(data stored in SCRATCH zone)

EMBL: CP001801

ID   CP001801; SV 1; circular; genomic DNA; STD; PRO; 2582886 BP.
XX
AC   CP001801; ACJO01000000-ACJO01000018;
XX
PR   Project:PRJNA31049;
XX
DT   23-OCT-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Halothiobacillus neapolitanus c2, complete genome.
XX
KW   .
XX
OS   Halothiobacillus neapolitanus c2
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales;
OC   Halothiobacillaceae; Halothiobacillus.
XX
RN   [1]
RP   1-2582886
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Davenport K., Brettin T., Detter J.C., Han C.,
RA   Tapia R., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Kerfeld C., Cannon G., Heinhort S.;
RT   "Complete sequence of Halothiobacillus neapolitanus c2";
RL   Unpublished.
XX
RN   [2]
RP   1-2582886
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Davenport K., Brettin T., Detter J.C., Han C.,
RA   Tapia R., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Kerfeld C., Cannon G., Heinhort S.;
RT   ;
RL   Submitted (16-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 627e9b88aa4d38a778864425b84e8c51.
DR   BioSample; SAMN02598477.
DR   EnsemblGenomes-Gn; EBG00001172884.
DR   EnsemblGenomes-Gn; EBG00001172885.
DR   EnsemblGenomes-Gn; EBG00001172886.
DR   EnsemblGenomes-Gn; EBG00001172887.
DR   EnsemblGenomes-Gn; EBG00001172888.
DR   EnsemblGenomes-Gn; EBG00001172889.
DR   EnsemblGenomes-Gn; EBG00001172890.
DR   EnsemblGenomes-Gn; EBG00001172891.
DR   EnsemblGenomes-Gn; EBG00001172892.
DR   EnsemblGenomes-Gn; EBG00001172893.
DR   EnsemblGenomes-Gn; EBG00001172894.
DR   EnsemblGenomes-Gn; EBG00001172895.
DR   EnsemblGenomes-Gn; EBG00001172896.
DR   EnsemblGenomes-Gn; EBG00001172897.
DR   EnsemblGenomes-Gn; EBG00001172898.
DR   EnsemblGenomes-Gn; EBG00001172899.
DR   EnsemblGenomes-Gn; EBG00001172900.
DR   EnsemblGenomes-Gn; EBG00001172901.
DR   EnsemblGenomes-Gn; EBG00001172902.
DR   EnsemblGenomes-Gn; EBG00001172903.
DR   EnsemblGenomes-Gn; EBG00001172904.
DR   EnsemblGenomes-Gn; EBG00001172905.
DR   EnsemblGenomes-Gn; EBG00001172906.
DR   EnsemblGenomes-Gn; EBG00001172907.
DR   EnsemblGenomes-Gn; EBG00001172908.
DR   EnsemblGenomes-Gn; EBG00001172909.
DR   EnsemblGenomes-Gn; EBG00001172910.
DR   EnsemblGenomes-Gn; EBG00001172911.
DR   EnsemblGenomes-Gn; EBG00001172912.
DR   EnsemblGenomes-Gn; EBG00001172913.
DR   EnsemblGenomes-Gn; EBG00001172914.
DR   EnsemblGenomes-Gn; EBG00001172915.
DR   EnsemblGenomes-Gn; EBG00001172916.
DR   EnsemblGenomes-Gn; EBG00001172917.
DR   EnsemblGenomes-Gn; EBG00001172918.
DR   EnsemblGenomes-Gn; EBG00001172919.
DR   EnsemblGenomes-Gn; EBG00001172920.
DR   EnsemblGenomes-Gn; EBG00001172921.
DR   EnsemblGenomes-Gn; EBG00001172922.
DR   EnsemblGenomes-Gn; EBG00001172923.
DR   EnsemblGenomes-Gn; EBG00001172924.
DR   EnsemblGenomes-Gn; EBG00001172925.
DR   EnsemblGenomes-Gn; EBG00001172926.
DR   EnsemblGenomes-Gn; EBG00001172927.
DR   EnsemblGenomes-Gn; EBG00001172928.
DR   EnsemblGenomes-Gn; EBG00001172929.
DR   EnsemblGenomes-Gn; EBG00001172930.
DR   EnsemblGenomes-Gn; EBG00001172931.
DR   EnsemblGenomes-Gn; EBG00001172932.
DR   EnsemblGenomes-Gn; EBG00001172933.
DR   EnsemblGenomes-Gn; EBG00001172934.
DR   EnsemblGenomes-Gn; EBG00001172935.
DR   EnsemblGenomes-Gn; EBG00001172936.
DR   EnsemblGenomes-Gn; EBG00001172937.
DR   EnsemblGenomes-Gn; EBG00001172938.
DR   EnsemblGenomes-Gn; EBG00001172939.
DR   EnsemblGenomes-Gn; Hneap_R0001.
DR   EnsemblGenomes-Gn; Hneap_R0002.
DR   EnsemblGenomes-Gn; Hneap_R0003.
DR   EnsemblGenomes-Gn; Hneap_R0004.
DR   EnsemblGenomes-Gn; Hneap_R0005.
DR   EnsemblGenomes-Gn; Hneap_R0006.
DR   EnsemblGenomes-Gn; Hneap_R0007.
DR   EnsemblGenomes-Gn; Hneap_R0008.
DR   EnsemblGenomes-Gn; Hneap_R0009.
DR   EnsemblGenomes-Gn; Hneap_R0010.
DR   EnsemblGenomes-Gn; Hneap_R0011.
DR   EnsemblGenomes-Gn; Hneap_R0012.
DR   EnsemblGenomes-Gn; Hneap_R0013.
DR   EnsemblGenomes-Gn; Hneap_R0014.
DR   EnsemblGenomes-Gn; Hneap_R0015.
DR   EnsemblGenomes-Gn; Hneap_R0016.
DR   EnsemblGenomes-Gn; Hneap_R0017.
DR   EnsemblGenomes-Gn; Hneap_R0018.
DR   EnsemblGenomes-Gn; Hneap_R0019.
DR   EnsemblGenomes-Gn; Hneap_R0020.
DR   EnsemblGenomes-Gn; Hneap_R0021.
DR   EnsemblGenomes-Gn; Hneap_R0022.
DR   EnsemblGenomes-Gn; Hneap_R0023.
DR   EnsemblGenomes-Gn; Hneap_R0025.
DR   EnsemblGenomes-Gn; Hneap_R0026.
DR   EnsemblGenomes-Gn; Hneap_R0027.
DR   EnsemblGenomes-Gn; Hneap_R0028.
DR   EnsemblGenomes-Gn; Hneap_R0029.
DR   EnsemblGenomes-Gn; Hneap_R0030.
DR   EnsemblGenomes-Gn; Hneap_R0031.
DR   EnsemblGenomes-Gn; Hneap_R0032.
DR   EnsemblGenomes-Gn; Hneap_R0033.
DR   EnsemblGenomes-Gn; Hneap_R0034.
DR   EnsemblGenomes-Gn; Hneap_R0035.
DR   EnsemblGenomes-Gn; Hneap_R0036.
DR   EnsemblGenomes-Gn; Hneap_R0037.
DR   EnsemblGenomes-Gn; Hneap_R0038.
DR   EnsemblGenomes-Gn; Hneap_R0039.
DR   EnsemblGenomes-Gn; Hneap_R0040.
DR   EnsemblGenomes-Gn; Hneap_R0041.
DR   EnsemblGenomes-Gn; Hneap_R0042.
DR   EnsemblGenomes-Gn; Hneap_R0043.
DR   EnsemblGenomes-Gn; Hneap_R0044.
DR   EnsemblGenomes-Gn; Hneap_R0045.
DR   EnsemblGenomes-Gn; Hneap_R0046.
DR   EnsemblGenomes-Gn; Hneap_R0047.
DR   EnsemblGenomes-Gn; Hneap_R0048.
DR   EnsemblGenomes-Gn; Hneap_R0049.
DR   EnsemblGenomes-Gn; Hneap_R0050.
DR   EnsemblGenomes-Gn; Hneap_R0051.
DR   EnsemblGenomes-Gn; Hneap_R0052.
DR   EnsemblGenomes-Tr; EBT00001739787.
DR   EnsemblGenomes-Tr; EBT00001739789.
DR   EnsemblGenomes-Tr; EBT00001739791.
DR   EnsemblGenomes-Tr; EBT00001739793.
DR   EnsemblGenomes-Tr; EBT00001739796.
DR   EnsemblGenomes-Tr; EBT00001739798.
DR   EnsemblGenomes-Tr; EBT00001739799.
DR   EnsemblGenomes-Tr; EBT00001739801.
DR   EnsemblGenomes-Tr; EBT00001739803.
DR   EnsemblGenomes-Tr; EBT00001739805.
DR   EnsemblGenomes-Tr; EBT00001739808.
DR   EnsemblGenomes-Tr; EBT00001739810.
DR   EnsemblGenomes-Tr; EBT00001739811.
DR   EnsemblGenomes-Tr; EBT00001739813.
DR   EnsemblGenomes-Tr; EBT00001739815.
DR   EnsemblGenomes-Tr; EBT00001739818.
DR   EnsemblGenomes-Tr; EBT00001739820.
DR   EnsemblGenomes-Tr; EBT00001739822.
DR   EnsemblGenomes-Tr; EBT00001739824.
DR   EnsemblGenomes-Tr; EBT00001739826.
DR   EnsemblGenomes-Tr; EBT00001739827.
DR   EnsemblGenomes-Tr; EBT00001739831.
DR   EnsemblGenomes-Tr; EBT00001739833.
DR   EnsemblGenomes-Tr; EBT00001739836.
DR   EnsemblGenomes-Tr; EBT00001739838.
DR   EnsemblGenomes-Tr; EBT00001739841.
DR   EnsemblGenomes-Tr; EBT00001739844.
DR   EnsemblGenomes-Tr; EBT00001739846.
DR   EnsemblGenomes-Tr; EBT00001739847.
DR   EnsemblGenomes-Tr; EBT00001739849.
DR   EnsemblGenomes-Tr; EBT00001739852.
DR   EnsemblGenomes-Tr; EBT00001739855.
DR   EnsemblGenomes-Tr; EBT00001739857.
DR   EnsemblGenomes-Tr; EBT00001739858.
DR   EnsemblGenomes-Tr; EBT00001739860.
DR   EnsemblGenomes-Tr; EBT00001739862.
DR   EnsemblGenomes-Tr; EBT00001739864.
DR   EnsemblGenomes-Tr; EBT00001739866.
DR   EnsemblGenomes-Tr; EBT00001739869.
DR   EnsemblGenomes-Tr; EBT00001739871.
DR   EnsemblGenomes-Tr; EBT00001739874.
DR   EnsemblGenomes-Tr; EBT00001739876.
DR   EnsemblGenomes-Tr; EBT00001739877.
DR   EnsemblGenomes-Tr; EBT00001739878.
DR   EnsemblGenomes-Tr; EBT00001739880.
DR   EnsemblGenomes-Tr; EBT00001739883.
DR   EnsemblGenomes-Tr; EBT00001739885.
DR   EnsemblGenomes-Tr; EBT00001739887.
DR   EnsemblGenomes-Tr; EBT00001739888.
DR   EnsemblGenomes-Tr; EBT00001739891.
DR   EnsemblGenomes-Tr; EBT00001739892.
DR   EnsemblGenomes-Tr; EBT00001739893.
DR   EnsemblGenomes-Tr; EBT00001739894.
DR   EnsemblGenomes-Tr; EBT00001739895.
DR   EnsemblGenomes-Tr; EBT00001739896.
DR   EnsemblGenomes-Tr; EBT00001739897.
DR   EnsemblGenomes-Tr; Hneap_R0001-1.
DR   EnsemblGenomes-Tr; Hneap_R0002-1.
DR   EnsemblGenomes-Tr; Hneap_R0003-1.
DR   EnsemblGenomes-Tr; Hneap_R0004-1.
DR   EnsemblGenomes-Tr; Hneap_R0005-1.
DR   EnsemblGenomes-Tr; Hneap_R0006-1.
DR   EnsemblGenomes-Tr; Hneap_R0007-1.
DR   EnsemblGenomes-Tr; Hneap_R0008-1.
DR   EnsemblGenomes-Tr; Hneap_R0009-1.
DR   EnsemblGenomes-Tr; Hneap_R0010-1.
DR   EnsemblGenomes-Tr; Hneap_R0011-1.
DR   EnsemblGenomes-Tr; Hneap_R0012-1.
DR   EnsemblGenomes-Tr; Hneap_R0013-1.
DR   EnsemblGenomes-Tr; Hneap_R0014-1.
DR   EnsemblGenomes-Tr; Hneap_R0015-1.
DR   EnsemblGenomes-Tr; Hneap_R0016-1.
DR   EnsemblGenomes-Tr; Hneap_R0017-1.
DR   EnsemblGenomes-Tr; Hneap_R0018-1.
DR   EnsemblGenomes-Tr; Hneap_R0019-1.
DR   EnsemblGenomes-Tr; Hneap_R0020-1.
DR   EnsemblGenomes-Tr; Hneap_R0021-1.
DR   EnsemblGenomes-Tr; Hneap_R0022-1.
DR   EnsemblGenomes-Tr; Hneap_R0023-1.
DR   EnsemblGenomes-Tr; Hneap_R0025-1.
DR   EnsemblGenomes-Tr; Hneap_R0026-1.
DR   EnsemblGenomes-Tr; Hneap_R0027-1.
DR   EnsemblGenomes-Tr; Hneap_R0028-1.
DR   EnsemblGenomes-Tr; Hneap_R0029-1.
DR   EnsemblGenomes-Tr; Hneap_R0030-1.
DR   EnsemblGenomes-Tr; Hneap_R0031-1.
DR   EnsemblGenomes-Tr; Hneap_R0032-1.
DR   EnsemblGenomes-Tr; Hneap_R0033-1.
DR   EnsemblGenomes-Tr; Hneap_R0034-1.
DR   EnsemblGenomes-Tr; Hneap_R0035-1.
DR   EnsemblGenomes-Tr; Hneap_R0036-1.
DR   EnsemblGenomes-Tr; Hneap_R0037-1.
DR   EnsemblGenomes-Tr; Hneap_R0038-1.
DR   EnsemblGenomes-Tr; Hneap_R0039-1.
DR   EnsemblGenomes-Tr; Hneap_R0040-1.
DR   EnsemblGenomes-Tr; Hneap_R0041-1.
DR   EnsemblGenomes-Tr; Hneap_R0042-1.
DR   EnsemblGenomes-Tr; Hneap_R0043-1.
DR   EnsemblGenomes-Tr; Hneap_R0044-1.
DR   EnsemblGenomes-Tr; Hneap_R0045-1.
DR   EnsemblGenomes-Tr; Hneap_R0046-1.
DR   EnsemblGenomes-Tr; Hneap_R0047-1.
DR   EnsemblGenomes-Tr; Hneap_R0048-1.
DR   EnsemblGenomes-Tr; Hneap_R0049-1.
DR   EnsemblGenomes-Tr; Hneap_R0050-1.
DR   EnsemblGenomes-Tr; Hneap_R0051-1.
DR   EnsemblGenomes-Tr; Hneap_R0052-1.
DR   EuropePMC; PMC4830845; 27148201.
DR   EuropePMC; PMC5981063; 29625980.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01322; CRISPR-DR9.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001801.
DR   SILVA-SSU; CP001801.
