKIKAALKARRDALIIARVDSRGVIGLDDAIERAKI
FT                   YLEAGADIIFPEALTSKEEFTKFAKEVKAPLLANMTEFGKTPYIKAQEFKEMGYKYVIF
FT                   PVTIFRVAAKAMKDALEVLLREGTQINLLDKMINRQQQYEIIDYFFYERLDKELGSIKL
FT                   VRKL"
FT   gene            358089..358517
FT                   /locus_tag="Ssol_0397"
FT   CDS_pept        358089..358517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0397"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: sin:YN1551_3089 putative
FT                   signal-transduction protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90680"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR0"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACX90680.1"
FT                   /translation="MAITSRSLIKRSPVVVKVGTKAIDACKIMYQNNIGSVVIVNEKDY
FT                   PVGIFTERDVLRAVACGKDLNDKVENLGTFGKLVTVKSNSSIGEIAEKMVKNNIRHIVV
FT                   VDDEGKLIGVVSIKDIVNEKHVLDFLVRSELNWEGGTD"
FT   gene            358517..359650
FT                   /locus_tag="Ssol_0398"
FT   CDS_pept        358517..359650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0398"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: sim:M1627_2775 2-methylcitrate
FT                   synthase/citrate synthase II; TIGRFAM: 2-methylcitrate
FT                   synthase/citrate synthase II; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90681"
FT                   /db_xref="GOA:D0KNR1"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR1"
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /protein_id="ACX90681.1"
FT                   /translation="MSVVSKGLENVIIKVTNLTFIDGEKGILRYRGYNIEDLVNYGSYE
FT                   ETIYLMLYGKLPTKKELNDLKAKLNEEYEVPQEVLDTIYLMPKEADAIGLLEVGTAALA
FT                   SIDKNFKWKENDKEKAISIIAKMATLVANVYRRKEGNKPRIPEPSDSFAKSFLLASFAR
FT                   EPTTDEINAMDKALILYTDHEVPASTTAALVAASTLSDMYSSLTAALAALKGPLHGGAA
FT                   EEAFKQFIEIGDPNRVQNWFNDKVVNQKNRLMGFGHRVYKTYDPRAKIFKKLALTLIER
FT                   NADARRYFEIAQKLEELGIKQFSSKGIYPNTDFYSGIVFYALGFPVYMFTALFALSRTL
FT                   GWLAHIIEYVEEQHRLIRPRALYVGPEYQEYVSIDKR"
FT   gene            359685..360056
FT                   /locus_tag="Ssol_0399"
FT   CDS_pept        359685..360056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90682"
FT                   /db_xref="GOA:D0KNR2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR2"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3087"
FT                   /protein_id="ACX90682.1"
FT                   /translation="MPLIVGLIGSVIAFIVAWIVVSIPTWIAGKIVTPRTATFGRAMLA
FT                   TLIGVIVYAIFTALFSLISPIIGVIIGFIAFLGVYKVVFNTGWLQALGIAILAIIVAFI
FT                   ILFILGLIGIALPHLGPFK"
FT   gene            complement(360035..360550)
FT                   /locus_tag="Ssol_0400"
FT   CDS_pept        complement(360035..360550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0400"
FT                   /product="Protein of unknown function DUF429"
FT                   /note="PFAM: Protein of unknown function DUF429; KEGG:
FT                   sin:YN1551_3086 protein of unknown function DUF429"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90683"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="InterPro:IPR018036"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR3"
FT                   /inference="protein motif:PFAM:PF04250"
FT                   /protein_id="ACX90683.1"
FT                   /translation="MYCGIDLAVRRKTAVAILIDNEIKIIELVTNEEIIESCKVAKITA
FT                   IDSPLSYHNGFRNVDKEMIKRKLRVLPPSFMKTLVQRAIQLKEKLYNVIETHPTSSMKI
FT                   VGLNWKDLHEIKDYVDAALCAMAAMAYDLGYAEEIRADDGIIYLVSKRFPFELKRKNYF
FT                   EFYLKGPK"
FT   gene            360578..361261
FT                   /locus_tag="Ssol_0401"
FT   CDS_pept        360578..361261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0401"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="KEGG: sid:M164_2703 triose-phosphate isomerase;
FT                   TIGRFAM: triosephosphate isomerase; PFAM: triosephosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90684"
FT                   /db_xref="GOA:D0KNR4"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022891"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR4"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ACX90684.1"
FT                   /translation="MKPPIIIINFKAYENSFGDKAVNLGKKIEKISKEYSVEIILSTPA
FT                   TMIYRMSQEVDLPIYAEHVDPVPLGAFTGAILPEMVKDAGAKGTLINHSERRLRADEID
FT                   DVLKRTKKLGLKSILCVDRYELVYPFSLLKPDAILIEPPELIGTGVSVSKAKPEVITRA
FT                   VDEIRKSEGIYLIAGAGITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSAL
FT                   RAISS"
FT   gene            complement(361230..361601)
FT                   /locus_tag="Ssol_0402"
FT   CDS_pept        complement(361230..361601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sai:Saci_1022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90685"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90685.1"
FT                   /translation="MSMEKNHQYINSMRYYLNKIRQFVKENYDKELELDVRYYSDFDGS
FT                   RLMKLIDKSLLINVIRLEGLCMEIKDCALFSAAIYLYVYFSLIRFENNEIKDICKNNFP
FT                   ELYIYLLKIATKRSPSMHL"
FT   gene            complement(361546..361926)
FT                   /locus_tag="Ssol_0403"
FT   CDS_pept        complement(361546..361926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90686"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR6"
FT                   /inference="similar to AA sequence:KEGG:M164_2702"
FT                   /protein_id="ACX90686.1"
FT                   /translation="MKGKVINIESDITSWLRIMIGCKDTSCVKDTLNALLNRYGIGKNI
FT                   TEIVLENIDGLATYKDNKVIINVLKYDEIANEASGQSEIVSAFLLLSSLYSLVGTKRME
FT                   EIIRNEYGKESPIYKLYEILFK"
FT   gene            362359..362883
FT                   /locus_tag="Ssol_0404"
FT   CDS_pept        362359..362883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0404"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   sin:YN1551_3083 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90687"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR022996"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR7"
FT                   /inference="protein motif:PFAM:PF01878"
FT                   /protein_id="ACX90687.1"
FT                   /translation="MALSKIMPLTKGFSKFYILKILLHSVTYWLVPIQEDMWDVIRDKG
FT                   IYGYKENLEEFIKEGDYIIIYVSKYYAKRYGGKIVGIVKVLSNWYEDQTPIYPEETVRN
FT                   KGIYIYRVKVEPVVIGECDMKKILDKIRFIEDKGQIAKYLRNAPANLKRPIPESDAKIV
FT                   EECLKESLLNI"
FT   gene            complement(362873..363229)
FT                   /locus_tag="Ssol_0405"
FT   CDS_pept        complement(362873..363229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sia:M1425_2715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90688"
FT                   /db_xref="GOA:D0KNR8"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR8"
FT                   /inference="similar to AA sequence:KEGG:M1425_2715"
FT                   /protein_id="ACX90688.1"
FT                   /translation="MTDVSGNNITFNDILQYEIIKRTYQNIITKLNSRNLKTLKEGLKE
FT                   LLNFVRDIKNNILDKRLRRAIQYQQKLAKRLLLIINIRYAIFFIYKILVNTLVSRLYES
FT                   IKTLLEEVSNHVRY"
FT   gene            complement(363307..364461)
FT                   /locus_tag="Ssol_0406"
FT   CDS_pept        complement(363307..364461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0406"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   siy:YG5714_2894 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90689"
FT                   /db_xref="GOA:D0KNR9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNR9"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACX90689.1"
FT                   /translation="MDKLLLHVGPTTIKEDVLVAGLENNVGFTSKEFVEALAYSLKGLR
FT                   YVMGASKNYQPLIIPGGGTSAMESVTSLLKPNDKILVVSNGVFGDRWEQIFKRYPVNVK
FT                   VLRPSPGDYVKPGEVEEEVRKSEYKLVALTHVETSTGVREPVKDVINKIRKYVELIVVD
FT                   GVSSVGAEEVKAEEWNVDVYLTASQKALGSAAGLGLLLLSPKALSILDSQNSIAGYYLD
FT                   LRNWLPVMRGAEEGKAAYFATPPVHVILQLAEAFRLIEKEGIENRIKRHTMVASAIRAG
FT                   LEALGLEIVARRPESYSNTVTGVILKVADPQKVLAGTVNEGVEFAPGVHPAFKYFRIGH
FT                   MGWVTPNDAIIAISVIERTLRKLGEPIRFGEGVKAVEEVLFSAR"
FT   gene            complement(364476..365150)
FT                   /locus_tag="Ssol_0407"
FT   CDS_pept        complement(364476..365150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0407"
FT                   /product="transcriptional activator, TenA family"
FT                   /EC_number="3.5.99.2"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG:
FT                   siy:YG5714_2893 transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90690"
FT                   /db_xref="GOA:D0KNS0"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS0"
FT                   /inference="protein motif:PRIAM:3.5.99.2"
FT                   /protein_id="ACX90690.1"
FT                   /translation="MMENSEKLWNFISDIYSSILRHPFILELVEGILSRDKFKYYIIQD
FT                   YLYLREFSKALALLAAKAEDEEQTLLFTTHIQDAIKVEKALHKFYIKEFNLDIEDYEMS
FT                   PTNLAYTSYLLAVAYSRPFNEVISAVLPCYWIYMKVGKELLKQGSKDKYYQKWIETYGG
FT                   EEYEKGVRAVLDIVNSLKVSEEEFNKMKIHFRTASIYEYMFWDSAYRLERFPFPTEKNK
FT                   GV"
FT   gene            365266..365976
FT                   /locus_tag="Ssol_0408"
FT   CDS_pept        365266..365976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0408"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: sid:M164_2697
FT                   protein-L-isoaspartate (D-aspartate)O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90691"
FT                   /db_xref="GOA:D0KNS1"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS1"
FT                   /inference="protein motif:PRIAM:2.1.1.77"
FT                   /protein_id="ACX90691.1"
FT                   /translation="MSAKDDILRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYVDK
FT                   PFYITPNVTTTALSLGMYMLDILNLGETQKVLEIGTGIGYYTALMAEVVGDNNVISLEI
FT                   DDTIFEYAKNILLPKYPRIKLIKTDGSLGYDKEAPYDRIIIWAAAPTVPCKLYDQLREN
FT                   GIMVVPIGSEKAQGLYRITKIGYEPKIERLGDVIFMKMRGLFGFYEDDDPNERRIKKIE
FT                   EKVNRLLSKFMSQS"
FT   gene            366009..366758
FT                   /locus_tag="Ssol_0409"
FT   CDS_pept        366009..366758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0409"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: siy:YG5714_2891 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90692"
FT                   /db_xref="GOA:D0KNS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX90692.1"
FT                   /translation="MVNLYYIMLLNVRNLTVRYGSFIAVNSLNFSVNSEVYCLLGPNGA
FT                   GKSSTLKAIMDMVPFEGNIEILGKSNKEKFVKNYVGYVPEQPALYEYMTPSEIISFVAS
FT                   LRGINDLNRINALVKAFSLEMFMNTPIASLSMGNRQKVSILLSLIHEPKLLILDEPFNA
FT                   LDVLSVKVLKELIQSHVKNGGGVLFSTHIMEVAEKICNRIGIMNKGIMVMETSSDNIRE
FT                   AGRSLEDVFLSVTGLDETIKDILKGLE"
FT   gene            366755..368116
FT                   /locus_tag="Ssol_0410"
FT   CDS_pept        366755..368116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0410"
FT                   /product="Protein of unknown function DUF2074, permease"
FT                   /note="PFAM: Protein of unknown function DUF2074, permease;
FT                   KEGG: sid:M164_2695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90693"
FT                   /db_xref="GOA:D0KNS3"
FT                   /db_xref="InterPro:IPR018646"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS3"
FT                   /inference="protein motif:PFAM:PF09847"
FT                   /protein_id="ACX90693.1"
FT                   /translation="MSNVKIHDVVYKQIIYLMYTSRSFGLSPKPDAISKIRRNAVTIKI
FT                   SNIIAYTIATIVSASISLINKDAPFSFIFLDLIILANIFTTGLNVIFFVTNYDLKTFLL
FT                   SLPLSERDVNRAVFRGIFEFFYYGFLASIVIAPISTYMITSSVLQALMAELEIIFFFSL
FT                   SFALVMLLGKRIRLGITSALFRIGTSLIWIVFIMLPYGLTFKYVTIPTYILPIFPFGFL
FT                   NIEGLLISLLYTGLSVFFAYKQSLKFLSFRLNSQYSTKYSIKLRSPLITYLYKDIRGLL
FT                   RVPQASFLLTIPVFALIFSFFAPVYAIFYTIFMITTSSIMLILLEASGMQLLLSLPAGL
FT                   RSSYISKLLIILIIYLIDVLIFSFFNRASLSLIMLPSTITSVELSLFISYNNVIKGKGM
FT                   RLADPLSFIIREIEINSIIGIASILTFFANIYYSLLFSVLSLIMINIVVYKKIK"
FT   gene            complement(368118..371078)
FT                   /locus_tag="Ssol_0411"
FT   CDS_pept        complement(368118..371078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90694"
FT                   /db_xref="GOA:D0KNS4"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS4"
FT                   /inference="similar to AA sequence:KEGG:M164_2694"
FT                   /protein_id="ACX90694.1"
FT                   /translation="MILIYSTTEESSVGKMLKRFCIKTKNMEWKVIIITILLIISLIPL
FT                   TPVSHSNTKPLPLSTLNSNDPGITFYDEQLFMALNAYPVSTNLVIYVKVIAQTSDSGYG
FT                   PAYLLNAITNNDWWYQVGVAYNWPYTNGSFDPGFHMIYMVWNSSGDPVIGPVLLNFNGI
FT                   VNSGDEMMLEIEISNGNIILSAYDNSTGAKAIAIVNANGASSIVTDLNFLHGFITGLMT
FT                   EWYHLKAYFGGELGVIYRLQYLTTSFTLGINEIYLTSPPQGIATDEIAYSVSNNYTFYN
FT                   LSYIGAFTASNGYYFITGNLYPIFLNYKVIGGSFNIPINVSYFSDGLKEIARLPSLIFV
FT                   NANSNISLPSIVLNGLSRIVSLNSTPILANRSGNITVYYQLQYFININIPVNASINGIY
FT                   TTLSSGWYNASIKVVISPFTYYPNDSRIMVFSYPTNEFTLITPTNLTITYILQYYVHVN
FT                   SLIPLFGSINGTNASISSGWYNKNTVIQIYNITFYQSNETRAVITKILPANKILVNMSY
FT                   TITANELIQYYIIVKSQIPIYALINGTNSTLTSNWYNIGTNINIENITYYGQNNEYRYV
FT                   ISNILPSRNITVENPITISIITVKQYPLIVYSKIPVYALVNGTNETLQKYSWFNAGSRI
FT                   QIENITYYINSTARFLMEKVLPYSNFTLLQPINITIITLPQYFLNVSSNYPVYVLFNGK
FT                   NTTLSNGWYNNDTEIELYTIWYINQTERQNLVNISLNGKPTSNNVIIVNGPVSLKLHYV
FT                   LQYYINLISNIPIKALINSTLVTFSPGWYNAVTPISFINMTYYISNNTRYIILSILPFN
FT                   FTVNRSLTVKVTTLKEYLVTVNEPILITIANRTLNTSEIWVPAGQTLLIPKYVNISNNE
FT                   RIFYNTSSYLINITQPTSINVKPIIEYLVTIDGNSEWLPRGSVITLTQSVPIYEQGKWE
FT                   GSYNVSNGVAITVNQPITETFVKNINGSFVGSVIILIAIIIIAILFLTIRRSRPKF"
FT   gene            371150..371344
FT                   /locus_tag="Ssol_0412"
FT   CDS_pept        371150..371344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90695"
FT                   /db_xref="GOA:D0KNS5"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3073"
FT                   /protein_id="ACX90695.1"
FT                   /translation="MISPIIFVKISFLVIALVMAIFGVTYVGLAYFNLFPRVRNDLYII
FT                   GSTLVAIATAFVILTIILL"
FT   gene            371669..372043
FT                   /locus_tag="Ssol_0413"
FT   CDS_pept        371669..372043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0413"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   siy:YG5714_2887 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90696"
FT                   /db_xref="GOA:D0KNS6"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="PDB:4YL9"
FT                   /db_xref="PDB:4YLB"
FT                   /db_xref="PDB:4YLC"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS6"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACX90696.1"
FT                   /translation="MMNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAG
FT                   FNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTAKY
FT                   ENGVLTIRIPVEGSVSIRIE"
FT   gene            complement(372055..373545)
FT                   /locus_tag="Ssol_0414"
FT   CDS_pept        complement(372055..373545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0414"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: sis:LS215_2874
FT                   ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90697"
FT                   /db_xref="GOA:D0KNS7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS7"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ACX90697.1"
FT                   /translation="MIRRLLEVFFKLAPRVLAYREFRNKILKEIPIDEKEMAEEAKKFV
FT                   DTLIELGPTFIKFGQILSVRPDIMPETYIKELARLQDEVPPAPFSQVSKIIDEELGNSV
FT                   KILKELSSASLGQVYLGEYNGKIVAIKVNRPGIKETVNEDIQVVKKLLPLLRFVFDESF
FT                   IEIIKVFLEEFSRRIFEEMDYTKEAFYLNKIKEELSDYPSLRIPSIIKATKRVLVMEYI
FT                   KGYKVTSEEAKKIVDNRILAYRVFRLFMYMLLNKDYFHADPHPGNIAVDEQGNLVLYDF
FT                   GMSGKIDEKTRNLLIRAYVAMIRMDADSLVRVLDELGAIQPFADRRVLAKGLRLFMQAM
FT                   QGIEVSELELEDFMKLADQVFFKFPLRMPSKLVLPFRMVNVLDGTCREIDKDFDFVKSS
FT                   ITFLEEEGYTTKVVIEQVRELVNGIWNRFRSFLLSYSQQQELINIQSSRKGSAITNYIP
FT                   QMILVITIIFYAITKDIIITLLMVILAFSISLSGRKNT"
FT   gene            373765..375030
FT                   /locus_tag="Ssol_0415"
FT   CDS_pept        373765..375030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90698"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3070"
FT                   /protein_id="ACX90698.1"
FT                   /translation="MKILIIAPLTEVSEEENEIRPIEVTNWSNSPVGISSKYSFLAEKK
FT                   FLEEERHEVKILTLVPTEIRKNLNVKFSNYNELVSNILEALKFGNDNIAVEVIPFEDSV
FT                   SLGTSLFFSYLKIYYAIKTFLPSLIILDVSHSSSSFSTLVLTALDIAITDSLLTQQVEN
FT                   YIYAKVSKRNDSIQLISHMFKNMYSIKLSEYFLREMKIMKSENQANLPQFVGRAEFRRL
FT                   GFCIENCYPLVVLHVLDGMDLEKLVSEEKIMEIVVNNLEIKDGKLIQNVELLEGATYYV
FT                   LATHLVKRYKVKKPFSVDNVRNILNLTSPTCRRISNQIIDEMMIELNYLLRHLGLREGE
FT                   YSLEQISNLLKQPLTEIIRKEESIGDILSRYKRECGSINLSGIGLDPGATIIKIDSDKI
FT                   YVYYADECEDSVLSKVKDQMGD"
FT   gene            complement(375027..375608)
FT                   /locus_tag="Ssol_0416"
FT   CDS_pept        complement(375027..375608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90699"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNS9"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2884"
FT                   /protein_id="ACX90699.1"
FT                   /translation="MTLQSRPWRIRSDIWEKLDEICIKLDNKKSYNCTDKIIQSASELI
FT                   MEDIDITNPSTRNAVLGIKYLIASNLFYNLISSIHDEKIYKEIANSLLSIITNEAQDTG
FT                   LLLLESFESNCKERSILENVLRGLAYILGDNIKLVADGKTKFEMINVSTNPNIIKFLRI
FT                   ITETLKENFQIIELDESCDNDRICVKLDFC"
FT   gene            complement(375655..376728)
FT                   /locus_tag="Ssol_0417"
FT   CDS_pept        complement(375655..376728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90700"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT0"
FT                   /inference="similar to AA sequence:KEGG:M164_2689"
FT                   /protein_id="ACX90700.1"
FT                   /translation="MPRSADIRLTPISESLRERAEVIMRMYGIEDEKDFYTNALMTMMN
FT                   MMEKDDSLLGIDLCFLIPYILIHENFSFIHSSYIEDKVDVYSGDEIIGYLFKKYFNFMN
FT                   PIHLKHLLEYLIPSPYTPLVVTNRNTLIYKISLNNINKKLRDYVQNFLENIVTVLGIGK
FT                   INSSKDNIEIIAPYQSLIDFGNRNHHLVRVESSVISKRNQIITKFTHNNLKNNDKYDKL
FT                   INDWSMYQLLTIYDTLFKNNLPLYNILDRLNDIYTLFLELRKTGHILYPYIRGIEYINY
FT                   RLIDKEIINKNLDIFTLLIDPRIKLIKINNQEFIISGLTDFDENLSSFIRHVLDEPEIE
FT                   KNNRFYFKIRMTKRIFS"
FT   gene            complement(377002..377103)
FT                   /locus_tag="Ssol_0418"
FT   CDS_pept        complement(377002..377103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90701"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90701.1"
FT                   /translation="MDNPGKVYYQKGDKMNPTLAGSAGFVGLPLMPM"
FT   gene            complement(377376..378617)
FT                   /locus_tag="Ssol_0419"
FT   CDS_pept        complement(377376..378617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0419"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sin:YN1551_3067 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90702"
FT                   /db_xref="GOA:D0KNT2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX90702.1"
FT                   /translation="MIEKYVEFIGEHELDAIFKIAEKIKDLSILHVNSTKAGGGVAEIL
FT                   NRMLPLMKELGLNVDWKVIKGDNEFFNVTKSFHNSLQNGTGNIPDEYFKIYDKWQEINL
FT                   SEIPLDYDIMFIHDPQPAGLIKFKKGNSNKWIWRCHIDISNPYPPVWNFLRKYISKYDS
FT                   MIISVPSFGRDDIEIPQFVIPPSIDPLSIKNRDMSETTILRILYKFGINLEKPLITQVS
FT                   RFDYAKDPLGVIQAYKLAKRHVDIQLLYVGSPATDDPEGEKVYSEVVKASEGDKDIHLL
FT                   MLPPYSDLEINVFQTASTVVMQKSIKEGFGLTVSEAMWKRKPVIGGNTGGIPLQVINGI
FT                   TGFLVNSPQGASHYIIYLIRNEEIRRRLGTNAREHIRRNFLITRELRDYLMTIVYVANR
FT                   GLASLNSHESISNH"
FT   gene            complement(378614..379270)
FT                   /locus_tag="Ssol_0420"
FT   CDS_pept        complement(378614..379270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90703"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT3"
FT                   /inference="similar to AA sequence:KEGG:M164_2687"
FT                   /protein_id="ACX90703.1"
FT                   /translation="MMDLDSKGKGIPFIFYAAYYPPLYSKLKAISLRELVEGIRKADKY
FT                   TLFYHVFHPIFSSHLIPEEYSNDFAHWIAESLGDKELAELVSDIPGAEPRTIEDIRNDL
FT                   IEILEPRINERRGIREFVFVSCTPIVYKTNYVANTLAEFLDLIQIIPDRALVWHFVSKR
FT                   ILGISKRNDFSEWLESNFGLSELAENLSKIDPQTYVYEEVLRRDIIRILERWLLR"
FT   gene            complement(379327..379827)
FT                   /locus_tag="Ssol_0421"
FT   CDS_pept        complement(379327..379827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90704"
FT                   /db_xref="GOA:D0KNT4"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT4"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3065"
FT                   /protein_id="ACX90704.1"
FT                   /translation="MNKAILGIVIVVLVLAGGVYYGFYYLTTGVVNVYIQDPPTSQGVK
FT                   IYLTISSIMIHKVNASNDSWITISNKTITILLTSNMTFLASSRIPSGQYNEVFLEISFA
FT                   QVQLGNVNISAKIPSGVFKIHIINGMDLKGGSSQSLLISFPHITYANGQIIISPSITAE
FT                   VIS"
FT   gene            380025..380918
FT                   /locus_tag="Ssol_0422"
FT   CDS_pept        380025..380918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0422"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein; KEGG: sin:YN1551_3064 2-alkenal reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90705"
FT                   /db_xref="GOA:D0KNT5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT5"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACX90705.1"
FT                   /translation="MYEDLVERVTPSVVTIITKQIALDQFFMPQVAEGIGSGYSIGKNI
FT                   LITSYHVISNAEEILVISEDGFREEAQVIAINPFHDLAMLRSTIELPSLKLAKECKTGE
FT                   VVLAVGNPLGLYSVSMGIISSEERAIMTPNGLPIYVVQTDAAVNPGNSGGPLINTRGEV
FT                   VGTVTAMIREAQNIGFAIPSKLVDSFVKNVMKFGRYIRPYVGIGVIKLNKALATYLGVR
FT                   KQNGLLVTNIDPNGSAYKYGIRRGDIILKVNNQEVKSPIDLLAVLEEMVGSQINVKMLR
FT                   DSKEIELSIPVPGLST"
FT   gene            380976..381446
FT                   /locus_tag="Ssol_0423"
FT   CDS_pept        380976..381446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0423"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: sin:YN1551_3063 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90706"
FT                   /db_xref="GOA:D0KNT6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT6"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACX90706.1"
FT                   /translation="MVEIGEKAPEIELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVC
FT                   TKEMCTFRDSMAKFNEVNAVVIGISVDPPFSNKAFKEQNKINFTIVSDFNREAVKAYGV
FT                   AGELPILKGYVLAKRSVFVIDKNGIVRYKWVSEDPTKEPNYDEIKDVVTKLS"
FT   gene            complement(381482..381889)
FT                   /locus_tag="Ssol_0424"
FT   CDS_pept        complement(381482..381889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90707"
FT                   /db_xref="GOA:D0KNT7"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT7"
FT                   /inference="similar to AA sequence:KEGG:M164_2683"
FT                   /protein_id="ACX90707.1"
FT                   /translation="MGEKSLVGCTKPTGRRLLVEGTIILTIFSLFLEITSVINYLIFVG
FT                   IWYAILLFIIAWFKSYTYCISESGIIIKSLLGKKVVKAENFKDTFISQGPIAKKLKCGS
FT                   IYIILKNGKITVLYDIKNPETFLEKIQSSRP"
FT   gene            complement(381831..382802)
FT                   /locus_tag="Ssol_0425"
FT   CDS_pept        complement(381831..382802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0425"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: sin:YN1551_3061 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90708"
FT                   /db_xref="GOA:D0KNT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT8"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACX90708.1"
FT                   /translation="MSDSILYKAININKYYLAKKRGILESLAREPPIYVRALDNVSVEI
FT                   RKGEVLGVVGESGSGKTTLGKVLATLEKPTGGNLIFMGMEVNDRNINHVRKHIHMVFQN
FT                   PMTSINPRMKVKDIVREAMKEKREERVKKLLEEVGLDYNYVKDKYPRELSGGQTQRVAI
FT                   ARALAKEPDFLILDEPTSALDASVQAQILNLLVDLQKERKLTYLFITHNIAVARYISDR
FT                   VIIMYAGKIVEEGNTKEVISEPMHPYTQSLLSSVPELGKKELKPPSGEVPSLINPPSGC
FT                   RFNPRCPFAMSVCKEKEPPLVEINGRKVACWLYETNWKKASR"
FT   gene            complement(382795..383760)
FT                   /locus_tag="Ssol_0426"
FT   CDS_pept        complement(382795..383760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0426"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: sim:M1627_2750 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90709"
FT                   /db_xref="GOA:D0KNT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNT9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACX90709.1"
FT                   /translation="MVVLQIRNLNVYYNTLISWVKVLSDVNLDVEKGEIVGVVGESGSG
FT                   KSTLGHAISRILPPNARIQGDIIVDGVNLAKLKDSELQKYRGTWVFMIFQNPLNSLNPV
FT                   KKVGSQLLEAVKIRYQREGKKAEEESLMRDVIEVLKDLRLPDPYSIIDRYPHQLSGGQV
FT                   QRIVISMALLLKPKLLIADEPTSALDVTIQAQVVNLFKQLNKEINTSILFITHDISLAY
FT                   VVSDRIVVMYAGRIMEDGKVEEVLKSPMHPYTQGLVASIPSGDKNQKLTAIPGNPPSFF
FT                   ALPTGCKFSNRCSKVFDICRKKEPSIIEKNGRKIRCWLYE"
FT   gene            complement(383770..384666)
FT                   /locus_tag="Ssol_0427"
FT   CDS_pept        complement(383770..384666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0427"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sid:M164_2680
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90710"
FT                   /db_xref="GOA:D0KNU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX90710.1"
FT                   /translation="MSESSGIRFMLKALIRDKAGLLGLIIVSLFLIWSLIQGILEILSS
FT                   YLRKQYLGYILLPHNPFQYNLQLAFHPPSSTFLLGTNAEGEDILSRILYALPRDAFVAI
FT                   VVVFSAIIIGGILGILAGYLGGIVDEILMRVTDAFLSLPALILVIAITVPLKATFFATI
FT                   LGLAVVWWPTYARFYRAQTLRIKNMDYISAAKLSNVSRISLFYRYIFLNAIDPVLAYAA
FT                   LDFGNVILTYSTLAFLGIGITPPIPELGEMAANGVTGLPQYWWWALFPGLTILIIVVGF
FT                   VLLGDRLQDVVAGRIVY"
FT   gene            complement(384659..385690)
FT                   /locus_tag="Ssol_0428"
FT   CDS_pept        complement(384659..385690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0428"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sin:YN1551_3058
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90711"
FT                   /db_xref="GOA:D0KNU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX90711.1"
FT                   /translation="MSINIVFFIIRRIINAFITLILLIILVFIMIHIIAPNPLALARLY
FT                   TGPHATYTELEQVAKQYGLDQPLYIQIINYIINVLHGNFGIDPTYKVPVITLIGKYLPR
FT                   TLELVIPATILSVVIGLFTGAIAASNRNKPLDYLVRGVYLVTWASPPFLIAVILQLVIA
FT                   YYLRLLPPTGTVNPVLTPPKSITPFPLLNAMLAGDWPYFSSLVHHMVLPVIAIALVSFG
FT                   IVTRIARASMLDYMESDFAKLSLMKGLSRRRVVYGVVLRNASIPLVTLIALLFGYSVAG
FT                   AVVIEDIFQYHGMGYFITQAIESLDYTSILGTTIIVGIAIIIANLIADILYGVLDPRVR
FT                   IVE"
FT   gene            complement(385780..387960)
FT                   /locus_tag="Ssol_0429"
FT   CDS_pept        complement(385780..387960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0429"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: sim:M1627_2747 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90712"
FT                   /db_xref="GOA:D0KNU2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU2"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACX90712.1"
FT                   /translation="MSSLKGLALLSIMLIGIILPSLFLLQTSAQTSLTISPPNSSILID
FT                   VSQTAPPDALDPATGFYVQDGPLYQAIFQELVEFNGSNYLQVVPVIAQNWSTTNYENWT
FT                   FFIRHGVYFPDGVQVNASTVWFSFYRTILMGQGPGVANYIELLFNSTQYGQTGYALPWG
FT                   VAAAIQNVTGLPTTKNATLAANVLASILSHFNAANTTIQKIMEYPYQAVVVKGPYEVEI
FT                   NTLEPYRYFLLDIASWWGAIVNPVFIDEHGGVQPNTPNSYINDNGMEGTGPYVIKSVGP
FT                   SLSEIVLVKNPHYWAANLSNIPLVAQPGHIPVIDIKYGLSHNNRVEDFATNQAQISYVS
FT                   LPFLQQMYSAYQYNKYVSFNQIFANLGYEAAVFYIAMNTQIFPTNITAFRQAIVHAINY
FT                   TAELDIFKFQNQTLAIEYLGPISPVFPLYNEVMQLDKLHPYTYNLSLALHYLNEAGYEG
FT                   HFYVVLPNGTTIGDTNGKQLGTLTIYALAPVNELEQEQLTIIQESLQKIGISTSIQYVL
FT                   PSVTDNWITPSGTPALIDLGWFPDWPDPIFQELMAQTDVLYGGISGDLAWVNISTLQQI
FT                   YENLPFLTNQTQQTLEVAKVYQILYQQAPYAWLPNPVVYYFVQPYVKGFVYNPFIGYYY
FT                   NLMYYQPYTITISTSTSTTSSTTTTTLQTTTTSIVFGGATNITTSVTSMTTTTSSSSST
FT                   LIYAVIGIVIVIIIIVVAVVLLRGRGRGGPGF"
FT   gene            complement(388105..389052)
FT                   /locus_tag="Ssol_0430"
FT   CDS_pept        complement(388105..389052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0430"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: sid:M164_2677
FT                   SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90713"
FT                   /db_xref="GOA:D0KNU3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU3"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ACX90713.1"
FT                   /translation="MEKNLRRRIQKIKGGSYIITLPPEWVRRNNLDAKSEVFVIEKNGE
FT                   LLIKPIRDYITRKIIDLDLIDLETTKYLITVYYMQGISEIEIKSKSVISAPIKDELKNL
FT                   QLYLPGLTIESESFNYITFKVQDDVNTNVVERMKTFSSKLLVLLKDLEKIIENPSKEMA
FT                   IDLKNRAEELNKLYNSVIREIALVSQKEEEFVVKGLPTRDLILYAIAMRDMGRMLSHIK
FT                   TASLAITECGNTSNDKELNSIIKIIVNMFEKSREVFFDENIDHVRSIRESMKEINKIVY
FT                   GSKIECRELARELARIASYCVALMDDGVHKSVKI"
FT   gene            complement(389095..390105)
FT                   /locus_tag="Ssol_0431"
FT   CDS_pept        complement(389095..390105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90714"
FT                   /db_xref="GOA:D0KNU4"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU4"
FT                   /inference="similar to AA sequence:KEGG:M164_2676"
FT                   /protein_id="ACX90714.1"
FT                   /translation="MDINYNDDPIYPEDNVYPPAWEFDNEKAMRLYRRAKKEQWDEEDL
FT                   DWKKYEEIISGLDRKQRLALAYWWALLSNFDNATPVFAYALVKASEKRLPVTIKALLTT
FT                   ITFDENRHNVLCGFAIDKAMKGFPFNFKPQDDLERKAKLNVEWVWWNGSRYWKGYIEAY
FT                   NKYTLDILFTSFMMGEAAATTVFSGMKDKTKIPTFKDAFRNLTVDETRHYAFTHLILTD
FT                   NLNKMNEEKKMFVTKQIRAGFVFLSLITYKPPKEFWKLPPWYKEVHEKMEELAIDAGLG
FT                   LPTIEERERIWREAVARVASNVKRFNVKVPSMPEIGINGDEDIELKEDDLVASIF"
FT   gene            complement(390215..390580)
FT                   /locus_tag="Ssol_0432"
FT   CDS_pept        complement(390215..390580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0432"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   siy:YG5714_2866 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90715"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU5"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACX90715.1"
FT                   /translation="MKESPFLKFLNIELEEIREGYARVSGVVAKDFLNLHNTAHGSFIF
FT                   AIADAAFEYISNFSRDSVALHMDIDFRRPVKEGEKVIAEAFEESSGKTTSLYRIIVKNE
FT                   DGKLVAYVTALVYHLDN"
FT   gene            complement(390584..391333)
FT                   /locus_tag="Ssol_0433"
FT   CDS_pept        complement(390584..391333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0433"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   sid:M164_2674 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90716"
FT                   /db_xref="GOA:D0KNU6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU6"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACX90716.1"
FT                   /translation="MIKVDNKDGYVVVTISRADKLNALNLEMRNELISKLKEINANPKI
FT                   RTVILTGEGRAFCVGADVNEFAPDFTIDLRETFYPIIREIRFSDKIYIAAINGVTAGAC
FT                   IGISLSTDFKFAKREVKFVTAFQRLGLASDTGVAYFLLKLTRDQRAYEIAVLGGEFTAE
FT                   DAERWGLLKISENPLYDAEEMANKILNGPFQSYIAGKRMANLVLYNDLERFLEYESAIQ
FT                   GYLGKTEDFKEGISSFKEKREPKFKGV"
FT   gene            complement(391317..392117)
FT                   /locus_tag="Ssol_0434"
FT   CDS_pept        complement(391317..392117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0434"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   sid:M164_2673 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90717"
FT                   /db_xref="GOA:D0KNU7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACX90717.1"
FT                   /translation="MQVNYIYMYSTIQIEVIDNIGIIKLNRPDKLNAINFQMVDELVDV
FT                   LNKLDNDDKIKVVIITGNGKAFSAGADVKEMLETPLEEIMKKGHMPLWEKLRTFKKPVI
FT                   AALNGITAGGGLELAMACDIIIASESAKLGQPEINLGIMPGAGGTQRLTRVLGKYKAME
FT                   LVLTGKLIDSKEAERYGLVNKVVPDNSLIDEAIRLAREIAEKPIISIILAKEAVARAWD
FT                   TLLQQGLDFERRNFYLALNTKEAKEGMRAFLEKRKPRWENDKSR"
FT   gene            392179..393342
FT                   /locus_tag="Ssol_0435"
FT   CDS_pept        392179..393342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0435"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /note="PFAM: Thiolase; KEGG: sin:YN1551_3050 propanoyl-CoA
FT                   C-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90718"
FT                   /db_xref="GOA:D0KNU8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU8"
FT                   /inference="protein motif:PRIAM:2.3.1.176"
FT                   /protein_id="ACX90718.1"
FT                   /translation="MTRRVAVIGVGNSKFGRRDDVSIQELAWESIKEALNDSGVSQSDI
FT                   GLVVIGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEAMCATGLAAALSAYTAVASGLVD
FT                   IAMAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVFGTTEE
FT                   QMALVSVKAHKYGSMNPKAHFQKPVTVEEVLKSRVISWPIKLLDSCPISDGSATAVFAS
FT                   EEKVKELKIDSPVWITGIGYANDYAYVARRGEWVGFKATQLAARQAYEMAKVTPNDIEV
FT                   ATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKGGKVGVNLFGGLKAKGHPLGAT
FT                   GLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMILRR"
FT   gene            393349..393735
FT                   /locus_tag="Ssol_0436"
FT   CDS_pept        393349..393735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0436"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   sin:YN1551_3049 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90719"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNU9"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ACX90719.1"
FT                   /translation="MQIDAIPLSIKYKIKYPDEFIEAVKRGEIVATKCKNCGSVYFPPQ
FT                   KDCYNCGKNEMEWIKVSNEGEIMTYSVVSQKPQGFENYEDYVIGIVKTKDGINIMAWIK
FT                   GQPKVGNKVRLTTDGMRIIGEVIR"
FT   gene            393732..395039
FT                   /locus_tag="Ssol_0437"
FT   CDS_pept        393732..395039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0437"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   siy:YG5714_2861 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90720"
FT                   /db_xref="GOA:D0KNV0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV0"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ACX90720.1"
FT                   /translation="MSVKLTYNEIDPKALTKEEIKEIQRFRLRGLIKRVYESSPYYHKV
FT                   FKERGLTPDDIRTLEDLVKLPFTTKEDLRRYAYPHGGDFLAVPFGNLVGWHMTSGTTGV
FT                   PTVNAYTWSDIEIWTSLVARSLVTAGVTKNDIVMNIYGYGLFTGGIGLHQGIQRIGAKV
FT                   IPWSTGRTEALARALKDFKATVITGTPSYELLIAETLRKLNIDAEKELQLRLAIPGAEA
FT                   MSKEMLERIEHELGLKAREGRALEIYGLTEALGPGVAQECPDDNHEWLHIWTDHYLVEI
FT                   IDPETGERISEDEEGEMVITTLSKEGMPLIRYRTRDITRLIESDDEIPFPKIGMLKGRV
FT                   DDVIFYKGVKVFPTAISNVLMSCEEVKEFQIVVDKTNREHRLIVRVETEKPSEKLAEKL
FT                   IEEIRTVAFVTPEVEFVSLGTLPRFEGKSKRVVIKE"
FT   gene            395096..395458
FT                   /locus_tag="Ssol_0438"
FT   CDS_pept        395096..395458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90721"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV1"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2860"
FT                   /protein_id="ACX90721.1"
FT                   /translation="MAKLLFVIMDDPNNLSESIRAAHALHYAVELKKEGHEVYVYFDGL
FT                   GTKIPISESPYKGLRPAYERALKEEIILGACGYCASPPHLNIRDKLINSIKLIGDEEHH
FT                   YAFIDLINGGFQIIIS"
FT   gene            complement(395445..395549)
FT                   /locus_tag="Ssol_0439"
FT   CDS_pept        complement(395445..395549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90722"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90722.1"
FT                   /translation="MLLLNLVIPKITNVLKLKYVYTVYNYTQNYIMKL"
FT   gene            395628..395861
FT                   /locus_tag="Ssol_0440"
FT   CDS_pept        395628..395861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0440"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: sin:YN1551_3046
FT                   SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90723"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV3"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACX90723.1"
FT                   /translation="MSSLKIYKELDLTSSSCAGPIGELSSVIDELRDGEAVKVILGDEA
FT                   TKKDITLWSKKKGLKIVQESQEGSKYVLLISK"
FT   gene            395874..397031
FT                   /locus_tag="Ssol_0441"
FT   CDS_pept        395874..397031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0441"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sin:YN1551_3045 FAD-dependent
FT                   pyridine nucleotide-disulphideoxido reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90724"
FT                   /db_xref="GOA:D0KNV4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV4"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACX90724.1"
FT                   /translation="MAKRVIIAGGNIAGTIVANRLVQKLEHEVNKGDVEIVALNKSDEH
FT                   IYLPGQLLVGFGLETPGELVRKESELLDPRIKFLHGQKGTISKIDVANHSVQTADGVSH
FT                   SYDYLVITTGVDYTWDEIPGYRSAAHTVYEYDDAIKMREALEKFDGGTIVVNTAKLPHR
FT                   CPVAPLEVTLILDDYLRKRGIRDKTKIIYTYPVQGVFGRPITNKFMLRLFEQRGIEVHS
FT                   PFTVTSVDPNNKVIESQEGEKLKFDMLIGIPPNMGAKVIEDSGIGDRRRWVPTDKFTLR
FT                   MKDHSNVYVMGDATDLPVSKAGSTADFESYTVAHNIANDIKGNLGVKHYGGDVLCYIAT
FT                   GTDQATYIRFSYTMNESPPPPSYVHWWGKIMYNKMYWTVTAKAVV"
FT   gene            397033..397413
FT                   /locus_tag="Ssol_0442"
FT   CDS_pept        397033..397413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90725"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV5"
FT                   /inference="similar to AA sequence:KEGG:M1627_2735"
FT                   /protein_id="ACX90725.1"
FT                   /translation="MKTGIIVGSNERSRLTYAAMTSVIISSMGDEVYVFLTMDAVKGFT
FT                   KNPEVKSEDISSKIMVEKKEEDYMSLFRKAKKSGKVKIYACSYASKLFGYAKDDYNDIV
FT                   DEIAGITTFSMDVEGGQIISVW"
FT   gene            397416..398540
FT                   /locus_tag="Ssol_0443"
FT   CDS_pept        397416..398540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0443"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="PFAM: protein of unknown function DUF1641; KEGG:
FT                   sim:M1627_2734 protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90726"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="InterPro:IPR017011"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV6"
FT                   /inference="protein motif:PFAM:PF07849"
FT                   /protein_id="ACX90726.1"
FT                   /translation="MQTINLEKLASKIDEKKIDELAELMDLTPALNEALKKVNELKESG
FT                   ALDAIVNSAYVVKTFRDMLNDEAIQSLGNIVSSLLEFGKAISKPKIFENTMAIMDNSDV
FT                   LADFVNKLKMLKEDGTLDVLINMAYTARTLRDMLNDEAIQNLASTVSSSLEVMKFITQK
FT                   AEPVKALLDKSSVINDLLVRLEDMKNDGTLDILMNSAYVVKTFRDMLNDEAIQSLGRYI
FT                   SNSLEIMREIDDETLKSIKSTMKKMRLIENVLTKVEELDKNGALDVAFDMAYVAKTLRD
FT                   MLNDEAITHLSSYVSQFLEVYPKALDFFEIAFSNVPYRMMRAIASEEVKKTLESPPKVS
FT                   LGGIVRLLSDPEIQRGLGVIFTVIRAIGKEFSTK"
FT   gene            398610..398963
FT                   /locus_tag="Ssol_0444"
FT   CDS_pept        398610..398963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90727"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV7"
FT                   /inference="similar to AA sequence:KEGG:M164_2664"
FT                   /protein_id="ACX90727.1"
FT                   /translation="MRIALTYDKSQELKPLDQAEIIGIIDEEKREVEQYENPGIGSKEA
FT                   TMSVILDLNADAIVVGPKFLCPGSYMMSYGRLRYIPTKYGNLKDVLEHLEEIKKNMKEE
FT                   LEEEMYAEEMEEF"
FT   gene            complement(398960..399196)
FT                   /locus_tag="Ssol_0445"
FT   CDS_pept        complement(398960..399196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90728"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3041"
FT                   /protein_id="ACX90728.1"
FT                   /translation="MEKLPPSAKLVLKVILEKKVIRFKELQDQTKLPTRTLRYALRILR
FT                   EKGLIKTLPCLDDARERIYSVYEIDECYKLFND"
FT   gene            complement(399253..399675)
FT                   /locus_tag="Ssol_0446"
FT   CDS_pept        complement(399253..399675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0446"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG:
FT                   sin:YN1551_3040 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90729"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNV9"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ACX90729.1"
FT                   /translation="MMLITERRSPFYPNIQNVPPSVIRKLVKNKAITLIDVRQPWEYED
FT                   HHIPGSILLPLDYFKELFPLVLSKNNLVKNGVAIICEHANRSTWLVYTEPSLFKEVKVY
FT                   NMLGGIELWMIMGYEIEKGMDDNGTLWYKLLTKNLG"
FT   gene            399818..401212
FT                   /locus_tag="Ssol_0447"
FT   CDS_pept        399818..401212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90730"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017003"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW0"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2852"
FT                   /protein_id="ACX90730.1"
FT                   /translation="MAIDKLIDKFRVNLDKYKKMGLNPLSLATGCAVKVDLIDTVYPAI
FT                   RKIRDELVKRNIEILPREDADIFVSREKIYIKRVINGGEFDADRAVSLIQVNQETSGNP
FT                   DKFAEFLLKVYTSIKTTRKLTIGKGHSIVTSNPKGEVAVLDLFRLEGGKERSYTVANND
FT                   TIQIVDPLDDPGSQMQVDVAISNSLNDLFTKGVFQDLRMIPVVDAPMDDLKEQLLKNAE
FT                   NYSREYSIELLSDVQPNSKTLMIGATVIGKSDHELPTYYNRVNENMEILVTRPVGELTP
FT                   INVFMWMLTVPELIEDMEARGITIQRVEEAKRKALMYMRKPNNEVAKIIYDHLPPFGGS
FT                   FDENSHIAMTTDVTGPGLFVIKEFAEKAQVDVELFDIPVIDPDIHEFATENFIIPNSTA
FT                   GTNGAIVIFAHKRVIDEIFDELKRKSQEPYIIGKVTGKGNGTVIVPPTITKYIHRNNVL
FT                   RQFKIR"
FT   gene            401418..402266
FT                   /locus_tag="Ssol_0448"
FT   CDS_pept        401418..402266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0448"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   sim:M1627_2729 molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90731"
FT                   /db_xref="GOA:D0KNW1"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW1"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACX90731.1"
FT                   /translation="MYPPDFTYVRVSSSEEATKFLESHDDARPLAGGQSLIPMLKLRVI
FT                   SPNYIVDLNPITSLSYVRSSFNSTKIGALTRYNEILKNDLVRVNVPLLHQAVRVVGDMQ
FT                   VRNLGTIGGSAANADPSADIPTVLTALNAEIILSSASGNRSVNALDFFKGAFATDLRKG
FT                   EIISEIVLPNLEGYRTIYKKVVRRAGDFALVSLALAIKLRQNEIEDIRLAYGGVGERPF
FT                   RALEVEKSVMGKRLNDELVEEIVSKVSSQVNPPSDTRGSSWYRREVMKVITRKALKEVS
FT                   G"
FT   gene            402267..402758
FT                   /locus_tag="Ssol_0449"
FT   CDS_pept        402267..402758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0449"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: sin:YN1551_3037 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90732"
FT                   /db_xref="GOA:D0KNW2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW2"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACX90732.1"
FT                   /translation="MLMVNQGEKIKIKVKVNGVLYERYVSPRILLVDFLREELGLTGTK
FT                   IGCDTTTCGACTVLLNGKSVKSCTLFAVQADGAEITTIEGLSVDSKLHPIQEAFKENFA
FT                   LQCGFCTPGMIMQAYFLLKENPNPSEEEVRDGLHGNICRCTGYQNIVKAVLDASRRLRA
FT                   "
FT   gene            402755..405004
FT                   /locus_tag="Ssol_0450"
FT   CDS_pept        402755..405004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0450"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: sid:M164_2658 aldehyde
FT                   oxidase and xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90733"
FT                   /db_xref="GOA:D0KNW3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW3"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACX90733.1"
FT                   /translation="MSYVGKPVKRIYDDKFVTGRSTYVDDIRIPALYAGFVRSTYPHAI
FT                   IKRIDVSDALKVNGIVAVFTAKEINPLLKGGIRPWPTYIDIRSFRYSERKAFPENKVKY
FT                   VGEPVAIVLGQDKYSVRDAIDKVVVEYEPLKPVIRMEEAEKDQVIIHEELKTNISYKIP
FT                   FKAGEVDKAFSESDKVVRVEAINERLIPNPMEPRGIVSRFEAGTLSIWYSTQVPHYMRS
FT                   EFARILGIPESKIKVSMPDVGGAFGAKVHLMPEELAVVASSIILGRPVRWTATRSEEML
FT                   ASEARHNVFTGEVAVKRDGTILGIKGKLLLDLGAYITVTAGIQPLIIPMMIPGPYKIRN
FT                   LDIESVAVYTNTPPITMYRGASRPEATYIIERIMSTVADELGLDDVSIREKNLVTELPY
FT                   TNPFGLRYDSGDYVGLLREGVKRLGYYELKKWAEEERKKGHRVGVGLAYYLEICSFGPW
FT                   EYAEVRVDERGDVLVVTGTTPHGQGTETAIAQIVADALQIDISRVRVIWGDTDTVAASM
FT                   GTYGSRSVTIGGSAAIKVAEKILDKMKRIAASTWNVDVQEVQYEKGEFKLKNDPSKKMS
FT                   WDDVASIAYRSHDPGLVEKIIYENDVTFPYGVHIATVEVDDTGVARVLEYRAYDDIGKV
FT                   VNPALAEAQIHGGGVQAVGQALYEQALLNENGQLIVTYADYYVPTAVEAPKFTSVFADQ
FT                   YHPSNYPTGSKGVGEAALIVGPAVIIRALEDAIGTRFTKTPTTPEEILRAIASKR"
FT   gene            405127..405447
FT                   /locus_tag="Ssol_0451"
FT   CDS_pept        405127..405447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90734"
FT                   /db_xref="InterPro:IPR018685"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW4"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3035"
FT                   /protein_id="ACX90734.1"
FT                   /translation="MIEMLDKVPGIIAVFRFREGKLAKIYGQDISMDLDKLSNILVENM
FT                   RIGETEAKELKFLEPFRGFAMILDDTGVVFVDDYLVITDAKKTNWDLLVKSILKGEVIR
FT                   SG"
FT   gene            405440..405916
FT                   /locus_tag="Ssol_0452"
FT   CDS_pept        405440..405916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0452"
FT                   /product="NUMOD4 domain protein"
FT                   /note="PFAM: NUMOD4 domain protein; KEGG: sid:M164_2656
FT                   NUMOD4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90735"
FT                   /db_xref="GOA:D0KNW5"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW5"
FT                   /inference="protein motif:PFAM:PF07463"
FT                   /protein_id="ACX90735.1"
FT                   /translation="MGSVKKLKGYEGHVKIDENGEIEESSNIENLSKLVELIKFNLKKG
FT                   NEEAKQLGFNKLNGFAMFGSNKSLTFMKGLAIVVDNDKADWQDLFTYYTYNKTFIITGG
FT                   VLVLLSILLFYYGLLTPMFNFMAPEPRIYIPTILLLIGVIFLILSKSTFSYRLE"
FT   gene            405999..406433
FT                   /locus_tag="Ssol_0453"
FT   CDS_pept        405999..406433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0453"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: sim:M1627_2724
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90736"
FT                   /db_xref="GOA:D0KNW6"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW6"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACX90736.1"
FT                   /translation="MKELKGTKTAENLRHAFCGEAMANRRYLYFAKRADEEGYPEIAGL
FT                   LRSIAEGETAHAFGHLDFIRQGGIGDPATDKPIGTLEQMLESAVAGETYEWTQMYPGYA
FT                   KVAREEGFNEIAEWFETLARAEKSHAEKFTGVLNQLKGGK"
FT   gene            406433..407620
FT                   /locus_tag="Ssol_0454"
FT   CDS_pept        406433..407620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0454"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: siy:YG5714_2845
FT                   protein of unknown function DUF224 cysteine-rich region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90737"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW7"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACX90737.1"
FT                   /translation="MYSLNPSNSTFFDSNKLLSEFIRQASVCHGCRLCFNYCDSFPLMF
FT                   TYTDKKGPKNLTLDDLFNVASKCFHCKMCYVNCPYVPPHEFNMDFPSLMEWAWLYYKKN
FT                   RGLTVRDFIFEMLDGVKFARPLAKVIMEKNKELLGIHKEAPTLPVAEKGLRERVKPKRI
FT                   DSPKARVALFPTCLIENFFPEIGEDLVEIYNELGIEVIIPNFVCCGAPMLDSGDVDRLK
FT                   KNAEYNIKIIEDLIKEGYDVVSPIPTCTLMIKEYKKVLDREVPKVYDAMEYLLKLKNEG
FT                   KIELKGKIEKSVYYHPPCHLKFLQLGLPGVRLLRSMGAKVDISNNGCSGIDGGWGLRNY
FT                   DTAKRVGSKMMEAFKQSKADLFSTECPLAGLQIEKSSGRRPLHPIQLLKEAMKNG"
FT   gene            407613..408179
FT                   /locus_tag="Ssol_0455"
FT   CDS_pept        407613..408179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90738"
FT                   /db_xref="InterPro:IPR021890"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW8"
FT                   /inference="similar to AA sequence:KEGG:M1627_2722"
FT                   /protein_id="ACX90738.1"
FT                   /translation="MVKITLQDILPWRTYEKVRMDRIRRIIEVKNKRRIELGDRLTLLF
FT                   ENRDTVLQQIQEMVYLDKKEKNEDILEEIKIYSTLLPCDGKIKASLYIHSYDFKDLDWV
FT                   YDNLKGIYNSVFLRVGNKLIQGIPEGGRDQGREFSTVQYLTFDLEGEKSTDMEVHVIHE
FT                   KYRYSTKIDKSLAEDLIREAYDICE"
FT   gene            408176..408748
FT                   /locus_tag="Ssol_0456"
FT   CDS_pept        408176..408748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sim:M1627_2721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90739"
FT                   /db_xref="InterPro:IPR032603"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90739.1"
FT                   /translation="MIFKTFYCKNIVIIKLNSVLRYNVCIDYTKCKMHINFKNSKAELN
FT                   IKVVIMLANSADIDNLEDFIMTVARSRDIFNLKSYSLKIISDYSKFFNIILPKDVSDIL
FT                   IVLPISRDDLGNTIKNELTKIRTSCSILVLYSSKLQKDRMAVGFRAIVNKTISGEANMN
FT                   KNKVISKRLEPLGLKTHLNLYSLGITF"
FT   gene            complement(408816..409619)
FT                   /locus_tag="Ssol_0457"
FT   CDS_pept        complement(408816..409619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0457"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sid:M164_2651
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90740"
FT                   /db_xref="GOA:D0KNX0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACX90740.1"
FT                   /translation="MGISGKLYSFLYLRGFKVWVSYRTQTVLTVLGWVLPVFTYYFTGT
FT                   ALGNRLVNEVGVSNYTAFFTIGLAFQGYVSSVISTISQRLRNEQLYGTIEYYVISRTGT
FT                   FGFLLYSALWGLTLNTINAIIILAVGFALNIHYNVNIVSAIVIIVLLILSTLGIGMIAG
FT                   AVTMVTKQGNPISFFFNTFTNLLGGTVFPVTVLPLYVRYISYGIPLTWALEGLREAFLN
FT                   GAPITDIAPFIIILTIFDIVLLPLGVFSYNHAFKKAREKGTLGEY"
FT   gene            complement(409610..410539)
FT                   /locus_tag="Ssol_0458"
FT   CDS_pept        complement(409610..410539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0458"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sid:M164_2650 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90741"
FT                   /db_xref="GOA:D0KNX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX90741.1"
FT                   /translation="MIKTIDISKTFKIKNKEIKAVDDVSFEIERNSTGALVGPNGAGKT
FT                   TIIKMLSTLIIPSSGDALVNGYSITKEEKKVRESIGLVTVSERLFYYRLTALENLIFFA
FT                   SLQNLSLSDARKRAKEVLEIVGLSEWGNIPYMKFSTGMQRKLALARALITDPPVLLLDE
FT                   PTLGLDPLSARMFRDLVRRIGRDKTILLTSHYMKDIEELAEKIILLKKGKAIAEGNKDN
FT                   LKNYLGKVIEVEVNEYPLTLGKYVVQTSTNYYILRIPEKELDELKDYRVIKEEEPSLED
FT                   VYIYLIGDVEDSARLEAVRRGGWGGRWG"
FT   gene            410714..411151
FT                   /locus_tag="Ssol_0459"
FT   CDS_pept        410714..411151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90742"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX2"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3026"
FT                   /protein_id="ACX90742.1"
FT                   /translation="MTNESIKYIAIKMLADKAYVVDAIYSYLVEGERPSVLAYKYGITK
FT                   HTIRGNIMRFVEKAGGEGRARKLIALVKQSNAKVSPIVYKSDGMYTCLLCNEKLDEGKL
FT                   EKHITTKHKAELQRAINYIMSKVEGKKKQEEANKKEVVVNA"
FT   gene            complement(411234..413480)
FT                   /locus_tag="Ssol_0460"
FT   CDS_pept        complement(411234..413480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0460"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: sid:M164_2648 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90743"
FT                   /db_xref="GOA:D0KNX3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX3"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACX90743.1"
FT                   /translation="MATEKKEELRITDNEEQLRIVGMHCATCVTTVSKSLKSVSGVKDA
FT                   EVNLATGSAKVILSGNVRLKELVKAVRKAGYDVATEKFTIKLNVNPEEMPKIERKFENV
FT                   KGVVDVKSNPGLGIVSVEYNPETTTPEEILKEAGVKGEIVNEQRSEKSILYKDFHDLLR
FT                   RLAVGIIFTPLTYLLPFFFGILVSIAVQFYSGLRFHKGAYRALKNKTTNMDVLVSLASN
FT                   ILWLSSIFLHNTFYADASLLITFILVGKTLEAYIKAKMSAEIRIEPYKATLKDGRVVNS
FT                   NELKVGDVVIVRAGERIPADGIIENGEGEVNEAILTGEQKPVLKKKGDNVLAGGILVNG
FT                   YLEVYVTRNWDRSYIVQVTESVRGAYNTRVSIQNLVDKVSSIFVPIVISISALTFLVWK
FT                   FVLDYNLYSSLLFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSIFEEMRN
FT                   INVAILDKTGTVTEGEYVIVSKKEFIEGALNLAAIAESRSIHPIAKAFHKMNVRAGEIE
FT                   QFEEFPGRGIYARVNGNDVIVGSKDFVRDNCNWNVEDEGDIFICINGNAGGIVNIRDKL
FT                   RDDAKKVISYLKGRGIRIIIATGDSSNYADEIGKELGVEVRKELTPDDKAELVKELREN
FT                   GNKVMFIGDGINDSIAMREADIGIAISSGTDLAKSAGKVVVNSLDDIIGLFEQTELAVR
FT                   KIKENLAWAFGYNTAIIPIAAGVFYPFITLPPEYAALAMGFSSVIVSLWSLVPI"
FT   gene            complement(413470..413640)
FT                   /locus_tag="Ssol_0461"
FT   CDS_pept        complement(413470..413640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0461"
FT                   /product="YHS domain protein"
FT                   /note="PFAM: YHS domain protein; SMART: TRASH domain
FT                   protein; KEGG: sid:M164_2647 YHS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90744"
FT                   /db_xref="GOA:B2CQV7"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B2CQV7"
FT                   /inference="protein motif:PFAM:PF04945"
FT                   /protein_id="ACX90744.1"
FT                   /translation="MIIDPVCGMEVDEKSQYKTMYKGKIYYFCSSHCLREFQRNPEEYL
FT                   RNGPKGMPHGH"
FT   gene            complement(413731..414222)
FT                   /locus_tag="Ssol_0462"
FT   CDS_pept        complement(413731..414222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0462"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: TRASH transcription regulator domain protein;
FT                   regulatory protein MarR; KEGG: sin:YN1551_3023 putative
FT                   transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90745"
FT                   /db_xref="GOA:B2CQV6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013603"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2CQV6"
FT                   /inference="protein motif:PFAM:PF08394"
FT                   /protein_id="ACX90745.1"
FT                   /translation="MEKLTDLEFRALEILREDSRISVTELSKRLNISRSTATRLLRNLK
FT                   RRGVKFTIKFQNEPFIAFAISESCQSDECYKLLDGRFINMIRANTLEDLENKLKNVKEK
FT                   DLVFIGKSSFVVKCDYCGKEIYDNPLTYKVGRKTYYACCNSCLSGLKEKFARNNGLHLH
FT                   "
FT   gene            complement(414234..414893)
FT                   /locus_tag="Ssol_0463"