DR   StrainInfo; 267184; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083909
CC   Source DNA and bacteria available from Sabine Heinhorst
CC   (sabine.heinhorst@usm.edu)
CC   Contacts: Sabine Heinhorst (sabine.heinhorst@usm.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Halothiobacillus neapolitanus c2, ATCC
CC                            23641
CC   Culture Collection ID :: ATCC 23641
CC   GOLD Stamp ID         :: Gi02105
CC   Isolation Site        :: Disintegrated concrete from an outfall
CC                            sewer in Melbourne, Australia
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 30 - 40C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Phenotypes            :: Carbon fixation, Sulfur oxidizer
CC   Energy Source         :: Chemolithoautotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2582886
FT                   /organism="Halothiobacillus neapolitanus c2"
FT                   /strain="c2"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia:Melbourne"
FT                   /isolation_source="disintigrated concrete from an outflow
FT                   sewer"
FT                   /db_xref="taxon:555778"
FT   gene            150..1559
FT                   /locus_tag="Hneap_0001"
FT   CDS_pept        150..1559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: tgr:Tgr7_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94867"
FT                   /db_xref="GOA:D0KVU0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU0"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACX94867.1"
FT                   /translation="MSTITSELWQQCIDRLSEDLPVQQINMWIRPLQAELKAENHLILW
FT                   APNRFVMDMVAQQYKSKILEQAQILLERPDLQLGLQVGSVPSEQPVDMPAAATLSSKSG
FT                   AVSSGVAPRVEPMADLAEPDTGAKEFVSHINKKFNFDNFVEGKSNQLARAASQQVAQNP
FT                   GVGYNPLFIYGGVGLGKTHLMQAVGNAILERSPDAKVVYLHSERYVQQMVSSIKNNTIE
FT                   EFKDFYRSVNALLIDDIQFFAGKPRSQEEFFHTFNALIEQGQQIIMTCDRYPKEIEGLE
FT                   ERLKSRFGWGLTVAVEPPDLETRVAILQSKAEQSQISLSTDVAFFIAKRVRANIRELEG
FT                   ALRRVIATAQFTGRPITVESTKEALKDQIAAQAKLITLENIQRTVAKFYNLKLTDLTGA
FT                   RRNRSIARPRQVAMSLAKELTNHSLPEIGEAFGGRDHTTVIHACKKIEELREIESKLSD
FT                   DYNLLRHTLNI"
FT   gene            1623..2735
FT                   /locus_tag="Hneap_0002"
FT   CDS_pept        1623..2735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mmw:Mmwyl1_0002 DNA polymerase III subunit
FT                   beta; TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94868"
FT                   /db_xref="GOA:D0KVU1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACX94868.1"
FT                   /translation="MQFAVDRDRFSSAINQVIGGVEKRQTMQILSNLLLEVADGRLTLV
FT                   ATDLEIQLRTSVDVQMQAPGATTVNARKLADIVKSASQDAKIALTQTDGWLEIDIGTGV
FT                   FRLASIEAGSFPQMTIDAATQSTVSITQKNLYALIDKTQFSMAQQDVRYFLNGLLLEVK
FT                   PGQMTAVATDGHRLAYAHLSDERLTENNRQVIVPRKMVSEMLKALDRDSDDEVSLAFRD
FT                   NQIELLIGENYLISKLIDGKYPDYSRVMPQSNSKILIVSKTELKQVLQRASILSNERFS
FT                   GAYFYLSPGRLMIESSNAEHESSKETMSVGYDASDLKISFNISYLLNILAVIESEEVCM
FT                   ELEAPESSVLIKPVMPGDIDSKYVLMPMKL"
FT   gene            2761..3840
FT                   /locus_tag="Hneap_0003"
FT   CDS_pept        2761..3840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: apj:APJL_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94869"
FT                   /db_xref="GOA:D0KVU2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU2"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACX94869.1"
FT                   /translation="MDLTHLTSLSITQFRNLTMTDCPLSAGFNLLVGDNGAGKTSVLEA
FT                   IYYLSTLKSFRTQTHNDLIARYPDRDRGCAVVRAGVHQDDHDFFMALERCKDQFRLRLG
FT                   REEVPRASLFVAHLPVLALHAQSDDLVLAGPEFRRKFIDRMAFYLFADFVPAYAQFARM
FT                   LKQRNAALRTGQSTEIWDPLFIQYGERLNEQRVAALDLLKTVLPQVFEALAPQLSVDMQ
FT                   FHPGHKSGLDLSEALARNRERDREMGQTLIGPQRADILFTLNDYAFKSFASRGQIKVFT
FT                   AALTLATAHIWQAQRGKRAVLLFDDFMSEFDAHHSSALLHYLSNMGHQVFISAVDRQQI
FT                   DFPFDAVFRLDAGQISAVV"
FT   gene            4029..6482
FT                   /locus_tag="Hneap_0004"
FT   CDS_pept        4029..6482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: tgr:Tgr7_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94870"
FT                   /db_xref="GOA:D0KVU3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU3"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACX94870.1"
FT                   /translation="MSDNTPNDASQNAGQSSGYDSTSIKVLKGLDAVRKRPGMYIGDTD
FT                   DGSGLHHMVFEVVDNAVDEALAGHCDTVTVTMHADGSVSVSDNGRGIPVDIHAEEGVSA
FT                   AEVIMTVLHAGGKFDQNSYKVSGGLHGVGVSVVNALSDELELDIYRGGHAYHQSYRLGV
FT                   PQAPLAEVGATEKSGTSIRFLPSPTIFTDVVFHYDILAKRLRELSFLNSGIRVFLNDEI
FT                   SGRADTFYYEGGIRAFVEHLNKGKTVIHKNVLSFSGQKDSVLVELALQWNDSYQENLFC
FT                   YTNNIPQRDGGTHLTGFRTALTRTLNDYMERAGILKKAKVSTSGEDWREGLVAVISVKV
FT                   PDPKFSSQTKEKLVSSEVKSAVESLTSERLAEFLEENPQEALLITNKIIEAARAREAAR
FT                   RAREMTRRKGALDIAGLPGKLADCQEKDPALSEIYLVEGDSAGGSAKQGRDRRTQAILP
FT                   LKGKILNVEKARFDKMLSSAEVGTLITALGCGIGREDFNPDKLRYHRIIIMTDADVDGS
FT                   HIRTLLLTFFYRQMKELVERGHIYIAQPPLYKVKKGKQEQYLKDDLALNQYLLQLAVDG
FT                   AALQVNAEAPLISGPALESMAREYLVAQAVIDRLSHRYDPAALKAVLHLPPMTAAEIVE
FT                   DSALFEAWLNRFTESMNQFADAGVNYSSRFARTEEGLAGIQITRSQHGVSHETFLPAGF
FT                   FSTADYRVLGELAIQLDGLIGEDARVLRGEKSAPITHFEQAIDWLMQEGRRGLGIQRYK
FT                   GLGEMNPDQLWETTMNPETRRLLQVRIEDAIASDEIFTILMGDLVEPRRDFIEKFALSA
FT                   VNIDI"
FT   gene            6658..7233
FT                   /locus_tag="Hneap_0005"
FT   CDS_pept        6658..7233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0005"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: pmy:Pmen_3325 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94871"
FT                   /db_xref="GOA:D0KVU4"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU4"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACX94871.1"
FT                   /translation="MGVTLSVLLFLVAVIVIWAIIMYNGLVVLKHNVSQAWSNIDVLLK
FT                   QRHDELPKLVETAKQYMKYEQETLEKVMRARSAVRGAQDRGDIDALGMAEGQLRAGLMD
FT                   FYAVAEAYPDLKANTSFQHLQQRISGLENMIADRREFYNASVNINNVRIEQFPDVLIAQ
FT                   LFRFRPFKLLTFREDELKDVDLKTLFNQ"
FT   gene            7248..8171
FT                   /locus_tag="Hneap_0006"
FT   CDS_pept        7248..8171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94872"
FT                   /db_xref="GOA:D0KVU5"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU5"
FT                   /inference="similar to AA sequence:KEGG:NE0281"
FT                   /protein_id="ACX94872.1"
FT                   /translation="MAWYAHWVGSLDDNGYHFLLVGLILLTLILLVAGIWFVRRTYWII
FT                   NTPTSNIVSAHQGYIEIEGITKNIDASPLVSPLTGTACVWYWVSVEHREQSFGESKRSD
FT                   WRRIYQHESDNLIAVEDATGECLVDPESASIRPNMRRQWYGATERPSGVTNSVGGHFFG
FT                   DYRYTEKLLLPHRNLYVLGWFKTIAHDPYVVENESVASLLRAWKHDPQMMKTFDLDGNG
FT                   SIDSKEWDQAREAGRQQIQAQQVKELERPQQTHLITANPQSRRPYIISADDQTVLAKRF
FT                   RRWGYLLWASSVLAFFFWVSAYYVRP"
FT   gene            8681..9454
FT                   /locus_tag="Hneap_0007"
FT   CDS_pept        8681..9454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0007"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: cvi:CV_0877
FT                   exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94873"
FT                   /db_xref="GOA:D0KVU6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU6"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACX94873.1"
FT                   /translation="MKIATWNVNSLNVRKPQVLSWLAQQQPAILGLQELKQVNEAIDNS
FT                   DFAAMGYQTLLNGQKTYNGVALIYQEELGEPSDVVCDIPALDDPQRRVIAATFGELRVI
FT                   NAYVVNGEAIDSEKYQYKLNWLEAFSNWLALEIAQHPNLVVMGDFNIAPSDADVFDPER
FT                   FKDAVLCSPPERDYFNRLLAMGFTDALNCFSNEENNFTWWDYRGGGYRRNHGLRIDHIL
FT                   TSPAVQAKATACHVDKEPRGWERPSDHAPVVLTLA"
FT   gene            complement(9655..12165)
FT                   /locus_tag="Hneap_0008"
FT   CDS_pept        complement(9655..12165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0008"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   tgr:Tgr7_2114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94874"
FT                   /db_xref="GOA:D0KVU7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU7"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACX94874.1"
FT                   /translation="MAIVEPPKPATHLGLPRLILLAWRGLWRELRSGALVTMFLALVIA
FT                   VSAVTAVGFFTDRVDAGMRAQAAEFLAADGRVESPDSLLKWQQKASELGLTTTQTLEFP
FT                   TVILAGEHTLLVSLKAVGAGYPLRGALTISTGAQQQKIQQEPREGHAWLAPRALALLDL
FT                   KVGDSFQIGQKKFTVSATLQREPDVGNFLAQAAPRAMINLADIPATGLVTPASRVTHYL
FT                   LLAVPSGVSTNVLQAFGKSLPADLSLERPENSQPAFKTAFDRAARFLGLAAMVAVLLAG
FT                   AALMLAAQQYNRLQQDPAALMRAFGVQSRHILYLYTLRLVFLALLAAVPGIALGGLAQF
FT                   GLSALLGSLLDFQLPPPSWLPVGFGVSIALVALLGFALPSLIRLQDTPPLRVLNRQLAA
FT                   PPTAAVLLFGAGLLAIGLLVWLQARDAWLTTYVTGGMVISFAAFIGIVWLLLQALRRYP
FT                   ARGVARFGLARLARSPWSSAMQIAALTLGLTALLLLGVVRGDLVSTWQNQIPNDAPNFF
FT                   AINIQPDQVPELTRFFQTNRIDDAGLVAMHRARWTSFNGKAVNADQLTGQAKRLAEREF
FT                   NLSVMPEHLAADNKIVAGSWQPDAQDAGWSVEQGIAKTLQWQLGDRLTFVVNGAPVTAA
FT                   ITSIRTVDWNSMRPNFFVLGSAVLLPRQSAQFITSFFLPSPNVEQQKALLRAFPTLTLF
FT                   DLNQILNEVRTLILRASQAVQYVFLFTLLAGLVVLLSAFAAGEAERIRETAVLRVLGAS
FT                   HRQIMNSLWFEFILIGLLSGLLASIAAGGLGALLALKLFDLPWALDWRIPLYGLAAGVL
FT                   LAALFVPYLGRRVLALPPARSLRG"
FT   gene            complement(12156..12857)
FT                   /locus_tag="Hneap_0009"
FT   CDS_pept        complement(12156..12857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0009"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: kko:Kkor_0791 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94875"
FT                   /db_xref="GOA:D0KVU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX94875.1"
FT                   /translation="MPEDTALILRALRVSKTVTAPGNEPLTILRDASLTVAEGEAVALM
FT                   GASGAGKSTLLALLAGLDTPTSGEVELAGFSLNNLNEDERAAVRAGRVGFVFQSFQLID
FT                   GLTALENVALPLELQGTANSTAQAKAALDEVGLSHRLHHLPKVLSGGEQQRVALARAFA
FT                   GTPAILFADEPTGSLDTATGERIIDLLFALRDQHQTALVLVTHDPALAARCNRGYRLQG
FT                   GLQGGELTPWQ"
FT   gene            13056..13742
FT                   /locus_tag="Hneap_0010"
FT   CDS_pept        13056..13742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0010"
FT                   /product="Arylesterase"
FT                   /EC_number="3.1.1.2"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ttu:TERTU_1706 GDSL-like lipase/acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94876"
FT                   /db_xref="GOA:D0KVU9"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVU9"
FT                   /inference="protein motif:PRIAM:3.1.1.2"
FT                   /protein_id="ACX94876.1"
FT                   /translation="MRLVLSLLLPALIACSASAAFGQQAPHKTPQKVISSERSHTVLVL
FT                   GDSLSAAHNLAESQGWVALMQKRLAEKNAGATHKWQIVNASISGETTSGGLSRLPELLT
FT                   VVQPGWVLLELGANDGLRGLPLALIRANLQKLIDQSKQSGARVVLLGIMLPPNYGPAYA
FT                   EPFAAMYQQLAEKNTLPLVPFLLKDVATNPKLMQQDGLHPTAEGEPIVLDNVWAVVKPL
FT                   WLPSSK"
FT   gene            complement(14129..14500)
FT                   /locus_tag="Hneap_0011"
FT   CDS_pept        complement(14129..14500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0011"
FT                   /product="protein of unknown function DUF559"
FT                   /note="PFAM: protein of unknown function DUF559; KEGG:
FT                   msu:MS1954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94877"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV0"
FT                   /inference="protein motif:PFAM:PF04480"
FT                   /protein_id="ACX94877.1"
FT                   /translation="MQPYNPALRQTARHLRSNMTDAEQVLWRHLRRKQVCGVAFYRQKP
FT                   LLTYIVDFYCPRARLVVELDGGQHFTTAHQGKDQTRDAALSSLGMKVLRFNNLEVLRQM
FT                   ESVLMLIHSEVAFRLAAET"
FT   gene            complement(14569..15519)
FT                   /locus_tag="Hneap_0012"
FT   CDS_pept        complement(14569..15519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0012"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: gem:GM21_4047
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94878"
FT                   /db_xref="GOA:D0KVV1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACX94878.1"
FT                   /translation="MNDKLAEAFVGIDVSKDTLDVHIAPSGVSLHETYDEKGIEKIIEA
FT                   LKAASSTLIVLEATGGLEVRLACELSATGLTVAIINPRQARDFAKATGRLAKTDRVDAA
FT                   MLAAFAQAIRPAARPLKDADARALEDMLNRRRQLIAMRVQELLRLNTAESKALQKSLKT
FT                   HIAWLEKQITTVDNDLNTQLRASDVWRAKDDVLKGIPGIGAVTSLTMLSKCPELGALNR
FT                   REIAALVEVAPLANGSGKHRGKRSIWGGRAEVRAVLYMAALSAMRFNPDIKAFAERLKN
FT                   KGKATKVVIVACMRKLLTIMNAMLKNMQPWVAQIA"
FT   gene            complement(16436..16546)
FT                   /locus_tag="Hneap_0013"
FT   CDS_pept        complement(16436..16546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94879"
FT                   /db_xref="GOA:D0KVV2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94879.1"
FT                   /translation="MNSDDKYSLSEILFIIVIIEILMVVGLWIYKGLQTL"
FT   gene            complement(16642..17178)
FT                   /locus_tag="Hneap_0014"
FT   CDS_pept        complement(16642..17178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0014"
FT                   /product="type IV pilin structural subunit"
FT                   /note="KEGG: pau:PA14_58730 type IV pilin structural
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94880"
FT                   /db_xref="GOA:D0KVV3"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV3"
FT                   /inference="similar to AA sequence:KEGG:PA14_58730"
FT                   /protein_id="ACX94880.1"
FT                   /translation="MLKQMNKSVNKGFTLIELMIVIAIIGILAAIAIPAYQDYTVRAKV
FT                   TELISVADAAKTGVAEAWTSDGLTGVTNFATSFNAEPATAHQSKYVSAIAIDPNTGAIT
FT                   VTSSTAAGSGLPTDAQGMTIVLQPNVQNAALVAGATGAIDWACASTSAATAGSNGLAGI
FT                   TLGTMPAKYVPSQCK"
FT   gene            17753..18331
FT                   /locus_tag="Hneap_0015"
FT   CDS_pept        17753..18331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0015"
FT                   /product="Tfp pilus assembly protein FimT-like protein"
FT                   /note="KEGG: xca:xccb100_1667 putative pilus assambly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94881"
FT                   /db_xref="GOA:D0KVV4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV4"
FT                   /inference="protein motif:COG:COG4970"
FT                   /protein_id="ACX94881.1"
FT                   /translation="MRLNPHHASPASASTHPRGSQSRYRRMRGFTIIELMITLVVAAIL
FT                   LAIAIPSFTYLTVSNKLTTSANSLVSNLAIARMAAIKRNADVGVCGDNTCSVNFPAGSA
FT                   TVIHVGISSIQPGVIDIKNVKALDYGAQGLAHTTTSTAPYNGLIADIYTGQISSNNHRC
FT                   VYLTSGSVVSTCTESNANCALGGPSGTCQ"
FT   gene            18315..18794
FT                   /locus_tag="Hneap_0016"
FT   CDS_pept        18315..18794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0016"
FT                   /product="type IV pilus modification protein PilV"
FT                   /note="TIGRFAM: type IV pilus modification protein PilV;
FT                   KEGG: xac:XAC2668 pre-pilin leader sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94882"
FT                   /db_xref="GOA:D0KVV5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV5"
FT                   /inference="protein motif:TFAM:TIGR02523"
FT                   /protein_id="ACX94882.1"
FT                   /translation="MEPVNKPVYGPSQRGVGLIEVLIAVLVLSIGFLGIAALQAKSLST
FT                   NNSAMARSMAVVASYSILDAMRADRTNALTGNYNQTVTANACTGNGSLAQTQLNTWCNE
FT                   LAQNLGAQAATTGTVDCKNTGDCTVTVTFDESRVGTNTGGTSGTGVTTITTRAML"
FT   gene            18791..19822
FT                   /locus_tag="Hneap_0017"
FT   CDS_pept        18791..19822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94883"
FT                   /db_xref="GOA:D0KVV6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV6"
FT                   /inference="similar to AA sequence:KEGG:XAC2667"
FT                   /protein_id="ACX94883.1"
FT                   /translation="MSRQTPAAALKQRGFTLIELMIALVLGLIVIGGVISVLLSNQQTY
FT                   RSNQALSQVQDGSRTAFEFLARDIRQAGLTGCGATAKIANVLNNKGTSWWDTWNNGLQG
FT                   YAANATAPIAVGTTANLRAANTDSITLMSAGDSGYSVNAPSSTSANFKLNEPNSDLQTG
FT                   DIIIVCDPNQATILQVSDYQSKSVTVVHNTGNKVSPGNCSDGLGFPTLCTTTGTKYTYQ
FT                   NNAMLAKLNASYWYIGNNSLGTCSATTPQACSLFRSTISVSGGNAAAQAQEIVRGVTNM
FT                   QLAYLQGGTSFVAAGSVTDWSAVTAVRVTLTVAVPTNPNNINNPEIVQRVFTNTIALRN
FT                   RVG"
FT   gene            20011..20643
FT                   /locus_tag="Hneap_0018"
FT   CDS_pept        20011..20643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0018"
FT                   /product="putative Tfp pilus assembly protein"
FT                   /note="KEGG: azo:azo2916 putative Tfp pilus assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94884"
FT                   /db_xref="GOA:D0KVV7"
FT                   /db_xref="InterPro:IPR025205"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV7"
FT                   /inference="similar to AA sequence:KEGG:azo2916"
FT                   /protein_id="ACX94884.1"
FT                   /translation="MSAVALRKGEASTVALRKGRGERGGFMKTGLDRQRGVALVVALVL
FT                   LVVVTLVGLAAIRGTTMQQQMTSNFYDREIGFQAAEAGLRTGESWLIANPNNTTLIRDC
FT                   SDPNNQCFANPFETGAATAGIIQAVPTATFDAGALGAGQPQYVVEKMGICNSGGGGNFA
FT                   FTNDQNNQGGGNSLVSSGMCYRVTAESNANAAANDRSNVILQSILRL"
FT   gene            20656..24519
FT                   /locus_tag="Hneap_0019"
FT   CDS_pept        20656..24519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0019"
FT                   /product="putative type 4 fimbrial biogenesis protein
FT                   PilY1"
FT                   /note="KEGG: net:Neut_1833 putative type 4 fimbrial
FT                   biogenesis protein PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94885"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV8"
FT                   /inference="similar to AA sequence:KEGG:Neut_1833"
FT                   /protein_id="ACX94885.1"
FT                   /translation="MNQSNKNTQIKRSKRHMRYARGNTMNFLHTTMQQVGRVAVRFFAF
FT                   ALLTAMPMITAQAAVDIDQSPLILQKPLPPNIVLMLDDSGSMTWDYMPDFGYLKNNSNN
FT                   DALINSANNSVYYDPTITYLPPLKADNTSYTNQTDFTNTPVDGFGTTSNDMIDLTNYNG
FT                   YDDTGNINYSKSVLTNSSYTKTGISRIDCYILYYNDQTAYDYSYSRARKSRPSSCTIYT
FT                   QVSSGYFQYSTGPAAGPYTVHYVANTSCGTQSNCVVASDKSGVSAPIGVAAGNNIANWF
FT                   AYYHTRILTTKTGLTLAFSGLDKTYRFGFASINGRNTADIPSPQYSFSTSNNSDNKLAE
FT                   VQPFGDGSSGTQKAKFWTWITNISPNDGTPLRGALQAVGEYYKTQQPWETSSSDTSEYA
FT                   CRPSYTILTTDGFWNGDTPSGIGNADGQNGPKITTPSTYQYLKTAPYQDGYSDTLADVA
FT                   MKYWETDLRTSVANEVPTTPSDPAFWQHMTTFTIGLGWDPTNLIRSTSGDANLTVPQIL
FT                   AWARSGNPPAGSSLTNSSNIWPKPTSNSINNIADLAHAAVNGHGEFYSVKSPDDLVNGL
FT                   QSALKKIGESPGAGNAVTLSDTALPTDSTAADALYRFRGTFYTGQWSGTLTAENYTTTT
FT                   TPPSYESFWSTKDLTPSFSTVGTGSSAERLSNRNVWTSTLGNGNKTSSVAFRVATDLSA
FT                   TQQTDLAATIGNSSVTAQTMVNYLLGDSTYAQGNPGGTLRNRDSFLGDIVSSTPVLIAA
FT                   PQADLYAGTTFTGADTYSTFVNKEATRAPIVYVAANDGMLHAFRVTAGAGYERDGSTVS
FT                   PVADQAKGTEVYAYMPSAVLTQTGDASITNLANPKYGDVDPVNGTQAVPHQYYNDGRIT
FT                   TQNVYFDKAWHTVLVGTTGRGPAKAIYALDITDPSVLMNPATADQALLWERSAGDGKTG
FT                   SSYIGEMVGTPVIAQVDQGGQPSWAVFVGNGYNSAEGKPALLQFDLQTGDLSVHTTTGS
FT                   VAADGGLAEPGLMQGDKTTGISTYAFAGDLQGHLWKFNLDSASSTGSVAFNAVDDKGNA
FT                   QPITSLVTLAYDGVTNSTFALFGTGKYLASADTKDDQVQTWYGVRVGMGADLAGVASAT
FT                   TPVADSSTARSDLTERFAFDFASGDRATSAQTSDTDMNNKAGWFMDLPQTGERIVNRIQ
FT                   LISGKAVATTLIPKVNDPCNTVPAGAVMGVDPFTGANQLVSTGNGYNLGTKIITVDGKP
FT                   QQVAINGKVFDAGPAAGVTAVRNADGTISITFNTLGGGLQSLGPLNLGGNQASRLSWRE
FT                   LTN"
FT   gene            24658..25152
FT                   /locus_tag="Hneap_0020"
FT   CDS_pept        24658..25152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0020"
FT                   /product="PilE protein"
FT                   /note="KEGG: xac:XAC2664 PilE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94886"
FT                   /db_xref="GOA:D0KVV9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVV9"
FT                   /inference="similar to AA sequence:KEGG:XAC2664"
FT                   /protein_id="ACX94886.1"
FT                   /translation="MKQIAHKAAARQQLGFTLIELMIVIAIIAIIAAIAYPSYIKSVVK
FT                   TKRAAAEGCLSEYANYMERFYTTNLRYDKDSAGTANPVVGSPVPAANQLDCSTAQNSGA
FT                   DYAFTVVATAPNAAANPNTYTVTATPTGAQLSRDTQCGTLSINQVGTRTESGSGTVADC
FT                   W"
FT   gene            25490..26074
FT                   /locus_tag="Hneap_0021"
FT   CDS_pept        25490..26074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0021"
FT                   /product="putative type-4 fimbrial pilin related signal
FT                   peptide protein"
FT                   /note="KEGG: noc:Noc_2270 putative type-4 fimbrial pilin
FT                   related signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94887"
FT                   /db_xref="GOA:D0KVW0"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW0"
FT                   /inference="similar to AA sequence:KEGG:Noc_2270"
FT                   /protein_id="ACX94887.1"
FT                   /translation="MPNHFTEPGFTPPDSALGFTAIELMMTLIIAMILLAIAIPSFSRM
FT                   KAQNHLATTANDFVSAFGAARQTAIVKGRPVTLCAGDQSGCFDTVDWSNGWLAFVDADK
FT                   SGTLNAGEPVVFTGVARRGDVVVQGNTPVEKPIIFSPLGFASQPGGAFTAGTLRVCVPA
FT                   DIANNARDLVLAKSGRLRVEAKDLSGACPAP"
FT   gene            26258..26629
FT                   /locus_tag="Hneap_0022"
FT   CDS_pept        26258..26629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0022"
FT                   /product="protein of unknown function DUF559"
FT                   /note="PFAM: protein of unknown function DUF559; KEGG:
FT                   msu:MS1954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94888"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW1"
FT                   /inference="protein motif:PFAM:PF04480"
FT                   /protein_id="ACX94888.1"
FT                   /translation="MQPYNPALRQTARYLRSNMTDAEQILWRHLRRKQVCGVTFYRQKP
FT                   LLTFILDFYCPRARLVVELDGGQHFTTAHQGKDQARDAALSSLGMKVLRFNNLDVLQQM
FT                   ESVLMLIYSEVTFRLSAET"
FT   gene            26749..26856
FT                   /locus_tag="Hneap_0023"
FT   CDS_pept        26749..26856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94889"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94889.1"
FT                   /translation="MQKGGAAFPKKRGGVLGVVPLLEGRAGFLALRLPL"
FT   gene            complement(26886..29708)
FT                   /locus_tag="Hneap_0024"
FT   CDS_pept        complement(26886..29708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0024"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: tgr:Tgr7_2295 excinuclease ABC,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94890"
FT                   /db_xref="GOA:D0KVW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW3"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACX94890.1"
FT                   /translation="MADPFIRIRGARTHNLKNIDVDLPRDALIVITGLSGSGKSSLAFD
FT                   TLFAEGQRRYVESLSAYARQFLSMMDKPDVDHIEGLSPAISIEQKTTSHNPRSTVGTVT
FT                   EIYDYLRLLYARAGIPRCPEHGVDLTAQTVSQMVDQVLALPEDSRWLLLAPVIENRKGE
FT                   HHKLFDEWRSQGFLRVRINGTVYEIDEIPALDPKGKNTIEVVVDRIKIRPDIGLRLAES
FT                   FETALRMADGRTFVVNMDDDSAHTFSAKHACPICGYALAELEPRLFSFNNPVGACPSCD
FT                   GLGVKQFFDPQKVIVNAELSLAAGAIRGWDRRNVYYYQLLLGLSKHYGFDLDTAWQDLP
FT                   ESIQNAILQGSGREKITFTYLSPKGKASTKDHPWEGVLPNMDRRYRETDSQAVREELAK
FT                   YISESACPSCGGTRLNLAARNVFIENENLPAITHRSISEALAFFQTLDLPGARGEIAGR
FT                   IVREISARLGFLNDVGLTYLSLDRSAETLSGGEAQRIRLASQIGSGLVGVTYILDEPSI
FT                   GLHQRDNDRLLGTLNHLRELGNTVIVVEHDEDAIRAADFVLDIGPGAGVHGGHIVAQGT
FT                   PEQIAANADSLTGAYLSGKKKITVPKRVTPDAERWLKLYGARGNNLVGDTLEIPMGLLT
FT                   CITGVSGSGKSTLINDTLYLIAARDLNGASTRPSAYERIEHLNQLDKVIDINQSPIGRT
FT                   PRSNPATYTGLFTPIRELFAGTQEARSRGYTPGRFSFNVKGGRCEACQGDGVIKVEMHF
FT                   LPDVYVACDVCHGKRYNRETLDIRYKGKTISDVLAMTVEDAAPFFDAVPALHRKLNTLL
FT                   DVGLGYLTLGQNATTLSGGEAQRVKLAKELSKRDTGNTLYILDEPTTGLHFADVEQLLA
FT                   VLYRLRDQGNTVVVIEHNLDVIKTADWIADLGPEGGSGGGQIIASGTPETVAKIAGSHT
FT                   GRYLARLLDH"
FT   gene            29824..30381
FT                   /locus_tag="Hneap_0025"
FT   CDS_pept        29824..30381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0025"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: asa:ASA_3997 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94891"
FT                   /db_xref="GOA:D0KVW4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW4"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACX94891.1"
FT                   /translation="MATRGINKVIVLGNLGKDPEVRYMPSGGQVTNITVATSETWKDKD
FT                   SGEQKENTEWHRIVFFGKLAEIAGQYLKKGGQVYVEGRLQTRKWQGQDGQDRYTTEIVA
FT                   NEMQMLGGRGGSGGSGGGQQESGDYEDDGYSNTPPARGAGRAAAAPARPSSGNRDSYGA
FT                   PPPPPRSPAKSEPNFVDDDIPF"
FT   gene            complement(30592..32391)
FT                   /locus_tag="Hneap_0026"
FT   CDS_pept        complement(30592..32391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0026"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: mrd:Mrad2831_1522 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94892"
FT                   /db_xref="GOA:D0KVW5"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW5"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ACX94892.1"
FT                   /translation="MPSKNTHKIISSFMALALLMSTAMAQGATPQTTTADAATITQQAL
FT                   DATAPATTRAELAAAKPVLAKQAMVVTAQHLATQVGVDILKQGGNAVDAAVAVGYALAV
FT                   VHPCCGNIGGGGFMVLHLAEGKTLFLDFREKAPLKATPTLFQDAEGNVVKGRSTHSYLG
FT                   VGVPGTVMGLNTALATYGSMSRKQVMAPAIKLARDGFVLTAGDVNILHTRREDFAKYPN
FT                   VSNTFLNHGKPYEVGDRLVQPQLAHTLALISKEGSHAFYRGHIAQAVVKASKENGGLLS
FT                   LQDFADYTVNWAQPIACGYHGYTIMSAPPPSSGGTTICQILQLIQPYPIKKWGYGSVKA
FT                   IHYLVEAERRAFADRNTYLGDPAFVKNPITDLLSPKHIAQMRASIEPDKATPSSEIKGS
FT                   LGADEGQQTTHYSIVDAKGNAVSITYTINYLFGLGQIAGDTGFFLNNEMDDFTAKPGVP
FT                   NSFGLVQGRVNQIEPGKRPLSSMSPTIVLKDGKLFMVTGSPGGSTIISTTLESILNVVD
FT                   FGMNMQQAVDAPRVHHQWYPDLVFIEPGLLTPKTQTTLKDMGYRFKEVTSWGADEAILL
FT                   NPKTGLLEGANDRRRPAGLAAGY"
FT   gene            complement(32408..33346)
FT                   /locus_tag="Hneap_0027"
FT   CDS_pept        complement(32408..33346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0027"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   hdu:HD1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94893"
FT                   /db_xref="GOA:D0KVW6"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW6"
FT                   /inference="protein motif:PFAM:PF04378"
FT                   /protein_id="ACX94893.1"
FT                   /translation="MMNIIVNRYACLNLCLVETMNYQHHFHAGNHADVLKHLVLLQLIE
FT                   LMQQKPTGFLLLETHAGAGLYDLQATEARRSDEASGGIARLLQATQAADTVPVLIQTYL
FT                   KQIEQFGSVPNLGYYPGSPLLAVCALRPQDRYIGVELVPKVARELSRNLAQRPMLEPCI
FT                   PDRRVIARDGEGLAALKADLPPLERRGLFLIDPPYEQPQERDDIAAALQAGLQRFETGV
FT                   YALWYPIKQRPYLDRWLNRIAKSTPRPVLTIENSIFPDESGNRLTGSGLLIINPPWQFD
FT                   TLMQPVLDFVNDALKQDTAAPRAIRWLNPAQ"
FT   gene            33737..34285
FT                   /locus_tag="Hneap_0028"
FT   CDS_pept        33737..34285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0028"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: hha:Hhal_1389
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94894"
FT                   /db_xref="GOA:D0KVW7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW7"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACX94894.1"
FT                   /translation="MDLESHASVCVGIISDTHGAIENSILELMQQCDVIVHAGDILNPD
FT                   ILRRVTPKTGHVIAVRGNNDTVEQWPAGTADLLESLPEVATLRLPGGVLAVEHGHRVNP
FT                   AHQRHEKLRARHPEARAVVYGHTHHRTIDTSAPIWVLNPGAAGKVRAYGGSGCLLLHAS
FT                   AERWWIEEKTLPNLRAGSA"
FT   gene            34356..35618
FT                   /locus_tag="Hneap_0029"
FT   CDS_pept        34356..35618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0029"
FT                   /product="Ketohexokinase"
FT                   /EC_number="2.7.1.3"
FT                   /note="PFAM: PfkB domain protein; Rieske [2Fe-2S]
FT                   iron-sulphur domain; KEGG: tcx:Tcr_1488 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94895"
FT                   /db_xref="GOA:D0KVW8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW8"
FT                   /inference="protein motif:PRIAM:2.7.1.3"
FT                   /protein_id="ACX94895.1"
FT                   /translation="MAKILGIGIATLDIINEVEGYPVEDSEQRALAQRQRTGGNVTNTL
FT                   TVLRQFDHDCALAALLTPDADGRQIQEKLAQRGIDLSSAQILGFGHAPTSYITLNRQNG
FT                   SRTIVHYRDLPEFDLNAFLKIDLAPFDWLHFEGRHCMDTAAMLAMARRAAGTKLLSLEV
FT                   EKERPYLDQLFSFPDVVFFSRAFAEQRGFNDPEAFLNAAHQWAPQAVLVLGWGATGAYL
FT                   KESLNDSVQLVPAQPIRGVVDSIGAGDTLIAGVIHARANQANADWRAAVTFGVRLAERK
FT                   IQQFGFDGLAVDPNANNQPLCHLDDLGPEDAMGVQPVDGIPSVIVVRDHRAIRAYRNVC
FT                   PHNGSALSKGVRGYLADKSTGPSDGMSLRCRLHNAYFEPLTGACTGGPCPGTHLTPVAI
FT                   RQVGEMIYLDDLDENSRPTGK"
FT   gene            35755..38121
FT                   /locus_tag="Hneap_0030"
FT   CDS_pept        35755..38121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0030"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: glo:Glov_3328 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94896"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVW9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX94896.1"
FT                   /translation="MNEDRVGLTSLPQRPCDYAEAWLWVDVNGQGALTATQAITSLDAI
FT                   APIDQILETLPQSDAWHQHMGQIGPMENIRDWIWQARWLSADRLDGSHSPLDDANLTNI
FT                   GGRRLLHVSLYPRLPDDAIGWLDSLPDCVIGRDANQAVVYRNRAAQTFNNPSLLDQLSR