FT   CDS_pept        complement(414234..414893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0463"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: siy:YG5714_2834 undecaprenyl-diphosphatase;
FT                   PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90746"
FT                   /db_xref="GOA:D0KNX6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX6"
FT                   /inference="protein motif:PRIAM:3.6.1.27"
FT                   /protein_id="ACX90746.1"
FT                   /translation="MKWKYIAIIYALYIIISIVVKIIGEVNFLGNVYFFYLINHSQLPA
FT                   LNPIMIFFSKYGREYIWIPVTAILFIMGGKFRRSSLLLVGGFIIAIILGEVSKYVMAQP
FT                   RPFLILHNINLLVPEPTDYSYPSGHALIVAVGAVIVLLTLPYYISIPLFIEALLTSYSR
FT                   VYVGVHWPLDVLVGWILGIAIALTATNLEKLITTIYNRVVNLILGNMRKTNLKRPK"
FT   gene            complement(415109..415303)
FT                   /locus_tag="Ssol_0464"
FT   CDS_pept        complement(415109..415303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90747"
FT                   /db_xref="GOA:D0KNX7"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX7"
FT                   /inference="similar to AA sequence:KEGG:M1627_2713"
FT                   /protein_id="ACX90747.1"
FT                   /translation="MKRYTMAGIIAGMMALFFIVLSLPLNFISARNIGVDPTSVIMATL
FT                   YMILASVIFVILFKGINKI"
FT   gene            complement(415304..415426)
FT                   /locus_tag="Ssol_0465"
FT   CDS_pept        complement(415304..415426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0465"
FT                   /product="quinol oxidase (SoxABC), cytochrome b subunit,
FT                   C-terminal part (SoxC)"
FT                   /note="KEGG: sim:M1627_2712 quinol oxidase (SoxABC),
FT                   cytochrome b subunit, C-terminal part (SoxC)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90748"
FT                   /db_xref="GOA:D0KNX8"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX8"
FT                   /inference="similar to AA sequence:KEGG:M1627_2712"
FT                   /protein_id="ACX90748.1"
FT                   /translation="MNKLGIAILALIFGATAFMAGFMAYNLLWDSVKIIAMLVR"
FT   gene            complement(415440..417113)
FT                   /locus_tag="Ssol_0466"
FT   CDS_pept        complement(415440..417113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0466"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: sin:YN1551_3019
FT                   cytochrome b/b6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90749"
FT                   /db_xref="GOA:D0KNX9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNX9"
FT                   /inference="protein motif:PFAM:PF00033"
FT                   /protein_id="ACX90749.1"
FT                   /translation="MGEEKKGIIDTIIDRVGVTEAPLFKTPDYMYNISYWLGAMVAAAF
FT                   IYTVITGLFLLMYYQPAYAYQSTQSIISSVPYGPVLLFSHLYGAYIMIILAYIHMFRNF
FT                   YKGAYKKPRELQWITGVILLLLTLGASFFGYSLVSDVLGVNAIDIGDQLLVGTGIPGAT
FT                   TIVGWLFGPGGSAALSSDPLVRSELFDRLLGWHILLVFLLGVLFLFHFMLAERYGMTPS
FT                   ARDKPKVPAYYTKEEQQRFNEWWPRNFVYMLSIVLLTWGIILFVPNLLANINGLPIVIN
FT                   PYPAPQAGSPESTSVQPYPPWFFLFLYKFVDFLLPNGMPITPILVLAVLIIGLLILIFL
FT                   PFLDPSDDLRVTKRKFWTWIVSTLAIYLIELSVWGYLEPGVPVPFSQEIEYLGLPLVII
FT                   GIIVYLWPVKQGNTPVSKSETKVIKMNITPMEILLASVSSLSLAGTFVNFLEFPTVVNG
FT                   IILIPVILLTIYMLRRVAAFILGRKPVAAIGNNIATSWSKKAAFYGIIIIFIVSLLLLG
FT                   LMWTLPSIGPQSTYAGMDLGVILMLWGIAVQLYHYEIYVK"
FT   gene            complement(417106..418641)
FT                   /locus_tag="Ssol_0467"
FT   CDS_pept        complement(417106..418641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0467"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   siy:YG5714_2830 cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90750"
FT                   /db_xref="GOA:D0KNY0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY0"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ACX90750.1"
FT                   /translation="MSQLLNQIKDTVIPKNTLNVVWLYTIGSIFWLGVLGIAAMNLRTY
FT                   LTYNSNSPNVGELYYSALTIHGWAGMFGFVPLAAAAVIAFAMYKSNLSIVHTKLMAIFF
FT                   WLSNIFLAIGLAGSPDMGWYMYPPLAIESGSNFHAFLFYTTPALMGMAYLSLTLAFILQ
FT                   TAMFIILIADAYATKPKNERLNIFGAYGVAFAIVIAITLPALAASTLWYTLYFFAGVPV
FT                   NPLLWALLFWFYGHPVVYYVPFPLFGALYYYIPKYAGRSLFSEKWARWNIYLLSIGSML
FT                   IWVHHLQTWPLPIDLRIWVNLSTLILASGSGLTVLNLGLTILLSQKYNWKDPVGMGGLI
FT                   ALVGFILAGVQALVLPENSINPLFHNTYYVVGHFHLMIWTLIVMGFTTVFLDMLKSTFG
FT                   GFNFSEQASKWMRIGMIWWTAPFLGVGYTMSVIGYLGMLRRMIAYPSVFQPYNLLESML
FT                   AEIGIPGLLVTIFVAIVDALAYASKQGIFSSPSPSTSPSNLPVMAKDGVKNNG"
FT   gene            complement(418638..419147)
FT                   /locus_tag="Ssol_0468"
FT   CDS_pept        complement(418638..419147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0468"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   sin:YN1551_3017 cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90751"
FT                   /db_xref="GOA:D0KNY1"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY1"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ACX90751.1"
FT                   /translation="MDIKEHAEEVWFIIMLILVATFFSWNVYYILTGKSFSLRYGLPEF
FT                   SGLPPQAQEIVKYFEAHPPPSGEYSEVINGTLVVNLTAVQYRWIPNVIIANVSEPVVLI
FT                   INSPQVDTGFYLRLPNGLINVNNVPGITSYVYFVTPNQPGNYTWYNAEYDGYSSSYMTG
FT                   TLEVVS"
FT   gene            complement(419503..419925)
FT                   /locus_tag="Ssol_0469"
FT   CDS_pept        complement(419503..419925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0469"
FT                   /product="Transposase and inactivated derivatives IS1
FT                   family-like protein"
FT                   /note="KEGG: sto:ST0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90752"
FT                   /db_xref="GOA:D0KNY2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY2"
FT                   /inference="protein motif:COG:COG1662"
FT                   /protein_id="ACX90752.1"
FT                   /translation="MSYTLKIFILKFYIANCFVSILNIYKLNCYYLRFHIISRFTRSKV
FT                   NYTDYYCVYQVLDNRVVGKKYTYLVESHNSWCRSHLARLARDTKAVTRSMRMTEYSLAL
FT                   LNVIYPHIFSRGRTPLNEAYLKGVQYIRENLIEFYY"
FT   gene            419947..420921
FT                   /locus_tag="Ssol_0470"
FT   CDS_pept        419947..420921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0470"
FT                   /product="Rieske (2Fe-2S) iron-sulphur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   sid:M164_2639 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90753"
FT                   /db_xref="GOA:D0KNY3"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY3"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACX90753.1"
FT                   /translation="MARGIPIIKRDDLIFAIKLLRRMRDPKTRFDEKEFMKSGRDYLYN
FT                   YAEKNVGPLDPSRRAFLKGILIGIGAAAVLSAIPVISYLNQPEISLKQFPWVIIVDSSG
FT                   NPIKASQIPVNDPEILLFEYPMQGDITFILNLGDENDNPIKVPPTTVVIPENGKTYTFP
FT                   GGVGPNNSIVAFSAICQHLGCTPPEIHFYPPKYMKVGLPTPNFLPQVALQAAQQANAPG
FT                   VIHCDCHGSTYDPYHGASVLTGPTVRPLPYVQLYWDSNTDYLYAIGMNLNAPTILGRTN
FT                   DLSGYAYLSSYDESTGCPKMLLQSGQTPSNCYTELESAGNTYQ"
FT   gene            420923..421363
FT                   /locus_tag="Ssol_0471"
FT   CDS_pept        420923..421363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90754"
FT                   /db_xref="GOA:D0KNY4"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY4"
FT                   /inference="similar to AA sequence:KEGG:M164_2638"
FT                   /protein_id="ACX90754.1"
FT                   /translation="MTSLGAIEMMYEKYIQMSKMMSRMNYMPAIAAGEITILLILYAGG
FT                   MLLAVYNLSLQGVPLIMHLYGAILVAILSVGLLASAVSYKDKGAIMLSFLNVLSVLLAA
FT                   FAGSFYFGGVIDVSYLLEMGMGFVFALITASGCLVYSIRRGE"
FT   gene            421365..421766
FT                   /locus_tag="Ssol_0472"
FT   CDS_pept        421365..421766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90755"
FT                   /db_xref="GOA:D0KNY5"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3014"
FT                   /protein_id="ACX90755.1"
FT                   /translation="MAVSQSRIRPSRLMLYISLTETILLAGLFYAGLATLFYDKFPLNA
FT                   YSEALILSSHITLAMLVGFFGSAMLAQSVREGIRSVYLFSLLNLLFIGIAAAGGLAFYG
FT                   LLIPDYAYLMALGFFGSLFCTSSVLFYAI"
FT   gene            complement(421875..422441)
FT                   /locus_tag="Ssol_0473"
FT   CDS_pept        complement(421875..422441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0473"
FT                   /product="Protein of unknown function DUF1404"
FT                   /note="PFAM: Protein of unknown function DUF1404; KEGG:
FT                   sin:YN1551_3013 protein of unknown function DUF1404"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90756"
FT                   /db_xref="GOA:D0KNY6"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY6"
FT                   /inference="protein motif:PFAM:PF07185"
FT                   /protein_id="ACX90756.1"
FT                   /translation="MILSLVKDEKITFRPLVLPIVLLAIAVNPFTEGLEFYSPAIYMIS
FT                   HYLVYFSGIFVGYKYFKGDIISLILGLIPPILWHLPYFFAIGAAFITYRAILEITLLTG
FT                   GILVGSSIRYVKFYLKVTLFALWMLGDSALAIIFIVSSPLYSNIVYKFSPYSPSTLPIA
FT                   GVAMFIAMNVFLGYVIARYIKGIIG"
FT   gene            422737..423495
FT                   /locus_tag="Ssol_0474"
FT   CDS_pept        422737..423495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0474"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sid:M164_2635 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90757"
FT                   /db_xref="GOA:D0KNY7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX90757.1"
FT                   /translation="MIKLDLSGKVCLITGGTSGIGLKTAELFSKLGANVYVIGRREANF
FT                   LSKNIYFKKVDLTRREDVLSFIEWYEKNVGTIHVLINNASQNSRYSVLDIPIKEWDEMI
FT                   SLNLTAPFLLSRMAAKLMIKRGIKGKIINISAIQSKFPLERSFAYVTTKGGLISMGRSL
FT                   AVDLGKYGIQVITVLPGPIYSKDDEPPASLDKRAATLLGRMGRMIEISHLLAFLASDLN
FT                   SFITGTEIIIDGGRIISRKPDPEEITKGEI"
FT   gene            complement(423496..424677)
FT                   /locus_tag="Ssol_0475"
FT   CDS_pept        complement(423496..424677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0475"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: siy:YG5714_2823 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90758"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY8"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ACX90758.1"
FT                   /translation="MTKISEIEAYILGKEVTSAQWASLMVLVRVTTNDGRVGWGETVSA
FT                   LRAEAVANFVKKINTVLKGNDVFNVEKNRLEWYKHDFNMTISLESTTAYSAVDIASWDI
FT                   IGKELGAPLYKLLGGKTRDKVLVYANGWYQNCVKPEDFAEKAKEIVKMGYKALKFDPFG
FT                   PYFNDISKKGLDIAEERVKAVREAVGDNVDILIEHHGRFNANSAIMIAKRLEKYNPLFM
FT                   EEPIHPEDVEGLRKYRNNTSLRIALGERIINKQQALYFMKEGLVDFLQADLYRIGGVTE
FT                   TKKVVGIAETFDVQMAFHNAQGPILNAVTLQFDAFIPNFLIQESFYDWFPSWKRELIYN
FT                   GTPIDNGYAIIPERPGLGVEVNEKMLDSLKVKGEEYFNPEEPVWVVKGTWRDY"
FT   gene            424741..425214
FT                   /locus_tag="Ssol_0476"
FT   CDS_pept        424741..425214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90759"
FT                   /db_xref="GOA:D0KNY9"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNY9"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3010"
FT                   /protein_id="ACX90759.1"
FT                   /translation="MRRRTILAISITILAIGLIDVLFTYLYSSLVVYSLRDNFSLAEEG
FT                   AQSFPILVKQNDKIIIEGNSSKPIDIYIIGIVPQKVANNVSSFSISYVSPNTGELYIQF
FT                   RSLPYSNLTTISFTIKVFNSWFSGIGYLSSAIILFVGLILLGYAVQLKERRRK"
FT   gene            425211..425720
FT                   /locus_tag="Ssol_0477"
FT   CDS_pept        425211..425720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90760"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ0"
FT                   /inference="similar to AA sequence:KEGG:M1627_2701"
FT                   /protein_id="ACX90760.1"
FT                   /translation="MKLLPFYMIGNNIFIDAHFLSSISKPYIRILLVRSNLKLEQEGEK
FT                   LEPIPLDHVIKLLEDGYVDLKSLSEKKERLDSLDYLLSSLYNPGWYFRKREAEITSSSL
FT                   LRIYDLAYKLVLKKLRDLSRVDVVFVSISFSNDSILINGKEDRIYTTLFKSDSNFKKAI
FT                   LNSLSG"
FT   gene            complement(425695..425865)
FT                   /locus_tag="Ssol_0478"
FT   CDS_pept        complement(425695..425865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_3008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90761"
FT                   /db_xref="GOA:D0KNZ1"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ1"
FT                   /inference="similar to AA sequence:KEGG:YN1551_3008"
FT                   /protein_id="ACX90761.1"
FT                   /translation="MEAYRTLMSIGYTLLLLDIFSLLIYRSPTTLFSQIVVLILSVFMI
FT                   VYAIIQIKNLK"
FT   gene            complement(425865..428314)
FT                   /pseudo
FT                   /locus_tag="Ssol_0479"
FT                   /product="hypothetical protein"
FT   gene            complement(426476..427441)
FT                   /locus_tag="Ssol_0480"
FT   CDS_pept        complement(426476..427441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0480"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90762"
FT                   /db_xref="GOA:D0KNZ2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90762.1"
FT                   /translation="MQTIQVSKTELKSLAITLATNNINVISQDLDPEIVKAAPSLLTGN
FT                   RGKYYLKVVRRGEKVISKGQRTFKFYPIYREVKGEINVVAVDETGLTVGEKEQEKAEGF
FT                   LLYNWKRKGVKMRSLDLVYPLRLPLLVEVADLRSDSPSQFLLRSVREVSQYMEIDYVVA
FT                   DAGFLNLGVIKEMPVKTIVRGKSNLKGFKELSNVPLVEKRYEVKDKVYVAYRVLEFEGL
FT                   YYYDVVYVKGKPRHFMFVTNFEGDPYELAELYRLRWQVEEGFKVRKARIRYVRKLSNKI
FT                   FLFLYYTVLDSAWNLVNHLLFNFKSTCKKVLSFDSFVKLL"
FT   gene            complement(427534..427695)
FT                   /pseudo
FT                   /locus_tag="Ssol_0481"
FT                   /product="hypothetical protein"
FT   gene            428412..430493
FT                   /locus_tag="Ssol_0482"
FT   CDS_pept        428412..430493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0482"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: sid:M164_2630 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90763"
FT                   /db_xref="GOA:D0KNZ3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACX90763.1"
FT                   /translation="MRKELVLEVGVIFSISVMLFSISGIMIANSASSPFPSTLYLGWYN
FT                   SNVEAYSSFATYNPNIFAGGLGGSFYGLLYAYSAIINVSNSQAIPVIITSWNFSPASWQ
FT                   QIWQTKPVNVTLIIRNDSGWSNGQPLTAYDLMATCLILDMFGAPPFPNYTVINNYTLVE
FT                   TWPPDTLSPILFTDTLINTVGLGEVAIIIPYQVWKPIISQIMGNWTTIQNTSNMKLAQQ
FT                   IIKNIRSEILHFRPNPATYPYSGPFYLSQLSSNEIVLNKNPYYYDAKYIPFNQVIIYQY
FT                   GQADLAAAAITGGQVSMDWSGLTGLSPTQLESLPTTLEVINIPQPFGWGIAFNLKNPWL
FT                   REYQVRAAIAYILNRTAIASVGGPLTAPVTIPNAIPNLSYYSFMTSSQYYSSLNPYNVN
FT                   LTKAAQLLKSVGFYQKSGVWYTPNGTPFTLTIGAGSPPTQALAMMEEVQKELQQFGINV
FT                   QLHIYTVVSQWHQAWQNGTGYDLWFENWGSSYSPGTAPWSLVLSYFGGYPWNVTQWNEN
FT                   LTLPNGTIIDFHKLLEETESPNTTQQLIQANQELSYYMNQYLLPILPLVEIENYVIVNP
FT                   SLLIAAPPANSWIWEEAQYGIGGTAMVQALIDYWYAPLYESTIITTTTTSISTTITTTT
FT                   TSATTATTSVTTTTSVTTTSISTTTVTVTSTSTIPIIIAIVIVIIVIIAAVAILMRRR"
FT   gene            complement(430564..431436)
FT                   /locus_tag="Ssol_0483"
FT   CDS_pept        complement(430564..431436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0483"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sid:M164_2629
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90764"
FT                   /db_xref="GOA:D0KNZ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX90764.1"
FT                   /translation="MVQGKFFEYLRLLWDNKKSRVGLIITVFYILIAIFGQIIFPKTYS
FT                   LPPSPTTIFMPPQLSNFYLIFGTGPFAESILVQIIQGAKSVIEISFLAGLFATLIGIVV
FT                   GIIAGYLGGIIDNILMGITDIILTLPSLILIIIIVSAFKTSNPIFLSLILSITSWAGLA
FT                   RAVRSQVLVIRNSPAVEVLRVLGLSRKYIIFREVVPTLGSYIAIHYIFNVEAAVYAEVG
FT                   LYYLGVLPYNPNNWGAMIQQALSYGAAAGGKAIYYLAFPTIVVAGFMSGLILLSYGIDE
FT                   ISNPRIRRY"
FT   gene            431516..432475
FT                   /locus_tag="Ssol_0484"
FT   CDS_pept        431516..432475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0484"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: sid:M164_2628 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90765"
FT                   /db_xref="GOA:D0KNZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ5"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACX90765.1"
FT                   /translation="MILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSG
FT                   KTTLISAILRAIRPPGKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNP
FT                   VLPISEIFYHEAISHGEADKKRVIERASELLKLVGLDPARVLKMYPFQLSGGMKQRVMI
FT                   ALSLLLNPKLILMDEPTSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANR
FT                   LLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVSSIPSLKGEVKVINVPLDEPLVSKEKGC
FT                   PFLARCSKAFGRCKEELPEIRLVYDRKVRCHLYGSNGA"
FT   gene            432456..433430
FT                   /locus_tag="Ssol_0485"
FT   CDS_pept        432456..433430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0485"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="KEGG: sid:M164_2627 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90766"
FT                   /db_xref="GOA:D0KNZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACX90766.1"
FT                   /translation="MGLMELKGVSVIFEDKVGLFKKRKFYALKDVSLSMNQGDLLIVLG
FT                   ESGAGKTTLGRVIVGLQKPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPF
FT                   NKTVEEILVAPILRWEKINKDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLS
FT                   IARSLSVNPRIIVADEPVTMVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYH
FT                   LFDKGNTIVMFAGRIVERADLEEILKDPLHPYTNDLIKLTPSIDNLYKEINVKINYERV
FT                   EKGCPYRLRCPFAMDICKNEEPKLFKYSHEVACFLYGKVGESE"
FT   gene            433423..435968
FT                   /pseudo
FT                   /locus_tag="Ssol_0486"
FT                   /product="hypothetical protein"
FT   gene            complement(433831..434796)
FT                   /locus_tag="Ssol_0487"
FT   CDS_pept        complement(433831..434796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0487"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90767"
FT                   /db_xref="GOA:D0KNZ7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0KNZ7"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX90767.1"
FT                   /translation="MQTIQVSKTELKSLAINLATNNINVISQDLDPEIVKAAPSLLTGN
FT                   RGKYYLKVVRRGEKVISKGQRTFKFYPIYREVKGEINVVAVDETGLTVGEKEQEKAEGF
FT                   LLYNWKRKGVKMRSLDLVYPLRLPLLVEVADLRSDSPSQFLLRSVREVSQYMEIDYVVA
FT                   DAGFLNLGVIKEMPVKTIVRGKSNLKGFKELSNVPLVEKRYEVKDKVYVAYRVLEFEGL
FT                   YYYDVVYVKGKPRHFMFVTNFEGDPYELAELYRLRWQVEEGFKVRKARIRYVRKLSNKI
FT                   FLFLYYTVLDSAWNLVNHLLFNFKSTCKKVLSFDSFVKLL"
FT   gene            complement(434889..435050)
FT                   /pseudo
FT                   /locus_tag="Ssol_0488"
FT                   /product="hypothetical protein"
FT   gene            complement(436038..437984)
FT                   /locus_tag="Ssol_0489"
FT   CDS_pept        complement(436038..437984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0489"
FT                   /product="protein of unknown function DUF608"
FT                   /note="PFAM: protein of unknown function DUF608; KEGG:
FT                   siy:YG5714_2812 protein of unknown function DUF608"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90768"
FT                   /db_xref="GOA:D0KPC4"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPC4"
FT                   /inference="protein motif:PFAM:PF04685"
FT                   /protein_id="ACX90768.1"
FT                   /translation="MMKIEKNFGIPLGGIGTGKINFYPDLTIGEITILNNWSNPLRKVR
FT                   GFHLLTFLDKKPIFLQTNPGKNVETPPQYTYVKDIETFVEFPVIRYSTPLAEIEVYSIL
FT                   RKNDVKNSSLPVIKFRIKGKGRFAISFPNIVGSKRAGRANESYKGKLNGVVMKNEKALN
FT                   SDPAYGEIFLGCIGCKVITNYAYYKPAKVGMTEDITYFYNLEEYDETYVIKPYAREEIG
FT                   GIVYKDVDEEETFILSWYFNGRPYHYPYGHYYENFFKDSIDVAEYALKLEPDLGIEEKV
FT                   EWLKDALVNSLYILTSNTWLTKDGRFAVYEDPFVTKLMNTIGSMTFDGLGFTLLELYRD
FT                   LVISADNYFMNYVNYGETPHDVGEESIEDPIYGASYPYWWTDLGPTLVLMLYRDYVFTS
FT                   NREILEKNYNKIKEIIDWLIRKDMDNDCIPDSKGGYDNSYDGTHMYGASSYIASMFLSA
FT                   LTAFIKMSEILDVKIDDKYYRFLECGKKTFNSLWNGKYFILWKKNDEENTSCLNSQLLG
FT                   QFWCDILGLPPITDHDKINTALRSIYELNFKASKYCLTNAVREDGSVDSSTAQLRSCWP
FT                   RVSFAVAAHMILRGMVKEGIEVAKREWETIKELNPFDQSSRIDAIDGKYVGLMSYIGST
FT                   SVWLLKLALDKIR"
FT   gene            438018..440372
FT                   /locus_tag="Ssol_0490"
FT   CDS_pept        438018..440372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0490"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: sim:M1627_2693 peptidase M1 membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90769"
FT                   /db_xref="GOA:D0KPC5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPC5"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACX90769.1"
FT                   /translation="MPNIEKYEIFLDFNGNEYEGVEKIYLNSEEEKLELDSVNLEIRSV
FT                   KSDGKDTKFELKGEKLVIYGKIERELEIKFKGKASRDSILGIYVAPYDGKGMITTQFEA
FT                   VYARRFIPCFDHPAMKARFKLSVRVQKGLKVISNMPVERIEEDVDGKVIYRFQETPKMS
FT                   TYLLYLGIDEFEEISDNSKQPTVILATVPGKSKRGLFAINVARKVIEFYEKYFEIPYQL
FT                   PKVHLIQVPEFAAGAMENWGAITFRETALLADDSSSISQKFRVAEVVAHELAHQWFGNL
FT                   VTLKWWDDLWLNESFATFMSYKSIKHLFPQWDSEGHLIYDESIGALEDDSLSTTHPIEA
FT                   HVKDPHEIEQMFDNISYGKGASILKMIEAYVGEENFRRGVVNYLNSFKFGNAEGKDLWN
FT                   SISNAAGQSIGEIMADWITKPGYPVIFVNAYGNSIRFSQKRFTLLDSGLNEVYKVPITY
FT                   EINDKFGTLLLDKESAEIRLDEGLKSIKVNINRTGFYRVLYDSLNLAFSSKLNAYEELG
FT                   LVNDYWNFLLADLIDAKTYFGVIGRFVYTSNSFVSREITSQLLTLYYLFKKNYGKDFLV
FT                   NQVKIFRKANDDLGKLAYSTVISALARMDEEFALGLSTLFDQYENIDSNIKEAVAIAYA
FT                   VTNNDFNTLLEKYKRYTIDEEKNRILSAISSLRDPSIVVKVFSLIFERNIKAQDTRFVI
FT                   SSLLHNPHIREEVCSYLMNNFEEVKKFVNTVYGGPWGLGSIVRSMSFCGVDKPKDIIDF
FT                   LEKVKFKEIERPIKESEERIKVYSRLKQNLP"
FT   gene            complement(440377..440769)
FT                   /locus_tag="Ssol_0491"
FT   CDS_pept        complement(440377..440769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90770"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPC6"
FT                   /inference="similar to AA sequence:KEGG:M1627_2692"
FT                   /protein_id="ACX90770.1"
FT                   /translation="MNPFKKEKTYPKQVDLNKVVNEFVSYLNIQKWKVQQKVEGNKAIV
FT                   QAQKGGILRDIIAADRALTFTFENTTQGLKVTAGIGSWKKNLAITALETLFLSELFLVV
FT                   DVPEMLWNEHVESELMKKLDEIIQKS"
FT   gene            440852..441616
FT                   /locus_tag="Ssol_0492"
FT   CDS_pept        440852..441616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90771"
FT                   /db_xref="GOA:D0KPC7"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPC7"
FT                   /inference="similar to AA sequence:KEGG:M1627_2691"
FT                   /protein_id="ACX90771.1"
FT                   /translation="MQDELVILSSIASIMVAIIVLILFYIEKIRTYVGVFFVYFSLTMM
FT                   IAMFVGASIYLLYPSRVSLAIAFGINTFIMIPLIAYFLLKIAKLANTPFRGERTHVVIF
FT                   SILLVLNEILMGTTFGIAQFGFSRFSNLYYSLYFSINSYWFFYPMMAEMLALYLLHYLK
FT                   GSINRELFPLIGLATFPPTAFDYQEWFYSALIFSLAFSILGSILSKRLWRYVYLMLILS
FT                   ELILLINAIPYDIAIAISMILYYYQSLLPLRR"
FT   gene            complement(441605..443143)
FT                   /locus_tag="Ssol_0493"
FT   CDS_pept        complement(441605..443143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_2690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90772"
FT                   /db_xref="GOA:D0KPC8"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPC8"
FT                   /inference="similar to AA sequence:KEGG:M1627_2690"
FT                   /protein_id="ACX90772.1"
FT                   /translation="MQDSLGLLAITLVIVLLFSILIGIIILNHENFTQLYNIQSNINGE
FT                   ILSKAKVGYYWIVEELKNKTISFIPHVYILDTEGVYNIQSVVETTFNGEIYTFPVKDLL
FT                   IFTNGSLNRNGVILSPGNVIIIRPNITSGQLSFVTNTGNAFSLALLPPSDRTLLPNKSS
FT                   QNYTVISLGNENILSIRTTNNHLIGPQNITSVELIFNSTPPLYNYTLQPMVNSPSKVQA
FT                   NYYQVRIAYFENVTFIKALDLKDNNSYIIYPGYGYWSGKVYAIGNHYNKTVGSFNISYN
FT                   TSYIYYKYGSINFAQDYIITFHVTSLSGYVPLCMIVYTYNLTNSNSGFYTVGSYSQLWI
FT                   KPLDNNSPVYITYSGYSYSYYEYYNFTFNYLNSNNINPIRVGGSSIYLGYLPINITVYI
FT                   MGNSLNKDISSFQILYNNSQQLMNLPIIMNITYNITSYSPPFLLNFSLTNVSLTVMLNG
FT                   TQDLPNYTFYTYKLNISIPINESILNINGYAQPIVIPYFIIIVNGKIVGENLPP"
FT   gene            complement(443178..445154)
FT                   /locus_tag="Ssol_0494"
FT   CDS_pept        complement(443178..445154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0494"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   sid:M164_2834 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90773"
FT                   /db_xref="GOA:D0KPC9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPC9"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACX90773.1"
FT                   /translation="MTERRVKLASIISYDFLFLVLLSGLLNLIITIFRERLLYVLSSFF
FT                   QYIVSNPSVALGDALGFIFVLQALLLGLFIGGIVILSISFTINLTRIRSEYEEGVPLST
FT                   ILRSRIITSSRLGIIANWISERSKRYINASADLESPTEVGVRYVAYFLVSLLVVIPVSL
FT                   ALSIALLSPLPFLLIFFPLTFIFYPEQKYKSRAREIRDDIQDEIPFFVTLITIINASGT
FT                   TIYEGMRKILQFPIFKAMKKEALLIIRDIEFFGKSPLDALEHRSRLTLNRDYSWFLAGY
FT                   SSIIRSGGDIEAYLFQKAREFLNWLQFRWRFYSERTSFLGELIVILFLIFPMFLIALAF
FT                   FTSGAVISFLLIIPILFGTILYTITANNRPRYMDSIGLTKLQLLIGFIAALLTAGVIEI
FT                   FLDEIYYAIGLGLLSFSLASTIFMYNQIREINDVENSLPQFLRDITEFRKIGYDLSRAI
FT                   KTLAEEKRYRREFNRVLNEITKQDSMGIPITRAKINTRSWLGKFSLTTVQILIESGAVR
FT                   PDLLEYLTEFTLNFIQSKKEAFSRMRAYQVLGILTPLLLIATILIAIVIIDSFTIVTLP
FT                   TNTVGLPQFPNIISQFILSPVILAEMFIFILMSTFAIGLLVTKALYGTVQYMIMPAIGL
FT                   TLAVLSIHFFSVIEPIILKFFSI"
FT   gene            complement(445147..446694)
FT                   /locus_tag="Ssol_0495"
FT   CDS_pept        complement(445147..446694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0495"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   siy:YG5714_2806 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90774"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD0"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACX90774.1"
FT                   /translation="MVLIGKKKSHNKFEELSYYLQSLDESGIISLKASLDNRNIVEHYT
FT                   LNSFDVEIYIAEKDGIGFYLVNEPQLDQRENKILLAILDGLIYSASTAVSNKQIDLEKL
FT                   QEDVLKISAKLGVIGDVKRNLKKYMYYITREIKYSILQAPMSDPFVEEIELVSPTTPIS
FT                   VVHSRHSEWPRLETNIVLGSELKVRRLVERLASLGGRSVSTATPLQDFMLPEGHRVAVS
FT                   YGEEISRGTTFNIRKFPEKPLTIIDLIYKYGTLSDLMAVYLWIIAEAKLFTFLVGPTGS
FT                   GKTTALNALLMLLNPLAKYLTIEDTPELKLPHKYWIQFYTRPSNYEGSKDISYYELVRL
FT                   SLRYRPDYIIVGEVRGKEIEWLVQAVASGHGGLTTFHGSNHTDLITRISGLLGPELSLQ
FT                   FKQLISVIAIIKRIETEDRKMNRKMISIVENDGNGFREVFRYDYERKNFVPDNLKEITS
FT                   IQLERSRELLGWGRDKLYREIENRLLLIRGLAEKGVYDYDTLARELVKYYTNGDKSD"
FT   gene            complement(446737..447156)
FT                   /locus_tag="Ssol_0496"
FT   CDS_pept        complement(446737..447156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90775"
FT                   /db_xref="GOA:D0KPD1"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD1"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2805"
FT                   /protein_id="ACX90775.1"