FT                   GVPAQCAEGVIEDQVSVDDHGRLRHFQRLLIAAPSPASSVKDFLELYELTTPKSLGKAE
FT                   GDYGQLIELLVEATHDLIVIKDPEGRWLFANLSIVHSLGLAHVVWLGKTDRELVDLASP
FT                   TVRGALQFCHETDKAAWNQGQQIRHLETIPCEDGHSLIVDVIKQPVFDDKGKPRAIIVV
FT                   GRDVTELHTTQEQFQILASQDELTGLLNRRFFQVEAQRWIDMLSDDGSKHLALLVFDLD
FT                   YFRSINDSYGHERGDQLLQEMARRLQNECVASPLLIARMGGDEFAILVETDNKPESLSA
FT                   LGEQVKSLTARPFQIEHLTLFTSASTGIVIWPEHGRSIGELLHQADSAMYAAKEQGRNG
FT                   HAVFSPEIMEHQNRQSALLTALRQSQGDERFFLVYQVQQNASSLAITGVEALLRWQAPS
FT                   PELAAGPDQFIPLLEKSGLIIDVGGWVLDEACQQIARWREYIGERITVAVNVSSIQLHS
FT                   PCFIGRVQAALKKSGINPSLLELELTETALVNDPAKAASTLIELKKLGVQLALDDFGTG
FT                   YSSLSYLTQFEFNRLKIDQSFVRDILVDPKDLVIVKAIVAMGHALGLEVVAEGVETVAE
FT                   RDLLDSLGCDSFQGYLVGRPGKPEEISPMLGVGLL"
FT   gene            38154..38462
FT                   /locus_tag="Hneap_0031"
FT   CDS_pept        38154..38462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0031"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: tau:Tola_0801 BolA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94897"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX0"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ACX94897.1"
FT                   /translation="MSRSERIKKLIEDQMAPVYLEIDNESHLHAGNREETHFRLVIVSA
FT                   LFEGEALLARHRRVQTLLQAEREGGMHALSLHTFTPAEWQAKGASAAPSPACAGQNH"
FT   gene            38491..39528
FT                   /locus_tag="Hneap_0032"
FT   CDS_pept        38491..39528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0032"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   tgr:Tgr7_2585 putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94898"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX1"
FT                   /inference="protein motif:PFAM:PF08668"
FT                   /protein_id="ACX94898.1"
FT                   /translation="MWQWIRQLWATKPTAPPAHLPRLRENGLAAGKPEPISDIIIPDAE
FT                   QASLVFFQKLLNAPEHPRGYTDALRPDETAWLSARIEDLKRTPTQLTHLVPRLPSVLPK
FT                   LMTALNNPDTPIRTLTGLIESDPVISSMVLRLINSPAMRVRRENIESLEQAVMLLGFSG
FT                   MREVVSAAMFSPIGQLGRIEGANPLLVHDVWPISLRAANALRLGLKTRSDHQRPLLSSD
FT                   EAFDLYLSVLIEHTGLIALLRQKPLTGANTSAAYVARFRALIPAYSARIAEAWALSENT
FT                   IRLIRSAPAELEHLRSQARYFSVACALNRRGTLDQAQFLHLCRQLPDYARGWYDLCVTA
FT                   NVSAD"
FT   gene            complement(39572..41770)
FT                   /locus_tag="Hneap_0033"
FT   CDS_pept        complement(39572..41770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0033"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: tgr:Tgr7_3185 GTP diphosphokinase; TIGRFAM:
FT                   RelA/SpoT family protein; PFAM: RelA/SpoT domain protein;
FT                   TGS domain protein; amino acid-binding ACT domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94899"
FT                   /db_xref="GOA:D0KVX2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX2"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ACX94899.1"
FT                   /translation="MPEASVPQPQPEKLVLVAEAAEAEIYFAPLAMTLATYIDPEGIAH
FT                   VRDAFIFGANSHVGQARQSGEPYISHPVAVAEILAGLHMDEATLTAAILHDVIEDTAVA
FT                   REEIVARFGEEVARLVDGVSKLTQIRFKSKAEAQAANFRKMMMAMVEDVRVILIKLADR
FT                   LHNMRTLGVMRPDKRRRIARETLDIYTPIASRLGLNSLRHELEDMGFSALYPTRYRVIS
FT                   EAVRKARGNRKEIVAGIEERFIHRFGEEGLRVQIDAREKRPYSIYRKMMQKHLTFKEVF
FT                   DVFAVRIVANSVDDCYRALGIVHNLYKPLPGRFKDYIAIPKANGYQSLHTILFGPHGIP
FT                   LEVQIRTNEMHQFAESGIAAHWLYKSSHDQGTVTQARAREWLRDLLEIQQKAGNPQEFL
FT                   ESVKVDLFPDEVYVFTPMGEIIELPRRATVVDFAYAIHTDVGNHCVACKIDRRFAPLST
FT                   PLENGQTIEIITAEGAEPNPNWLSFVVTARARANIRNYLKNLQDSEAIKLGHRLLAKSL
FT                   NAESIDFNDIKTDRLKRLLAEYHHDGLSDLLREIGLGNRMAPLVARLLMADENTDEGAE
FT                   SHGAMTSLNATQTPIISGTEGLVVDFAKCCHPIPGDAVVGFLSTGRGIVVHRHDCGNAA
FT                   DVGVHPERWLAVNWADPALGDYQALIVIHAKNVRGGLARIASAAAETGADIDDVRFDDR
FT                   DVNLTIITVTLRVADRVHLARVMRRIKQVPDVVKVLRP"
FT   gene            complement(41772..42095)
FT                   /locus_tag="Hneap_0034"
FT   CDS_pept        complement(41772..42095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0034"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: tgr:Tgr7_3186 RNA
FT                   polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94900"
FT                   /db_xref="GOA:D0KVX3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX3"
FT                   /inference="protein motif:TFAM:TIGR00690"
FT                   /protein_id="ACX94900.1"
FT                   /translation="MARVTVEDCLVKIPNRFELVLMAARRARQIEQGAEPLVPMGKEKP
FT                   VVIALREIGEGKIDQARIDEIQEHMVVLRSQISEAEIRAELAQFADEDEGSVRRPATTS
FT                   DEG"
FT   gene            complement(42146..42775)
FT                   /locus_tag="Hneap_0035"
FT   CDS_pept        complement(42146..42775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0035"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: tgr:Tgr7_3187 guanylate kinase; TIGRFAM:
FT                   guanylate kinase; PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94901"
FT                   /db_xref="GOA:D0KVX4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX4"
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /protein_id="ACX94901.1"
FT                   /translation="MSQGQLFVISAPSGAGKTSLIKALREQMPDLGLSISHTTRPMRPG
FT                   EVDGQHYHFVSKPTFESMIAEGAFVEHALVFGNHYGTSKAAVSAVLDKGQDLILEIDWQ
FT                   GAEQVRPLFSGAQSIFILPPSREALRERLFGRGQDDADVIARRLAEAEREMQAYPNYDF
FT                   LIINDDFSQALNQLRCLFESARLRTPRQAEKERVRLENLLNTPKKT"
FT   gene            complement(42782..43396)
FT                   /locus_tag="Hneap_0036"
FT   CDS_pept        complement(42782..43396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_1541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94902"
FT                   /db_xref="GOA:D0KVX5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX5"
FT                   /inference="similar to AA sequence:KEGG:Psyr_1541"
FT                   /protein_id="ACX94902.1"
FT                   /translation="MFGIDIAALLAQYGLLVLAIGCLLEGETVLVLAGLAAHQGMLPLP
FT                   QVFVIAVVFGWLGDQIFFWLGRWKGDAILLRFPSWAKQKPRLDRWIHKYHAPVVVMVRF
FT                   MYGLRAAGPVLIGHSGLCPWKFAFYNAIGALIWATIFIALGWVFGQAAERILEQINHWG
FT                   HYVFYVGAVVILVIGFVFWIVNRRRAARAVERAALSEQERD"
FT   gene            complement(43484..43954)
FT                   /locus_tag="Hneap_0037"
FT   CDS_pept        complement(43484..43954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0037"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: dat:HRM2_44910
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94903"
FT                   /db_xref="GOA:D0KVX6"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX6"
FT                   /inference="protein motif:PFAM:PF05433"
FT                   /protein_id="ACX94903.1"
FT                   /translation="MRAQSIIKWSVPIIMLAALTGCVTPMSGDVYSRNNAMQMQSVQYG
FT                   TIESLRGVRIAGTQTPIGAIGGAVVGGLLGSGVGGGLGRDLATVGGAIGGGVAGSAIEE
FT                   GVTQQNGVEIVVRLDNGRTVSIVQSVGGQIFSLGQRVQVITAPNGTSRVTAG"
FT   gene            44187..44936
FT                   /locus_tag="Hneap_0038"
FT   CDS_pept        44187..44936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0038"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   swd:Swoo_1180 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94904"
FT                   /db_xref="GOA:D0KVX7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX7"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACX94904.1"
FT                   /translation="MIELLLAPETWIAFATLTALEIVLGIDNIIVIAILVSKLPEHQRA
FT                   AGRLFGLALAMVTRIGLLFSLVWLMGLTEPFLHIGELAFSGRDLILLVGGLFLVYKAVT
FT                   EMHDTMETGGHIETNSTGAMLKKVSIWAVVTQIALIDIVFSLDSVITAIGLVKHIEIMV
FT                   AAIIVAVLVMMIAAKPISEFVERHPTIKMLALAFLILVGVFLIAESFGQHVPKGYIYTA
FT                   MAFSLVVESLNIRMRKKREQLTSKVLE"
FT   gene            complement(44946..45716)
FT                   /locus_tag="Hneap_0039"
FT   CDS_pept        complement(44946..45716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0039"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: tgr:Tgr7_0109 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III Xth; exodeoxyribonuclease
FT                   III; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94905"
FT                   /db_xref="GOA:D0KVX8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX8"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACX94905.1"
FT                   /translation="MRVISFNANGIRSAARKGFFDWLSEQNADFVCIQETKAQADQLTD
FT                   PEFCPAGYTCQYVSAEKKGYSGVAIYARRSPDAIITQLGLPEFDAEGRYCAFEYPDLMV
FT                   ASLYLPSGSAGDHRQESKDRFLAAYLPILESYLQKQHKPLILCGDWNIAHKEIDLKNWK
FT                   SNQKNSGFLPHERAWLDELFDRLGFVDAHRLVAPGEAVYTWWSNRANAWENNVGWRIDY
FT                   QIITPDLADRVERATVYRDMKFSDHAPLIIDYRS"
FT   gene            complement(46091..47545)
FT                   /locus_tag="Hneap_0040"
FT   CDS_pept        complement(46091..47545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0040"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.108"
FT                   /note="KEGG: csa:Csal_1628 peptidase S1C, Do; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94906"
FT                   /db_xref="GOA:D0KVX9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVX9"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ACX94906.1"
FT                   /translation="MRTQILVEAIRAGLPRRGRLLMAAALIATPLMAMTPAISFADNGV
FT                   PDYVQLVKQASPWVVNISSVSNPKTQEAFNNGEMPTFPPGPAGDMFRHFFQEQMPQMKR
FT                   EPIRSLGSGFIISADGYILTNAHVVNGADKITVRLPDQQTYKAKVIGKDKRTDIALLKI
FT                   DAKNLPVAPIGNSDNIQVGEWVLAIGEPFGLDHTATHGIVSALGRDLPDESYVPFIQTD
FT                   APVNPGNSGGPLINANGKVIGINSQIYTKSGGFMGISFAIPINVAMNVVDQIKSTGHVT
FT                   RGYLGVLIQPVTYDLAQSFGLDTTKGALVAKVEPNTPAAKAGLKSGDIILKFNGSEIKH
FT                   SGELPIMVGMSPIGKPATLTLMRDGKQMELNVTIEKLDKKALEAESGTSEAIEKMGLQV
FT                   TELSPDELQQLNIKYGIKVKSVKNDSQFASVIAPGDILLEVNRMPMKSATDLKKALDSA
FT                   PKDRPIAIRLLRDGQPLFMAVQLGTQ"
FT   gene            47739..48017
FT                   /locus_tag="Hneap_0041"
FT   CDS_pept        47739..48017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94907"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94907.1"
FT                   /translation="MSRKARRETGLRQLRVNGYSIRERRNTAGLRQLRVKSPSKARPMR
FT                   VDAQKTQHFVIGLGIVAQLRPSASASFCGFWISNSAHEGFNQRFLRS"
FT   gene            48154..50388
FT                   /locus_tag="Hneap_0042"
FT   CDS_pept        48154..50388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0042"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: mxa:MXAN_1389 putative alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94908"
FT                   /db_xref="GOA:D0KVY1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY1"
FT                   /inference="protein motif:PRIAM:3.1.3.1"
FT                   /protein_id="ACX94908.1"
FT                   /translation="MNATSPSLALAHSNSRRQFLKLIVLTASAGALAACGGGDGGAENI
FT                   STDTRYFPQSVASGDPAANSVILWTRLGTLGPQTDGQLRVQVSTQEDFSNLIVDESAVP
FT                   VAAAHDHCLRLKVAGLKPGTTYYYRFLFSTGNQAWASSRTGRTKTAPDATANVPVSYAV
FT                   TSCQDYIGRYYNVWAYLLQTEPDLDFILQIGDYIYETTGDPSFQTVGSARSITFTDTAG
FT                   AIQLGDATAPYYAASSVSNYRDLYKAYRSDPILQQVHERYPMIGIWDDHEYSDDCWGAT
FT                   ATYFNGREDEYNPPRRDRAEQVYYEFMPLDDPAIASGALNKDPATLWPNNVLYRRLRFG
FT                   QNLEAVLLDYRSYRPDHLIPEGGFPGKVVMSEPVLVSILGQTAYDAVKANFGPYVDTTT
FT                   APWNSYLTALIPVLAQGYLQAGFTGDAQTKATDDLTGLVSAFVFNQLIGQFNAAVAAGQ
FT                   IPGASALPAIDSTTYDALPRGIAFLHIGKQSFFSELGARYAVVQPTFDLYAQYMQATGQ
FT                   YEQDPLGATQRQFLANALASDATFINVISTVSTAPLRWDLRSATNLPADYQTVFKPNVD
FT                   QWDGFPQGKQAFLETLANRPGAFLASGDIHASFVTQHQTSSMAMPVADFTGPAISSGTF
FT                   NNFVESAISGLPGLDSAQKAAANQALVLGLDQTLQASAPADEPIVFADTTHHGIMVFRV
FT                   DGSQTQVDYLLIDQSAVSQNLTGDSSALIKAFSRQRFTLDPQTGKVTSAS"
FT   gene            complement(50405..51196)
FT                   /locus_tag="Hneap_0043"
FT   CDS_pept        complement(50405..51196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0043"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   pla:Plav_1666 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94909"
FT                   /db_xref="GOA:D0KVY2"
FT                   /db_xref="InterPro:IPR006355"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY2"
FT                   /inference="protein motif:TFAM:TIGR01458"
FT                   /protein_id="ACX94909.1"
FT                   /translation="MQTTTQAVIFDIGGVLLDGNTPMPGAVDALARLREASIPFLLLTN
FT                   TTRRSHADLLAALHEAGLDVSAQQLLTPARAAAAWLQSYQTHGVLLIHPGLLPDFAGVD
FT                   TTLIGAKSEATGPRAVIVGDAGEGFTYTTLNAAFRELMAGATLISLSDSRYFREADSLS
FT                   LDAGPFVRLLENAAGVTSNAMGKPGASFFQQAIAALGFSAENITLIGDDVHSDIQGADA
FT                   VGLQTILVQTGKYQDGDEDLAPENTLIAKDVLASVYLLNQR"
FT   gene            complement(51408..52196)
FT                   /locus_tag="Hneap_0044"
FT   CDS_pept        complement(51408..52196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0044"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   aeh:Mlg_1211 molybdopterin binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94910"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY3"
FT                   /inference="protein motif:PFAM:PF00994"
FT                   /protein_id="ACX94910.1"
FT                   /translation="MSVASGKPIAIGVLIIGDEILSGRRKDTHLAAVIERLAPRGRQPD
FT                   WAQMIGDDADHIERTLRESQQAGSIVFCFGGIGATPDDLTRASAARAFERPLTRHPEAE
FT                   RRIIAQFGEAAFPHRVHMADFPEQVDLIPNPINNVAGFYLENHFFMPGFPQMAHPMLDW
FT                   ILANPLASLGTLDYREQSIWTIGASENDLLPTMTGLCAEFPDLKFFSLPIGQGERRLIE
FT                   LGFKGASARVAQAIKALQNQLDALDVTHQSERPPTEPTQT"
FT   gene            complement(52193..53305)
FT                   /locus_tag="Hneap_0045"
FT   CDS_pept        complement(52193..53305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0045"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="KEGG: tcx:Tcr_1864 ferrochelatase; TIGRFAM:
FT                   ferrochelatase; PFAM: ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94911"
FT                   /db_xref="GOA:D0KVY4"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY4"
FT                   /inference="protein motif:TFAM:TIGR00109"
FT                   /protein_id="ACX94911.1"
FT                   /translation="MTYQGEPHYAHGSAERMGVLLLNLGTPDEPTTPALRRYLKQFLSD
FT                   PRVIELPKLLWWPILNLIILNTRPKKSAAAYREVWDHYEDGSPLLTISRQQQRGLQERL
FT                   SQQMAGPVSVALGMRYGNPSVATALAELRDAGARRILVLPMYPQYAAATTASTFDAVFD
FT                   EMKTWRWVPELRFITHYHREPAYLDALAASVREHFAEHGQPQKLVMSFHGVPKRYLLAG
FT                   DPYHCECHVTGRLLADRLGLSADQYMVTFQSRFGREEWLKPYTDETLKGLPAKGIKHIA
FT                   VVCPGFSADCLETIEEIGQENREYFEEAGGETYHYIPALNARDDHLDALTHLIRRHTQG
FT                   WIEHSGYDAQADAQERDRVRANALAMGAER"
FT   gene            53431..54390
FT                   /locus_tag="Hneap_0046"
FT   CDS_pept        53431..54390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0046"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   ppr:PBPRA1159 putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94912"
FT                   /db_xref="GOA:D0KVY5"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY5"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ACX94912.1"
FT                   /translation="MSETNTRHARLLILGSGPAGYAAAVYAARANLNPVLITGMEMGGQ
FT                   LTTTTEVENWPGDPGDLTGPALMDRMKAHAEKFDTEIIFDHIQSTNLKQRPFTLKGDSG
FT                   TYTCDALIVATGASAKYLGLESESKFKGKGVSACATCDGFFYKNQEIAVVGGGNTAVEE
FT                   ALYLANVASKVHVIHRRDKFKAENILIDRLMKKVDEGKVEIHWHSAIDEILGDNTGVTG
FT                   LRIKQVQTEKTTDIALTGVFIAIGHAPNTGIFEGELDLAGGYIQVKSGTQGNATATSVP
FT                   GVFAAGDVMDHVYRQAITSAGTGCMAALDAKTYLEGLE"
FT   gene            54484..54804
FT                   /locus_tag="Hneap_0047"
FT   CDS_pept        54484..54804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94913"
FT                   /db_xref="GOA:D0KVY6"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94913.1"
FT                   /translation="MDPVIAAYTVLLAVALGLSGFLRGDARRRGRGLLMAATLSGFIVV
FT                   AAASALVNAVSVPDLILTSLAVFFSAQAATTAFSLLWREISSTRQARGSVPDSDHREDT
FT                   ST"
FT   gene            54801..55673
FT                   /locus_tag="Hneap_0048"
FT   CDS_pept        54801..55673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_4084 NAD(P) transhydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94914"
FT                   /db_xref="GOA:D0KVY7"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94914.1"
FT                   /translation="MSVGLQIDLVGWFALALILAALYGLNSEKGERSGNTTWHKPAIGL
FT                   LSAALLLMLLSVLWTSDGSNVPLAIVMVLLGIVAAPLSSRYRSSRYRDARGSSPQRTLR
FT                   EGILSGLSLITIGTGLSVALLGLTGWFDMDRDAFTWDIRLVSVSSEFIGVWTFAAGLML
FT                   WLRLNDYLPQSSPGRNQKRVGLAVLALAVVLSGLSVLFPAYASALMIVVAVLALELGAL
FT                   SALGVAETRVARVLGQHTGLIGAAIAMLGYVQASLFLLSMGGLIVAAAIHYLRGAMAFN
FT                   QARRRRTDF"
FT   gene            complement(55687..56304)
FT                   /locus_tag="Hneap_0049"
FT   CDS_pept        complement(55687..56304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0049"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: eic:NT01EI_2688 5'-nucleotidase, putative;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94915"
FT                   /db_xref="GOA:D0KVY8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY8"
FT                   /inference="protein motif:PRIAM:3.1.3.5"
FT                   /protein_id="ACX94915.1"
FT                   /translation="MLSKSTTPEQSHFFAYLARMKYITRWGLMRNTRTENIQEHSLQVA
FT                   MIAHALAVIGNELYGETNDIGRIVTVALYHDASEIITGDLPTPVKYFRQDILDSYKALE
FT                   AHAERKLTGLLPERLRSAFASTIESAQIEPEVTRVVKAADSMSAYLKCLEEGFAGNQEF
FT                   KKAESYLLAKLVEMQETMPAVAYFRTHFVEGFALTLDDLSHE"
FT   gene            complement(56333..57763)
FT                   /locus_tag="Hneap_0050"
FT   CDS_pept        complement(56333..57763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0050"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /note="KEGG: mpo:Mpop_2521 deoxyguanosinetriphosphate
FT                   triphosphohydrolase; TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94916"
FT                   /db_xref="GOA:D0KVY9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVY9"
FT                   /inference="protein motif:TFAM:TIGR01353"
FT                   /protein_id="ACX94916.1"
FT                   /translation="MKRTESNWPRWLNAARRRPSQTSPALFHTETRAEIERDYDRVLFS
FT                   TPVRRMADKTQVFPLDHSDSVRTRLTHSHEVANLARSVGLDLVFNRNLAAGLPQALRDV
FT                   PALLATIGLAHDLGNPPFGHQGEEAIGRWFARHEATVLNPQTGLSEAMRQDFLRFEGNA
FT                   QTLRLLTKLQLINDDYGLNLTVATLAALIKYPVGSDDIDKKFVVRKKHGFFQSEQALVA
FT                   EVQAQCGLDAGQRHPLTWILEACDDIAYSVLDAEDAVKKGLLSFSDIIAFLRHAADGDP
FT                   VVTRVCDAAQEEHRRYRQTDLSPAELNDISMQTFRIRAIGALMQAVADTFLTQLPAMSA
FT                   GTFNQELIAASPARALLSTLKACNWQHAYRHKTVLKVELTGFEVIHGLMDAFWYAITDR
FT                   VDPLDPASARRTPLASYLYQLISENYRRVFEAPSNPMPLRYREAQLLTDMVSGMTDSFA
FT                   VRSWQQIQEAGFRPNVPY"
FT   gene            57863..58720
FT                   /locus_tag="Hneap_0051"
FT   CDS_pept        57863..58720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0051"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   NADP oxidoreductase coenzyme F420-dependent; KEGG:
FT                   cyt:cce_2482 putative 3-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94917"
FT                   /db_xref="GOA:D0KVZ0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ0"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACX94917.1"
FT                   /translation="MNIAVLGLGLMGRAIAERLVKAGMTVRGYNRSALSAPPTGVTMSE
FT                   SVAAAVEPSDIVWVMLADFAACESVLLAENPWDLFKNKLIINGATIGPEQSRALAESIK
FT                   QLGGHYLESPVLGSTPQAETGTLQILVGGDPADVAVADPVLKALGKPTHFGGIGQGAAV
FT                   KLAMNQLIGSLTAAFSMSLGLVEREGVDVDTFMNTLRDSALYAPTFDKKLDRMRTRDFA
FT                   AANFPLKHLLKDIRLFTEVAGAQQIDARMLDGLARILADGVTAGHADEDYSALFGQIVP
FT                   NITP"
FT   gene            58846..60408
FT                   /locus_tag="Hneap_0052"
FT   CDS_pept        58846..60408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0052"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: asa:ASA_3451 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; SMART: AICARFT/IMPCHase bienzyme formylation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94918"
FT                   /db_xref="GOA:D0KVZ1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ1"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ACX94918.1"
FT                   /translation="MKNNRTTPRRALLSVSDKTGLLAFAQSLNRHGVALISTGGTASML
FT                   RDAGLPVTEVADVTGFPEMMAGRVKTLNPKIHGGILARRGVDEDVMAEHGIEPIDIVVV
FT                   NLYPFAETVAKPNCQFDDAVENIDIGGPAMVRAAAKNHQDVAIIVDPSDYGRVLSEVEA
FT                   GGIEAQTRFELAVRAFEHTAHYDGMIADYFGKMVSGNAFAPTFNLQLKKAQDLRYGENP
FT                   HQEAAFYVEHTPPVGSIAAAHMIQGKALSYNNIADSDAALECVKQFAEPACVIVKHANP
FT                   CGVAVAEDLTVAYDRAYATDPTSAFGGIIAFNRPLDGHTARTIVERQFVEVVIAPEISP
FT                   EARIEFEAKPNVRVLTVGQWPAVSPARLDFKRVHGGLLVQDDDAARITARDLTVVSERQ
FT                   PTPEELRDLLFAWQVAKFVKSNAIIYASGEQTIGVGAGQMSRVYSARIAAIKAEDACLP
FT                   VAGSVMASDAFFPFRDGIDAAAAVGIRAVIQPGGSMRDQEVIDAANEHGIAMVFTGIRH
FT                   FRH"
FT   gene            60466..62061
FT                   /locus_tag="Hneap_0053"
FT   CDS_pept        60466..62061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0053"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   afr:AFE_3259 DNA recombination protein RmuC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94919"
FT                   /db_xref="GOA:D0KVZ2"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ2"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ACX94919.1"
FT                   /translation="MSSFFAQLPNLPPVWAWAGLASTALLLVALLFVWLVLAQRARQNR
FT                   QSAAEEIERLNVALAESRHEVTEQELAARQAQRDLTAASTELARTQATLSALSDQLSRM
FT                   QAERMSERQQSEQRIDVLSRQVQTQAAEQAELQERLAQERRAAAEKLALIDQAQVQLQQ
FT                   AFQALSADALRANNESFLKLAEENLARFQAGAAQDLNKRQEAIVQMTQPIRERLEQFDV
FT                   KLNSLEQARTNAYGAMNQQINDLLQIHLPKLHRETADLVRALRQPQTRGRWGEVQLKRV
FT                   VELAGMLEHCDFEEQVSQSDTGGRLRPDMIVHLPGGRQVVVDAKAPLNAYLQAMEAPSD
FT                   EARAAALQDHARQVRTHISQLSKKEYFDQFSPTPEFVVLFVPGEVFFSAALMQDPTLIE
FT                   FGAEKRVIPASPTTLIALLKAVSYGWRQEALAKNAQEMAELGRDLYERMGTLAQHWQKV
FT                   GKHLDQAVGAFNQSVGSLEGRVLPTARKFRELGAVRSDKEDLPSLTPLTTETRPLTAQE
FT                   LTGPDSAAAITQKD"
FT   gene            complement(62045..62242)
FT                   /locus_tag="Hneap_0054"
FT   CDS_pept        complement(62045..62242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94920"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94920.1"
FT                   /translation="MNLNTELNALSTQELEHLIQAIAAELSERSSKPAKPLDEEEIVQV
FT                   LSFELKRHRKQKDEVFNPFA"
FT   gene            complement(62254..63108)
FT                   /locus_tag="Hneap_0055"
FT   CDS_pept        complement(62254..63108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0055"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bbr:BB3098
FT                   serine/threonine protein phosphatase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94921"
FT                   /db_xref="GOA:D0KVZ4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACX94921.1"
FT                   /translation="MTLFKQLLVNPNGRDFVVGDIHGHLSRLEKVLDYHQFKPESDRLI
FT                   AVGDLINRGTDSLNTLRLLSEPWFFSVAGNHERMISQYRQALTRRQLTADERQKMVSIG
FT                   AQWLLDAYDALNEDKWADLITEIMNLITQMPLMIQVGNGPEAVGVIHAELPDWDWSRSV
FT                   TRLERIKKVKFWDQPRDEPSIESLLWGNAQFQSLRNGEQNDRHISGIAWVIQGHSVSNI
FT                   PRRAGNRLWIDTGADESQSAHGLSIAELGPQLTVTTHFRDLRIRTERFNLTPQPRFHSV
FT                   LMS"
FT   gene            63522..63998
FT                   /locus_tag="Hneap_0056"
FT   CDS_pept        63522..63998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0056"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   tgr:Tgr7_2583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94922"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ5"
FT                   /inference="protein motif:PFAM:PF08754"
FT                   /protein_id="ACX94922.1"
FT                   /translation="MKKIRLLQSAFVLFMLGLLSALPVQAQTVDAKAIDALGGNSLANH
FT                   HIVLQETDSDLQRQTLVLNVASNLINAYGDNADIEIVGFGPGISLLFANNEHAKRIESL
FT                   AQQGVRFSACMNSLAKATERLGYEPKLNPVAKKVPAGIVRIIDLVDAGYILVRP"
FT   gene            64169..64549
FT                   /locus_tag="Hneap_0057"
FT   CDS_pept        64169..64549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94923"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94923.1"
FT                   /translation="MTETTASESMSHKEVAEYIANHDADRRGGFVARPILLQKLNEFGS
FT                   PSLAVLTFEGEKTLTLAGLLSLQPDDEVVLYDDNAPDGAQSFYGVVEDVREGVRPADSI
FT                   KRMRLIYLQKKSSDKVLDPREA"
FT   gene            64622..67444
FT                   /locus_tag="Hneap_0058"
FT   CDS_pept        64622..67444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0058"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   GlnD PII-uridylyltransferase; KEGG: tgr:Tgr7_0463
FT                   (glutamate--ammonia-ligase) adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94924"
FT                   /db_xref="GOA:D0KVZ7"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ7"
FT                   /inference="protein motif:PRIAM:2.7.7.42"
FT                   /protein_id="ACX94924.1"
FT                   /translation="MINLIEPEMRLHIESAARDAGASVNQLAQLRVLLEVSPFVAENIT
FT                   KQPCLWPFLLEQVNHANGPTGLAERIEQQLSNSPIEDLDQQLRHIRRAEMLRIAWRDVA
FT                   RLAPTTETLRDLSDLADQCVQQALMAHERVLVARHGFPRSKQGAYQQLVVLGMGKLGGY
FT                   ELNYSSDIDLIFLFEEEGETDGPKSISNSEFFIKLGQRVIRSLNEVTRDGFVFRVDMRL
FT                   RPHGDEGALALSFDAAELYYTTLGREWERYALIKARVIAGDQAAGARLLALLKPFVYRK
FT                   YLDFGAFAQLRDMKKAIEREMNRRGMHDNIKLGPGGIREIEFIGQLYQLLRGGREPKLQ
FT                   SRSILTTLEVLRGLKELPSAIIDELLAGYDFLRRAENRLQMMHDRQTQTLPLDDLDQAR
FT                   LALAMGYSSWGDFMAALDQHRQRIHRYFGEILQTSRDDNVNELPMQQIWLNNLTPEVAE
FT                   ELLRKQGFDDPESILDTLLAWKRDLSPQLSDTVQHRLDLLMPNVLQEVATHGTSAETLR
FT                   AVLALVDAVLSRSVYLALLIEQPAALKHLVQLCSASPWIAELLRQQPILLDELVDANNL
FT                   YSQPDVQALSQEISGFLSRFPDDEERQFDELRRFRQLATLRVAAADAMDILPVMRVSDQ
FT                   LTWIAEVVLEKVLQLAYQQMVTRHGEPRALDEHGAEYTPGFAIIAYGKLGGIELGYGSD
FT                   LDVVFLHDSTDTSAMTTGQKPIDNQLFFARLAQKIIHILSIRTPSGVLYEVDTRLRPDG
FT                   AGGLLVSSLQGFEQYQKQHAWLWETQALCRARFIAGQNQIAERFATIRRDTLCAPRDPA
FT                   TLKEAVLDMRQKMRAEHGQTGAGETFHLKRGIGGITDIEFMVQYLLLRHAHAHPEIVAF
FT                   TDNIRQLRALAQADLLDGERSEQLVTAYQRLRNTSHRRTLNKQSLELPCADFAEERAVV
FT                   LAAWQQIFEL"
FT   gene            67499..67957
FT                   /locus_tag="Hneap_0059"
FT   CDS_pept        67499..67957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0059"
FT                   /product="protein of unknown function DUF188"
FT                   /note="PFAM: protein of unknown function DUF188; KEGG:
FT                   hha:Hhal_1913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94925"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ8"
FT                   /inference="protein motif:PFAM:PF02639"
FT                   /protein_id="ACX94925.1"
FT                   /translation="MHIWVDADACPVAVKEILFRAAARTGLPMTLVANQPLAIPRGAST
FT                   VRFIQVAGGFDVADNEIVRRLSAGDLVITQDIPLAAEVIEKGGLALNPRGEHYTPDSIK
FT                   ARLSMRHFMESLRESGVNTGGPAKLNQSDRQVFANALDKILLARPGSV"
FT   gene            68056..68586
FT                   /locus_tag="Hneap_0060"
FT   CDS_pept        68056..68586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0060"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /note="PFAM: outer membrane chaperone Skp (OmpH); KEGG:
FT                   aeh:Mlg_1854 outer membrane chaperone Skp (OmpH)"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94926"
FT                   /db_xref="GOA:D0KVZ9"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D0KVZ9"
FT                   /inference="protein motif:PFAM:PF03938"
FT                   /protein_id="ACX94926.1"
FT                   /translation="MDRAVRYGLSVLVFLFAAATQAEVLAAPIKVGYVNSVALMEQAPQ
FT                   ADIAKHALEREFSPREREIRALQQQAQTLQGRLDNGGASMGDTERSTLRQQLDQKMLRI
FT                   QQMQSDFQDDLNLKKNEALGKLQQAVLQAIKDVAKTNGYQLVLSDGVVYAAPSVDITKL
FT                   VAERLKQLAKGKQ"
FT   gene            68944..69192
FT                   /locus_tag="Hneap_0061"
FT   CDS_pept        68944..69192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0061"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   app:CAP2UW1_0380 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94927"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW00"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ACX94927.1"
FT                   /translation="MEAIQLIRDFLQERTQTDPALVTPDARLETLGIDSFTLLELIFEF
FT                   EEKYGVSIPNDTQTPETVQDLLNLIARFRQQAEAKPS"
FT   gene            69189..70436
FT                   /locus_tag="Hneap_0062"
FT   CDS_pept        69189..70436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0062"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: dar:Daro_4170
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94928"
FT                   /db_xref="GOA:D0KW01"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW01"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ACX94928.1"
FT                   /translation="MTRPHRVAVTGLGMVSPFGGSTQDFFTRMLAGESAVALYETDDAP
FT                   RGLSVPAVRCADFDPAERVPKHMLATMDRYAQLGLAAAFEAWAQAGLTLGANEDSPDAG
FT                   VAWGSALGGTLAYERGYRDLWQNGQERVSPMSVVQGMNNAASAQIGIALGLGNSCLTYT
FT                   VACASAAAAIGEAFNRIRYGDAKIMLTGGSDAPLAYAVVRAWEAMRVLAPGDRDTAYRA
FT                   CRPFHPDRRGLVLAEGAAALVLEDWDHAVARGAPILAEMSGFGASCDHSHLVRPDAGGQ
FT                   VRALQQALDQAGLAPKDIGYVNAHGTATREGDPTEIQALKTVFGAHAEHLAVSATKSMH
FT                   GHVMGATGAIEALITVLALWQDAIVPTAHLDAIDPACAGVRHITQAEHGSDLQAALCSS
FT                   FAFGGSNAVLAFKACK"
FT   gene            70516..70800
FT                   /locus_tag="Hneap_0063"