FT                   /translation="MQKYRKGLENALVTVLLILVAIAAVSLISYYFFGVLRHSMITTGL
FT                   SISNVQMVGGILTGDLINQGASNITSITIQVRPQNNATVISNFTNSSLNIPPGHSYAFT
FT                   LAVPKAIEGNNYVITVLVKYDNGQTYATSVEVIDQ"
FT   gene            complement(447184..447573)
FT                   /locus_tag="Ssol_0497"
FT   CDS_pept        complement(447184..447573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90776"
FT                   /db_xref="GOA:D0KPD2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD2"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2804"
FT                   /protein_id="ACX90776.1"
FT                   /translation="MKGQASVIAMVVIFFLIIATIGLILYISVSYENLQKEYIQVSQIL
FT                   ANKAKENLLIGYVNSSLSIYNAGSVVTTIVAILLINKTNVTIVPENIVIPPNSNVIIHV
FT                   KTANGYVIVTSYGNSFYIAPSSGKK"
FT   gene            complement(447577..447987)
FT                   /locus_tag="Ssol_0498"
FT   CDS_pept        complement(447577..447987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90777"
FT                   /db_xref="GOA:D0KPD3"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD3"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2992"
FT                   /protein_id="ACX90777.1"
FT                   /translation="MRGISEAITVVFLILVTLIAIAIVTIYYLHIVNANQYGLYQELKN
FT                   YYIDSGQILSVVYYHQINNHSYFYVENIGNLPINITNIYVNHTIVKFIIYNNTNTQIKI
FT                   LYPKVVYVIEVYDNTTNIIIQTSNNNLIQLEA"
FT   gene            complement(448078..448848)
FT                   /locus_tag="Ssol_0499"
FT   CDS_pept        complement(448078..448848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0499"
FT                   /product="zinc finger RanBP2-type"
FT                   /note="SMART: zinc finger RanBP2-type; KEGG:
FT                   sin:YN1551_2991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90778"
FT                   /db_xref="GOA:D0KPD4"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD4"
FT                   /inference="protein motif:SMART:SM00547"
FT                   /protein_id="ACX90778.1"
FT                   /translation="MPKQCPKCGYINPDDANYCSKCGYPLQYQPIISTNPPSTPSPTSP
FT                   NPLQPDRLSTSFNILTKNLSIIFPPIIMLIIEVILLALFGAITAGISLISPVAFTVTAL
FT                   IFSIIIGIVDAIIFSITVHTTTYMARDAVMGAQLNLNNAFTNARNTLSRLYPIIAILIV
FT                   LGILLGLSRSLGLGWIIMGLVGVLLYIVSAATILNRPMSLSETINWYSRAFGVDAGGAV
FT                   VILIGSLLSLIPIVNIFAIPYTSILTYLMVRDIS"
FT   gene            448976..449221
FT                   /locus_tag="Ssol_0500"
FT   CDS_pept        448976..449221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0500"
FT                   /product="Protein of unknown function DUF504"
FT                   /note="PFAM: Protein of unknown function DUF504; KEGG:
FT                   sid:M164_2614 protein of unknown function DUF504"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90779"
FT                   /db_xref="InterPro:IPR007547"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD5"
FT                   /inference="protein motif:PFAM:PF04457"
FT                   /protein_id="ACX90779.1"
FT                   /translation="MKIKDAINRVRWKYKEKIDDYVIVIKDKLTETGLKEIPFTDIYTV
FT                   DNNYLYLKGEDTIIPLHRVLMIRRKSDDALIWKRGD"
FT   gene            449282..449533
FT                   /locus_tag="Ssol_0501"
FT   CDS_pept        449282..449533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_2789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90780"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD6"
FT                   /inference="similar to AA sequence:KEGG:LS215_2789"
FT                   /protein_id="ACX90780.1"
FT                   /translation="MSSRKIIPTKLPVIGNEDILPLLPRVSLSEYDEVMLRCKACNQIL
FT                   PISKALNHQLMHKEKGEDACFIVEMSKPKHIWYSNEII"
FT   gene            complement(449517..449864)
FT                   /locus_tag="Ssol_0502"
FT   CDS_pept        complement(449517..449864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0502"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: sin:YN1551_2988 transcriptional
FT                   regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90781"
FT                   /db_xref="GOA:D0KPD7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACX90781.1"
FT                   /translation="MEPLTNELESLFSALADGTRLRIVLFLLDKGQATVDEISKSLGKS
FT                   QSLISHHMACLRNCGIVKVRKDGKFSYYSISTPEIIELIKLSINHVKKYSQSILSCDVL
FT                   AEEKGQVKLSH"
FT   gene            449967..450149
FT                   /locus_tag="Ssol_0503"
FT   CDS_pept        449967..450149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0503"
FT                   /product="TRASH domain protein"
FT                   /note="KEGG: siy:YG5714_2798 TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90782"
FT                   /db_xref="GOA:D0KPD8"
FT                   /db_xref="InterPro:IPR010507"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD8"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2798"
FT                   /protein_id="ACX90782.1"
FT                   /translation="MVNLRLNLKQDELKCENCGVKLSEDEIYVREINGKEHYFCCSHCA
FT                   DKYEARFKEGVSSCC"
FT   gene            450175..451524
FT                   /locus_tag="Ssol_0504"
FT   CDS_pept        450175..451524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0504"
FT                   /product="mercuric reductase"
FT                   /note="TIGRFAM: mercuric reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   KEGG: sin:YN1551_2986 mercuric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90783"
FT                   /db_xref="GOA:D0KPD9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPD9"
FT                   /inference="protein motif:TFAM:TIGR02053"
FT                   /protein_id="ACX90783.1"
FT                   /translation="MIIGYGAAGFAALIRANELGIKPVVVGYGEIGGTCVNVGCVPSKR
FT                   MLRIGELYNYSSKVIGKKLFPEFFQAFQDKAEIVNSLRKEKYEDVINSYDIKLKIGKAY
FT                   FTSPNAVKVNGEIIEAKKFIIATGSSPNIPNIKGLTEVGFWTNVEALSPDKTISSLAII
FT                   GGRALALEFAQMYKRLGVDTTILQRSGRILPDWEPEISLSVKNYLEENDSIPIFTNVRV
FT                   KEVRKGNGGKIIVTDKGEVEADEILLATGRKPNVDLNLDAAGIELNDKGGIKVNEELRT
FT                   SNPNVFAAGDVIGGPMLEALAGRQGSIAAENAIMNVHRKIDMLSVPQVVFIEPNVAKVG
FT                   LTALEAVKEGYDIDQRVVKMDNIAKARILRENYGLIKMVIDKKFRNILGVQMFGKYAAE
FT                   VINEAALALRFRATIDDLIDTIHVFPTMGESLRIAALAFTGDVSKMSCCV"
FT   gene            451665..452033
FT                   /locus_tag="Ssol_0505"
FT   CDS_pept        451665..452033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90784"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE0"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2985"
FT                   /protein_id="ACX90784.1"
FT                   /translation="MQEVKRLYEDEEVEEIALRITDEEIEVVDRRGVIKGKISSKQLAK
FT                   KALEKKTLKFRITEAIDTKITKEDEKALPNLIELYFDPHLLIYGKKAEEVKGSGYICPI
FT                   CGIEIDEYGYCGCGTGSS"
FT   gene            452169..452570
FT                   /locus_tag="Ssol_0506"
FT   CDS_pept        452169..452570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0506"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: sid:M164_2608 putative
FT                   signal-transduction protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90785"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE1"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACX90785.1"
FT                   /translation="MKLKDVFNNTRPIRIARHTSLSEALERMDKQGVKFALIVDDSKGE
FT                   EIIGIVTRSIILSSLGKGISQNEPVSKVMIKNVITINGEEDLIDTFMFMMKNNITHLLA
FT                   INENGKIIGVVTLRDVLSAINKECERDID"
FT   gene            complement(452567..454342)
FT                   /locus_tag="Ssol_0507"
FT   CDS_pept        complement(452567..454342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0507"
FT                   /product="Acylaminoacyl-peptidase"
FT                   /EC_number="3.4.19.1"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: sin:YN1551_2983
FT                   acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90786"
FT                   /db_xref="GOA:D0KPE2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE2"
FT                   /inference="protein motif:PRIAM:3.4.19.1"
FT                   /protein_id="ACX90786.1"
FT                   /translation="MKPEDYYYSIKLVPEITIENGKLFHVETWIEEDKYKSSIYLNLKR
FT                   ITFQGNESSPKFNNDKLYFIRNEEAKSSLLEAQLYGEPKVIFTFSGKISKYEFHNKGIL
FT                   VIAEENTDKTLPFRAEKIKYRFDSRGLLRARQSLYLFDGKDLRRLVTGNFDVTDLATNG
FT                   NRVVISATKDGDDYGLGNLYEVNIETGELNRITKEDGTVQAIAMNSEGKIAFLGHRKGL
FT                   TPWASLEIMLPEEGKSYMCGKTCGNKVLTDLFDGVKDRIVFEKDLILSLGQEGGTSHIY
FT                   QISDNKVDKVTSGNIMVRGFDYSNSELAYFYSTPEKPVILKYRDIEYDPNPNIKGYTPE
FT                   RITVNSNGVEVEGWSIIKDPNAPTILFIHGGPHMAYGYGYFIEFQFFVDNGFNVIYANP
FT                   RGSQGYGEEFAKACVGDWGGKDFEDLMNFVNTVKERYSLKGKFGITGGSYGGFMTNWIV
FT                   TKTSMFSAAISERSISNLVSMCGTSDIGFWFNAIESGIADPWSTEGIEKLMKMSPIYYV
FT                   KNVKTPTMLIHGEEDYRCPIEQAEQFYVALKMQGVPTTLVRYQGDSHEHARRGKPKNMI
FT                   DRLKTKLEWFSKYLL"
FT   gene            454418..455248
FT                   /locus_tag="Ssol_0508"
FT   CDS_pept        454418..455248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0508"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sin:YN1551_2982
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90787"
FT                   /db_xref="GOA:D0KPE3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE3"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACX90787.1"
FT                   /translation="MHSITTYWWKYYLASFFSILVIGIVISSLNINIPYFFLIQIGLVF
FT                   SLWYLISPIIMILVFKMRRAPQDVTFMVEDLSKKYNVKLSKVYIINDNFLNAFAFGNII
FT                   FRGIAVTSPLYESLVQEELAAVLSHEIAHIKNYDPEVMLLTIFSINSIYAALIYYLPLV
FT                   SLFFLIIYFVILLPSVFYVHRKIEKRADLTAVKVNPDITYWLESSLIKIGYLSRSIPTN
FT                   MLRYVPPIQIFLAKEFIVNHIVDEKSVLSFRTHPSLKERLLYLSQYEKQKMYYI"
FT   gene            complement(455252..455578)
FT                   /locus_tag="Ssol_0509"
FT   CDS_pept        complement(455252..455578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0509"
FT                   /product="GYD family protein"
FT                   /note="PFAM: GYD family protein; KEGG: sin:YN1551_2981 GYD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90788"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE4"
FT                   /inference="protein motif:PFAM:PF08734"
FT                   /protein_id="ACX90788.1"
FT                   /translation="MIMAIFIVLSNLTDKGAETIADKPERIKEVNEELAKIGAKVKEQY
FT                   VVFGDIDFINIVEVDNVETFLKALIELNSRGTVRTKTYLAISVDEAIRAIKTTPPIGHP
FT                   HERK"
FT   gene            455710..456840
FT                   /locus_tag="Ssol_0510"
FT   CDS_pept        455710..456840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0510"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /note="KEGG: sin:YN1551_2980 propanoyl-CoA
FT                   C-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90789"
FT                   /db_xref="GOA:D0KPE5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE5"
FT                   /inference="protein motif:PRIAM:2.3.1.176"
FT                   /protein_id="ACX90789.1"
FT                   /translation="MVAIIDASITRFGKRKESLLELAGEVALPLIGKYEIDFVVVSNSY
FT                   SGEFNSLSGINNLITTYLSVDKVPSIRVDNTSGSGGSAILVAKSLLDSKITKTVLVLGV
FT                   EKMSEKNTKQVTSVIASLLSPEEKIVGLTLPSLAGLMTKEYMRRYNASREAFALVAVKN
FT                   HYNGSLNPFAHIQKVVSLEEVLNSPIIADPLTLYEFTPISDGASAIVMVRDEDAYSFTK
FT                   KPVFIKGMGASSDTSYLSEREDILTMNAVRIAGLTARKMAKVDKVDFAELHDMATVLEI
FT                   VEAEELGLLKKGEGWKAYYDDYTKINGEMPINTSGGLNSKGHPIGASGIAQAVEAFLQI
FT                   RNQAGSRQVRNARVGLSLSMAGFGNSATVIIYGDEP"
FT   gene            456837..457112
FT                   /locus_tag="Ssol_0511"
FT   CDS_pept        456837..457112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90790"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE6"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2979"
FT                   /protein_id="ACX90790.1"
FT                   /translation="MIYVCKNCGYSFWVKRARCPRCYSTEFNIKDNIREGELLTSWKLS
FT                   ATPEGFEDKYWLCLVKVDNVKVFCRSLSEPKNKMVLKENGLCEPLA"
FT   gene            complement(457104..457424)
FT                   /locus_tag="Ssol_0512"
FT   CDS_pept        complement(457104..457424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90791"
FT                   /db_xref="InterPro:IPR021585"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE7"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2978"
FT                   /protein_id="ACX90791.1"
FT                   /translation="MKIIVNGKEAGTKEKGCALCGGTWGDYYEEIDGEKLFFCCDICAL
FT                   EFVNMVNEVKKRTNWSKIDELIINGNYYTGRTCSAKSGNKEYKFYVKFNDEAGIETFKE
FT                   LG"
FT   gene            complement(457421..458332)
FT                   /locus_tag="Ssol_0513"
FT   CDS_pept        complement(457421..458332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0513"
FT                   /product="TENA/THI-4 domain protein"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG:
FT                   sin:YN1551_2977 TenA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90792"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR017004"
FT                   /db_xref="InterPro:IPR032553"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE8"
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /protein_id="ACX90792.1"
FT                   /translation="MPLCPSCEMKFNSWEDLAKHMDLIANTNSDKSHVMWLNRNISMKR
FT                   MEVNELANALERFFSTPNSLSMWIRTRFIERFYGDNPHPFIVAMQNPTKGVLLGYVIEH
FT                   QHFLKNWVKVLSSIVFKTDKDDVLQYELENISVEFIGYNGRPAHYELLLRMGEALGMPR
FT                   EKILSTQPLPSTQSAIKTWRKIAESKTWLETMASMHSLELVADRSLVKYGAKLPYFNPE
FT                   ILSSDEYPQAVKDFLREGYEADVSHAGEALEMVEKYTEEMEMKEQVQITVLKSFDAFSK
FT                   YLLARLERGFEIEPSLLKRVIK"
FT   gene            458439..459614
FT                   /locus_tag="Ssol_0514"
FT   CDS_pept        458439..459614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0514"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sid:M164_2600 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90793"
FT                   /db_xref="GOA:D0KPE9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPE9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90793.1"
FT                   /translation="MQDDYGYTFLLLSRILRSIGIIYITLSSSLYLSAIGVKPEIIGII
FT                   FLGAIGFSSTLNLALGIIGDRIGYKKVLIFVEILAAIASMLLALSINQTLIFAALIIGG
FT                   VGGAAGGIRGVFSPGLTALVASNWSEEKERVRRLSFLMSASSLAGIGGSVLLSIRSYIS
FT                   NSVEGYRLLYFLSFALLLASAISLLLVKEVKRPKKTSKVMKKSSMKYISKVIVSNSITG
FT                   FGLGIAIPLLPLWYKLAFHANSFEIGLIFTISYLTTAIGSLLSNKIMFDPLKVASITRI
FT                   LNGVFLIAMAFSPWLALAAGLYIARGLNAGIGAPNRSAVNVRGVSAEDFGTASSFQGLA
FT                   TRLSQMSSGISGYLLDISYSLPLEIGGLLQAVGGYLYMKLLAISTDRKVDS"
FT   gene            complement(459589..460632)
FT                   /locus_tag="Ssol_0515"
FT   CDS_pept        complement(459589..460632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_2774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90794"
FT                   /db_xref="GOA:D0KPF0"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF0"
FT                   /inference="similar to AA sequence:KEGG:LS215_2774"
FT                   /protein_id="ACX90794.1"
FT                   /translation="MGLNRKLLVFGFSFSSIGGPLALVGQFLENVNPFEVVLSVLIFSP
FT                   ITFLVYYSMNKVWDKGGLYDYVVKFTPKLSSYFLYFWFFSYFLYLSYTVDYIVYYILNL
FT                   DGFTAILLTIGIAGSIAMITLLDRELEFLFVSAIIQMLFILPINWHLKFMNPYELSFTN
FT                   ILSTSLLYICITLTPFIGNGSKEGINSVILAYLITGAILFLDSFFNIPKIIYLISSFST
FT                   FSLIVVEFYSLKSVLSKFSIKSRKYLVLGFLGFTLTSLINPYMYYIYTIVPSLTALYIS
FT                   LIIFFISMTFSIRNELKLLGFISLGLIAYGLYSSLQLSSYYLLLEQIIIIIIIGVIPLL
FT                   KNRLFYQ"
FT   gene            complement(460623..460832)
FT                   /locus_tag="Ssol_0516"
FT   CDS_pept        complement(460623..460832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90795"
FT                   /db_xref="GOA:D0KPF1"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF1"
FT                   /inference="similar to AA sequence:KEGG:M164_2598"
FT                   /protein_id="ACX90795.1"
FT                   /translation="MKISKIGLIIVGISILILIIGGAFFGMAATSHQPATSTSHMTTYT
FT                   STTSPSTSSSTTTTTSSSSGAVWG"
FT   gene            460950..461345
FT                   /locus_tag="Ssol_0517"
FT   CDS_pept        460950..461345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90796"
FT                   /db_xref="GOA:D0KPF2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF2"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2782"
FT                   /protein_id="ACX90796.1"
FT                   /translation="MPRVSISLLALGVVAGIASFAWTADHLPLYSIRFLPYSIRAFFLF
FT                   DSILAIIAGILFILSFRLFTLKIIYLLEVIYWWINYLLLTLTRVFPAPLIGRPLPVTTG
FT                   PALIAFVLDIILIILSTTIYIFLTSKR"
FT   gene            461435..463138
FT                   /locus_tag="Ssol_0518"
FT   CDS_pept        461435..463138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0518"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sid:M164_2596 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90797"
FT                   /db_xref="GOA:D0KPF3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90797.1"
FT                   /translation="MVQYKWIALSNTSLGAFMGFMNANVVLIALPAIFRGININPFNSF
FT                   QYLLWILFGYSIVSAILVVNVGRISDIFGRVRMYNLGFLIFTIASILLYLTPGKGDIAA
FT                   IQLIIYRILQGIGGSFLMANSAAILSEAFPPNERGFALGLNGVIGIFGGVAGIIIGGIL
FT                   ASIYWRDVFLVSVPIGILGTIWSYKSLRQLNKPNRNQSIDIVGNILYAVSLISILLGIT
FT                   YGILPYGNQVTGWTNPFVISGIVAGVGMFIGFLFVESRVKDPMFRIELFKIRAFTSSAV
FT                   SIILAQLAFGGLQLMLVLLLQAIWLPLHGYSYEVTPFWAGVYLLPLLAGFGIMGSIAGR
FT                   LADRYGARSLATIGLLIMGIGVLTLTTLPYNFNYIEFAVIIFFIGVGNGLFVSPNMTAL
FT                   MNASPPQHRGSASGIRAMLTNTGSTLSIGIFFTIVIDTLYISLPPVLTNALTAAGAPQL
FT                   APILSKIPPTAAIFASFLGYNPVSTILSQLPTSLVNAIPASTIATITGTYWFPNVIASP
FT                   FMEALRIAFYVSASMAFLATIASALRGKTVIYERDLMRPMAVNSSDDKKD"
FT   gene            463166..464023
FT                   /locus_tag="Ssol_0519"
FT   CDS_pept        463166..464023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0519"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: sin:YN1551_2970 SMP-30/gluconolaconase/LRE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90798"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF4"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACX90798.1"
FT                   /translation="MEPNLITLSNYKATLGEGPVYDKELNKLFWVDIEGKRIIVNDLNT
FT                   GTEVFYEMPDLISSLCVIDDKRVIATIRHGFYIVNLDRGEIQKIAEVETDMESNRFNDG
FT                   KCDKLGRYWAGTMNMNERKPTGSFYKLDTGKITKILEGLTVSNGLGWDPDNTQMFLIDS
FT                   PVRKVFVFDFDLNKGEIYNRRVAVDFGNEPGNPDGMAVDEEGYIWVAHWGGGKVSRWNP
FT                   KTGKKLFEIKVPATYVTSVTFGTQELDQLFITTAGKSQDPLAGKTFTTKANVRGLQNFR
FT                   FKIS"
FT   gene            464054..464764
FT                   /locus_tag="Ssol_0520"
FT   CDS_pept        464054..464764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0520"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   sid:M164_2594 purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90799"
FT                   /db_xref="GOA:D0KPF5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF5"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ACX90799.1"
FT                   /translation="MNPVHILAKKGEVAERVLVVGDPGRARLLSTLLQNPKLTNENRGF
FT                   LVYTGKYNGETVSIATHGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYII
FT                   VTGASYNQGGLFYQYLRDNACVASTPDFELTNKLVTSFSKRNLKYYVGNVFSSDAFYAE
FT                   DEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSDNLAKGGIWITKEELEKS
FT                   VMDGAKAVLDTLTS"
FT   gene            complement(465015..465416)
FT                   /locus_tag="Ssol_0521"
FT   CDS_pept        complement(465015..465416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0521"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: sid:M164_2593 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90800"
FT                   /db_xref="GOA:D0KPF6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF6"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACX90800.1"
FT                   /translation="MDLTIASIGLLIFRILYGIALIPHGTAKANKNLNSQFKGYMRQLG
FT                   VPPIFVDLSMLVEILGGLLVMIGAISLIVSAVLILFFLGTIVVSHRMKKPLATGMNPGM
FT                   DLDILFLAGAIILLLLGPGDLAILPGPQI"
FT   gene            465632..466657
FT                   /locus_tag="Ssol_0522"
FT   CDS_pept        465632..466657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0522"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein;
FT                   AIR synthase related protein; KEGG: sin:YN1551_2967 AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90801"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF7"
FT                   /inference="protein motif:PFAM:PF02769"
FT                   /protein_id="ACX90801.1"
FT                   /translation="MHLGKINEDVFNKVIYPHLGERRKEVVVGPQHGVDTGAIDLQDGR
FT                   VLVVKTDPVFIVPQFGFKKAAWFAVHILASDVMTSGIPPEYAVIDLNLPPRIKDEEFEE
FT                   MWIGIHEALKEIGVMVVGGHTGVYEGTDYPMVGGFTMFGIGEKERLGMPSKVKVGDSVI
FT                   MTKGPAIEATGLLTNLYPEYFKQRLSNEIFNEAYNMYWKMSCWKDGLIASRIGIHMMHD
FT                   ATEGGVFGALTEVARASSKGMRIYEERFFINRAVREVTKLVNIDPWISISEGTMIIVTD
FT                   KGEEVRNTLIREGIEAEIIGEIVDQSGEVTMVKKDGSRVKIEHPLEDPFWRAFFDLASK
FT                   T"
FT   gene            complement(466644..467552)
FT                   /locus_tag="Ssol_0523"
FT   CDS_pept        complement(466644..467552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0523"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: sis:LS215_2767
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90802"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF8"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACX90802.1"
FT                   /translation="MSEILELINRGKYNEALKRIKEEIEQKKDDPELYYLMGLVYFKIG
FT                   KYRRAIDNLRKAIRLKKDEAKYHCLLGYSLYMEGYNISDEKLIRRALKELQLSLEMDKD
FT                   LPNKEKKYYYYMANILYELEDYEKALEKVNKALEIDDSSEVHKLRGDILFQLKKYNEAI
FT                   EEYKTNLNDDKNLYAIAYTYFTMGKYDQALEYFNKAISANPEDPYYYQGKAETLLFMGR
FT                   TNEAYNTIKRALEIDPDNPYIKLTEVEILTETNEKEAIKVLTEYLEEMEEFREIVCEEI
FT                   REGKFKEKTKEVIEKVITKFC"
FT   gene            467672..468301
FT                   /locus_tag="Ssol_0524"
FT   CDS_pept        467672..468301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0524"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="KEGG: siy:YG5714_2775 protein of unknown function
FT                   UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90803"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPF9"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2775"
FT                   /protein_id="ACX90803.1"
FT                   /translation="MEINVDQINLMTKKGLRGDLKNFESVLDFLEKYGNATIVKYGMYS
FT                   LVFQIAMNKFIDISKECEECGGKCCQIGYPVPVYGFDYEELRNKLSMEDLKKLEKVDSN
FT                   LFLLRRPCKFQKGWYCSIHKFKPYACLSYPFATEDEQRDAINSYDGKGIPDFKVPEYCK
FT                   AGMRVKHIMNQIITDLTNKLGRPPTPRELYNELKSRYYKNEETTSK"
FT   gene            468379..469815
FT                   /locus_tag="Ssol_0525"
FT   CDS_pept        468379..469815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0525"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sid:M164_2589 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90804"
FT                   /db_xref="GOA:D0KPG0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG0"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACX90804.1"
FT                   /translation="MKALSTLAMAVIIIVVIAVVAAAAYLITSSSHHPSISTTTTPIIA
FT                   TNTTAPITLTVVTFSGQSANFIQYAGNLFHQLHPNVQVEVIQYPFSEYIQKELTALEAH
FT                   SSQYDIIGFTSTSALDVASYLLPINESVFNFSDIIYPQEDFGGLYYNVSTNKTEVIGIA
FT                   YETAVYLMAYNATIFNNQTLAQEFEQEYHMNFSPITYKNWSVVLDVDQFLTSHHITKYG
FT                   FLIDDHVAHGIIDAFPAVFGWYYFRNNSLNMGNPAGLPNYNIMFEGRILPGFNYPLPSF
FT                   NSSSGVQALITYRELVSYEPSPSQIQISYDNLPAFFSQGAGAFLFTSQLSYINNSKDVL
FT                   LAPLPGGYAETGTDFLGISKYSSHPQLALEFLQFLVSPKVQEIAFLKYGKFPISKQAFL
FT                   SLISNSSLPSYKREWLQETYYAALNATANPPNIPQTYPALIPSFNNEAFQFLTSPQYNE
FT                   TYAMNVLQQAANAWIKALSS"
FT   gene            469858..470802
FT                   /locus_tag="Ssol_0526"
FT   CDS_pept        469858..470802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0526"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: siy:YG5714_2773 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90805"
FT                   /db_xref="GOA:D0KPG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX90805.1"
FT                   /translation="MITLKEVTKFFGSFKVIDSISLNVEKGEFFVILGKSGSGKTTLLR
FT                   LIAGLEKVSSGKILISNEDVTDLPPSKRDIGMVFQSYALYPNKKVFENLMIALENSEIN
FT                   KKDKEERIIEISKQLEIYHLMDKYPAQLSGGQQQRVAIAKALVKRPKVLLMDEPLSNLD
FT                   VQLRYSARKLIKKVQKEFNITTIYVTHDSNEALAIADRIGVIDKGRLLQVGIPEDIYNN
FT                   PLSKEVASLVGNPPMSFVKIDGKIIGVRPDNIIIKDNGTYEGIVSNCEFWGSYYLIYID
FT                   FIDNEVKAISKERIKEGSKVKFDFISYKVFSND"
FT   gene            470795..472441
FT                   /locus_tag="Ssol_0527"
FT   CDS_pept        470795..472441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0527"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="KEGG: siy:YG5714_2772 binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90806"
FT                   /db_xref="GOA:D0KPG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG2"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2772"
FT                   /protein_id="ACX90806.1"
FT                   /translation="MIKYSVPYLVYIAVFGIIPLILTFVIVGINFSGAIKSSFSVAPPP
FT                   EIIYNTFFFSLFTAVVSTLLGYILAITVDIYPKKLLILLILLPFTIPFTASALIWVISF
FT                   YGGYGWFTYFLGINYDPLYFSKSALFAVSLVSAWSSVPLAFLLILASLKSIPKEIKESS
FT                   QIDGLTLSQYYFKVAFPYSLKGILLAFLITFVLSMGNFDLPYVMTQGGPGFSTTTLPLI
FT                   VYFMMFQYDNFSGGALFASILALIASIPAIGVALLVKSKGFRFSLPAIKIPDKIFKIIA
FT                   LLISLIIIIFLDFPVYWMVLVATRPNTLDFLKPPVLIPKEFTLSYLVSSLESSVPYIIS
FT                   SIIVSLIVGVLTILLSSLGAYEGARKFWFWLLLLSIYLYALPSTSYIIPVYLMTSDLHL
FT                   INTWIGLALPSAIFTASFAFWTMFNFYIDFPKVYEEAAEIDGMKNKILKLILPLSRPFL
FT                   IATFVISFTFAWHLLFYPLVLSETPYQMNFPPTGSETATIFALNAISQGSVNWALLASS
FT                   ALVASLPVVIVSYVAQDYMLRGLYSGGVKGA"
FT   gene            472526..473935
FT                   /locus_tag="Ssol_0528"
FT   CDS_pept        472526..473935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0528"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sim:M1627_2655 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90807"
FT                   /db_xref="GOA:D0KPG3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG3"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACX90807.1"
FT                   /translation="MNTNSILIVLTLGSLMAAVDTTIVLLALPTITSSLHTDLLSSIWV
FT                   LLAYMIVISVLSTQAGRIGDLFGKGKIYNLGFVIFTAASALCGISSNIDMLIVFRIIQA
FT                   IGGSMLVANSSSIVADVFPPNRRGKAYGITSLGWNIGALVGIVLGGVLTTFFGWQYIFY
FT                   INVPIGIVAVLLGVMNIKDINKVNTKLDMLGAILLGISLALISLSLMFIAASGISTDNI
FT                   IELALGVALIPFFLLNETRSKYPILNLKIFKIRLLTYSILANFLQGIGGLSLSFLLIMY
FT                   LQGVRGLSPLDSSLLLTPGYVIASILAPFMGRVADRGKPGIVAGIGLMFIFITMILYFF
FT                   LLTPTTDYYLIVGISAITGIGSAMFWPSNSTAIMFHAPKEYYGSVSGLSRTLGNIGTIL
FT                   SYVLSIVVATLSIPRSVAFEIFIGTTTLNGDVSVTFVNGLHFAFLISSIIIVVAMIFSF
FT                   MSGKTQESAIK"
FT   gene            complement(473928..474881)
FT                   /locus_tag="Ssol_0529"
FT   CDS_pept        complement(473928..474881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0529"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: sid:M164_2585 alcohol dehydrogenase GroES domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90808"
FT                   /db_xref="GOA:D0KPG4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX90808.1"
FT                   /translation="MWKVFFINGNFVKENVRDELPKPNEVKVFPKYIGICGTDKNIYLG
FT                   KKPVKEPLVLGHEISGITEKGEKVAIFPNYWCGYCNNCRRGFYNSCKNKISIGVNADGG
FT                   MAEYINVPKDFVFRIPYTLDLKLGALVEPTAVAVAALNKIDKEIEKVIIIGGGSTGTLV
FT                   SIVAEINGLETFVIEKDSRKEEILKEKGFRTTKELKFDDRVAVIDTINNQESMVLAQSI
FT                   LKNSIARSELIITGLDNEQISLNRDIIVRNEVIIRGSIIYSKDDFLNSIKIVSENQEKF
FT                   NKIVDKVGYIDNINEWFRKYVIELPNIKVLIKMDSI"
FT   gene            complement(474884..476143)
FT                   /locus_tag="Ssol_0530"
FT   CDS_pept        complement(474884..476143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0530"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sid:M164_2584 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90809"
FT                   /db_xref="GOA:D0KPG5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90809.1"
FT                   /translation="MKGNLRWKIVLIIFALIIVDYIDRGLINTALPVLKSEFHISSFEA
FT                   GIIGDGFTFGYLIMNPLVGYFLDKYGPKRVFSRFAILWGAVQAINVFAFSTFYFIVTRV
FT                   LLGIGEAVGFPGVTKIVANWLRKDEKARGGTISDSGVNLGIVFGSLFMLGLFAIIPNQE
FT                   LAWRLGFLVSGLLAIILAIILGRLLYDLPEQHPKISKEELDYILSGREKVGVKTKLPLS
FT                   YWLRSKNYWGYMQGLGAQAGIFFGLFTWLPLYLFYARHLSLSFTLEYTALIWSFGFIGE
FT                   LVGGYVVDKLIKRNPNLGFKVGFAVSSLAVTIGLAAATLISSPIEAVEILMVTFFFLRW
FT                   SGIQWAAPSFLVSTELAGQFGGHIGFWETLWGIIVPIVFGATVEVTKAYLLGMEILIGI
FT                   GLIYFIGTVIITNYRQIKVS"
FT   gene            476498..477703
FT                   /locus_tag="Ssol_0531"
FT   CDS_pept        476498..477703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0531"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: siy:YG5714_2766 amidase,
FT                   hydantoinase/carbamoylase family; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90810"
FT                   /db_xref="GOA:D0KPG6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG6"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ACX90810.1"
FT                   /translation="MNPERFLTTFHSLTNIGWTEDGVLRLALNEYDIKVREELIKILSS
FT                   IGVHIMVDDAGNIIGELGGKLSDAIAIGSHMDSVPYGGKYDGFYGVMAGLEVLRSIKER
FT                   GISNHSIKLIDFTNEEGSRFQPSLLGSGLTTGIFDKNYVYSRRDKDNISFEEALRVSGF
FT                   MGDESNRLMHMKPNYYLELHIEQGPILEEEGYQIGIPLGIAGLSVYEFTFKGQSSQTGP
FT                   TPMDRRRDALVGASKFVVSVRDHAKKQENLRATVGILNVKPNVYNAIPREVRLTVDVRS
FT                   IERNRIDHTINEFVNIAKSIADDEKLEVEYRHLWTANPVSFSDEVISVIERACKELSMR
FT                   YKFMYSWAGHDAQYMTKISKVGMIFIPSHLGISHAKEEYSSDEDMLNGLRVLEKAVELL
FT                   NS"
FT   gene            477785..479119
FT                   /locus_tag="Ssol_0532"
FT   CDS_pept        477785..479119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0532"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   sis:LS215_2757 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90811"
FT                   /db_xref="GOA:D0KPG7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG7"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACX90811.1"
FT                   /translation="MGEIEDKKIIRDHTFKTWSKQKGWDPIIVSSAKGVYFYDVEGKKY
FT                   LDFSSQFVNVNLGYGNERVINSIKEQLDRLQYINPSFGADIRVKATKALLKVMPRNISK
FT                   FFYSTSGTEANEAAIKISRFYKKPRYKILARYRSYHGSTEGSISLTGDYRRWFVEPNTM
FT                   NGVVRIPEPYCFRCPLKLKYPDCGIACATYVDYVIRQEKNVAAMIIEPITGTNGVIVPP
FT                   KEYMPLIRKIAKENDVLFIADEVMTGWGRVGEWFAVNLWDIHPDILTTAKGASASYVPI
FT                   GITGVSKEIGEFFEDEVFAHGHTFEAHPVSLSAIPAVIEEYERLNILSHVKVMGDYLGK
FT                   RLQELKERHRSIGDVRGVGLFWAIELVKDKNNTPFGGYDDKYEGYTTFVDVLARRLLIE
FT                   KNTYVYNGPSWFIISPPLIINKEEIDEGVDAIDDILKEADKEFNN"
FT   gene            479296..481721
FT                   /pseudo
FT                   /locus_tag="Ssol_0533"
FT                   /product="hypothetical protein"
FT   gene            complement(480141..481209)
FT                   /pseudo
FT                   /locus_tag="Ssol_0534"
FT                   /product="hypothetical protein"
FT   gene            complement(481773..482747)
FT                   /locus_tag="Ssol_0535"
FT   CDS_pept        complement(481773..482747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0535"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sin:YN1551_2955
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90812"
FT                   /db_xref="GOA:D0KPG8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG8"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX90812.1"
FT                   /translation="MGLFKRNNPDSNKIGGLKILFTSDLHGSETAFRKFLNAALMTKAD
FT                   TLIIGGDLAGKSLVPIIDIGNSKFKIEDKIVGKEGVDEIIKKYKSSGVYYTIVDQKGLT
FT                   ELNENRKSLDEEFKRVILERLQEWDRIAEEKLKGTNLKIYTNLGNDDPLYMFDVITKSE
FT                   RMVKCEGEIVNINGYEMITFGYVNPTPWNTPREMTEDQIYSNLKRIIEKVGNPAKTIFN
FT                   LHAPPYGTNLDNAPLLDKTLKPVVKNGEIVMTHVGSMSIRKLEEEFQPLLGIHGHIHES
FT                   RAFDKINKTIIINPGSEYNLGMLHAAYIILEDNKVKTHQFVIG"
FT   gene            complement(482827..485569)
FT                   /pseudo
FT                   /locus_tag="Ssol_0536"
FT                   /product="hypothetical protein"
FT   gene            complement(482984..484048)
FT                   /locus_tag="Ssol_0537"
FT   CDS_pept        complement(482984..484048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0537"
FT                   /product="Transposase, ISC1217"
FT                   /note="PFAM: Transposase, ISC1217; KEGG: sto:ST1952
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90813"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPG9"
FT                   /inference="protein motif:PFAM:PF04693"
FT                   /protein_id="ACX90813.1"
FT                   /translation="MTKELTREEYYKALEKAVNEVILSMTGTRKDVAKRLLLGAVVGRN
FT                   ATEIAQEAEMNYETVLNNLDKAAQVNLIEVVKKLVGDHPVLLIIDDTHDHKLYARAMPV
FT                   SRNGAQIFYCRAHKRFESAIQLLVIGVKDLVNNQIYVIHIIAYIPRKVEEELKRRGEEV
FT                   KFKTKIDALLEFLSSLSGLNVKSKVFDSWYVNSRTLQGNTVGELKSSARVVESGRSVPV
FT                   SEFPQGEYLVEYLGTPIKLLVIDDYKGYGRRYFFSTDLNDTAEDIITTWENRWDIEVLI
FT                   RELKALGLEGGSFLTWVRNSGFVALKALSLLVVQYFKYSTGLVLGAKRLARLIKSIYRE
FT                   AGGIKKLFKRRRKP"
FT   gene            485937..486125
FT                   /locus_tag="Ssol_0538"
FT   CDS_pept        485937..486125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90814"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN47"
FT                   /inference="similar to AA sequence:KEGG:M164_2513"
FT                   /protein_id="ACX90814.1"
FT                   /translation="MNSILMTGYAHEVLGATNTDGRVVVFPSTSPNELRVSVYEPSRGV
FT                   PVAELEVVKSKQKLRHG"
FT   gene            486179..487501
FT                   /locus_tag="Ssol_0539"
FT   CDS_pept        486179..487501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0539"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   sid:M164_2578 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90815"
FT                   /db_xref="GOA:D0KPH1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH1"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACX90815.1"
FT                   /translation="MEENLDSSVLEAPIINVTPPGSKSLKLLKDQEEYETSAINYPKYF
FT                   KIAIDKAQGSTVTDVDGNVYIDLVTGISVVNLGHNNPFVRKRVQEQLEKVWHTLEVPTE
FT                   IRVNFSKKLLSTLGMRAKLLFTTTGADAVEAAVKIARFITGKKTIIAFEGSYHGITAGT
FT                   LGLTGANRFKEFQPFFDDRVVKFPYPYPYRCPFKDCLNETLSLLDYAMSNPGYLGGDVA
FT                   GILVEPIQGEGGYVVPPKGFLKGLKELAEKYSVPLIVDEVQTGVGRTGKMWAYQWENIE
FT                   PDIVTISKAIGEGIPVSMVAYREDFDKLPTGFHLGTYRGNPLGLAAGLASLEFIESHNI
FT                   LSRVERLGRKALELLKEVQNPHVGDIRGLGFMIGIELVKDSKEPWSEGTKVVIERALKR
FT                   GLLVYKAGRWDNVIRLMPPLTIPESLLDRAIEILKIILNTL"
FT   gene            487580..489139
FT                   /locus_tag="Ssol_0540"
FT   CDS_pept        487580..489139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0540"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   sid:M164_2577 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90816"
FT                   /db_xref="GOA:D0KPH2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH2"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACX90816.1"
FT                   /translation="MEKSKKGAFLRESSGLVREFGILDALWFNIALLGLLFSTYYVAST
FT                   GPLVGGNPLLGLLLPIVGFFLVGIIFSYVGSKVPRVAADYVYVSRNLHPALGFVGNAGY
FT                   FLATVPLFMGITGITLQTFGLIPLLTILGYYTHNPSLIVVGSQIDSNPYLIMVIGAVEI
FT                   VIMSLIPIFGNKVYRAFQWIAIPLALIAAIGMIIVEASVPHSLAIARLNNFASVYANVS
FT                   NLYANVTSSNAPVPAYYNIYNIISLNPVYVVGFSYIINTIYVAGEVRNPKRSMPISILG
FT                   TLIITGFIFTAALALEYNQFGYDFTTKMMYLSIVQGTLPIPTPYLDLLEGIASGNIVLG
FT                   VLFALASIVQLLMYLSAASFVGSRLLFSYAMDRIMPDFVGDVSEKRHVPIKAIILSMIA
FT                   GLIGLTVFTLPVTSAGAFLLSSVAVAILMLFPMAILSIAVLKTEKNENKIRIIAALSII
FT                   YLIYTFYQYLTVPAIGADSIVGYGILAGSIVILFIIFYVAKFIRARQGIDFNLIFKEIP
FT                   PE"
FT   gene            489146..490054
FT                   /locus_tag="Ssol_0541"
FT   CDS_pept        489146..490054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0541"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sto:ST1015
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90817"
FT                   /db_xref="GOA:D0KPH3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH3"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX90817.1"
FT                   /translation="MAKDIKLMFVTDIHGSDIVFRKAINAAHMFKVNYLVFGGDLVGKG
FT                   VVLLNKKVDEYLTLDNKLITKEEVEEIKRNGYYIYILENRKGMEDFNEVTINRIYVDLV
FT                   SQQLNSWFKIVRERLEETKVIWNLGNDDPFFVDDIFKNNDIEIKEIIEIDTSSSPLFML
FT                   NYAHTNETPYKSYRVAPEYIIYNKGHEMLKKINETKNVIFNFHAPPYNTRLDNAYVNGQ
FT                   WIHVGSRSVRELEEKFQPLLGLHGHIHESSAIDKIGKTLVINPGSMYSEGVLKYAIITI
FT                   SKEVKGISVGYRIKGYVLSQG"
FT   gene            complement(490045..491178)
FT                   /locus_tag="Ssol_0542"
FT   CDS_pept        complement(490045..491178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0542"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; KEGG: sto:ST1738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90818"
FT                   /db_xref="GOA:D0KPH4"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH4"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ACX90818.1"
FT                   /translation="MWFIYGRPTNNPFGREKEIESLLGLYKLGQPVGLIGPRRIGKTSL
FT                   LLASLEHSSFPYSLISAEEFVRGEKGFDFAEFLSAYITSVTSTIYSKANYKIILEKGKS
FT                   YLKQLRDLLGQVKVTFNIPELYSTIELTLDKAEKKKYLEKEFRDALDLPQILSEKFGLQ
FT                   RVVIAIDEFQYLRLAKQSIPGIFHIMRSKWQFHKNVTYVISGSLIGMMMELLSSRNQPF
FT                   YQFFYLMKVNPFDRKTSIEFLRKGFEVNNLDVKSEEIELIVDQVDGFPAWLNLVGIKIV
FT                   TEKRSANEVINSLVKDINLVTALENDLKRLSPTARAVLKNLASLGGAGSPKDLGLDLLT
FT                   VTRGLKQLMNYGLVEKEGRGIYRIVDPILIKYLVSQP"
FT   gene            complement(491214..492131)
FT                   /locus_tag="Ssol_0543"
FT   CDS_pept        complement(491214..492131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0543"
FT                   /product="agmatinase"
FT                   /note="TIGRFAM: agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   siy:YG5714_2758 agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90819"
FT                   /db_xref="GOA:D0KPH5"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH5"
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /protein_id="ACX90819.1"
FT                   /translation="MRQLDALKSPRFTQISTFGRLPICEKNEEIKAAFLGIPFDDAVTY
FT                   RPGARFGPMGIRQGSRLLRPYNQFLDTYPFDKLNACDMGDINVIPGYIEDTMNAIQTSL
FT                   YEIISSKNLVPFIAGGDHSITLPILRTLYKKFGKINIVHFDSHYDFWDSYWGKKYTHGT
FT                   WLRRAIEEGLIKEAVQGGIRASTFSKEDLRDKERLGIRSFTIRDLKYNLDTVIREINSL
FT                   SGPTHVSIDIDVVDPAFAPGTGTPEVGGLTSFEIIEIVRKLRFDKLVGFDVVEVAPPYD
FT                   MSEITAMLAANIIYEGMSVLSLNL"
FT   gene            complement(493174..493833)
FT                   /locus_tag="Ssol_0544"
FT   CDS_pept        complement(493174..493833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0544"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   sin:YN1551_0133 uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90820"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH6"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ACX90820.1"
FT                   /translation="MENFISRLIACDKCPRLTQYRKSFPDNYWKKPVPPNGQIDAEIVI
FT                   VGLAPAGNGGNRTGRMFTGDESSNNLANALYAVGLSNQPFSVSKDDGLKLFNVYITSAV
FT                   KCAPPQNKPNKDEIINCSVFLEEEVRILKNTKVYIALGKIAWDSLIYVFKKIGYNVPNV
FT                   RFYHGALVKVVKPDMSIIWLVGSYHPSPRNMKTGRLTINMLIEIFNTAKMLVNTKK"
FT   gene            complement(493871..494134)
FT                   /locus_tag="Ssol_0545"
FT   CDS_pept        complement(493871..494134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90821"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH7"
FT                   /inference="similar to AA sequence:KEGG:LS215_2749"
FT                   /protein_id="ACX90821.1"
FT                   /translation="MGVSISDIKYIVERPEIFGFKVETIRKDNGFNTVINDVKQNGIRI
FT                   DNYWVTCNKDNGECEVVDDNSNSLIIVNFIKKTIIKYVTSKL"
FT   gene            complement(494173..494457)
FT                   /locus_tag="Ssol_0546"
FT   CDS_pept        complement(494173..494457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90822"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH8"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0135"
FT                   /protein_id="ACX90822.1"
FT                   /translation="MDYSAILGTLTKDKRECQSFLSICNNGKFVFVAICDTQTKVYCGE
FT                   VNENSIIFGEKGNNNSVTYEIPISDNNIKVIKVSDSIYAYNVNESLLSD"
FT   gene            494577..495251
FT                   /locus_tag="Ssol_0547"
FT   CDS_pept        494577..495251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0547"
FT                   /product="carbonic anhydrase"
FT                   /note="KEGG: sim:M1627_2641 carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90823"
FT                   /db_xref="GOA:D0KPH9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPH9"
FT                   /inference="similar to AA sequence:KEGG:M1627_2641"
FT                   /protein_id="ACX90823.1"
FT                   /translation="MFNRYFLNKRLNLLMSIFTVMRLVVSCMDRRLNSYIKKKYQDAIV
FT                   LRNAGANVNSLLMSLEKFNNKVDEVILLPHTDCGAMKVVYSSLKEGKKITSLVEEKLVS
FT                   QFSSKKFSSLSELERLNMEIQEENLKRIFGDKVRAELVDVNKIEIPPSNDPYMVYVTVP
FT                   SQLVRLSSNIYHISAEDKEIWDSLDIAVYAMNITKIISQNDKLAEKIRNMYPSVTVSTA
FT                   SF"
FT   gene            complement(495235..495795)
FT                   /locus_tag="Ssol_0548"
FT   CDS_pept        complement(495235..495795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0548"
FT                   /product="protein of unknown function DUF433"
FT                   /note="PFAM: protein of unknown function DUF433; KEGG:
FT                   sin:YN1551_0137 protein of unknown function DUF433"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90824"
FT                   /db_xref="GOA:D0KPI0"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI0"
FT                   /inference="protein motif:PFAM:PF04255"
FT                   /protein_id="ACX90824.1"
FT                   /translation="MELPGYDYIIVYKDIHFGRPFIAGTLIRPENVLYELAKDKTFDEV
FT                   SKAFYNQINFKQIRECIKYAIDVMKILKYYKKVKPKVPRRLKRKLGPTNYTFIDKDDDN
FT                   NSSKYDPKIKNSSTKVVDVLNKLYEGKEISQVAEELNIPKEAVIESILYSASLVDDFHL
FT                   SLSAFEDPASVVIESFNYIRKKQ"
FT   gene            complement(495833..497146)
FT                   /locus_tag="Ssol_0549"
FT   CDS_pept        complement(495833..497146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0549"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: sid:M164_2570 peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90825"
FT                   /db_xref="GOA:D0KPI1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI1"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACX90825.1"
FT                   /translation="MDEELYTLIEFLKKPSISATGEGIDETANYLKETVEKLLGVKANL
FT                   EKTKGHPVVYAEINVNAKKTLLIYNHYDVQPVDPISEWKRAPFSATIENDRIYARGASD
FT                   NKGTLMARLFAIKHLLDKNELNVNVKLLYEGEEEIGSVNLEDYIEKNTNKLKADSVIME
FT                   GAGLDPKGRPQIVLGVKGLLYVELVLDYGTKDLHSSNAPLVRNPCIDLAKIISTLVDMG
FT                   GRVLIEGFYDDVRELTEEERELIKKYDIDVEELKKALGFKELKYNEKEKIAEALLTYPT
FT                   CNVDGFECGYTGKGSKTIVPHRAFAKLDFRLVPNQDPYKVFELLKKHLQKAGFNGEILA
FT                   HGFEYPVRTSVNSTVVKAMIESAKKVYGTEPQVIPNSAGTQPMGLFVYKLGIRDAVSAI
FT                   GAGGYYSNAHAPNENIKIDDYYKAIKHTEEFLKLYPIL"
FT   gene            497276..498784
FT                   /locus_tag="Ssol_0550"
FT   CDS_pept        497276..498784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0550"
FT                   /product="Vinylacetyl-CoA Delta-isomerase"
FT                   /EC_number="5.3.3.3"
FT                   /note="PFAM: 4-hydroxyphenylacetate 3-hydroxylase; KEGG:
FT                   sid:M164_2569 vinylacetyl-CoA delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90826"
FT                   /db_xref="GOA:D0KPI2"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI2"
FT                   /inference="protein motif:PRIAM:5.3.3.3"
FT                   /protein_id="ACX90826.1"
FT                   /translation="MVLRTGEEYVNAIRHRNKVEIYVMGKEVKDVTEHPFLKPSVLAFK
FT                   ATYDAAHEEDSESLARAWSSFINEEVNRFTHIHRSPEDLAAKVKLLRKISHKTGACFQR
FT                   CVGWDALNAIYVTSRLMAERGKKEYYERFVEYLKYVQKNDVALAGAMTDVKGIRTLRPH
FT                   EQPHAYLRVTQVTKDGIYVSGAKANITGIGAAEEIVVMPTRAMSEKDMDFAVAFSIPLD
FT                   TEGIKVIIGRQVNDGRRLEEGEIDGLPYRTNHEGLVIFDNVFVPMERVFMLGDWQMSGI
FT                   LVEIFSSYHRQGYGGCKSGLGDVIIGAAYNLAKQIGVEKAPHIQNKLNEMVLLNENMYG
FT                   SGIAASLDAVKLCEDGCWWVNPMFANVTKQLVTRFPYEITKFSTDIAGGIIGTAPSEWD
FT                   LKNPKLKPYIEKYLQGMMDYSTEDRLRMVRLLENVGFSVAFLIESVHGAGSPEAQRIAI
FT                   NRVYDYEYAEKIAKYLSQIEKRIDFKENAEPWRKTDTEKIASSG"
FT   gene            498795..498935
FT                   /locus_tag="Ssol_0551"
FT   CDS_pept        498795..498935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90827"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90827.1"
FT                   /translation="MLIEIFLFPFFLLFFSDSNPIEAMHEGLVDVKQRSESSAVRFERV
FT                   S"
FT   gene            complement(499036..499788)
FT                   /locus_tag="Ssol_0552"
FT   CDS_pept        complement(499036..499788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0552"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: siy:YG5714_2750 putative
FT                   signal transduction protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90828"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI4"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACX90828.1"
FT                   /translation="MKVIDIANPIVITIFPESSLKEAIDILSNNPSGRIVVLKEEKPIG
FT                   IVSTRDVVASFSEYGTNIYDLKVKDIMSKDLVIVSPNDDVNHVVRIMLMNNIGGIPVVD
FT                   NNVIVGIFTEREILKLIASSMFSGLVDSVMSSNIISIGEENTIMDAAKLMVMNNVRRLP
FT                   VFSKDNRLVGIITAADIVKYLAKNKNIGKVLDAGTKNPITINRYYSILNAAKLMIEKRI
FT                   GTLLVMENQKLVGIVTERDLMYAYINIA"
FT   gene            complement(499822..500355)
FT                   /locus_tag="Ssol_0553"
FT   CDS_pept        complement(499822..500355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90829"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI5"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2749"
FT                   /protein_id="ACX90829.1"
FT                   /translation="MYCLDDRKRIPANVVCSSYNFKIRAIVNGRPYMASYEELWNFPLD
FT                   GLNSIHLFENLDYALRNDPFLSATSSIAIFVSEKEDIEGFVELILSKTLFEIRSIILVE
FT                   NPISKYGDSEVTLSSSSLYYSVSYRNDRLMIKAKDREGYYEINMKLHNFTFVSDYRELL
FT                   RNVEKVGKSTRVVI"
FT   gene            500463..502199
FT                   /locus_tag="Ssol_0554"
FT   CDS_pept        500463..502199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0554"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   sin:YN1551_0142 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90830"
FT                   /db_xref="GOA:D0KPI6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI6"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ACX90830.1"
FT                   /translation="MKTLGFISNQITSALIDLSSIVWFPVPKFDSPSVFTRLLDEDGGE
FT                   FSILPEGQEIIAVKQEYVYPLVLMTAIRTKQGEISITDLIPLGETVIIRKVESEIPFKV
FT                   VFKPRFYYSLYKPIIDGNRFVNPRGRDCMAFLYDFSGEVKRSGNYVWNFSNGKGYLIAN
FT                   YASDVKHGVFSERGSTLNAIYERSFENTINYWKSIDVKDAKSFNDLYKASIYTMLGSIY
FT                   APSGGVIAAPTTSLPEVEGGKRNWDYRFAWVRDSSIIAEALLEAGSIVEARRIINFLLS
FT                   LINFSSKPFYYPLYTIEGTIPPPERELRWLSGYKNSKPVRIGNGASSQIQLDIEGFFIS
FT                   ALYKYVKMTNDQVFLKDVFSKVKYIGDWISENWSLKDSGIWEDRGSPQHYTHSKIMMWI
FT                   ALDKIGKLANLIGYADIWAKEREKLRNWIFTNCVKNNYFIRYCGNTDDVDSSLLSAPLY
FT                   GFIEVSDSTFINTLTKIENDLKTDVFVKRYKTDFMGEAKHPFLLTTVWLARVYMRLGKI
FT                   DSAIEILNKINKVSRELHLVGEHVDVEKGEFTGNFPQIFVHAQLVIAIKELNDTLTDKN
FT                   II"
FT   gene            502222..503415
FT                   /locus_tag="Ssol_0555"
FT   CDS_pept        502222..503415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0555"
FT                   /product="Protein of unknown function DUF650"
FT                   /note="PFAM: Protein of unknown function DUF650; Protein of
FT                   unknown function DUF651; KEGG: sid:M164_2565 protein of
FT                   unknown function DUF650"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90831"
FT                   /db_xref="GOA:D0KPI7"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI7"
FT                   /inference="protein motif:PFAM:PF04894"
FT                   /protein_id="ACX90831.1"
FT                   /translation="MIRPELCIRCRGAKYLCGLSYCPIIVNTKTVRVNFKEVYGSSPPS
FT                   VFVGRFSYPKITVYPSAPPILGDTSKFEDSKYWLNADLSEFLSMRLSLVRGGVKYHKDD
FT                   ARLPDRFLLDIQSITISSRPVELDLRLKRIPSGGILDESLPPLGPSAPLEKLEIATLPP
FT                   PLAVVEKVYVDNDMRAKDGIMKLYNAGIDVEKISRILSIGGIGKERKLVPTRWSITAVD
FT                   KAISDTLIENIKNYDTIDKVEVYFRKYNKNLFIAILLPRDWSFEWGEAWYPGSTWNKFG
FT                   NYVDIEVDNERYHGRSDYPEIGGCYYASRLGVTEFLASRKRQATAILWREIYEGFNLPV
FT                   GVWFVRENVKEMFKGKPVVFDDISTALNFVKRLLRSDLKQWLSKSLLSFNTIDKWLK"
FT   gene            503412..504188
FT                   /locus_tag="Ssol_0556"
FT   CDS_pept        503412..504188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0556"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sis:LS215_2739 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90832"
FT                   /db_xref="GOA:D0KPI8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACX90832.1"
FT                   /translation="MIVKSIRVKSALSKSGLKELNYSLNPYLGCVFSCPYCYAPNFTPD
FT                   REASENWGKVVAVKENLLEVLEREVKIYKRGVVGISTITDAYQPIEALRKLTRESLKIL
FT                   LKNGFRVSIQTKSPLVLRDIDVLLEYKDRVDVGFTVTSLNNKLEPNAPPAKGRLRALEE
FT                   LSNEGLETWIFLGPIIQGVNDTEVENIIREISNIKARVIFDSFHYYRGLKFKEGSIHWW
FT                   VNLKNKILENCKRYSIECHEQSEDWIYEKKRYYKTF"
FT   gene            complement(504191..504529)
FT                   /locus_tag="Ssol_0557"
FT   CDS_pept        complement(504191..504529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0557"
FT                   /product="Protein of unknown function DUF2173"
FT                   /note="PFAM: Protein of unknown function DUF2173; KEGG:
FT                   sin:YN1551_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90833"
FT                   /db_xref="InterPro:IPR018685"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPI9"
FT                   /inference="protein motif:PFAM:PF09941"
FT                   /protein_id="ACX90833.1"
FT                   /translation="MSEKLDKLMQLKGAIAAGQYTPDGKLVEYKGPMSKEIAEMVAKMV
FT                   AANTLMGTVEAESFTKISGMRWTPFLGWAVAAGEYAVCVMGNYGVFVKLAEADFNQIFK
FT                   TLREVAGI"
FT   gene            complement(504737..505990)
FT                   /locus_tag="Ssol_0558"
FT   CDS_pept        complement(504737..505990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0558"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sim:M1627_2631 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90834"
FT                   /db_xref="GOA:D0KPJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX90834.1"
FT                   /translation="MIKYKDTRWMYLIIPYNASTGPLSTLVTLQILSLGGNAINVAYAI
FT                   SLSNAVLIPASILWGFMADRMDRKKQILLSLAGVSIPLVFMPFMNSISLVTLNYALITF
FT                   MSTASATPFNLLIMESVEKKHWGSLFSRFSLFSSIGVLLGLVISTFLVILLRIDQIEEI
FT                   LGFSVLATLIASIKILPKPIITFERTAIIHHKESFLTRMRHLPMMFLHLPNIHHFKMFS
FT                   MTRLFRKPINYVPLLYLGIVLFYISSGIFNTVYPAGLYVKGLNKSEVLAVISVGMVFQI
FT                   LGFRISSMLLESKDEKGLAHISLILRGVSYVVLGIFAQLFLGIPIFISGLIFYPLAAGI
FT                   AYAIFYSSSTTLIFKIVGERRQGTGLGVYSTVVGISLFLGSLLSGYITHYISYGIDFIT
FT                   AGIILLFASWIFRYLEEG"
FT   gene            506146..506934
FT                   /locus_tag="Ssol_0559"
FT   CDS_pept        506146..506934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0559"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: sin:YN1551_0147
FT                   aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90835"
FT                   /db_xref="GOA:D0KPJ1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ1"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACX90835.1"
FT                   /translation="MKIKKGDTEAEILTKGAYLYSFKIGNRDMILRGDLERPTRGGMAI
FT                   LIPFANRVKNAEYVFEGVKYTLPQNREGNAIHGLVMDKEFNVIGKSEDSISLQYILEHE
FT                   GYPSKLDCVITYKVFKYGLRIKIVVRNVGNKRAPLTVGAHPYFITADDWRIVVEKEESI
FT                   KKCISFNKIPTGELVKTKLEHTDYDDCFLISGGIQLHSSYSKVRITRRNMPFVQIYTGV
FT                   RGSIAIEPMSGAPDAYHNGLGLKILEPNESSYFAFAFRFH"
FT   gene            507006..507815
FT                   /locus_tag="Ssol_0560"
FT   CDS_pept        507006..507815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_2735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90836"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ2"
FT                   /inference="similar to AA sequence:KEGG:LS215_2735"
FT                   /protein_id="ACX90836.1"
FT                   /translation="MPYAEEMEVKASRSQLLSFFIDPVRFAGILGHLMIVNIFDKAESK
FT                   FVTMGSLKKPENKFKVLYLIGDPESRLITFSGIMEGPTLTFNTITYKGEGDNGKLTWRI
FT                   DLILTELGKLTRMKVAADVKQSYGFLDRVRIGDFDFATHLVKEHVIPFVKFYFKPSILE
FT                   ETPVLNEVFRFRGSVEEVILKLREVIVNIKQGGIIILGDDYNIITSIVNGEVSHAQINN
FT                   MDVPGSEVFAYLLKASGNVELIAYDISLDDLIFKNLKRRLEEVKAKS"
FT   gene            complement(507810..508850)
FT                   /locus_tag="Ssol_0561"
FT   CDS_pept        complement(507810..508850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0561"
FT                   /product="Linocin_M18 bacteriocin protein"
FT                   /note="PFAM: Linocin_M18 bacteriocin protein; KEGG:
FT                   siy:YG5714_2737 Linocin_M18 bacteriocin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90837"
FT                   /db_xref="GOA:D0KPJ3"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ3"
FT                   /inference="protein motif:PFAM:PF04454"
FT                   /protein_id="ACX90837.1"
FT                   /translation="MFSNDPSTLTRKEKFDKEESVRAIRNAIAAEIDAINFYLQQNKYI
FT                   DDEKLRKVHEDITKEEMTHFGEFLRLLYQVSPEDFSYFKKGWEEASKLIGETKDFPLIP
FT                   TSSKEISKDHIVSWITEGIVSSRIMRNIGNTIKYEFTTIPLSEIKEDSGDIIQSKSASL
FT                   YEVPLINSQVKFYLGQKSDSRRTAVLAGKSFAKMENYLLLKNHPLSPLKIGLKITGSDW
FT                   NVAGNILLDVLRAYENLTREGFGKDVYILMSSLNYSKTFRVVDRSGTYEIEMIKEIGNV
FT                   VPTDIVSNDEIYVISKQGFDILVFSDLNVEYLSKEKDYEVYLITEQIAPRLISSAASCV
FT                   ITQKTS"
FT   gene            complement(509085..510434)
FT                   /locus_tag="Ssol_0562"