FT   CDS_pept        70516..70800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0063"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: app:CAP2UW1_0378 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94929"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW02"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_0378"
FT                   /protein_id="ACX94929.1"
FT                   /translation="MTDLSQKITDQALVEELANLIVDGLNLEVSAAEIDADAPLFGQGL
FT                   GLDSIDILEIAMMVSKRYGFALRSDDENNTRIFSSLRHLAQHIAEHRSC"
FT   gene            70809..71507
FT                   /locus_tag="Hneap_0064"
FT   CDS_pept        70809..71507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0064"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: eba:ebA7058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94930"
FT                   /db_xref="GOA:D0KW03"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW03"
FT                   /inference="protein motif:COG:COG4648"
FT                   /protein_id="ACX94930.1"
FT                   /translation="MSRAGLLSRVKAGLILFLLGLDLFLANILSPKAHVSAAVVVLAFL
FT                   PITLIMLDVLWHTAGKAVALAVAALIVLGGVLLLPQLQAQISLIYLLQHLTANLLLGFW
FT                   FGRSLWRNRQPVCTQFAGVLHPRMTPLLVQYTTRVTQAWTIFFFAMATTSILLYLFAPI
FT                   TLWSIFANSLTLPLLVLMFGAEYLVRRRVLPPEDQLGPLSAFRAYRRSVLARLAQGRHS
FT                   NVNPDTPTSK"
FT   gene            71516..73297
FT                   /locus_tag="Hneap_0065"
FT   CDS_pept        71516..73297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0065"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase;
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: bcj:BCAL0843 AMP-binding enzyme family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94931"
FT                   /db_xref="GOA:D0KW04"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW04"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACX94931.1"
FT                   /translation="MTSFPLIFADPDQLLFYRQQGNAVHTITAREFMADAEALAVDLTT
FT                   RMGAHQSIINLCQDRYRFMVGFAATILAGKTNLLPSTFTGETLRQIFIDAPDALCLHDH
FT                   DDWPFPYPHLSLDHLSLSHRALANRCPREPLPDGLGESDHIKPEHVVAQVFTSGSTGLP
FT                   MPHNKTWGKLVRNVEAALQQLGLWRPVSLVGTVPPQHMFGFESLVLLCLIGRCPLWSGK
FT                   PFYPADIVAALDAMPEPRMLVTTPFHLQALLDAQIALPKIDRLLLATAPLSPELAERAE
FT                   RVTGAPLFEIYGSTETGQIANRRPTQSTAWTLFPGITLTKAHLDENDELFIANGEHIEA
FT                   PVMLSDRIHVRADGRFDLLGRIADQVNMAGKRSSLNYLSAQLKAIDGVTDGVFFLPETK
FT                   KDRTGKNRVGKDQAITRLCAVVVAPALSAADILAALRDRLDPVFLPRPLILVENLPYNA
FT                   TGKLPQIALQAILDQHLAALAPKNQTSWRIPSDHPVFAGHFPGHPLVPGALLLDWVVER
FT                   VAAYWQVASAGLRIEQAKFTHPVLPDARVTLDLKPEADRCRFTLHVHAGETNPVAVSGV
FT                   LSRQSNDEAGDTEARQA"
FT   gene            73294..74238
FT                   /locus_tag="Hneap_0066"
FT   CDS_pept        73294..74238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0066"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   pna:Pnap_1376 lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94932"
FT                   /db_xref="GOA:D0KW05"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW05"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ACX94932.1"
FT                   /translation="MNASAKAEWQQRPERGSQFMLRVMLWLSRHLGRSVSRWVLYPIAL
FT                   YFLLFVPAARRASRQYLARVFGRPARLIEVFRHIFTFASTVHDRVYLLDGRDDLFKIEF
FT                   VNRHWFDSPEGAILIGAHMGSFEALRSAGKTHARRRVSMLMYPENARKINALLALVNPD
FT                   AANDIIPLGQVDSMLTAQERLAAGHLVGMLADRSLPQDTLRPCVFLGEPAAFALGPFRV
FT                   AALLKKPVYFMAGLYLGGNRYRVHFDRLADFSDTPRAGRDAAILAAQDRYVEILESLCR
FT                   QAPYNWFNFYDFWSDDSSSDHARTNPPDKEPAD"
FT   gene            74238..74837
FT                   /locus_tag="Hneap_0067"
FT   CDS_pept        74238..74837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94933"
FT                   /db_xref="GOA:D0KW06"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW06"
FT                   /inference="similar to AA sequence:KEGG:Daro_4176"
FT                   /protein_id="ACX94933.1"
FT                   /translation="MRQTLFLMLLLLQGLVQPVTVVAAAPSPDWSPASVLHTLAEHRRG
FT                   EVRFTEQKFIGVLDTPLLSEGTLTFRPPDYLEKHTTSPRDERMTIEGDVLTYTRQSQTY
FT                   TLNLAEHPEATAYANSIRGLLNGNAALLRKSYVLKLSGDRAHWVLLLLPTDPRIQSLIK
FT                   SISVNGSGDHLQRIEYDQANGDRSVMTLLPVIPPTP"
FT   gene            74834..77248
FT                   /locus_tag="Hneap_0068"
FT   CDS_pept        74834..77248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0068"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: bac:BamMC406_2683
FT                   exporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94934"
FT                   /db_xref="GOA:D0KW07"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW07"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACX94934.1"
FT                   /translation="MKHQGLEKMSWTERRLPVIGLWLLALALSLAVILHTRFTADMSAF
FT                   LPEHPTAAQAFLVDQIKDGAISRMILIGIEGGDAATRADASKALGNALRQSGLFTVVRN
FT                   GDAPTRDQDKTLLFDHRYLLSPDITPERFTVAGLHEAIANGIDLLASPFGMFSQTIFTR
FT                   DPTAETFAIVGKLGQNTGTDDAPRNQNGVWVSPDGKRSLMMLQTRAAGSDTDAMARAIE
FT                   AVRADFSNAVKAHPDGSSLRLLVSGAPVFSVDARALIKSDVERFSIIGSVAVMLLLLVV
FT                   YRSFSMLVLGLLPVLTGIAVAIATVSLGFGTVHGITIGFGTTLIGEAIDYSIYYFIQTQ
FT                   NAPKEGSAFRSAGRSEGMERFWPTIRLGVLTSITGFAALLFSGFPGLAQIGLYSIAGLT
FT                   TAALVTRFVLPHLGTARLNRHSLAGIGRLLAPVFRAIQALRWGFVLLALAGFVLLVWRH
FT                   DAIWQTGLSGLNPISGQAKAMDDELRADMNADDARYFIVAKAPTQQAALAAAERIDAAL
FT                   EPLIKQGVLARFDSPAKFLPSVATQRVRQQALPDSTTLTERLDAAVQGLPISASKLKPF
FT                   VDAVEQARKQTPLTPADLEGTSFGLAVSALLQKQNGEWLTLIRLYVPSVGTLDTARITA
FT                   ALKSSGISDALFVDKDAESSRLFNSYLENTITLSLAGLLGIVILLGFVLRRPARLIRVL
FT                   LPLLVAVVLVMAGLNLAGEKLNILNLVGLLLIVAIGSNYALFFNQNTAPDHQTLASLLL
FT                   ANLTTVIAFGTLAFSQLPILHAFGSTVAPGAFLALVVAAAFAKPNAPKAPA"
FT   gene            77245..77697
FT                   /locus_tag="Hneap_0069"
FT   CDS_pept        77245..77697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcj:BCAL0836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94935"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW08"
FT                   /inference="similar to AA sequence:KEGG:BCAL0836"
FT                   /protein_id="ACX94935.1"
FT                   /translation="MTNAQAQSRTLDHEEIAALIPHQGSMCLLDHVVDWNAQKIACTAI
FT                   SHRAIDNPLRRNGRLGAAVGIEYAAQAMAVHGALLAARDTAPKKGMITRVQRIALHAER
FT                   LDDCPDALRITAKRLMGDERMVRYGFELRCAERMLLEGEASVILDA"
FT   gene            complement(77721..77927)
FT                   /locus_tag="Hneap_0070"
FT   CDS_pept        complement(77721..77927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94936"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW09"
FT                   /inference="similar to AA sequence:KEGG:Pnap_3867"
FT                   /protein_id="ACX94936.1"
FT                   /translation="MYQRIVVLGALGLVTLVSGCSSAAWYSAGQSYQRNECLKVPNQAE
FT                   RERCLDNANTDYNTYTKETTPAP"
FT   gene            78057..79043
FT                   /locus_tag="Hneap_0071"
FT   CDS_pept        78057..79043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0071"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ana:alr0058 D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94937"
FT                   /db_xref="GOA:D0KW10"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW10"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACX94937.1"
FT                   /translation="MRVAVFSSKPYDQESLTRANAAFRHELHFFEAALNLQTCSLAENA
FT                   EAVCVFVHDQIDAHLLCCLAGRGVKVVALRCAGFNNVDLPAAREVGIDVVRVPAYSPYA
FT                   VAEHAVAMMLTLNRHTHRAYNRVREGNFALNGLLGFDMNGKTVGIVGTGRIGTVLARIM
FT                   IGFGCTVLAYDLYPNDECKALGVRYVPLDELLPQSDIISLHCPLSEETRHLIDSKAIGK
FT                   MKRGAMLINTGRGALIDTSAVIAALKSGHIGALGLDVYEQEENLFFEDHSEEIIQDDVL
FT                   ERLMTFPNVLVTAHQGFFTREAIDAIAKITLNNLKQVEAAEPCPNQL"
FT   gene            79194..79484
FT                   /locus_tag="Hneap_0072"
FT   CDS_pept        79194..79484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0072"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   tgr:Tgr7_1284 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94938"
FT                   /db_xref="GOA:D0KW11"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW11"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ACX94938.1"
FT                   /translation="MLLKPDLRDFQRMPQRAPMRYQNEHDPTWQSAELMDLSASGLAML
FT                   TIESLPEGSVLNVEIAPALAVVPPLRAVVEVRRCEPDGEGHLVGVRFVEMY"
FT   gene            complement(79586..80446)
FT                   /locus_tag="Hneap_0073"
FT   CDS_pept        complement(79586..80446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0073"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: neu:NE0449 aspartate and glutamate
FT                   racemase:glutamate racemase; TIGRFAM: glutamate racemase;
FT                   PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94939"
FT                   /db_xref="GOA:D0KW12"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW12"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACX94939.1"
FT                   /translation="MKLTDTKPTAPIGIFDSGVGGLSVYQAVRHALPAEDIIYIADSGF
FT                   APYGDRSSDFITERAVAMTDFLIAAGAKAVVVACNTATVIAVTQLRRQFSIPIIALEPA
FT                   IKPAIEHSQSGTIGVLATRKTIESPAVERLCRTHGVNTRVLLQPCPGFVEQVERGEMDH
FT                   PDTTDLIRRYVEPLLAAGADTLVLGCTHYVYLAQQIRTIVGPDVSILDSSAAVARQVGR
FT                   RIGSSEVAASTGRCGQDQFFTTAASTDHARAVMSTLVGRPVEVHYAGTTRPASTLEAET
FT                   AQTRD"
FT   gene            complement(80598..80861)
FT                   /locus_tag="Hneap_0074"
FT   CDS_pept        complement(80598..80861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0074"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin Txe/YoeB; plasmid
FT                   stabilization system; KEGG: tau:Tola_2844 addiction module
FT                   toxin, Txe/YoeB family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94940"
FT                   /db_xref="GOA:D0KW13"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW13"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ACX94940.1"
FT                   /translation="MSWQLVYTKHAQKDAKKLAASGLKEKAMDLLKVLEENPYQNPPPF
FT                   EKLVGDLAGAYSRRINIQHRIVYEVLEQAHIVKILRLWTHYE"
FT   gene            complement(80858..81100)
FT                   /locus_tag="Hneap_0075"
FT   CDS_pept        complement(80858..81100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0075"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: dol:Dole_2606
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94941"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW14"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACX94941.1"
FT                   /translation="MAILNATEARSKLYSLIDEANDSHQPIVIKGKRGSAVLISEEDWN
FT                   AITETLNLLAIPGMRESIQEGLNTPASECAKDLDW"
FT   gene            complement(81147..81383)
FT                   /pseudo
FT                   /locus_tag="Hneap_0076"
FT                   /product="hypothetical protein"
FT   gene            complement(81463..81732)
FT                   /locus_tag="Hneap_0077"
FT   CDS_pept        complement(81463..81732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94942"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW15"
FT                   /inference="similar to AA sequence:KEGG:Noc_0084"
FT                   /protein_id="ACX94942.1"
FT                   /translation="MKAKDFDKKFEEGQEDIVDDLDLSSARRVNQGQKRINVDFPAWVV
FT                   ESLDREAARMGVTRQSIIKVWLVERLQAESANKPLHGDTAGGAH"
FT   gene            complement(81722..81817)
FT                   /locus_tag="Hneap_0078"
FT   CDS_pept        complement(81722..81817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94943"
FT                   /db_xref="UniProtKB/TrEMBL:D0KW16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94943.1"
FT                   /translation="MRSQPFLYFAPNITLIPTAHPLRGRVDLYES"
FT   gene            complement(82067..82297)
FT                   /locus_tag="Hneap_0079"
FT   CDS_pept        complement(82067..82297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94944"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94944.1"
FT                   /translation="MSKAVPDEPKFPIQLVWIESGDVETYEDARDLLCNLEEFDSNDPV
FT                   DRNAARLTDALGRHISLVVRIYDDLCECKLE"
FT   gene            complement(82401..82859)
FT                   /locus_tag="Hneap_0080"
FT   CDS_pept        complement(82401..82859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94945"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94945.1"
FT                   /translation="MRSTAKFLLALLVALAFVVSLISFGWWLVFAYNIVTGHTAIEFGT
FT                   KFAPQMLEQASQQKILFTQMREYFVLIGGAIGWGAFFALPNFSNRPFRALPKLLLISCV
FT                   IGITAALVMPASVIFKVTPILTVILIFMRCLLIEDHPKHAMDQKNIET"
FT   gene            complement(82918..83169)
FT                   /locus_tag="Hneap_0081"
FT   CDS_pept        complement(82918..83169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_2541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94946"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWE9"
FT                   /inference="similar to AA sequence:KEGG:CPS_2541"
FT                   /protein_id="ACX94946.1"
FT                   /translation="MKQKEIDRWAKARTKGMLMYVLLTGIVSYGIPMFAVMTFLFHHSK
FT                   LSVVQSAALWLAAGAFYGIATWLVQEHRYRKATDVPQV"
FT   gene            complement(83197..83307)
FT                   /locus_tag="Hneap_0082"
FT   CDS_pept        complement(83197..83307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94947"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94947.1"
FT                   /translation="MRSQPFLYFAPNITLIPTAHPLRVRVPSALRAPAAG"
FT   gene            83541..83720
FT                   /locus_tag="Hneap_0083"
FT   CDS_pept        83541..83720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94948"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94948.1"
FT                   /translation="MGLIDHMVQRDKFQSEELTNGFDFPCCVCIHRHGTDKDEPCRTCD
FT                   HNMGSVPDDEVPNA"
FT   gene            83787..83966
FT                   /locus_tag="Hneap_0084"
FT   CDS_pept        83787..83966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94949"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94949.1"
FT                   /translation="MRREQLTELESHLTKAASALRAAWILCKHNHMEPTAKELADTVLD
FT                   VETARDRVKDISTA"
FT   gene            complement(84404..84736)
FT                   /locus_tag="Hneap_0085"
FT   CDS_pept        complement(84404..84736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94950"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94950.1"
FT                   /translation="MNIDEVVDLLPDEKLRSDLAKWVNDWKEDDTDITRLEKMLSKWHS
FT                   YTWFKDDERTLHFLNQLNEFRKTAISNVGGLTMNERLYYFCLFDNWDNGNVQQKDKIRH
FT                   KLLAQA"
FT   gene            complement(84810..85118)
FT                   /locus_tag="Hneap_0086"
FT   CDS_pept        complement(84810..85118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_4005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94951"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF4"
FT                   /inference="similar to AA sequence:KEGG:AZC_4005"
FT                   /protein_id="ACX94951.1"
FT                   /translation="MACDKCKELCIRYAIRLPGNLRKAISIASQNVTDGTLIDTTDPSA
FT                   HSVSFAQLAAGQTWDDIVAYHFRCSCCGEQFSLHAETYHGSGGFWEPVRKAAIRENL"
FT   gene            complement(85145..85255)
FT                   /locus_tag="Hneap_0087"
FT   CDS_pept        complement(85145..85255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94952"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94952.1"
FT                   /translation="MRSQSFLYFVPNITLNPTAHPLRGRVPSARRAPAAG"
FT   gene            complement(85475..86020)
FT                   /locus_tag="Hneap_0088"
FT   CDS_pept        complement(85475..86020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0088"
FT                   /product="putative yfeABCD locus regulator"
FT                   /note="KEGG: sdn:Sden_3281 putative yfeABCD locus
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94953"
FT                   /db_xref="GOA:D0KWF6"
FT                   /db_xref="InterPro:IPR025229"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF6"
FT                   /inference="similar to AA sequence:KEGG:Sden_3281"
FT                   /protein_id="ACX94953.1"
FT                   /translation="MTYDEAKKKILIKWLVGAPVVVATSLSSAVSALKMFYFGLDSGDQ
FT                   LSSAIALPIKRLVYLIYENTFFLGFFWKHSPTPTPKELFATSNIAFFVIYLCIFFGMAL
FT                   VGSARSLSARLAEIDKEIENELIRESVKGNVPRRRQEIQEQVSVPKPGRLSQFHTLYLA
FT                   PIVAGVVVLVIAKISGLG"
FT   gene            complement(86050..86634)
FT                   /locus_tag="Hneap_0089"
FT   CDS_pept        complement(86050..86634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0089"
FT                   /product="ATPase"
FT                   /note="KEGG: bmj:BMULJ_02360 predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94954"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF7"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_02360"
FT                   /protein_id="ACX94954.1"
FT                   /translation="MSSQEFYVITGASGAGKSTLIAALDDLGYSTIPEAALAFMREQLE
FT                   CNGRILPATDRTAFMESVLARSIQDYEAAKSLDAPVFFDRGIPEWLRFLEPSEPNCRIA
FT                   AECRYASTVFVAEPWPEIYVCDHERTHSYDRAAKSYVPTISAYLQSGYEACVLPKVTVR
FT                   ERVAFVLAQVGAGAQQAAAADRHPATRPAGG"
FT   gene            complement(86936..87046)
FT                   /locus_tag="Hneap_0090"
FT   CDS_pept        complement(86936..87046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94955"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94955.1"
FT                   /translation="MRSQSFLYFAPNITLNPTAHPLRGWVPSALRATAAG"
FT   gene            complement(87208..87318)
FT                   /locus_tag="Hneap_0091"
FT   CDS_pept        complement(87208..87318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94956"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94956.1"
FT                   /translation="MRSQSFLYFVPNITLNPTAHPLRGRVPSARRAPAAG"
FT   gene            complement(87553..87843)
FT                   /locus_tag="Hneap_0092"
FT   CDS_pept        complement(87553..87843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0092"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   ttu:TERTU_1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94957"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG0"
FT                   /inference="protein motif:PFAM:PF07045"
FT                   /protein_id="ACX94957.1"
FT                   /translation="MNAYLILDISINDFESFKGYIEKIPAFIQKHDGRYVIQGVEPEVM
FT                   EGDWKPERVVVIEFPTKEGAKGFLNDPDAQALFDIRHKSTTSKLILAEGCL"
FT   gene            complement(87840..88214)
FT                   /locus_tag="Hneap_0093"
FT   CDS_pept        complement(87840..88214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0093"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bmr:BMI_I1921 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94958"
FT                   /db_xref="GOA:D0KWG1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACX94958.1"
FT                   /translation="MIIDHIGMAISDYDKSKKFYSKALAPLGIGLVAEVQGWAGFGKDG
FT                   KPEFWFGVHEKIQNPMHIAFSAVSREEVNKFYEAAILAGAKDNGKPGVREIYHPNYYGA
FT                   FVIDPDGHNIEAVCHAEENK"
FT   gene            complement(88585..89196)
FT                   /locus_tag="Hneap_0094"
FT   CDS_pept        complement(88585..89196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0094"
FT                   /product="cation efflux protein"
FT                   /note="KEGG: dol:Dole_2141 cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94959"
FT                   /db_xref="GOA:D0KWG2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG2"
FT                   /inference="similar to AA sequence:KEGG:Dole_2141"
FT                   /protein_id="ACX94959.1"
FT                   /translation="MSDCGCGAEQAEKLERTTLAYLLSINGVMFVVEAALGFYAQSTGL
FT                   IADSLDMLADATVYGISLYVVGKGISQQAKAASVSGVLQIILGLGVLFEVVRRSLYGSE
FT                   PQSMLIMAVGLLALIANVACLMLISKHRDGGVHMRASWIFSTNDVIANVGVICSGALVW
FT                   LLGSRYPDLVIGAIISAVVVRGGIKILKDAKATKSQEIVT"
FT   gene            complement(89303..89722)
FT                   /locus_tag="Hneap_0095"
FT   CDS_pept        complement(89303..89722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0095"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cte:CT1841 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94960"
FT                   /db_xref="GOA:D0KWG3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACX94960.1"
FT                   /translation="MVGELLAEIMNAIGVQAFNFDLAETTSRLQDFLNREKYFVFVARG
FT                   VSGNPAGFIALYESYALYAEGTFGTIPELYVRPDYRTNGLGLRLVSQAKSFGAARGWKR
FT                   LEVTTPPLPQFDRTLAFYEREGFAISGGRKLKVSL"
FT   gene            complement(90138..90461)
FT                   /locus_tag="Hneap_0096"
FT   CDS_pept        complement(90138..90461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94961"
FT                   /db_xref="GOA:D0KWG4"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94961.1"
FT                   /translation="MSDNEIQAQGSSMSLRKSIGIYAAFLAVFIILVNLSFSTTWFPGV
FT                   IAFFAYLVFGFLLNRIVLRGLIEWHPMYNTIENVSSAKLSSFLLWPISYAGLFFRLAVN
FT                   KVL"
FT   gene            complement(90867..91082)
FT                   /locus_tag="Hneap_0097"
FT   CDS_pept        complement(90867..91082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pin:Ping_1936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94962"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG5"
FT                   /inference="similar to AA sequence:KEGG:Ping_1936"
FT                   /protein_id="ACX94962.1"
FT                   /translation="MEIILASTLTCPECGHKETETMPTDSCQWFYECKGCGVLLKPKKG
FT                   DCCVFCSYGSVPCPPIQQGTGSCCSS"
FT   gene            complement(91085..91495)
FT                   /locus_tag="Hneap_0098"
FT   CDS_pept        complement(91085..91495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0098"
FT                   /product="putative mercury transport protein MerC"
FT                   /note="KEGG: sfr:Sfri_3489 putative mercury transport
FT                   protein MerC"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94963"
FT                   /db_xref="GOA:D0KWG6"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG6"
FT                   /inference="similar to AA sequence:KEGG:Sfri_3489"
FT                   /protein_id="ACX94963.1"
FT                   /translation="MRLTAISEKLGSLGAIVSAMGCASCFPVLGSLGATIGLGFLAKFE
FT                   GLFINTLLPIFAVIALVSVAISWWSHRQHIRGILGVAGPAMVLATLYLFWTDSWSTYMF
FT                   YFALALMFAVGVWDIVSPPNKKCAIPISSSEG"
FT   gene            complement(91540..91896)
FT                   /locus_tag="Hneap_0099"
FT   CDS_pept        complement(91540..91896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94964"
FT                   /db_xref="GOA:D0KWG7"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94964.1"
FT                   /translation="MLNLLYGLWLESPPIRAPGFIAALVVAGLGGYLCFAKVRVKAWNV
FT                   FSKSLAVAFCCFVILLIFAIIGILVVSTGILGMARSWASFGDAYVWGVFSLPLLAFFLS
FT                   LGSFALTNHSRATR"
FT   gene            complement(91913..92266)
FT                   /locus_tag="Hneap_0100"
FT   CDS_pept        complement(91913..92266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amr:AM1_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94965"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94965.1"
FT                   /translation="MSAADQKTLKDAAMADIRLVEEILRRWDPIGVEPGIVAPADEYDS
FT                   YAPHIVSMAKSGCTVKALAAHLEHLGSDTMGLGSSNELSRSHSLKFAAEILVALQPSNN
FT                   SLKSDAAKPRTLG"
FT   gene            complement(92363..93529)
FT                   /locus_tag="Hneap_0101"
FT   CDS_pept        complement(92363..93529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94966"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWG9"
FT                   /inference="similar to AA sequence:KEGG:Nham_0140"
FT                   /protein_id="ACX94966.1"
FT                   /translation="MNLPNDIDSLRERVQKILDPIVSAVDKGTKAEKDFLFTASRTDAG
FT                   RGLPSYYLVYFLFVDLLGYKNLGQFEKVAWSVPIDYNGTAYLLEHRKMGMGLFAADKEK
FT                   QEGECQEIVKKIKKAAKAAQPYFEWIANEAAKQSKLNVLNHSLRLHDRYSFLESEHKKK
FT                   LEEAISRKDERIKTQHSENSWSVRMPYYELKRESEWLALSAIDAFYSFTEHVFIHAAIL
FT                   KGHLLTGEDVANLADKDWASKFKACLDVQENSVKPHYDKLVAIKRQIRNYMAHGAFGKN
FT                   GEAFQIHSGAGAVPLLMPHQKGSSRFSMQSGTEFQEEEAISAIEEFMRFYWESNDFPEV
FT                   MYIKSTLPSILTYASDATYKNAMASTEDMESFVDYLIGVHDRAGDMDW"
FT   gene            93675..94408
FT                   /pseudo
FT                   /locus_tag="Hneap_0102"
FT                   /product="hypothetical protein"
FT   gene            94568..95170
FT                   /locus_tag="Hneap_0103"
FT   CDS_pept        94568..95170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0103"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: tgr:Tgr7_2760
FT                   tellurite resistance protein TehB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94967"
FT                   /db_xref="GOA:D0KWH0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACX94967.1"
FT                   /translation="MSEFWNQKYARDDYFYGEQPNDFLHSQIFRLPTGARVLVVGDGEG
FT                   RNGVWLAEQGFTVTTVDGSHVGCDKSRALAAQRKVSLEIVCADLLTWDWPVGAFDAVVS
FT                   VFLHFSPDERKVAHARIQAALVHGGWLIIEQFHPNQLNGYTSGGPKAVDMLTTMGDLAD
FT                   DFNAIDWWLLAEGTTRLEEGPGHSGLGYVSHGVGRRQ"
FT   gene            complement(95561..98821)
FT                   /locus_tag="Hneap_0104"
FT   CDS_pept        complement(95561..98821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0104"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; zinc finger SWIM domain
FT                   protein; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein; KEGG: dar:Daro_3870
FT                   SNF2-related:helicase, C-terminal:SWIM Zn-finger"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94968"
FT                   /db_xref="GOA:D0KWH1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH1"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACX94968.1"
FT                   /translation="MTRPIHLPFTLADITDYFGAHEIKKAEPYARHAVQLMHVENGYIN
FT                   AEVQGTVRTPYDVHINFYHDTDGKVFFDAECSCPVGYQCKHAAATLIAALNNHQHTIPG
FT                   VSAQTLAWLDQWRQSTTNAAKAMKEMLVYLLKPPSGRELLAKVYLNKVRVGKEGPILES
FT                   AKTWYNIDGALRKPPRFVQQVDRSILHLINDQPFGFGYNGFSLENDLGEMALDLMCDTG
FT                   RLYIERNHTPLKRGADRAARLQWRREGDTLHPELVAEPEAKLFALSAFWYLDAHTGEVG
FT                   RLSTAEDPSKIKHLLSIPPVTEQALPLVATVLAESAPDLAPPIQSEATATAIDIAPTPV
FT                   LSLHTLAARRINPYRSYDRKIDGFDVAEFAFDYDGVRVGLDDCSGLSQDARGHWVFIKR
FT                   QADDEARWARQLRKHGLTRIPANVLDDARALYGLENEAAWVEFMTEALPKLRAAGWLVE
FT                   IPDDFRHVWHEPQGWDATVNEEGAGWFDLDLGVLIDGQRLSLTPMLSELFAREPRWLDS
FT                   SYIDEQPDDASVILHSHENLRIRVEAGRIKTIVRQLIDLFDRPQGDSLRLHTLDATRLE
FT                   TLPEDMRPNESIHALEVARRIRSAGAAVAVEAPEGLGIELRGYQREGLGWLSHLRTLGV
FT                   GGILADDMGLGKTAQTLAFLLREKQQGRLGHPALIVLPTSLIFNWRHEAKHITPALRVL
FT                   TLHGANRSALFDQISKHDIVLSTYPLVWRDIEALEQHTWSQLILDEAQTVKNASSQAAQ
FT                   AIRRIKSEHRLSLTGTPMENHLGELWAQFDFLLPGFLGDKTAFTRAFRTPIEKHGDTIR
FT                   RDLLARRLRPFLLRRRKEDVAAELPPKTSIIRSVSLEGAQRDLYETVRSAMDEKVRQSI
FT                   DSMGLARSHIVILDALLKLRQVCCDPRLLPSSKTGQSAKRPTQSAKLDLLLTMLPELVD
FT                   EGRRILVFSQFTSMLALISEALTKAKLAHSMLTGETRDRETVVRQFQNGDTPVFLISLK
FT                   AGGVGLNLTAADTVIHYDPWWNPAAEDQATDRAHRIGQTRQVFVYKLVTEGSIEEKILA
FT                   LQDKKAKLAEGVLSGDGSAFTKFSEVDIQALMAPLPRD"
FT   gene            99273..99587
FT                   /locus_tag="Hneap_0105"
FT   CDS_pept        99273..99587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0105"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: ava:Ava_B0167
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94969"
FT                   /db_xref="GOA:D0KWH2"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH2"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACX94969.1"
FT                   /translation="MLALSQLLSRSEIPAMPHTSSQHNPARSASFGIGLAARGSRVRVV
FT                   GLTGEHPALAKRLEGMGIHAGSELEILQREGGALIVRIGSSRVALGTGMVHKILVTAQS
FT                   "
FT   gene            99584..99838
FT                   /locus_tag="Hneap_0106"
FT   CDS_pept        99584..99838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0106"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: mag:amb2732 ferrous
FT                   iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94970"
FT                   /db_xref="GOA:D0KWH3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH3"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACX94970.1"
FT                   /translation="MTTNVQITLLDLKPGDVGVVKGFAPGNADYRRRLMAMGLTPGTRF
FT                   TVTRLAPLGDPIQLQVRNFALTLRKDEACLLRIERADAS"
FT   gene            99908..102244
FT                   /locus_tag="Hneap_0107"
FT   CDS_pept        99908..102244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0107"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: Ferrous iron transport protein B
FT                   domain protein; GTP-binding protein HSR1-related;
FT                   nucleoside recognition domain protein; Ferrous iron
FT                   transport B domain protein; KEGG: rru:Rru_A2470 ferrous
FT                   iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94971"
FT                   /db_xref="GOA:D0KWH4"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH4"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ACX94971.1"
FT                   /translation="MATFTVGLIGNPNCGKTTLFNALTGLRQKVGNWPGVTVDRKVGTF
FT                   DVGADRVELVDLPGTYSLDAASSASLDEAIAREYALSGEADVIINILDASNLERNLYLT
FT                   TQLLEMRVPLILAVNMLDLAEEAGIHIDFAALEQRIGCPVVPITAAKKQGLDELKRRLV
FT                   ERAAHADEPGIKIEYAALIETALRELKPKIEPVAAAQNIDPRWMGVKLLESDRLTLATI
FT                   DDSLRTDVEAAQEKIRAHLDEEADVFIADARYTFIHQLTSASVTQRGQLRRSLTDRIDA
FT                   IVLNRFLGIPIFLLMMYLLFVMSFNGGSIFLDFFDQATHTIFVSGFAHVLQLVHAPDWL
FT                   ITFLATSVGGAIQLVSTFIAPIGMTFLFLSLLEDSGYMARAAFVMDRFMRKIGLPGKAF
FT                   VPMIVGFGCNVPAVMATRTLEDPRERLISALMQPFMSCSARLVIYMAFVAVFFRENGGQ
FT                   IVFALYVLGIVLAILTALLLKKTALRGEATPFIMELPTYHVPTLRGLLLTTWERLSVFI