FT   CDS_pept        complement(509085..510434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0562"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: siy:YG5714_2736 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90838"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ4"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACX90838.1"
FT                   /translation="MVCEIPRVTVTTWSSRSIILVGPTYRKYLEKTLEIVRNNEVASVV
FT                   GQPGMGKTTLLKKIEEITKTDNLSIYLDLANKQSIDEEFWTKTTQFELREKALLELQKI
FT                   KGKLGYSFWKRLMGVKFEDWLLKICNKYNNPFLRVYCLSYERNFDGMINALRDMKNLSK
FT                   LVLLIDEIRDYHLSLIHRLINAGLDIPIIMAMPTEVYSKVSDLAIRRRIEESRIPLDDA
FT                   LTSEDIKEIVEAYCKDLTEDILPIIITLWNSKEITNVSSILQFIRNEMDKVEKVCEKNN
FT                   IDCIRSELRKYTSLRNPEVDAKEFEKKVRELLSNISKEFGISYVHPRGKRIEVDGKSIV
FT                   VGLFFIVDDQVYLGDVVFSNDGSLYNYEELKLLSKIEEVEHDKKVYKVRGRFVITNTAT
FT                   NINNIYTLNIPTLEVVKILNGDVFLLEERLKILFDQYQTPTRNETENLAL"
FT   gene            complement(510437..510937)
FT                   /locus_tag="Ssol_0563"
FT   CDS_pept        complement(510437..510937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90839"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0153"
FT                   /protein_id="ACX90839.1"
FT                   /translation="MIGKDDVFALILSEYKDSQKPVSLSKIKRKFKDRNLIHVLEELEK
FT                   EGKIRRVENGSKITFEPLDSINIEDELKILRDEIHKMLDLLQKFVESKSFSSKDFDEAY
FT                   DRIRDSLGYAPLERIRIELGLSKEEFYSKFRKYVEENYDLIAGGDEGFTRRGVTYGIVK
FT                   RRR"
FT   gene            complement(511175..512341)
FT                   /locus_tag="Ssol_0564"
FT   CDS_pept        complement(511175..512341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90840"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ6"
FT                   /inference="similar to AA sequence:KEGG:Cmaq_1387"
FT                   /protein_id="ACX90840.1"
FT                   /translation="MIRPIILPPKSPFSDIKGGVGTPYVIYDSKRDKHWFLFTGWSDLK
FT                   GLKREGFVAPIDRSLNVDFSGIKKILPSDFPMQVDYSNNGIRGFYNEARDEFYITSTHG
FT                   NDVYFFAFDQEWKLKGYKLLIKDLKKDSGFPIRPTGAYRNMHDAFAVAPNADSSGVKLY
FT                   MVRSVDDLEKVRVEDLGDIGAWARSNDVLDFTLIPRFQIFIEMNTVSKWMLQSFIGPNL
FT                   DELYVTEDVNKVSFLQGSLMPLLGLDDSFVQVGHPHYTTEPDGKPKLFFVSFRDTYTTR
FT                   IDTGKEGYTHEIWVEYVDTFIFDPRSYGELRGKFKGRESKWYYVPNANRLIVSVNGEAE
FT                   LQLKADINDEVSDSVVLKRGINIIDKPTTWIRLSSSTEIGATIKALVY"
FT   gene            complement(512398..512940)
FT                   /locus_tag="Ssol_0565"
FT   CDS_pept        complement(512398..512940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sis:LS215_2731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90841"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ7"
FT                   /inference="similar to AA sequence:KEGG:LS215_2731"
FT                   /protein_id="ACX90841.1"
FT                   /translation="MNRLQQLLKEALDEIEIYGSWVSLYYILKLLAESNVEKLCKEQEV
FT                   AYHMTVDSLTLFTIYKYGGGIDKTRLFVLSFLLYDYLSRYYNIQNPIFSIKWNKRYFVY
FT                   SPRIDSRLHTLSKKSLILKKERLYYLNQLGRSEAESINIREKDNAKVDSIVTNLKSLKK
FT                   VKDIRIFVRRHLLGNDK"
FT   gene            complement(512940..514694)
FT                   /locus_tag="Ssol_0566"
FT   CDS_pept        complement(512940..514694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0566"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   sin:YN1551_0155 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90842"
FT                   /db_xref="GOA:D0KPJ8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ8"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ACX90842.1"
FT                   /translation="MTRYYEFLSNGITSALIKNGSVEWLPLPRFDSSSIFTKILDEERG
FT                   GYFSISPVDEKYEVIHEDYIENTLILRTIFKSEEGKAEVTDFLPLSLAGIIRIYESEID
FT                   LKVEIKPFFEYGLITPAIIKARRGLIFRNPKSKEGVEILIGGEYIPIDDTEFVLKKGKG
FT                   YIYLLYSKDLRYGLFSNKGFVYSEPYEALNKAIRYWRRRLENAKKVNMYVDAYYRSLLV
FT                   LLGLIYEPSGGIIAAPTTSLPEIIGGSRNWDYRYVWVRDASYSAEALIKAGLLVKARDI
FT                   IGFLTAMIDPSSKSFDHPLYTIDGTAPPAEEILDWLKGHKKSFPVRVGNAAYMQIQMDV
FT                   EGAYMNALYEYYNASKDSEYISEIWWAIEAIAEWTKKSWKWKSTDLWEQRGVEEHFTHT
FT                   KVMDWVALDRASKLANELGYKNEAEEWINVAEEIKKDVFDNGYSEKLGYFTRYYGSNSV
FT                   DSALLTLPLYGFIDAKDPRFLRTFEKIERDLMISDGLLLRYKDDFMGNVKHPFALVSTW
FT                   LSRVYIRLGEVDRAKKVIEKLINCSTSSLLLAEHLDQNTCEPRGNFPQAFPHAGLIVAI
FT                   VELEERLV"
FT   gene            515059..516372
FT                   /locus_tag="Ssol_0567"
FT   CDS_pept        515059..516372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0567"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   siy:YG5714_2732 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90843"
FT                   /db_xref="GOA:D0KPJ9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPJ9"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX90843.1"
FT                   /translation="MISVAINTQTPPIRFSLTYRDLLEKYGYLEPPIDLNLLSNDDYHI
FT                   SVGGVAKMMLSLIKTRAFSKSRWVSLGPGYPPSVKMEEAEVYFVDLDAKSLANYTRFKE
FT                   GLYNESHGLSKYNLVGEEYIAYANYNWLSAQKLLEFYNDTDIYFINDFQQLLVGGIIGP
FT                   SAPAVLWYHIPFVPENLSRKLKEFLIKAFESFDLVILSTKRDLEGLVRTGAKVKVKQIY
FT                   PFIDPSSYKTVGRKEIQYIEDKYQLKSDDKVILVVARMDPMKSQDLAISAIKNVDAKLV
FT                   LAGDGSFTSKTLGHDKGSMWVSRLKELARSLGVENKVVFTGYVPDEELFALYQRANVVL
FT                   LPSRIEGFGLAVCEGWVYGKPAVVSSGAGISELIIEGGNGFVFKSGNIDELAEKLKLAL
FT                   KDEKVGSLGKETVKKCSVSNALNELKEGFEIASEEYKK"
FT   gene            complement(516376..517275)
FT                   /locus_tag="Ssol_0568"
FT   CDS_pept        complement(516376..517275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0568"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: sid:M164_2553 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90844"
FT                   /db_xref="GOA:D0KPK0"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK0"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACX90844.1"
FT                   /translation="MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDVVLV
FT                   VVAGCSSVIQGNAPYNAYNFPTVNVAFAAGPATAAGLARAYKQKGKNVTIVVWAGDGGS
FT                   ADIGFASLSGAAERNDNILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENKKNL
FT                   PLLMIAHNVPYVATASVGYPHDYIEKLKKARQVEGFRYVHVLTPDPYGWLFDPSKTVEV
FT                   AKLAVQTCYWPLFEYYNGKLNISSESLHCLDRRTRRPIRDFLSIQGRFKKLTDEQIKIL
FT                   EQYIDNLWEKLKSMLNNP"
FT   gene            complement(517244..518446)
FT                   /locus_tag="Ssol_0569"
FT   CDS_pept        complement(517244..518446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0569"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: siy:YG5714_2730 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90845"
FT                   /db_xref="GOA:D0KPK1"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK1"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACX90845.1"
FT                   /translation="MIRKIISGNEAVALGVKLARVGVTGIYPITPQTTIIEKLAEMRAK
FT                   GEIETEIVRVESEHSAMAATFGAALGGVRAFTATASQGLLYMHEMVWWVAGSRVPVVMV
FT                   VGTRAVGAPWNIWNEHTDFTSERDSGWIMAFASNPQEALDLTLQAFRISEDERVFLPMM
FT                   IGMDGFILSHTKTNVLIPDQDQVDDFLPPRRQPYVIDPEDPVGMGNIFPPEGYMRLRES
FT                   IDLALRNSEDVIKEIGREYNKKINPLGDYSTLNVSYKLEDADYAVVLMGAWAGDAMEAV
FT                   DTLREKGIKIGMLRIRYLRPWSEKEIRNTLKDKKAVLVLDRSTSFGRGGGPLYVEIKST
FT                   ISNVVPQIKGVVSGLGGVTVNKNDLVYIFNKFVEGLKDDVIWYYPKEVGKIELRTPRDI
FT                   E"
FT   gene            complement(518443..518706)
FT                   /locus_tag="Ssol_0570"
FT   CDS_pept        complement(518443..518706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0570"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: sin:YN1551_0159
FT                   pyruvate ferredoxin/flavodoxin oxidoreductase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90846"
FT                   /db_xref="GOA:D0KPK2"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK2"
FT                   /inference="protein motif:TFAM:TIGR02179"
FT                   /protein_id="ACX90846.1"
FT                   /translation="MSLLEYQYFPITRPNKGAGGRTGAWRIVKPVVDYSKCIGCKACFM
FT                   FCPESTIVPSNGKVRVDYEYCKGCGVCANVCPVKAISMVSEQ"
FT   gene            complement(518693..519247)
FT                   /locus_tag="Ssol_0571"
FT   CDS_pept        complement(518693..519247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0571"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: Pyruvate/ketoisovalerate
FT                   oxidoreductase; KEGG: siy:YG5714_2728
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90847"
FT                   /db_xref="GOA:D0KPK3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK3"
FT                   /inference="protein motif:TFAM:TIGR02175"
FT                   /protein_id="ACX90847.1"
FT                   /translation="MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGA
FT                   EIEAYCRISDTPIRVTSPVEEPDYLVVIDNSLIQISRSLFRGLKDTSTILLNSPSKPDL
FT                   RWRTFYVNATKIATDLGLVKSGWPMVNVIILGALIRVMGMPKLSSLEKAIEEEFDGKVA
FT                   QLNIKGARLAYGQVGVEYVTA"
FT   gene            complement(519311..520507)
FT                   /locus_tag="Ssol_0572"
FT   CDS_pept        complement(519311..520507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0572"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sid:M164_2549 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90848"
FT                   /db_xref="GOA:D0KPK4"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK4"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACX90848.1"
FT                   /translation="MERKLGFIFDHNKCIICNACVDACNKAYGDLNWRSLIVMTHGESK
FT                   TALSIACNHCDNPTCMQVCPANAIEKNEMGIVRIRDDKCIGCGFCTWACPYEALKFNNE
FT                   GVMSKCHFCYDRLAEGKGIPYCVEACPTGALAFGWIEKGEAEVNYLPPSEITKPRIVIK
FT                   QPESKETLNASVLHTKKEENYLGLLAFTIGSEFALGYSLFKLPLWSIVSVILLVASLLL
FT                   SVNHARKTDRFYRVIYNLKTSWLSREVLFSSIAILFYILSIAEPLFYYPAILFLTVGVI
FT                   SSIMIYMLKSRPSWYNVDTPVSFIGSIFTMSLPIVYFFSHNLTTIIPLIITLVIEIISN
FT                   NRRSNVRMSLNVASIVISLISIVFPEIIIITEIINIVSEVTHRREFYEKVVYYGLPKV"
FT   gene            520574..520822
FT                   /locus_tag="Ssol_0573"
FT   CDS_pept        520574..520822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90849"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0162"
FT                   /protein_id="ACX90849.1"
FT                   /translation="METPFYKYALMRNFIREAIEHEPIENFVKEKLASDLEMKSRFCNE
FT                   DDNTLKQLISEVIEYVTLGKGKGKEDEILNAIISSCH"
FT   gene            complement(520806..523088)
FT                   /locus_tag="Ssol_0574"
FT   CDS_pept        complement(520806..523088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0574"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: sid:M164_2547 aldehyde
FT                   oxidase and xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90850"
FT                   /db_xref="GOA:D0KPK6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK6"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACX90850.1"
FT                   /translation="MYIGSSVKRVEDLRFLTGKGRYIDDIYLPNMQYMAVLRSNYAWAK
FT                   FKLDPKRAEERGFNVITFEDTKEFSPLPNFFIPDPKRAPKEYILAKEEAKYFGEPIALV
FT                   LGRDRYEVYDALELVDVDYEPIEPITDPFKAIEPNSLILHKELGSNIVYSDIFEYGEEP
FT                   KDYHYVEKTFRYNRILPAPLETNGVIADFDKVSGNLTIYANTQVPQVFKTALSIIFNIP
FT                   RSKVRIIVPDSGGGFGGKIFLKPLAMTALASILTGRPVKYIETRYEHVISAIHGPDRHY
FT                   TAKILFKGDEILGAIVDLVEDFGAYLHTYQPLPILRQIYQLVGPYKMKYLKFRVSGVVT
FT                   NKPPTGAYRGLGIPPAVLVLENLVKSISKVNGIDEIELRTKNFIDKLPYEHITGAIYDS
FT                   GNYREALKKLISQLEVKDKDKYTGVGIAFALEPGSSLAFQTLVVNKPRTPYYEGVYMRI
FT                   DSGGDVTVFLSTNTMGTGHETAISQVVADVLGIPIEDVKVILGDTAGPPGTGFYGSRFS
FT                   VVGISAVYIASLKLKEKMREYLAKMFNVEKDDVKIDNGTVKIGNRSINVKEAVNMIYNR
FT                   SYLIGDEIGLDVSVTINSYNVNIADEKRRVNFSTTYGVNAHGIVIRVDKDTGFIKILKY
FT                   VILSDCGTMINPMIVDGQLMGGTTMGIGASLLEKVEYDENGIPKQTSFADYWIPSAEEV
FT                   PNFEIQHMINPSPFTPLGTKGVAEGGATVPPAAIINALEDIVKKPINRVEIPITPEYVL
FT                   QLINDMS"
FT   gene            complement(523091..524287)
FT                   /locus_tag="Ssol_0575"
FT   CDS_pept        complement(523091..524287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0575"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   sim:M1627_2615 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90851"
FT                   /db_xref="GOA:D0KPK7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK7"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ACX90851.1"
FT                   /translation="MVFPFKSLEDFKVEITQDHELLRSAVRDFAENVLAKYVERGEKEL
FT                   DIPLEAKQKAKEIGLYGLFASQDLGGQGADYLSLLTATEEIARIWPSFSTFLLINWMFI
FT                   YALSRFGNEELKKKYVIPVANGDKVAAFAVTEPVAGSDVAGIKTTAKKLDGEYVINGRK
FT                   IFITNGDIADYYLIAARTSPPDPKARWKGISMFVVEKDAVKPVSRIETTGLRSSHTAEI
FT                   LLEDVKVQTENLLGEEGNGFKYAVSSFDFARTIVASQALGIGQAALEKMINYSLQRSAF
FT                   EKKLAEFQLVQTKVSESLADLEVARLITYWAGTLFRNGKENEYTVAASLAKFISTESAE
FT                   RIILRAMSVYGGYGVTTSTGLERMLRDLQIMKTYEGTNDIQRISAARFLYNKFIGYKV"
FT   gene            complement(524313..525176)
FT                   /locus_tag="Ssol_0576"
FT   CDS_pept        complement(524313..525176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0576"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein alpha subunit ;
FT                   Electron transfer flavoprotein alpha/beta-subunit; KEGG:
FT                   sid:M164_2545 electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90852"
FT                   /db_xref="GOA:D0KPK8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK8"
FT                   /inference="protein motif:PFAM:PF00766"
FT                   /protein_id="ACX90852.1"
FT                   /translation="MKTVVFSESPVFLRMAAAVAQSFGGEVIGISDNENVKFVNKLYII
FT                   DKIDEDGIVDLISSLSPDVILTGNVRRDRAIAGRVAGRLKLPIATDVVSLKVEDKKVTL
FT                   NRVAYSGMGLVTLESELPIVITIANTQLQPKELQPSVEKVQLKEGRVKIVGRKSTSSGV
FT                   NLATADIVVGVGRGIGSKENVKYAEELAKALGGAVGGSRPVAAELNWVSEDRQIGLSGL
FT                   RIRPKLYIALGISGQPQHIAGIRDSKIIVAVNIDKNAPILENADYLVVGNAIDFCKAML
FT                   SKLGKK"
FT   gene            complement(525178..525906)
FT                   /locus_tag="Ssol_0577"
FT   CDS_pept        complement(525178..525906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0577"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: sim:M1627_2613 electron transfer
FT                   flavoprotein alpha/beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90853"
FT                   /db_xref="GOA:D0KPK9"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPK9"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACX90853.1"
FT                   /translation="MNIIVGFKIVPDDQMIKVVGDKLNTDAPLKVSTYDKNAIEEAIRL
FT                   KEKFGGKVTGITVGNNDRKSIREALAMGVDEVIAILVKDPDVYVTAMAIAENVKTLNPD
FT                   IILFSEMTTDSGTSALPAYVSELLGLPYISNVKSLKIEGNKVVADRGMVSYLETVESSL
FT                   PIIVSVGGEINTPRIPSVKQIMESSKKPVKEVKFDAQSKVRIREIKPMIVNRKRIVIEE
FT                   SDINKAVDKLIEYLKSDGVI"
FT   gene            526003..527886
FT                   /locus_tag="Ssol_0578"
FT   CDS_pept        526003..527886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0578"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: sid:M164_2543 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90854"
FT                   /db_xref="GOA:D0KPL0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL0"
FT                   /inference="similar to AA sequence:KEGG:M164_2543"
FT                   /protein_id="ACX90854.1"
FT                   /translation="MTLLPIIITITMLLAMFYVIYEVEKWISIRRVLLALYVEGMMLIM
FT                   NIGAYLYLLSNNPFYFLITNSAYMIFGLYPLLNIKEVKKRQFIYGIFALFMVISEITMG
FT                   ALIYTLETSTPANIDTSIENIYFVSVMVVEMVFTLILSFRNINKTLRNYLIGLLLLMPW
FT                   FPQIFPSVNLPIWLSAIIMIGDTILIYDSLYSQRLRASQETFTTIELIIIFTLMMIGEF
FT                   FFFLYNTLLVFDISMIIGMIWFIYRALAGPNSRKGNYTKNPILAFTIIFLTFVMEFFMG
FT                   GVLDFVEGIFSPGVSGFINSLTLPWEPLTNPINTLWNFINIVGSVLGSMWFLIMMGIEM
FT                   GFLAFKKMLEMRVREVRIRMSLMILAYALYTIYIPMFSPISDHLPYLPYMWSMGIGTLG
FT                   GVSNSVLLGLIGTYVVYALLSFLFGSRNLCAISCTAPLMYQGTFYDSLKVYNRTSKLGR
FT                   KMMTSRLSNWFKIVTLSISILVLVASIISYLNSLGIINFTIFGADITVLIYFIWFDIIW
FT                   YLLFISIPFLGTFACINTGYCYWGVFNQAVSSIGLFRLKVKDPMICVNCKTVDCASACP
FT                   VGITDMRGWFIKKGEFKSFKCVGLGECVNACPYDNIFFYDVRHWIKERFKH"
FT   gene            527970..528947
FT                   /locus_tag="Ssol_0579"
FT   CDS_pept        527970..528947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0579"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sin:YN1551_0168 FAD-dependent
FT                   pyridine nucleotide-disulphideoxido reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90855"
FT                   /db_xref="GOA:D0KPL1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACX90855.1"
FT                   /translation="MPLKTYDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLT
FT                   DLIENYPGIESTGGLTLAQKIEKQAKKFGAEFIYGEEVKEIAQESDLFIIKGIKGEYAG
FT                   RALILAFGKTPREINVPGEQEFKGKGVSYCAICDAAFFKGKPAAVIGEGEPGIEAIELL
FT                   SNYANPAYYITSSSYLAGEEEIVKNVVNKPTVKILTSSRVLEIRGNSKVEELVIKRGDE
FT                   ILQLKVDGVIIEMGYTLKTEFLKGFVELNEKGEIIVDELGRTSREGVFAAGDVTQTPYK
FT                   QAVVAAAEGVKAALSAYNYIRSKRGLPPVNVDWKAEKKKVSFRL"
FT   gene            528978..530333
FT                   /locus_tag="Ssol_0580"
FT   CDS_pept        528978..530333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sia:M1425_2557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90856"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL2"
FT                   /inference="similar to AA sequence:KEGG:M1425_2557"
FT                   /protein_id="ACX90856.1"
FT                   /translation="MQTYFVPLAVDQNYNEINFHKQIAISLLNLDLEKKEKVVRASIIG
FT                   WPLLIKKTEQGFLVLDQTLRVSSRILKYIYPPFNDVASEFSSMNDYTTFVSNLKKINLK
FT                   RVSSNEITLIGLLNIEIDKLLKVAKNSVNANYQLFMLDSKLSDHDVKVIKDTLISLKAE
FT                   AIFTITSLESLVKEVDDVRVRIKKGYASKLEATTKKYNELIENKKKEIDNEVQKANSEI
FT                   YNETNSEISSRISRLTDITTRHIVVSLKYEGGIVGRDEFENSKNEFENLLNEFRQIKDS
FT                   VAGKYLEKIKNLRKELDSLYSERNSEIENINKLMKDLDNVTNDFKNDANKVKENIENFI
FT                   KYIESFYNTKLDMAEDSTLVIPFLIAKTNTGNTLVVQPQVYKGKTRGILGKVFKKSDLS
FT                   EPLLNLQVFTEYLKTIDIIDNVKIHSIQINNALKEINDEGWRSLDSLEEIYA"
FT   gene            complement(530324..530929)
FT                   /locus_tag="Ssol_0581"
FT   CDS_pept        complement(530324..530929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90857"
FT                   /db_xref="GOA:D0KPL3"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL3"
FT                   /inference="similar to AA sequence:KEGG:M164_2540"
FT                   /protein_id="ACX90857.1"
FT                   /translation="MIFKYSNGTISSEGLTLCTVKVERNQIRVEGNYNFLLKREGLDSY
FT                   EIYQYNSKIGEIKNFNLQYSIFNFVVSRPQLVAFKRGYENIVKIFTNSNTEVGEIKRVQ
FT                   DGLEGYLNDAYDPYIILIYLVVLSNFINVISYPKYRTSRVSKYRGLFYFIPLLLILVYL
FT                   IPLPFYIDLAIYVALLIIFYYLLVIRRILILSPRAAHA"
FT   gene            complement(530949..531134)
FT                   /locus_tag="Ssol_0582"
FT   CDS_pept        complement(530949..531134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90858"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90858.1"
FT                   /translation="MLTNPYYPRMLFYYMGYKSRLYHVRLPKVYKAYYFYFKSKKFLLS
FT                   RKYVLNYARKRRKLIF"
FT   gene            531341..532267
FT                   /locus_tag="Ssol_0583"
FT   CDS_pept        531341..532267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0583"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   sis:LS215_2713 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90859"
FT                   /db_xref="GOA:D0KPL5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL5"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACX90859.1"
FT                   /translation="MALNERRVIALILTVVLAGIALGGGVFVLSSVFKIIPADYLLYIY
FT                   AAIWFIVAVIVSYFIGSLIRNRLGDVIGYDNASSISFVVRLIGYIIAFVGFFVLIRVSL
FT                   GTALAAGGFAGLVLGLAAQDVLANIFGGIMIVISRPYKVGDRVTVSTWQYGLLAPTYPP
FT                   KFFSNDFLIPGYTGTVTDISLLYTTIFTDDQIPVKIPNSIMIQAAIFIHNGEEKRKVRT
FT                   KYEVSKDIDPDVLINVLKEKIKKLDFVIEEPSIKVLETTLNTYILGIDTICKTIYEEPP
FT                   RSEILKIVMRTVRELQTKTAAASDYNR"
FT   gene            532294..533526
FT                   /locus_tag="Ssol_0584"
FT   CDS_pept        532294..533526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0584"
FT                   /product="Cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: sid:M164_2538
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90860"
FT                   /db_xref="GOA:D0KPL6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL6"
FT                   /inference="protein motif:PRIAM:3.5.4.1"
FT                   /protein_id="ACX90860.1"
FT                   /translation="MFTIRNAKLLDGRIVDVGIEGEKIVCLGECEDNDELIDAENKLVI
FT                   PPYFNMHFHLDSAFTKAVNKSGTLWEGIRIWQDIRNKISEDEVVRNALTAVKLFVAYGT
FT                   LWIRSHVDITERSFKLLRAINRVKDESRDIADIQITAFPQDGIFTEKGNDELLRKALEN
FT                   GADNVGLIPHNEITREDGFKSIKYAFELAKEYNKDVDGHIDETDDPNSRYLEVLAKETI
FT                   NNEWYGRVTAGHVTAMHSWDSAYRFRILPYVARAGITVVPNPLINVVLQGRFDGYPKRR
FT                   GMAPIKEMLYANVNVTLGHDCIMDPWYPLGIGNMLQVLFMAIHLDQMMGINELVSSINL
FT                   ITFNGAKAWRVKNYGIEVGNEANLLVTDADDVIDLIRFMWPPRFVIRKGKVIAKEGKYV
FT                   LFKGKWERIKG"
FT   gene            533564..534190
FT                   /locus_tag="Ssol_0585"
FT   CDS_pept        533564..534190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90861"
FT                   /db_xref="GOA:D0KPL7"
FT                   /db_xref="InterPro:IPR031594"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL7"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2715"
FT                   /protein_id="ACX90861.1"
FT                   /translation="MDVSVFLAALGISLLELTEAGAIAAIYHNIYKNNLPFIYAVLGVA
FT                   IVLIPTFTLGKLIYLVPLNYVLLASAVILFYFGYRLIRSARRSFKGIKKKGGEEKEEGL
FT                   SVVFTVSAIEGLEASLVILALIPQSYSSAVMGAILASVLVVILTAILKSQVARIRLPHL
FT                   KFVLSALLFSLGTLWISEVVFDIPDLILPLFFLAYLGINYVIIKI"
FT   gene            complement(534196..535110)
FT                   /locus_tag="Ssol_0586"
FT   CDS_pept        complement(534196..535110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0586"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   sin:YN1551_0174 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90862"
FT                   /db_xref="GOA:D0KPL8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL8"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ACX90862.1"
FT                   /translation="MVKILLFSPNPNEFKRVGVYENGRVIDLVKAYELLYDAKPPNWFY
FT                   DTKDLIEGGNGSILLIKSVLDSLRGKEDKVSYDPEKIFYYPPITNPEKIFLLAVNYKAH
FT                   GKETNNEPPKEPYIFTKFSNALIGHNQPILYPKASNKVDYEIELGVIIGKQGKYVKRER
FT                   AFDYVFGYTVFNDISYRDRQFPSEMPYGMRWVHGKGMDTGAPMGPWIVTKDEIPNPYEL
FT                   RLTLRVNGEVRQDAYAEDMIFKIDEIIEYLSNGITLKPGDIISTGTPPGVGLATGKFLK
FT                   PGDTIEAEISKIGVLRNYLVKEE"
FT   gene            complement(535142..536737)
FT                   /locus_tag="Ssol_0587"
FT   CDS_pept        complement(535142..536737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0587"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; KEGG: sid:M164_2535 thiamine pyrophosphate protein
FT                   domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90863"
FT                   /db_xref="GOA:D0KPL9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPL9"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACX90863.1"
FT                   /translation="MGKTTSELLIDTISSQVTDVFGIPGTHGLSLYEELRKRVSRGEIR
FT                   YYMPRLEYGGAIMADYYARLKGNVGVFLSVNGPGFTNSLTALVGAYSEGSPLVLISLNK
FT                   EFKYRHRRQLHDSGYYDLQLEMARQATKASFRIYSPEDVPIIMERAFKIALEDKMGPVY
FT                   IEVPVDVLEEKGDFENYKIKKVNRTLIYPTKEEVREALNFLSECSKPILLLGYGASRSN
FT                   ILNYIEKLGIPVFTTIRGKGSIPENHPLYAGTIFNLKEIPGDCLIALGTSFNDLETSRW
FT                   SIKLPDRILHVDPDVNVFNTSINAEVTIKASAEAFLEEIVEKVNLPKWSYKVEEKNSDI
FT                   VDNTSEITHDYLAKVLDETLSEDRVIISDAGTNQVMAMDIKVYKPNSYFNSLIFNAMGS
FT                   AIPASIGGKIASPERQIVSIIGDLGFQGCFNELITAAQYKINFLTVLVEDGVQHFLRLN
FT                   QKMRYGNTFTTDVFQIDYTKVVEGIGVNVIEVKDRKDLKKSVEEAVGLSLKSPTVLRVH
FT                   VSPNSIPSRLLMKR"
FT   gene            complement(536763..537812)
FT                   /locus_tag="Ssol_0588"
FT   CDS_pept        complement(536763..537812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0588"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sid:M164_2534 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90864"
FT                   /db_xref="GOA:D0KPM0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM0"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX90864.1"
FT                   /translation="MDLLITNHRDLRHRKAGGAEQVIYEISRRLVKKGVSVTWLSEEIK
FT                   GLPKEEEIENIRIIRRGNSITLHLYAPIEARRHEIVIDSVAHAVPFYSYLVNKNAIALV
FT                   HHVHQDVVKYELNPIMARAVAFSERSVSNYKSIIAVSNTTKRDLVERLKAKEDRIEVIH
FT                   NGIDHNIYRPGKKASEPTILWIGRLKKYKNPLDAIDVAKRVKAKLVMAGGGDLENEVVQ
FT                   KIKTINGEYLGRVSEEDKIRLYQSAWIVIVTSFIEGWSMVTVEANACGTPVIAYNKGSL
FT                   PEIIKNGVNGYIVNYKDIEAMSKIINELIEDEKRIKELWKSSYEESLNYDWDKSSEKYY
FT                   NYLIRKALD"
FT   gene            complement(537830..538099)
FT                   /locus_tag="Ssol_0589"
FT   CDS_pept        complement(537830..538099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0589"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sid:M164_2533 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90865"
FT                   /db_xref="GOA:D0KPM1"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM1"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACX90865.1"
FT                   /translation="MMDLLKRLSLNKYNVDKTTHIEVNTDICLTCKDKPCTKVCPAGTY
FT                   EPSPDGRIVVHYERCLECGAALVACPYGAIKFHFPEGGISYKYG"
FT   gene            complement(538096..539319)
FT                   /locus_tag="Ssol_0590"
FT   CDS_pept        complement(538096..539319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0590"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: sis:LS215_2706 FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90866"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM2"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACX90866.1"
FT                   /translation="MSFDADVIIVGGGLAGLSAAITANREGLSTIVLERGEYSGSKNVS
FT                   GGRMYTHALLQLFPDALERAPLERPVTNETYEIYCEEEKKITFSFRHKTRNSYTVLRAK
FT                   FDQWLAKEAENEGVLISYSTLVTNARRENDYVVIETNRGELKAPLVIDAGGITAPVSRF
FT                   LGVKKLEPKTLMLGVKEVLDIKPDMDDDEGEARTIVGLIGNLKGGGFVYTNKDTLSVGV
FT                   TIKVESLYNSNIPSHEIVERFRESLGLSGSILEYSAHLIPYYGYDKIGKIYDKNLILVG
FT                   DAAGFLINDGFNIRGMDLAMGSGIIAGKSAKKIKELNDYSRTDIYYEMLKESFVLKDMK
FT                   TALRSFSVLNEEEIFTKYPKVICNVLGQLFTVTSDGKERPINVLIKESKSENVNTTKML
FT                   TDIMRLFI"
FT   gene            complement(539339..539695)
FT                   /locus_tag="Ssol_0591"
FT   CDS_pept        complement(539339..539695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90867"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM3"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0179"
FT                   /protein_id="ACX90867.1"
FT                   /translation="MFGKLVAVIDKLNEGNVIEAGNELLLIAKDYEDQDKIIDLLAEIE
FT                   KEIKEFKSSNDFLHRDDSPFMDMVKRSMEEMRICRENKLKALILHTLYIISNGNEILLN
FT                   MIKKVNIGKPNTYI"
FT   gene            complement(539723..540142)
FT                   /locus_tag="Ssol_0592"
FT   CDS_pept        complement(539723..540142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0592"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sin:YN1551_0180
FT                   UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90868"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACX90868.1"
FT                   /translation="MKRILVGYDGSENAERALDFAIELASKFSARLFVVEVIDLTLFYN
FT                   TGILPPLEATKSLEERAKKDVKRAIEKAKSKGVNAEGITVEGDPANSILQFATDNQIDV
FT                   IVIGSRGLSKVQRIFLGSVSNKIVQESKVPVVVVK"
FT   gene            complement(540177..541055)
FT                   /locus_tag="Ssol_0593"
FT   CDS_pept        complement(540177..541055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0593"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sin:YN1551_0181
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90869"
FT                   /db_xref="GOA:D0KPM5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACX90869.1"
FT                   /translation="MEDVKKFKYFTVSPLAFGTWRIGGGYWYSSHDRDNEWVGAIRRAI
FT                   ELGLRVIDTAEMYGNGHAEELVGEAIKEFSREELFIVSKVWPSHADYDNVIKSAKNSSR
FT                   RLGTYIDLYLLHAPSRVPICKTIRAFEKLVDDGVIRFFGLSNFDVDQIESARECVSKYE
FT                   IVAIQNHYSLLSRSDERRALAYAEKNGLMYMAYTPLENGILARNEFLANIGKKYNKTAT
FT                   QVALNWYITGKNSLIPIVKASKIPHIEENAGAMGWRLSEEDWRAIDEHFREKSYFLDKF
FT                   VSSLKSMRPWS"
FT   gene            541786..541974
FT                   /pseudo
FT                   /locus_tag="Ssol_0594"
FT                   /product="hypothetical protein"
FT   gene            complement(542055..542483)
FT                   /locus_tag="Ssol_0595"
FT   CDS_pept        complement(542055..542483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0595"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein; KEGG: sin:YN1551_1959 HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90870"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM6"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ACX90870.1"
FT                   /translation="MNFDSLAFSYITQAEERLDLAKTEYERKKYNIVVRLCQEAVELSL
FT                   KACLRLVNIEPPKFHDVGPILKNNTDKFPQWFKEKIDIFASYSRSLRKERELSMYGDEE
FT                   TNTPPELLYSAYDGQQSIKIAEEILEYAKKLYEEKRNK"
FT   gene            complement(542473..542997)
FT                   /locus_tag="Ssol_0596"
FT   CDS_pept        complement(542473..542997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0596"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: sim:M1627_0757 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90871"
FT                   /db_xref="GOA:D0KPM7"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM7"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACX90871.1"
FT                   /translation="MFIRFLGFIYHMIKEPYAKLLNDMVKIMREEFKDDLISVVLYGSV
FT                   ARGDNRNDSDVDLLIVIDNLPMDGILKRIRLFETKVEDKLNLDEYWSKGYYISLSPILK
FT                   TPEEAGKISPLYLDMVYDAVILYDKDQFFTKILQKLKGRLMELGAERVRMGKRWYWILK
FT                   KDSGFGETVEL"
FT   gene            543624..543698
FT                   /locus_tag="Ssol_R0002"
FT                   /note="tRNA-Thr1"
FT   tRNA            543624..543698
FT                   /locus_tag="Ssol_R0002"
FT                   /product="tRNA-Thr"
FT   gene            543994..545118
FT                   /locus_tag="Ssol_0597"
FT   CDS_pept        543994..545118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0597"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: cma:Cmaq_0386 IS605 family
FT                   transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90872"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM8"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACX90872.1"
FT                   /translation="MKLACEIYNTLRWADIYFYQRDGKGLTQTELRQLALDLRKQDDEY
FT                   KQLYSQVVQQIADRYYEAKKRFFEGLARFPKEKKPHKYYSLVYPQYGWKILQVREIRKG
FT                   KKKLITLKLSNLGTFKVIVHRDFPLDKVKRVVVKLTRSERIYITFVVDHEFPKLPNTGK
FT                   VVAIDVGIEKLIVTSDGEYFPNLRPYEKALWKVKHLHRELSRKKFLSNNWFKAKVKLAR
FT                   AYEYLKNLRTDLYMKLGKWFAEHYDVVVMEDIHVKQLIGKSLRSLRRRLSDVAFSELRD
FT                   LIKYQLEKYGKKLILVNPAYTSKTCARCGYVKEDLSLSDRVFVCSNCGWIADRDYNASL
FT                   NILKGAGSERSLVPVELRPLPVPALRYWHGRAVK"
FT   gene            545224..545469
FT                   /locus_tag="Ssol_0598"
FT   CDS_pept        545224..545469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sim:M1627_0999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90873"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPM9"
FT                   /inference="similar to AA sequence:KEGG:M1627_0999"
FT                   /protein_id="ACX90873.1"
FT                   /translation="METVTIKVDKEIAELIKKMISLGIAKSKNEAVNMLIEYGRAEIER
FT                   RVKEEEEVKKLVEKWLQEGFPYKNLDTSDLREERYG"
FT   gene            545462..545881
FT                   /locus_tag="Ssol_0599"
FT   CDS_pept        545462..545881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0599"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: sto:ST2004
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90874"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN0"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACX90874.1"
FT                   /translation="MDEIKYVDTNVILSLVEEDANFERARKLKGLTNLVTGEITQLELN
FT                   SFYSRKLKDEIKARASTLYLLQFVNVKVIEADWNKLFRKALDLSYKLELKTLDVLQIAS
FT                   AFLSGSKIFITFDKEIISKREIVKKYTGVSVDDLT"
FT   gene            complement(545919..546943)
FT                   /pseudo
FT                   /locus_tag="Ssol_0600"
FT                   /product="hypothetical protein"
FT   gene            complement(547286..548485)
FT                   /locus_tag="Ssol_0601"
FT   CDS_pept        complement(547286..548485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0601"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: cma:Cmaq_0386 IS605 family
FT                   transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90875"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN1"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACX90875.1"
FT                   /translation="MPTLGFRFRAHTDEQTLRALKAQLKLACEVYNTLRWADIYFYQRD
FT                   GKGLTQTELRQLALDLRKQDDEYKQVYSQVVQQIADRYYEAKKRFFEGLARFPKEKKPH
FT                   KYYSLVYPQYGWKILQVREIRKGSKKKLITLKLSNLGVFKVIVHRDFPLDKVKRVVVKL
FT                   TRSERIYITFVVEGYEFPKLPNTGKVVAIDVGVEKLLVTSDSEYFPNLRPLEKALWKVK
FT                   HLHRELSRKKFLSNNWFKAKVKLARAYEHLKNLRTDLYMKLGKWFAEHYDVVVMEDIHV
FT                   KQLIGKSLRSLRRRLSDVAFSELRDLIKYQLEKYGKKLILVNPAYTSKTCARCGYVKED
FT                   LSLSDRVFVCSNCGWIADRDYNASLNILRGSGSERSLVPVELRPLPVPALRYWHGRAVK
FT                   "
FT   gene            complement(548579..548683)
FT                   /locus_tag="Ssol_0602"
FT   CDS_pept        complement(548579..548683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90876"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90876.1"
FT                   /translation="MNEIAVHTHQTVTIAKTLASALVDNAEGEPLGEL"
FT   gene            complement(549116..549733)
FT                   /locus_tag="Ssol_0603"
FT   CDS_pept        complement(549116..549733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0603"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   sia:M1425_2536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90877"
FT                   /db_xref="GOA:D0KPN3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN3"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACX90877.1"
FT                   /translation="MAKSTTTKVGNAIVRTIIYIILYVILSAIVKYIIESLLPSFNIHA
FT                   VSYESYVQILLALAFGYLIVSGISLIFYYSLLPKYGHPTAAAVRNIMRIIGIGALAASI
FT                   AGAVAGGAAGVALGGFIGIVIGFASQQVLGQAVAGLFLLVARPFKVNDNVNIVSEDGIV
FT                   EDVSTLFTTILKADGTRVLIPNNMIIGNKIYLKQTEQQQKPQ"
FT   gene            complement(549839..550423)
FT                   /locus_tag="Ssol_0604"
FT   CDS_pept        complement(549839..550423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0604"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   sim:M1627_2591 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90878"
FT                   /db_xref="GOA:D0KPN4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN4"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACX90878.1"
FT                   /translation="MVYVFQGIGGYIILFLLMIGEGIGLPLPSEVIMPLVGYYSYLGSI
FT                   SLYLGVIVGTLGSLVGSIIAYIIGYKLGLAFLKRYGKYILIDEGKIEALHNWFLRYGNM
FT                   AVFGFRFIPGLRALISYPASIGQMKILKFLGFTFLGHTIWDIVLALIGYQLANQINFVI
FT                   TQAEKLGNYLFILVIVIIVIYILWRIFWKRK"
FT   gene            550947..551339
FT                   /locus_tag="Ssol_0605"
FT   CDS_pept        550947..551339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_2623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90879"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN5"
FT                   /inference="similar to AA sequence:KEGG:YN1551_2623"
FT                   /protein_id="ACX90879.1"
FT                   /translation="MEWRFEETFRKAITIIRRFYPDYALIGRYARNFYAPPETTLDIDF
FT                   LVNVDDIEILAELIDYVRSQGYEIHPDDIGPWQYKIVIKGIRVDLVKPKGIDIDNEMIS
FT                   KRRVVELVNFISFLRRIWLFFMSFPP"
FT   gene            complement(551862..553397)
FT                   /locus_tag="Ssol_0606"
FT   CDS_pept        complement(551862..553397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0606"
FT                   /product="phosphoesterase"
FT                   /note="PFAM: phosphoesterase; KEGG: sin:YN1551_0225
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90880"
FT                   /db_xref="GOA:D0KPN6"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN6"
FT                   /inference="protein motif:PFAM:PF04185"
FT                   /protein_id="ACX90880.1"
FT                   /translation="MKRVLILTLLPLLLINTTFHANTTTPIRHVIIIIEENHSFDNLFG
FT                   TYPFGYPPILNNITLSLMYPYGLYENYTQLQGAKNGVLYWISVPDIPWLPIAYSHPYYS
FT                   NAYSTRDPYEGWDSYHGDYWFDTDKGFVYYSGPQSLAYFSYQQTWILWDYAEEYVLADD
FT                   YFSPVLGLTEPNRIAYLTGFSPNFYSDDATNVIPFNYSIMYQLQLNNVSWGYFVYKLNG
FT                   IPWPLDAFNQINMSHIYDLKNFFGDLKNGSLPAVSWVMLIGGESDEYDMHPPHNITAGE
FT                   IMIANITNAVMESQYWNSTVIFITFDEGGGYYDQVIPPSINHYGLGQRIPLLIISPYAK
FT                   EGYIDNYTLSGYTLLAFIDYNWHLPWLTKYVEDSDLQGLLQAFNFSTKPRAPIILTPSN
FT                   WTYPLPLQYPIHYGYIATVPNYKGYAEIYPMPEMAFLLPLDVIAFVLLFISFKKRTLIK
FT                   LTFLLFVVSLGISGYIYEINNIYQFISEYYFAASFIGFLIGGVLLARQYSRGK"
FT   gene            complement(553482..553892)
FT                   /locus_tag="Ssol_0607"
FT   CDS_pept        complement(553482..553892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0607"
FT                   /product="Protein of unknown function DUF2299"
FT                   /note="PFAM: Protein of unknown function DUF2299; KEGG:
FT                   sin:YN1551_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90881"
FT                   /db_xref="InterPro:IPR018747"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN7"
FT                   /inference="protein motif:PFAM:PF10061"
FT                   /protein_id="ACX90881.1"
FT                   /translation="MVSDSEVFNWFKELGMRVEQVKSGDLYFHFTVAPPMGGLPVSVIR
FT                   PRPDSTYYIVAVLLELDQERLRNNKRLVEQIKRELLRMNVEFFFTPNDKEPKSIQVARL
FT                   MFTDGLTKNEALNNVTLVKNSALLVLQLINES"
FT   gene            complement(553892..554467)
FT                   /locus_tag="Ssol_0608"
FT   CDS_pept        complement(553892..554467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sia:M1425_2514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90882"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN8"
FT                   /inference="similar to AA sequence:KEGG:M1425_2514"
FT                   /protein_id="ACX90882.1"
FT                   /translation="MIPYVIDLDAIFDLSSIEIYRLLTSSLSNVRYYPPKDLLKTVIND
FT                   FDISKFKPFPDSQYLEELNYRARIYVITNLPKIEAKLLLVRYNLDAFIQDVISPEDINR
FT                   YFPSKEVLVLISRKTNSPLGSITFITPHIDYAILTSNLGMRTILIRNSISLPRDIRVEI
FT                   RKSLVELAEITAQHKIDSEAGDSALRCQ"
FT   gene            complement(554448..555944)
FT                   /locus_tag="Ssol_0609"
FT   CDS_pept        complement(554448..555944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0609"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: siy:YG5714_2681 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90883"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPN9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACX90883.1"
FT                   /translation="MLNAGLIVSKKAREIIGDEILKEVFEEAKLSYVAEMGDYVIDDIN
FT                   NNELKALLLVSENGKERWMEDIDQKLGISPLAILTIPPKWFIGKSKEYIFTLLTAYSLR
FT                   VELMDLAYRVQPTPTSSVSRRSLLKLKTYEYKPYPVLFDEVHAKREINKAIESCPQGLI
FT                   VKAPEGPSVGYPEKCSVCGYCSASSYLGYLEIPTATTDQVLSFINTIVRHYRDKQAAIL
FT                   FTDSIIDDIPEGIFPFLMPCTAGVHDSFVLASYAAGITPIVHVSSKCESRDIALKRLDE
FT                   LPSHFPGTNFIISKVRNDEELKKTLSYIKPIQLSRSEIPLEVILQRSRRRALLIWSIEE
FT                   MSKKVKLNEDDTVPGVYNVEVDPNKCVLCGVCVRACQMLVPELKGSSTLELSYNIPYCI
FT                   GSQRCVKNCPEKAVIVTGYAKISDLKRKIVNKANVSKCRFCGKPLGSERIKNKVDTLLI
FT                   QYGFAGTAQYTDVCNECKQKILTKIWLERLLSGKNDTVRY"
FT   gene            complement(555944..556594)
FT                   /locus_tag="Ssol_0610"
FT   CDS_pept        complement(555944..556594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90884"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP0"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2680"
FT                   /protein_id="ACX90884.1"
FT                   /translation="MALSVLLNIRHASYDLFADLFLYKFGEDEYKQLLEKIDLVDKELG
FT                   KQLEETIGIRVNEIKRVFSETKRSGYLIEYSTLFLSGFGAKPLLPVESKRLFQLMGEKV
FT                   ATFKYTDVINFYRSRGIVMRFSSQFNPEPDHISSIFAFMSLLIEEEYEQRSEGKDPFKV
FT                   LQDEKNFAITHIFSWIPDWASDVINDPRSSIYKVVCSELAKFLRFERKYLGVN"
FT   gene            complement(556622..557464)
FT                   /locus_tag="Ssol_0611"
FT   CDS_pept        complement(556622..557464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0611"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sin:YN1551_0230 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90885"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP1"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACX90885.1"
FT                   /translation="MSSPQNTTTPQIKLDIRQGGVQHAPPFSLKANYAIITDLNKCFGC
FT                   GGCQMSCKEWNTSGMFGPLPDLNPYGELDVMFWLRVLYVEVGTYPQTKVYNIPINCFHC
FT                   INAPCTEVCPVGATFKRTEDGIVLVDYNECIGTKYCIYACPYGNRFFDYVEGVTKKCTH
FT                   CFDRIYDPTLPPEERIPACIHGCMVQARIWANILDPTDPGTILFYDKGGFVMGPETGAQ
FT                   PASGYLPWRSKYAESDVQLLSEAEYYNVWTANGVVQLGAQGNNSTYTEGNGSNSSSNS"
FT   gene            complement(557475..561755)
FT                   /locus_tag="Ssol_0612"
FT   CDS_pept        complement(557475..561755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Twin-arginine translocation pathway, signal
FT                   sequence, subgroup; KEGG: sis:LS215_2683 oxydoreductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90886"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP2"
FT                   /inference="protein motif:PFAM:PF10518"
FT                   /protein_id="ACX90886.1"
FT                   /translation="MLKLSRRDFLKISGATAVATAFILGGNSVAKRIFDSVSETNYTLN
FT                   YPSDEIVYTNCFQCLGRCAIEVVRTPTGFPRFVTGTIGWHINDGGVCPRGAADVFYYFA
FT                   PSRLRYPLLRASDRGSGKWIAVDYDTAFDIIVNGTSAQSWSKLGLNPQQLGIGNFPGLL
FT                   KIRETNPHALAFWEGRDQLIPGITGGYFSANFGTANAAAHGGFCSMNVYTAGVYVTGAP
FT                   VWEYAGPDEERSQYFILAGLAGDHFPNWMRRIIARIRENGGKVLTIAPERYGFYSVSDE
FT                   HLFVNPATDGALVMGWIRVLVDFHYYIYKVSQGQKVLNPITLQPVQLAVNPASGQLWMQ
FT                   TITPSGQVVALSSLGDIPSTAVYAHIDEEFLRYYTNLSWLVIVNPNPQNGDCLDPTDPT
FT                   AGNNVGLHVRMSVSNPQYSSNHPWLEAVMGNDGNVYAYVDIPWQKSVIPILTLDELPQS
FT                   MQSQIVQVPYKLKNGTVVKIPAIQVTVPKALGSQDMITLTATTAFELFRAELLNYDPYT
FT                   PLSQSPQYGALNVASVTGIPHQTVVRIANEIANVAFQKAIYEPAKWVDYLGRFHDHVVG
FT                   RPVSIYFMRGLAAHANGFMSAASLYYLVLMVGAWDNPGADLYKYPYPHYLPGHAVPPHP
FT                   LANAPQIDPDVANAIQGLNLTIPKSRSGFLKTEYIYNDGTVYVKNVQVVGAGPYGFPDG
FT                   PDDLVIYKTGRPLLVDRGYSWELPLTTQRSISAVAATSYLMNKYPKQVIPYTINAMMWY
FT                   ITSPFWNNAYNLAEVLQMVTEKDSSGNYIIPFTISFDLFMHETNNVVDLIMPDLSFLEV
FT                   YGFHSTFDRPTSLPQGPSDSLNWPALPSLYPVLSTGDTLLTLLWILRAYPSQNTIDPMK
FT                   NPFYTTQDPITGGDLISPITLHDPLTGTAILQQGQPGLISTGMFILKQGILLAGYGDRF
FT                   QYILTDANGKQSPNPQQLKLYASSVPNNSTQDAVINQILSSVPSGQKFSTAPTYKNSAS
FT                   NRSSGVEHYFRISVEFQPKLQSMLQTIINKYAAGKMTLDDINPGYVKVGKGGAVYVLPP
FT                   SIRYMRNVNMFYFLGWGAYMPGAYGPIGLPYVHRIYLEYLQKFRLAAAGKWTGYNAAYY
FT                   YYYLKTKNTSFLVRSQLPNDSYGKALQKNILDYFRPFGGYYPVPAWQSDITSDGINLSQ
FT                   YPLTFFVRRHDRMYHSWSYVVPWLTAIMPYTPVMLSAADPYVKSMGIQSGDMVQFEAVN
FT                   QPSSGGQRTTITAIAFLDNATRPGTAWVIVSSQALPGFRSQATNSPQVKYSILNNWANI
FT                   SYMPPSRGGILDPMKDNAFPILYLDPITGQTSWHDSRIRIVGKSTSTQVQVVSNKFTYM
FT                   GQDFSNQDILSVIVSKMGGQITVNNTPSQPTFAQPIDIPHLRFDANNITSTSLWSYVAP
FT                   GSLAPTYTIGQYKIRYGFATEPSS"
FT   gene            complement(561836..562660)
FT                   /locus_tag="Ssol_0613"
FT   CDS_pept        complement(561836..562660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0613"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; KEGG: sim:M1627_2570
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90887"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP3"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACX90887.1"
FT                   /translation="MEDVIKQAEELLEKGRYNEVLKVLENFESVEVYLLRAEAYLRMNN
FT                   SKAALVELDKGVQTFPFSYAILSAKAEVLENEGRLEEALENINKALEILPFSSEYRFIK
FT                   ARILFKLERYEEANIELTEVLRLNPNNVDARVMKAFCYYNMGLKLDALSEINRALNVKK
FT                   EDSSLHELKGKIYFETGFYKLALSEFKIAAHYDPNNPDHYYNAAACYYNLKMYNDALTY
FT                   MDLALSKGEKANYHILKALILKELNMEFSQEVEEAIKLDPSTKSIIENLFKK"
FT   gene            562771..563847
FT                   /locus_tag="Ssol_0614"
FT   CDS_pept        562771..563847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0614"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   siy:YG5714_2675 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90888"
FT                   /db_xref="GOA:D0KPP4"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP4"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACX90888.1"
FT                   /translation="MIKMGLFTAPEPGTSFGVQAPIIQINQYPLWGEYVALALYFTEIA
FT                   GMLMAIIGLMEVTGKYKAFNRRASVAAFIASILALLFFDIDLGRPTAAILAPAEALFYF
FT                   AFSWMARGIIFVGGLLLFSFLYMVISLLNVKNKWSRGVIAVLGAFAGIFSTTYSGFELA
FT                   ATTGIPFWNNGGLPALYLADGVFAASGLGYLIALVGKNEDVIRARVTLTKVLFYSSIAI
FT                   LATWFLFLANVNYLNVFNQVAYEYLLSQATFYVDITLSVLTLIISGIGYMSITRFLMFG
FT                   IKQKAPESAIGQIPVMDLPTVIKYVIVVAAIFALVAGFLARADVLFAGQYAYQLSPMTP
FT                   FQSVSNQPIPIGSFGWRG"
FT   gene            564015..564641
FT                   /locus_tag="Ssol_0615"
FT   CDS_pept        564015..564641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: siy:YG5714_2674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90889"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP5"
FT                   /inference="similar to AA sequence:KEGG:YG5714_2674"
FT                   /protein_id="ACX90889.1"
FT                   /translation="MSIKILDDRDTIILEFLVIYGYLTSYKLAKISDIPMATVWRILVN
FT                   LKSLSLVTKQKKGFTITPRGLVFAYYLTKKDNIRLQALQKLKESWKYDGSVNEIRSFLD
FT                   ALNQFLKKYEISLISVCFNHPLSVISLMLPKAKELDEFSQRLLARFILKAFPTVVLPTG
FT                   CKAIISFDEKGEPYALAADCKDEGVHIFHKCPYINKYFSVEVKPR"
FT   gene            564638..565537
FT                   /locus_tag="Ssol_0616"
FT   CDS_pept        564638..565537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90890"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP6"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0236"
FT                   /protein_id="ACX90890.1"
FT                   /translation="MIQLQRKFFLNLSQLVKQGFHPALLLTGCQKRALPVMKIINSNGD
FT                   LRGDLKINLCIRMGLREDKSCEFFYPSTREITYKKEISTSKGNGLLLASSEGLLLVDAI
FT                   YPERNKEILRATLSNLITIWGVKWYEIETKDNIVGFVWGFTDRIYMEVKEGMKVGMINR
FT                   PGGTLPVKLLYKALNGNIEYLEKRGIGINYIYELAEETFSRATKILKLNSNVLPINITR
FT                   IGINNINSLFANYSLKIQLPTPWYAEIMREIAPLIQDPLQSELLVLVIGEKREVEDALQ
FT                   EAEKQGFPSFLVGEVLRR"
FT   gene            complement(565526..566518)
FT                   /locus_tag="Ssol_0617"
FT   CDS_pept        complement(565526..566518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0617"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sin:YN1551_0237 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90891"
FT                   /db_xref="GOA:D0KPP7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP7"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACX90891.1"
FT                   /translation="MKALTFDKNGIENLKFTDYKNPEIGNHEVLIRVKLAGVNPVDYYT
FT                   VERLKVNPIPHIPGVEFSGEVVKVGDHVKSVSVGDRVTIYGRIFDGTCDMCMTGYETVC
FT                   RNGGRIGVDANGGWAEYIAVEEKYVFKLPNEYTWEMGSSLTVAALTAYHALKEAELRPS
FT                   QTLVIFGASGNTGMFLVQLGKKFGAKVIAVSRKSWLREYGADFVVDYNEVEEKVKEITN
FT                   AKMADVVVNSLGEQLWDKSFSVVGIRGKLVTFGTLLGGNVKVDLSQLYSKHISILGVNR
FT                   GNRKDFVELLDICKDCKVKTWKIFKLEEGKQALKELFSKERDGRIFLSP"
FT   gene            566683..568098
FT                   /locus_tag="Ssol_0618"
FT   CDS_pept        566683..568098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0618"
FT                   /product="cytochrome b558/566, subunit A"
FT                   /note="TIGRFAM: cytochrome b558/566, subunit A; PFAM:
FT                   Cytochrome c-552/DMSO reductase-like, haem-binding domain;
FT                   KEGG: sid:M164_2500 cytochrome b558/566, subunit A (CbsA)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90892"
FT                   /db_xref="GOA:D0KPP8"
FT                   /db_xref="InterPro:IPR017572"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP8"
FT                   /inference="protein motif:TFAM:TIGR03154"
FT                   /protein_id="ACX90892.1"
FT                   /translation="MSIKRKSKYTLGVLLLASFLAIIMGLANVPMAQTSPQIPVYKVVG
FT                   NADLSNPGSASYWSQIPWINISLTANIPMAPTSGLTHYLLVKAVWNGSWIIILERWYAP
FT                   EPAFGAWSAAAAALYPPASGPGLFRQIMLTPGTTYTIEKNYTNYFSIVNGNIIQGRLVL
FT                   NYSGILLPAPNDTQITVLSNGTIILWHSPRPIEDLLYSDGMFYGYYTNNTWYYPDRAAI
FT                   MWYMGSVIPPTKDGMNIGGKVPGQAFDGVTFNDTGGSLVQPGGAANIWMWVSGATWNNA
FT                   TYDPAFKVNLWQNTSLTGLPYIDPDNHGFAVPLYTNNTNMYEVDTAGIWYTPVTTSGLN
FT                   GSLFFIWTGATYQNGYWTVEFARPLAVPSAYAKWMPNITVGKTYYVAFAVWQGKLGETL
FT                   FDKSITSNFLTLELVTTPPTSTTTSTISSTSVTTTTSITTVTSIPSTTIYVTIVGVVIA
FT                   IIALIILYVVFRR"
FT   gene            568095..569039
FT                   /locus_tag="Ssol_0619"
FT   CDS_pept        568095..569039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0619"
FT                   /product="cytochrome b558/566, subunit B"
FT                   /note="TIGRFAM: cytochrome b558/566, subunit B; KEGG:
FT                   sim:M1627_0781 cytochrome b558/566, subunit B (CbsB)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90893"
FT                   /db_xref="GOA:D0KPP9"
FT                   /db_xref="InterPro:IPR017573"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPP9"
FT                   /inference="protein motif:TFAM:TIGR03155"
FT                   /protein_id="ACX90893.1"
FT                   /translation="MKMVDELKGNLNSFLILLGIFSFLQFSFKQSFMFPSILPLNIPDS
FT                   NLLLVIGNISFYFFFVFLLIVSMILSLTYKSLIPLTIILTISPFITLIPNYENSFLLYS
FT                   LEIAILILGLASTIEGLIKSSLLSILLIPTLVLVNLGIYASILLNIFHNALFISYLTIY
FT                   LISIAGYLAYVISWGKIKSLRNYIAISVGLLSMIPFIFFENIISHNRYLEILMNMILPS
FT                   TLGITLYNPYHITLLVMALGLSTMGIVTSLIKGNVSSGVGYFLIITTVFLGIDGFSLLI
FT                   YMLTPIIGFLVITSSEIESKRRLIDIISPTRNG"
FT   gene            569076..570044
FT                   /locus_tag="Ssol_0620"
FT   CDS_pept        569076..570044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0620"
FT                   /product="Rieske iron-sulfur protein SoxL2"
FT                   /note="TIGRFAM: Rieske iron-sulfur protein SoxL2; PFAM:
FT                   Rieske [2Fe-2S] iron-sulphur domain; KEGG: sid:M164_2497
FT                   Rieske iron-sulfur protein SoxL2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90894"
FT                   /db_xref="GOA:D0KPQ0"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017586"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPQ0"
FT                   /inference="protein motif:TFAM:TIGR03171"
FT                   /protein_id="ACX90894.1"
FT                   /translation="MIRFKSDKEDKPILEYPDLAFIRKLIRKMRDPKTKFDAKEFVNKG
FT                   EDYLFNYTNKNVGSVDEKRRKFLKSLIFGIAAAAVVGVIPGLKVLVPPTVTVTSGFPKS
FT                   LLVDSSGSPIKASEIPVNSPFIIIFEYPMTGEPNFLINLGDSTGKPIEIPSTSVVVPQT
FT                   GKTYTFPGGVGPNKSIVAYSAICQHLGCTPPYIHFYPPQYVGPSQLTASEPDQLTAAAL
FT                   LAAKQAKVPALIHCDCHGSTYDPYHGAAVLTGPTVRPLPAVVLEWDPSTDYLYAIGAVG
FT                   VATYPNGSNGVPTSNPTDDLSSSFGSSVSDKTTVQETENPF"
FT   gene            570096..571706
FT                   /locus_tag="Ssol_0621"
FT   CDS_pept        570096..571706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0621"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: sid:M164_2496
FT                   cytochrome b/b6 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90895"
FT                   /db_xref="GOA:D0KPQ1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPQ1"
FT                   /inference="protein motif:PFAM:PF00033"
FT                   /protein_id="ACX90895.1"
FT                   /translation="MSSKLSDWFKERLGLDDLPFFRTPDYMYKVDYWLGALVASAFIYT
FT                   VITGLILLLYYNAQAGYNSTEFVINSVPYGSVVLYSHLYGAYAMIILAYIHMFRNYFAG
FT                   AYKKPRELLWIIGVIMLILTLGTAFLGYSLIGDALATSAVDVGEGIISSVPGLSIFIPF
FT                   LFGNYDAGDYGRVLAWHIILTALIGLLFVFHFFLAEHYGMMPSRKVKDKVPAVYAKEEW
FT                   QKFNPWWPRNFVYMMSLIFLTWGFILIIPNAFAYLNGLPQQLNPFLNPKPAPPPNSPAA
FT                   AHITTYPPWFFLFLYKIADFTSDVVIFLFIGVIIPLIYLIIVPFLDRTEYLHPMKRKVF
FT                   VGIGILIVTYLTQTTIWGDLTPGVEIPVSQQVLVYLPPAIIVALGLAAIRPKTDNKGNI
FT                   KGTIGPITALAFILVSSLFIIAGIELLANPTILTVGVFIPIAGIFILTTKKIAPIALNA
FT                   EQRSENASVSEERAPEWKKKLAEGLVALLFIYAIILAAQIWTIPATGYFSNLFGIDLGL
FT                   ILLMLGEGISLYHYVIYRK"
FT   gene            571718..572011
FT                   /locus_tag="Ssol_0622"
FT   CDS_pept        571718..572011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0622"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   sid:M164_2495 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90896"
FT                   /db_xref="GOA:D0KPQ2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPQ2"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACX90896.1"
FT                   /translation="MINVGFYYKVKRGFEKDFENKFKEVLSYLRANADGFVDAKLYKNV
FT                   DEPSEYLIYSVWRDLDSFKKFVSSSAYKNTVNYGKSIIESKPIHRILQEIND"
FT   gene            572268..572546
FT                   /locus_tag="Ssol_0623"
FT   CDS_pept        572268..572546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0623"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: sin:YN1551_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90897"
FT                   /db_xref="GOA:D0KPQ3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPQ3"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ACX90897.1"
FT                   /translation="MAEIDKILKNLGVGELRFWVSGVYCNNCVNRIHRALKTISGVESV
FT                   EVKPDFKELKALVILKYRGEVSKKDIEEVLSETSDETPYHEYKPIWE"
FT   gene            complement(572622..572810)
FT                   /locus_tag="Ssol_0624"
FT   CDS_pept        complement(572622..572810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90898"
FT                   /db_xref="UniProtKB/TrEMBL:D0KN47"
FT                   /inference="similar to AA sequence:KEGG:M164_2513"
FT                   /protein_id="ACX90898.1"
FT                   /translation="MNSILMTGYAHEVLGATNTDGRVVVFPSTSPNELRVSVYEPSRGV
FT                   PVAELEVVKSKQKLRHG"
FT   gene            complement(572893..573183)
FT                   /locus_tag="Ssol_0625"
FT   CDS_pept        complement(572893..573183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90899"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX90899.1"
FT                   /translation="MIKAQPILYLYPEEHISFHICDKIRLDVCDEFIIVVSNYGTYSSE
FT                   AINKLREVVDTIKGLIASKATALGNLINEGEKIMRRAENLCRDKKDCNTFA"
FT   gene            573494..575017
FT                   /locus_tag="Ssol_0626"
FT   CDS_pept        573494..575017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0626"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   siy:YG5714_2650 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90900"
FT                   /db_xref="GOA:D0KPQ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0KPQ6"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX90900.1"
FT                   /translation="MDSTIMDYNLNIRSIFWRIEKLYKDREIISRTYEGIVHYTYSDFA
FT                   LRVRKLATFLKTNGIAGEAVASIAWNTHRHLELYFAVPLLGGVLHTVNVRFHESEMDYV
FT                   IKSMGDKAIFMDKDINYKNSTLPTFIFDERYDEDVNSQESTSDFPDVDERQGAIACFTS
FT                   GTTGKPKGVIYSHRSVFIHSLSLLAADALGISSSDTVMPIVPMFHISAWDLPFSSLMTG
FT                   AKLVLPGPRPKAEDIVKLIKEFKVTVGVGAPTVWIDVVNYVERENVDLPLKVVVTGGAE
FT                   PPLGLIKKLKELGVKTYHAWGMTETEAIATVNKSDNIERMSEQGYPIPAFEIALMGPEG
FT                   NELPWDGKSTGELVARGAFVTKKYLNDKSDAQTKWFRTGDVARINPDGSVKVIDRLKDL
FT                   IKSGGEWISSVDLENAIMSYEKVLEAVVVGVKDERWGERPIALVVKKPGMDVNEYEIIE
FT                   YLKSLNRFPKWWLPDKIIFVDSIPKTSTGKLDKKLVREQLRSMLEEKKY"
FT   gene            575061..576017
FT                   /locus_tag="Ssol_0627"
FT   CDS_pept        575061..576017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0627"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: sto:ST0151
FT                   acetamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90901"
FT                   /db_xref="GOA:D0KQ36"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ36"
FT                   /inference="protein motif:PRIAM:3.5.1.49"
FT                   /protein_id="ACX90901.1"
FT                   /translation="MQYTIHAKTHNKWDNSLPPILTISDGDIITVETKEASDGQVTPSS
FT                   TEKDLLKLDFSKIHPLTGPIEVKGAEPGDALEVEFLEFRHKGWGWTGVLPGFGFLADEQ
FT                   YTAPIDLQGPALKIWKVDEKYAYAKFGDLNVKVPIYPFPGVIGTGLPFRGKLSTIPPRE
FT                   NGGNMDIKHLTVGTKLYLPVFVNGALLSIGDTHLAQGDGEVCGTAIEAPMEVTVKVRLI
FT                   KNVGLTQPLFVTKKVKEMEYDEYIAYPGIDSNLWNATKKAIKGIISILSKYMAPVEAYI
FT                   LASVVVNLRVSEVVDVPNWIVTAYLPKNVFDVNVEVL"
FT   gene            576114..577349
FT                   /locus_tag="Ssol_0628"
FT   CDS_pept        576114..577349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0628"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: cma:Cmaq_0386 IS605 family
FT                   transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90902"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ37"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACX90902.1"
FT                   /translation="MPTLGFRFRAYTDEQTLRALKAQLKLACKIYNTLRWADIYFYQRD
FT                   GKGLTQTELRQLALDLRKQDDEYKQLYSQVVQQIADRYYEAKKRFFEGLARFPKEKKPH
FT                   KYYSLVYTQSGWKILHVREIRKGSKKNKKKLITLKLSNLGTFKVIVHRDFPLDKVKRVV
FT                   VKLTRSERIYITFVVEGYEFPKLPNTGKVVAIDVGVEKLLVTPDGEYFPNLRPLEKALW
FT                   KVKHLHRELSRKKFLSNNWFKAKVKLARAYEHLKNLRSDLYMKLGKWFAEHYDVVVMEG
FT                   IHAKQLVGKSLRSLRRRLSDVGFGELRDVLKYQLEKYGKKLILVNPAYTSKTCARCGYV
FT                   KNDLSLSDRVFVCPNCGWIADRDYNASLNILKGAGSERSLVPVELRPLPVPALRYWHGR
FT                   AVKQEAPSFMRG"
FT   gene            577357..577632
FT                   /pseudo
FT                   /locus_tag="Ssol_0629"
FT                   /product="hypothetical protein"
FT   gene            complement(577646..578446)
FT                   /locus_tag="Ssol_0630"
FT   CDS_pept        complement(577646..578446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sin:YN1551_0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90903"
FT                   /db_xref="GOA:D0KQ38"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ38"
FT                   /inference="similar to AA sequence:KEGG:YN1551_0264"
FT                   /protein_id="ACX90903.1"
FT                   /translation="MKWYQILIIVVAVILVISGIVILVHNTSQQQINVTKVVFPTQAQI
FT                   SSILGNGWNITGLFEENYSSAVNQQYPGGSALYQEYIQRANQTITLNVIQLNSTSTTLK
FT                   GIKLGKYLVSANITGNSSKFDLSNIVNLEIETLKSGNGLMPTLNPLLFPANQSVSLLEF
FT                   GNAITKNYTIYFETIMYNNSYISIDIANSSNISSLFTYLLKSTGQNVTVSSINGMKYFN
FT                   LSFISQYGSVYYFVGINNNDNYLIFIQSQTPKAFQFFVEISTKV"
FT   gene            complement(578738..579220)
FT                   /locus_tag="Ssol_0631"
FT   CDS_pept        complement(578738..579220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0631"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sid:M164_2481 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90904"
FT                   /db_xref="GOA:D0KQ39"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ39"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX90904.1"
FT                   /translation="MNDQIKIRKATKEDWEKIYQLYNSLSDEDLYLRFFHLYRITEEDA
FT                   KKIASNEDHVTFLAEVDGKVVGEASLHKDGEFSLVVHRNYRTLGIGTLLVKTLIEEAKK
FT                   SGLSTVKFYTLPENTPMIKIGRKLGFKMRFYEDEVYGEMRLTERELNVNLATFSAP"
FT   gene            complement(579344..579607)
FT                   /locus_tag="Ssol_0632"
FT   CDS_pept        complement(579344..579607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90905"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ40"
FT                   /inference="similar to AA sequence:KEGG:M164_2480"
FT                   /protein_id="ACX90905.1"
FT                   /translation="MNREVAVKFEDEENAFYLISDDGLIVKRNTIPKKIDILIVKQTDR
FT                   SKIIEAVKMNYKLFECNNITKEECLVKVLNRVFPYCKTCRFT"
FT   gene            580005..581888
FT                   /locus_tag="Ssol_0633"
FT   CDS_pept        580005..581888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0633"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: sis:LS215_2658 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90906"
FT                   /db_xref="GOA:D0KQ41"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ41"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACX90906.1"
FT                   /translation="MIGGAQGSGVDTSANIFGNAVAASGYYIYGNREYYSNIKGRHSYF
FT                   NLTISDKPPRSIAQQIEILTSFDAETIFQHFNEVKDVLIYSTEVENTKAEQVQSMEPEI
FT                   TEHVVKFLKEKGYGTTVKDVINYLKKEKGVKVIPIDYMEILKKVADQAKVQLSVADRAR
FT                   NTIAIAASYKLLGLKEQYLINSITRTFRQEVFAKINTIAAQLAMQQIQPMYNLPELPNN
FT                   EEKINLDGNTAAAIGKIYGGLRFQSYYPITPASDESVFIEAHQTVFTVDPKTGEKRKST
FT                   IVVVQAEDELAAINMASGAALTGVRAATATSGPGFSLMVEGMGWAGMNEVPVVITYYIR
FT                   GGPSTGQPTRTSQADLMFALNAGHGEFPRIVIASGDHVEAFHDGTWALNLAQKYQTPVI
FT                   HLVDKALANSYSIIPKKTLGMENIRIEKGKIVINTNTPELKRFEITEDGISPFAPLGTA
FT                   RVHYTGDEHDEYGFIAEASENREKMYEKRIKKLMTADKEIPEESRVNVYGNTDSKVAII
FT                   TWGSPKGAILDAMEELENEGIKPMLIQIRMFSPFPKNLMRKLLNGKEFIIDVESNYFGQ
FT                   AGEVLKLNTGIEPTHYILKWNGRPMMRDEVKEGIKAVVQKGERRVVLHGGA"
FT   gene            581875..582792
FT                   /locus_tag="Ssol_0634"
FT   CDS_pept        581875..582792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0634"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, beta subunit; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding; KEGG: sid:M164_2478
FT                   pyruvate ferredoxin/flavodoxin oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90907"
FT                   /db_xref="GOA:D0KQ42"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ42"
FT                   /inference="protein motif:TFAM:TIGR02177"
FT                   /protein_id="ACX90907.1"
FT                   /translation="MAGLKVEWNDWCPGCGNFGILSAEQQAIQELGLDPKKVVLVSGIG
FT                   CSGKIPHFIRLPASGVHTLHGRALTFAIGIKLANPSLEVIVNGGDGDQLGIGVGHFVSA
FT                   GRRNVDLTVIVHNNGVYGLTKGQASPTLKLGVKTKSLPKPNINSDINPIALAISSGYTF
FT                   VARGYAYDVKHLKEIIKKAIKHKGLAMIDVLQPCPTYNDIHTKEYYDKRVYKLDEDPSW
FT                   DPIVKKPEEMDDKMSKAILKSMEWGDRIPIGIFYQNELVSTYEQRIAERSPSYLDNPPA
FT                   HDVIEFEGKPTTDVEDILKERRVT"
FT   gene            582961..584793
FT                   /locus_tag="Ssol_0635"
FT   CDS_pept        582961..584793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0635"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: sid:M164_2477 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90908"
FT                   /db_xref="GOA:D0KQ43"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ43"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACX90908.1"
FT                   /translation="MPELKVVVSIKQVPDVDELRIDPVTNNLVREGVPAVINPPDLHAI
FT                   EEAVRLKERYGAKTIVITMGPPQADSALREALAMGIDEAYLISDRAMAGADTWATSYTI
FT                   SKAVQKLGGADLILFGRRAVDGETEQVGPQTGKWLGLPVIGYVSEIKSLEKDKIVVTRT
FT                   TEFDEEVIEAPVPVVLTILEVANKPRQPDILSLIKAKTAKVTVWNKDDIKAEPNKIGLA
FT                   GSPTKVIKVQPPPKTRKAEIIDGKKDVEKAAKWFLDKIFESLKEDESTLKEYVKPKPKV
FT                   KVNGEIWVYIDHIGEKPNRASFEIMGEARRIADLMDTSLSAVMVGGEATKSLIEETFEY
FT                   GADKVYFVETKGFDRYDNEVYTRALAKVIKKYKPEAVFFPGTKNARELASTTAIEVDTG
FT                   LIADCTNFDVDDKGVLLSTRPDFGGKEMSTIICPRHRPVMVTVRAGVFMPLPRVPGRKG
FT                   ELAREEIDDLFTRLKVLDYRVIEKRNILAEADIVIGVGRGIRSPENIKMAEELASLLGG
FT                   VVGVSKPLADMGWYPKDRQVGQTGTTIRPKVYIALGISGAVQHLVGILSSRKIGAINLD
FT                   PSAPIFENCDFGVVGDIFEILPKMMELLKKKEVS"
FT   gene            584796..585983
FT                   /locus_tag="Ssol_0636"
FT   CDS_pept        584796..585983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0636"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="PFAM: glucose-inhibited division protein A; FAD
FT                   dependent oxidoreductase; KEGG: sia:M1425_2479 FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90909"
FT                   /db_xref="GOA:D0KQ44"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ44"
FT                   /inference="protein motif:PFAM:PF01134"
FT                   /protein_id="ACX90909.1"
FT                   /translation="MKFDIVVVGAGPAGSSAAITAARGGAKVLLLERGPEPGSKNVSGA
FT                   MIRLEDFSSVYDIASIPIERKVKNVDLILLSDSNRTRISVNVESNLATVARLKLDKWMA
FT                   QQAEKAGALLITKTTVLGVEREGNEYKISTDRGEITADRVVLAEGVNALVSMKANIRPD
FT                   LTPDHAAQTVKEVYSLNKDEINKRFGFKADDEGISWRILGTDPVPYAGFLYVYKDAVAI
FT                   GAGIPMKILIKRKITPYTVLDEVKERLNFNELVKGASLREYSAKVIPEYGFPSWKACSG
FT                   KVYLAGDAIGLVDPLTFNGIGPAVASGVVAGKAALESYECNKYEYELMKNKEVRRVVNA
FT                   RPLVKELIEEENFKYYVKTINDLLHGWVYSDFSKVKLDTSKLLKHLLLGMGVLKS"
FT   gene            585980..586267
FT                   /locus_tag="Ssol_0637"
FT   CDS_pept        585980..586267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0637"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sin:YN1551_0272 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90910"
FT                   /db_xref="GOA:D0KQ45"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ45"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACX90910.1"
FT                   /translation="MRIEEKLYTLRYKKDEQPHLAIIDPNKCLRCEQVNGVPQPCIAVC
FT                   PANVYSWIDQRIVISYENCVECGACRIACPYSNILWKYPRYGLGIALRYG"
FT   gene            complement(586264..587202)
FT                   /locus_tag="Ssol_0638"
FT   CDS_pept        complement(586264..587202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0638"
FT                   /product="Pyruvate, water dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; KEGG: sid:M164_2474 pyruvate, water
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90911"
FT                   /db_xref="GOA:D0KQ46"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ46"
FT                   /inference="protein motif:PRIAM:2.7.9.2"
FT                   /protein_id="ACX90911.1"
FT                   /translation="MNYTYLLDEVSLSMVSIVGRKSAYLGELYKMGFNIPKGFIISSRG
FT                   VNEAIKDLDDEIRGILSSVNLNDTTDLEKRSEMIKSMIIASKLPNEMEKEIYERFSQLG
FT                   SKYVAVRATATSPLSGASFAGEYETDLFVTQENLIPSIKRVIASYFNPRAIAYRILTHN
FT                   EAGMAILVQTMINPVSAGTAFSIHPITEEPDYVVIESSFGLGESVTKGMVTPDQYVVSK
FT                   ATRSLVSKRISEKVMKLTYDFAEKKIKSIELSKEEALAESLSDNDAIRIANMAIAIESI
FT                   FKRNINIEWAIEDKKVYLLEVRGIRRLYPEF"
FT   gene            complement(587264..588031)
FT                   /locus_tag="Ssol_0639"
FT   CDS_pept        complement(587264..588031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0639"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: sia:M1425_2476 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90912"
FT                   /db_xref="GOA:D0KQ47"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ47"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACX90912.1"
FT                   /translation="MRVKRFDLVRVKDSEAYKDSDFVAVEEPLNIRTCFEKCEDFAIIM
FT                   RTPGDDKELSLGFLYSEGVINSIHDVEDIKQVENNVIEVKLNKPIGIRIRELIVNSSCG
FT                   VCGRAFLYTLNILKSDLKVKREVIFSFPEKLREKQSVFNISGGLHATALFNPQGELLFI
FT                   YEDVGRHNAVDKVVGRLLLEDKIPASNYIMQVSGRLGYEIVSKGIKAGIPIICGISAPT
FT                   SLAIEIAEEAGLTLIGFLRGKSLNIYTHSERIY"
FT   gene            complement(588012..588368)
FT                   /locus_tag="Ssol_0640"
FT   CDS_pept        complement(588012..588368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0640"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="PFAM: protein of unknown function DUF1641; KEGG:
FT                   sin:YN1551_0285 protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90913"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ48"
FT                   /inference="protein motif:PFAM:PF07849"
FT                   /protein_id="ACX90913.1"
FT                   /translation="MEEGGVQAIDGLIEQLIESREALENFLKLINTLQKTGILPLLVGM
FT                   MNTFDQNLAFLAEQNAVLIRNINIIYSILSGKEEAKDISLTELTKQLNDPDVKRGLYLL
FT                   LKILKAIGSASKEV"
FT   gene            complement(588332..591271)
FT                   /locus_tag="Ssol_0641"
FT   CDS_pept        complement(588332..591271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0641"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; molybdopterin oxidoreductase Fe4S4
FT                   region; ferredoxin; molydopterin dinucleotide-binding
FT                   region; NADH:ubiquinone oxidoreductase, subunit G,
FT                   iron-sulphur binding; KEGG: sim:M1627_2542 formate
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90914"
FT                   /db_xref="GOA:D0KQ49"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ49"
FT                   /inference="protein motif:TFAM:TIGR01591"
FT                   /protein_id="ACX90914.1"
FT                   /translation="MSLVSIKLVIDNKEVLANEGETILSTLKRNGIYIPHICYNEGLVP
FT                   IESCDSCLVEVNGKLVRACSTRVEDGMSISVNSKRAMEARKTAISRILRYHKLYCSICE
FT                   NNNGDCVLHEAVIKLNINSQKYVEKPYQTDESGPFYIYDPSQCILCGRCVEACQDFAVN
FT                   EVIWINWDLNPPRVVWDNGNPIGNSSCVNCGTCVTVCPVNALMEKSMLGEAGYLTWINK
FT                   DLKKKAIEAIGKAEDNFSLLMTFSEIEAKARESQIKKTKTVCIYCGVGCSFEIWTKGRK
FT                   ILKIEPKPESPANGILTCVKGKFGWDFVNSSERITKPLIREGDKFREASWDEAISYIAK
FT                   RLKEIKERYGPDSIGFIASDKMSNEEAYLLQKLARAIIGTNNVDNSARYCQSPATVGLW
FT                   RTVGIGADSGTIRDIENANLIVIVGHNTTESHPVIGSKVKRAKKINGSKIVVIDVRKHE
FT                   IAEKADLFIKPKPGTDAAVLAGVAKYLIDQGWIDKEFIDKRVNGFEEFKESIKGFTLDY
FT                   VEDITGVPRDQIIKLAEMIHNANSVAVLWGMGVTQHLGGADTSTIISDLLLITGNYGKP
FT                   GSGAFPMRGHNNVQGVSDFGCLPNYLPGYQKLEDENVIAKFEEAWGVKLNRNPGLQIPQ
FT                   MIEGVLEGKIHALYIVGEDTVMVDCGTPLTRQALEKVDFLVVQDMFITETAKLADVILP
FT                   AAASLEKDGTFVNTERRIQRFYKAMEPIGDSKPDWEIIQMVANALGANWSYNHPAEIMN
FT                   EIAKLGPIFAGVNYSRLEGFNSLLWPVNEDGSDTPLLYTNAFATKDGKAILYPLSWKPP
FT                   ELKDEVHKVTVNTGRVLEHFHVGNMTRRVEGLRRKVPETFVEVSKELASKYSIKNGDLV
FT                   LVKSKFGGEIKARAIVSDRVEGEEIFIPLYASDPSKGVNNLTGLVIDKASGTPGYKDTP
FT                   VVIEKIEEGKGESPLPLDNWRFHVNERRRQIGIEVEKKWKREEFKPLTG"
FT   gene            complement(591546..592022)
FT                   /locus_tag="Ssol_0642"
FT   CDS_pept        complement(591546..592022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90915"
FT                   /db_xref="GOA:D0KQ50"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ50"
FT                   /inference="similar to AA sequence:KEGG:M164_2470"
FT                   /protein_id="ACX90915.1"
FT                   /translation="MRKSNIGMITSAIIPAFTIVYQPIWLLGLIITSIASTKLFDPNFK
FT                   DSIYSPNFRKNTSIYLLVLSILEGITGFGAGPQTSGIISTLTFNLLNRGNSLELHLVLI
FT                   IPLALFFILHTVSGVGSLILSKGIKNPILFKYIIPIVWIMMYLVVVYLDLYYFL"
FT   gene            complement(592009..592638)
FT                   /locus_tag="Ssol_0643"
FT   CDS_pept        complement(592009..592638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0643"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   sin:YN1551_0288 oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90916"
FT                   /db_xref="GOA:D0KQ51"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ51"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACX90916.1"
FT                   /translation="MRLTNRRDFLKLLLISSSLLVLGRLSISEMQHAQNGLTPFGSWYV
FT                   VQYSQIVPDIMLNNYVLTVDGEIENPLKLTYQDLLNMPSIEVKDTIQCVSDPYFLRANV
FT                   LWKGIPLSYVIDMVKPKSNVIKVVGYGADGYTADLPIEKAKEPNVLIAYMADDKPLPQV
FT                   HGYPVRLVVPGWWGYTYVKWLVRLHFTSKNILGYWESLGYPDYAKK"
FT   gene            593360..593752
FT                   /locus_tag="Ssol_0644"
FT   CDS_pept        593360..593752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0644"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: sim:M1627_2538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90917"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ52"
FT                   /inference="protein motif:COG:COG3432"
FT                   /protein_id="ACX90917.1"
FT                   /translation="MTYGYNIFTVIKFSDNVYKLQLIYYSMQLERRKRGTMEIMFDILR
FT                   NCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRKIYEITEKGKLLRTHI
FT                   EEFIKIRENLYSAKEKVSELLRTDSE"
FT   gene            complement(593764..594180)
FT                   /locus_tag="Ssol_0645"
FT   CDS_pept        complement(593764..594180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90918"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ53"
FT                   /inference="similar to AA sequence:KEGG:M164_2466"
FT                   /protein_id="ACX90918.1"
FT                   /translation="MEWRKIIMTNHDIDAVIKILSDPEFFIPLVLPVTKFLLNSDSRLY
FT                   RCEGDIGKLPVVFQGREYVGSYNITHIIEFERPPNVSGKINIQAIENKIVITILLQNLY
FT                   IIYLPLRVHISNRLNQLEKTFEEKIRLERIKRKL"
FT   gene            complement(594274..595149)
FT                   /locus_tag="Ssol_0646"
FT   CDS_pept        complement(594274..595149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0646"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   sid:M164_2465 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90919"
FT                   /db_xref="GOA:D0KQ54"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ54"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACX90919.1"
FT                   /translation="MNYKPLIKVLLALVILALVDYLASVILKTLTFYFPQISTYTSDTF
FT                   TAITVIIIAIGGFYIIRILQGLIYSQLLTRLEKSTASSIKVALDIIFYTILVLVILAAL
FT                   KVNLTGVLVGGAVGGIVIGLAVQTIAQNILSGILVTSSRTIRLNDAVSLISWIWGNPII
FT                   GEISKISLLFTEVKTINGNVIKIPNSAFLGNTVFQKLESEHSLVYPYQLLVNADVPAND
FT                   LLNLAKAYINDFFSKEKIQLPEIYFTGKNGGTNAFTVILHFNDIKQLNGILNLINGAFD
FT                   KAYWELKKKG"
FT   gene            complement(595321..596949)
FT                   /locus_tag="Ssol_0647"
FT   CDS_pept        complement(595321..596949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0647"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sia:M1425_2467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90920"
FT                   /db_xref="GOA:D0KQ55"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ55"
FT                   /inference="similar to AA sequence:KEGG:M1425_2467"
FT                   /protein_id="ACX90920.1"
FT                   /translation="MHPKGLIKRDDIIYLSIFIVVFLIALRNYMISPPYTLGDTTILPS
FT                   TNPGLYTPSATIQYYLSLLIGENNLIKTLNFLAFIIAPISIYFTLGRKGDFFKRLILPL
FT                   IFTLNPISISIFYDGNGEGILLVYSLQPLVYYLTYKMLYEVKNRLKYLIYLSIVEVVGQ
FT                   IFFFQMFLFSLFFQLPFILLSIKERKYLFLVYPILADLLGFLSELSWEVYLYIGVVPSV
FT                   LVSPSNTLVRLGLAYYSTIVSALLFAIVITTAFIYRNKYALATLTSVGILLVIYAILQN
FT                   FRFDIPVISALLAAITTFQTKVYLLSFGLLDLSLFYLKRTREFIIPLLSLLLIVLLVNT
FT                   GGLQATTYSIFSFKPQPMPSWYYELYDYLSQNNPNNVYSLATQYQYLQYLPGFSGFIYD
FT                   TSFIHNLTNPFYGMKYLISTSQMNYTGLRLVKTFGPVLVYYNENFTGLVHYLNGSPVSN
FT                   YSISDMEIRIYDGNPPFVVSLPYSEYWTSAENYNGFLELTTNISQNSLTSLVHELFFVS
FT                   LFFLILPFILLILEKTPMKTLIVGR"
FT   gene            complement(597156..598913)
FT                   /locus_tag="Ssol_0648"
FT   CDS_pept        complement(597156..598913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0648"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: sin:YN1551_0294 AAA ATPase central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90921"
FT                   /db_xref="GOA:D0KQ56"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ56"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACX90921.1"
FT                   /translation="MATVTSNNSTIGLGLSSNTLQLIIEVILTILFFLVPLIFWIYFSR
FT                   RMMIGNTTKSRKPKIHIPNIRWDEVYDLKDVKMRLEEIAKIVQEGRAYGVILFGPPGTG
FT                   KTTIAKALANKLGWAYFELRPSKILSKWYGESELLLDSFFDQVEINTPAVVFIDELDSL
FT                   AMSRQSDLHEVTHRLVNIMLMRLQDLHDKNLRVIIIGATNVPQEIDEAFLRPGRFDEVI
FT                   YVALPDEKSREEIWKGYIKREDIDYSLLAKKSERFSPADIKNVADKVISKNNSLKTEDF
FT                   LREIENYKPSIQLSTIIKFENIARKYERSKLIIKTYGIPNISWNDLGDLEEVKRIIRES
FT                   IVLPITNKEFAEKLGIYPVKGILLYGPPGTGKTSIAKALANDLRFNFIELSGEEVSGAG
FT                   PLDAPKIIAEKFYIALDNAPAIIFIDEIDMIARNRMTNEWRNALTELLRQMDGLREIHN
FT                   VIVVGATNRPWDLDPAILRAGRFDKIIYVPPPDKDGREKILQVLIKDLIINRNIISKVA
FT                   ELTENYTPADLKLVVEEVKRNLLKEASISGNLRTEVKLEDFMDVLKRVKASLDRQTLIM
FT                   YEKFGFERR"
FT   gene            599277..599978
FT                   /locus_tag="Ssol_0649"
FT   CDS_pept        599277..599978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0649"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: sim:M1627_2533
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90922"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ57"
FT                   /inference="protein motif:PFAM:PF02633"
FT                   /protein_id="ACX90922.1"
FT                   /translation="MKLVEITREEIRGDLVGLVPVGSIEQHGPHLPMGTDGIISEYIAS
FT                   KAEEKLKDITLLFPTIYYGVSLEHKGFPFVSLSFQTAISFFTDLLESVFNDLGLRRIII
FT                   VNGHGGNSYFLPLVQREFNMKHSDAKVIVFNTFGEEEKILFNVNDLHAGTIETSKIWAI
FT                   GKSLVRVNKIDEIKNYEVRDGVFIYYSSREANQFGVLNDGKPIRVNEEYGKKILRDLVD
FT                   KLIWTILNFKV"
FT   gene            599975..600358
FT                   /locus_tag="Ssol_0650"
FT   CDS_pept        599975..600358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sid:M164_2461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90923"
FT                   /db_xref="InterPro:IPR012372"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ58"
FT                   /inference="similar to AA sequence:KEGG:M164_2461"
FT                   /protein_id="ACX90923.1"
FT                   /translation="MIKYVRSQDGEELLRDIVITLGLDYINLDRVKVVYSYGSKTEAIA
FT                   RIWAVPKIVLETFQLEPLYVIELISERFNRLSNDDKIKIMIHEILHIPFKFSGGLRAHG
FT                   SKVNSREVNKLYKKYIKLKERRS"
FT   gene            complement(600928..601839)
FT                   /pseudo
FT                   /locus_tag="Ssol_0651"
FT                   /product="hypothetical protein"
FT   gene            complement(601992..602840)
FT                   /pseudo
FT                   /locus_tag="Ssol_0652"
FT                   /product="hypothetical protein"
FT   gene            complement(603136..603624)
FT                   /pseudo
FT                   /locus_tag="Ssol_0653"
FT                   /product="hypothetical protein"
FT   gene            complement(604035..605699)
FT                   /locus_tag="Ssol_0654"
FT   CDS_pept        complement(604035..605699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0654"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: siy:YG5714_2607 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90924"
FT                   /db_xref="GOA:D0KQ59"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ59"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACX90924.1"
FT                   /translation="MKRKYRYSLAKGLTSTQIAVIVAVIVIVIIIGVIAGFVLTKGPST
FT                   TPVTTTVTSTFTTTTTIPTTTTSTPSNTVVFYTWWGGGDGGQALSQIIPAVKQYTGLQM
FT                   QTYSIPGAGGTNAKYAILALIQAGKPPAAFQVHYGPEMISYVEAAPNGIHTFVNMTPYL
FT                   AQWGLLNNAVYAVLQAGAYNGTLLSVPINVHRGAVLYVNTQLLREYNLPFPYNFSTLVY
FT                   DTVQLANHGVSPWIIPGGDGGWDQFNVWEDIFLYLAGPQMYNELIYGTLNFNNPMVQKI
FT                   INETNYLFLNFTSYNYPGWQSMSWEQGFALLAQGKVAFQANGNWVTNYASYINISVYPP
FT                   LPQYINNSSVSVVETPFPGTQHYYALVIDTIGIPVGPQEQQALQLAHFWSSYQGQEVWT
FT                   KYKAVTYYKNGTDWYAQPAQWYDYQQLINTSEQNFVYQLSDGGVFDDVFAQIDSGLLTL
FT                   QQVGKIGLSAWNSTLVSSMQQEQSEWLAAAKLGLGYLGFPGHPFAGYYPPWVTNPSAYG
FT                   LNTNTRQTSNSTILFLLPFLALSPAIANIDKKYYLLK"
FT   gene            605892..606752
FT                   /locus_tag="Ssol_0655"
FT   CDS_pept        605892..606752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0655"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: siy:YG5714_2606
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90925"
FT                   /db_xref="GOA:D0KQ60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ60"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX90925.1"
FT                   /translation="MMKKGTIILVVPTAVFSAILLYLVIWNAVISFMNWSLLNSKPTFV
FT                   GLETYATVVRTFQFTNSLLHSIELSVSLVIIGNILGILIAALLYFLNSNKARSIFLSIV
FT                   IYPLAISMAVNGLIWLWLFNIHIGVDWLLVRIGLPQIPWLSSTSTMFPSLILVTVWAYT
FT                   GIAALFYLAGFMNIDKTIVEAARLDGTSAFKILYKILIPNSLNSFIIATALLFLFSFRI
FT                   FDLPYVLSGGTTNIFLQTSELYMYYLFTVEYFSQATAVATIITLVATIIIIPYALTVIR
FT                   RWIRR"
FT   gene            606749..607600
FT                   /locus_tag="Ssol_0656"
FT   CDS_pept        606749..607600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0656"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sin:YN1551_0302
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90926"
FT                   /db_xref="GOA:D0KQ61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KQ61"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX90926.1"
FT                   /translation="MRPVIKASLHYLALAIISVIWLIPVYAMLINGFKSNFEVLSTPVL
FT                   VPPTKITFEAYASVLLSLAKPLINSLIIVIPTSFISAFLGAMGAYFFYTLSYSFSRASS
FT                   AISDVLFSLISLATFIPQEATLLPLTRLMVSMGFLDTYIGIIFALLIFYIPTGALLMSM
FT                   FITVIPRSLIEAAKMDGTGDLKIFMKIVFPLSMPGFISTLIFIIIQTWNNFFIPLVLVT
FT                   TPGMKPTSIAVLSYSGAYGTLYNDTFAAGMLASIIPLAIFVFLGRYFIRGLMALGGGGK
FT                   GV"
FT   gene            607604..608665
FT                   /locus_tag="Ssol_0657"
FT   CDS_pept        607604..608665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssol_0657"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: siy:YG5714_2604
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssol_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACX90927"
FT                   /db_xref="GOA:D0KQ62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040856"
FT                   /db