FT                   LRVGKVIIVASVIVTLLSSFSTSGKPLGEGEVGDSILGSIGKTITPVFHPMGITDENWP
FT                   AAVGLLSGVVVKEIVMGTLNGVYTRMDAGDAAKAAADEPKPKTFDFWGGLAAAVQTIPD
FT                   NAKAFAKGFFDPLGFGQVEQTQQSNLQQAAAQQDLDATTLSRMGNLFTTSAAIAYLIFI
FT                   LLYIPCVNTMAAIYRETRSRAWTLFAIVWGIGLAYGLAVLFYQFANFNAHPMQSLVWLV
FT                   VILAALIAVIVALKRNGQRLVHVPH"
FT   gene            102268..102612
FT                   /locus_tag="Hneap_0108"
FT   CDS_pept        102268..102612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94972"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94972.1"
FT                   /translation="MNSSRLLTPSQLKAYLKFRGTAPLRDVLLHFDAAPSAVLHLLAFW
FT                   RERGHIRQIAVTPAVCDKGCGGCGSGDVCTPDPHEYDLIEWVESSASPVCFDVLSDYDE
FT                   AWKPGSPHGV"
FT   gene            complement(102736..103629)
FT                   /locus_tag="Hneap_0109"
FT   CDS_pept        complement(102736..103629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0109"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; SMART: heat shock protein
FT                   DnaJ domain protein; KEGG: tgr:Tgr7_2956 heat shock protein
FT                   DnaJ domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94973"
FT                   /db_xref="GOA:D0KWH6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH6"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACX94973.1"
FT                   /translation="MKFHDYYATLGVERTATQAEIKKAYRKAAQKYHPDRNKEAGAEEK
FT                   FKEINEAYDVLGDEEKRQRYDTLGSNYRAGEDFRPPPGFDPNQFGDQYGGAGFSDFFSS
FT                   IFGGGFDPGAAHGGRRTRAARGPDYEMALSLSVQEMIEGGSKSVTTDHPETGRKTLKVT
FT                   IPKGSTPGKRMRLTGQGGSGANGGPAGDLYLVFQLEANSLFTLDGNDVLYNLPVTPWEA
FT                   ALGEKVTVPTPTGGKISMTIPAGSQSGSRLRVRGRGLAGGDYFVTVMIHTPPAKTDEAR
FT                   DFYREMKASMPFNPRD"
FT   gene            complement(103831..103956)
FT                   /locus_tag="Hneap_0110"
FT   CDS_pept        complement(103831..103956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0110"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; KEGG: tcx:Tcr_1270
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94974"
FT                   /db_xref="GOA:D0KWH7"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH7"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACX94974.1"
FT                   /translation="MKILSSLKSAKTRHKDCQIVRRRGKVYVINKTNPRFKARQR"
FT   gene            complement(104152..104227)
FT                   /locus_tag="Hneap_R0001"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(104152..104227)
FT                   /locus_tag="Hneap_R0001"
FT                   /product="tRNA-Phe"
FT   gene            104375..104971
FT                   /locus_tag="Hneap_0111"
FT   CDS_pept        104375..104971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0111"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   dar:Daro_3382 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94975"
FT                   /db_xref="GOA:D0KWH8"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH8"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ACX94975.1"
FT                   /translation="MMPARTAEITRDTAETQIELRINLDGSGRAEFKTGVPFFEHMLDQ
FT                   IARHGLIDMDLTAQGDLHIDDHHTVEDCGIVFGQALAKAVGDKRGITRYGHAYVPLDEA
FT                   LSRVVIDLSGRPGLVFSCSFTRASIGRFETQLVEEFFRGLVNHAGMTLHIDNIRGDNAH
FT                   HQAETIFKAFGRALRMALSPDPRQADQIPSTKGSL"
FT   gene            104974..105624
FT                   /locus_tag="Hneap_0112"
FT   CDS_pept        104974..105624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0112"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: tgr:Tgr7_0214 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94976"
FT                   /db_xref="GOA:D0KWH9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWH9"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ACX94976.1"
FT                   /translation="MAEAIAIVDYGMGNLRSVAKAVAHVAPAGTEVRITDSAEYILSAD
FT                   RVVFPGQGAAADCMAALKSRDLIAPLTEAAKTRPFLGICMGMQVMLDHSDENGGVHLLA
FT                   WFKGAVQRFPAGVDASGLALKIPQMGWNEIRQVRPHPLWHGVADMSRFYFVHSYYCAPE
FT                   DASLTVGETEYGLRYTAALARGSVFAIQSHPEKSADDGLTLLKNFTRWDGRFD"
FT   gene            105661..106416
FT                   /locus_tag="Hneap_0113"
FT   CDS_pept        105661..106416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0113"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: tgr:Tgr7_0215
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94977"
FT                   /db_xref="GOA:D0KWI0"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI0"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ACX94977.1"
FT                   /translation="MLLIPAIDLKAGQCVRLKQGRMDDDTVFSDDPVAMAQRWVDAGAR
FT                   RLHLVDLDGAFAGSPKNRESIAAICAAFPELPIQVGGGIREEETIEQYLAMGVSYVIIG
FT                   SKAVSDPHFVSDACLSFPGHVIVGLDARDGKVAIDGWAKTSNTDATDLARRFEQDGVSS
FT                   IVFTDIARDGMMQGANMEATRALARAVRIPIIASGGMTDMADIDRLIDAADDGVAGAII
FT                   GRALYEGGIDLGMAQSRVDARCGVPPFTE"
FT   gene            106496..107269
FT                   /locus_tag="Hneap_0114"
FT   CDS_pept        106496..107269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0114"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: tgr:Tgr7_0216 imidazoleglycerol phosphate synthase,
FT                   cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94978"
FT                   /db_xref="GOA:D0KWI1"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI1"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ACX94978.1"
FT                   /translation="MSLAKRIIPCLDVADGRVVKGIQFESLRDAGDPVEAARRYNLEGA
FT                   DELTFLDISASHEGRDTMRHVVEQVAEEVFIPLTVGGGIRALADVRSLLNAGADKVSIN
FT                   TAAVFNPDLIKEIADSIGAQCLVVAIDARRVSQPGEPLRWEIFTHGGRKPTGLDAVEWA
FT                   NRMAEYGAGELLVTSMDRDGTKQGFDLELTRAIADSVPVPVIASGGVGNLDDLTAGILQ
FT                   GHADAVLAASIFHFGTYRISEAKANMAAAGIEVRQ"
FT   gene            107266..107676
FT                   /locus_tag="Hneap_0115"
FT   CDS_pept        107266..107676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0115"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   eba:ebB39 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94979"
FT                   /db_xref="GOA:D0KWI2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI2"
FT                   /inference="protein motif:PRIAM:3.5.4.19"
FT                   /protein_id="ACX94979.1"
FT                   /translation="MTVPLWIDAVQWTDDGLVPAIAQDAQTGRILMFAWMNRVALEQTV
FT                   STGEAVYFSRSRQRLWHKGEESGHVQRVQEIRLDCDGDVILLQIEQIGGIACHTGRESC
FT                   FFRRLVDGQWQITDPVLKSPGEIYGEGAHGHE"
FT   gene            107663..108037
FT                   /locus_tag="Hneap_0116"
FT   CDS_pept        107663..108037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0116"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   mfa:Mfla_0256 phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94980"
FT                   /db_xref="GOA:D0KWI3"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI3"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ACX94980.1"
FT                   /translation="MATNNPGELLAQLAAVIEQRKQADPGSSYVAQLFAKGRSKIAQKV
FT                   GEEGVEVALAAVSGDNVAIVSEMADLWFHSMVLLADAGLSHQAVLDELGERFGLSGLEE
FT                   KASRPQSIKSGASKTGNHKN"
FT   gene            108062..108343
FT                   /locus_tag="Hneap_0117"
FT   CDS_pept        108062..108343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0117"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: cti:RALTA_A2864 twin arginine
FT                   translocase protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94981"
FT                   /db_xref="GOA:D0KWI4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI4"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ACX94981.1"
FT                   /translation="MGSFSIWHWLVILAIVLLLFGTKRLKNLGGDLGSAIKGFKNAVKD
FT                   EEKKDADTAASEGSKESLSHKEADSSRVIEGEAVRRQNANDESGNKPS"
FT   gene            108390..109016
FT                   /locus_tag="Hneap_0118"
FT   CDS_pept        108390..109016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0118"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: tgr:Tgr7_0220 twin-arginine
FT                   translocation protein, TatB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94982"
FT                   /db_xref="GOA:D0KWI5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI5"
FT                   /inference="protein motif:TFAM:TIGR01410"
FT                   /protein_id="ACX94982.1"
FT                   /translation="MFGFSIWEIFLILVIALLVVGPERLPGLARTIGTWVHKIKKFVAN
FT                   AKAELDSEFNFQDMKDILNSQESEIAKLRALVEETRQEVNESGRQVLGAVDDAEASFRA
FT                   AAQSEQEVAGAPLKAIDDAAPAEQPVSAENKQAKTGKDADAATGKVKTSAPTSVPLSFD
FT                   EEIRMLEESSGQAFKRPFAPAEPVDAPSNTADANKPSPDSDSKTS"
FT   gene            109013..110113
FT                   /locus_tag="Hneap_0119"
FT   CDS_pept        109013..110113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0119"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: tgr:Tgr7_0221 sec-independent protein
FT                   translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94983"
FT                   /db_xref="GOA:D0KWI6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0KWI6"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACX94983.1"
FT                   /translation="MTERDSSPEADKNGLADVVEETGMAGFLGHLVELRNRLLKGVLAV
FT                   LVLFLILFPFRNELFTMLADPLSRHMPAGSTMIAVEVASPFFIPLKLTALTAVFIAIPF
FT                   LLYQLWAFIAPGLYKHERKLVAPLVFSSTILFYLGAAFAYFVVFPVVFGFLSTAGPSDV
FT                   NFAPDIGEYLSFVTSLFFAFGFVFEVPVAIVLLVIVGVVTPDKLAGFRRYAILIAFIIA
FT                   AILTPPDVLSQFMMALPIIMLYEFGLFVSRFFYKAKLARAAEVEAEESGAADDESDEAV
FT                   SARHAEYEAKAQTQADEPLDMDKAFDEAEADQRRLESDSSASDDGPESNTAGRTEEGEQ
FT                   PSTGSKPEDEPNAPSEPSPKKPDSPV"
FT   gene            110181..111722
FT                   /locus_tag="Hneap_0120"
FT   CDS_pept        110181..111722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0120"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: tgr:Tgr7_0222 phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: BPG-independent
FT                   PGAM domain protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94984"
FT                   /db_xref="GOA:D0KWI7"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI7"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ACX94984.1"
FT                   /translation="MSRTAPRNPVLLIIMDGIGVNPSRENNAYALANTPNLDYLFSHHP
FT                   HTVIEASGRACGLPDGQMGNSEVGHLTLGCGDLIRQDLVRIDDAIADGSFYENTALVEA
FT                   AQKAAADHRPLHLIGLVSDGGVHSHINHLLALIDLASRHGARPLVHMITDGRDTAPKSA
FT                   RSYLPELEASLKAAGGAIATISGRYYAMDRDQRWERTALAWETIVRGDGPRAESAEAAL
FT                   EASYADGKTDEFVLPMALKAFEPIEAGDSVIFFNFRNDRPRQLTEALAQTDFSGFDRGD
FT                   YQTVRVTCLTEYDPRFLSPIGFPPERPKNVLAEVISQAGIKQFHCAETEKYAHVTFFFN
FT                   GGKETPFAGEDRYMAPSPKVATYDLQPEMSAHEVADATIAAVEREEYGFVLVNFANGDM
FT                   VGHTAVRDAVIKAVETVDLEVGRLVQVAQKHGYSIIVTADHGNCDEMVDPVTGEPHTQH
FT                   TVYPVPCLLIDETEPRLRTGGGIANIAATVLELMGLPVPKKMKRSLLLNSSNVSE"
FT   gene            complement(111734..112534)
FT                   /locus_tag="Hneap_0121"
FT   CDS_pept        complement(111734..112534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   tgr:Tgr7_3122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94985"
FT                   /db_xref="GOA:D0KWI8"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI8"
FT                   /inference="protein motif:PFAM:PF03649"
FT                   /protein_id="ACX94985.1"
FT                   /translation="MNIETLSAIDLGLAALLVVALGVVQFLMGLGLQRSLVIGTVRMTL
FT                   QLLLVGLVLKTLFESAHLVWIGLMALVMLALAGYEVSARQKRPIKGWRGYVIGLLSMGV
FT                   TAAIITLLALIVIISPQPWYTPQYAIPLLGMILGNTMTGIGLALNHLTQTAWSNKSRIE
FT                   ARLLLGQTATQAMADLRTEALRAGLIPTLNMLAAAGLISLPGMMTGQILAGAPPMEAVR
FT                   YQILIMLLITAATGFGSLLAVHLGARRLFDDRQRLRLERLGQRS"
FT   gene            complement(112531..113148)
FT                   /locus_tag="Hneap_0122"
FT   CDS_pept        complement(112531..113148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0122"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tgr:Tgr7_3121 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94986"
FT                   /db_xref="GOA:D0KWI9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWI9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX94986.1"
FT                   /translation="MLFEARNVTGEPGSGVRYRPVSLQLEAGEILTIYGQSGIGKSQFL
FT                   RALADLTPHTGDVLLDGVSQTKIRPENWRQQVGYVPAESGWWADVVAQHFSEQPPEAWL
FT                   SMLSLAPELLDAPVERLSTGERQRLALVRALVLQPKVLLLDEPTANLDQRNAQKLIELV
FT                   KTYAQSEQAAVIWVSHDVDERALLGNRSLEICADTTHQAHRS"
FT   gene            complement(113272..114528)
FT                   /locus_tag="Hneap_0123"
FT   CDS_pept        complement(113272..114528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0123"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: cps:CPS_0283
FT                   cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94987"
FT                   /db_xref="GOA:D0KWJ0"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ0"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACX94987.1"
FT                   /translation="MAQGHTPKVDSSAKFVGLVGTVLLLAAIYYLVTSLIHVVTGQTYK
FT                   NEFSPGDAPSVASATSAPASPTSEAASSSPAPTTTPVAAVSGGDAAAGKTKYATCAACH
FT                   GADGKGNGGAFPNLTKLNAADAEAILHAFKKGDKAYLSKHGLGGARYGTMAPQAAGLSD
FT                   ADIADLAAYIAELGGHSASAAEPAAAPAAATSTTASASTGDAAAGKTKYATCAACHGAD
FT                   GKGNGGAFPNLTKLNAADAEAILHAFKKGDKEYLAKHGLGGARYGTMAPQAAGLSDADI
FT                   ADLGAYIAELGGHSASAAPAAAEAAPAAKPAAAAAPTQKIVSSEVVAWGHALFSSCAVC
FT                   HGAAGEGGKLFAAPKLAGLPYDSVVSLLNLYRKGQQMGANSYAMIPQAKHLTDSEINAL
FT                   ASYIAVMNNSADHGATATE"
FT   gene            114766..116844
FT                   /locus_tag="Hneap_0124"
FT   CDS_pept        114766..116844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0124"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: csa:Csal_3245 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94988"
FT                   /db_xref="GOA:D0KWJ1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ1"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ACX94988.1"
FT                   /translation="MVKIAAQQRSVPQKLHLPVDSLAGVGPRVAAQLVRLSIESIGDLL
FT                   WHLPLRYENRGQIVPLGYHLIGQSVLIHVTIAEAKSLMRGKARQVAQGYDDAASITLWQ
FT                   FGRFGPTLQTGQSYLLFGEVREGASGLEMAQPELIQSAQLEAIVPIYPSTEGLSQSKLR
FT                   TLVGQALRVALHDLDECLPAPIRQRFGWPTMLAALQRIHAPVLADGVPTRDEPAFARMI
FT                   GEELLAHLLALRLKRHEQSRDHAPRLSAPGRLYQELLAQLHFLPTKAQTRVLDEIRADM
FT                   AQGSPMLRLVQGDVGSGKTLVAAGAALTAIEQGYQVALMAPTALLAEQHQRNFSQWFSP
FT                   LGIDVQLLSGQQSASERRASLAALAEARSLMVIGTHALFQERVAFDQLGLVIVDEQHRF
FT                   GVHQRLALSDKGTHPDRAGHRPHQLVMTATPIPRTLAMSAYADLDVSIIDELPPGRTPI
FT                   TTALVRSDRRDQLIERISTVCAEGRQAYWVCPLVEDSERIEAQAAESTAELLREQLPHL
FT                   TVGLVHGRMSAAEKNTQMARFKSHEVDLLVATTVIEVGVDVPNASLMIIENADRMGLAQ
FT                   LHQLRGRVGRGRTDSYCVLLFDEPISDKARARLSLMRETQDGFRLAEADLAQRGPGEIL
FT                   GTRQTGLAKLRVADLVRDADLLDTARQLADELIAAQSPDIKPLIQRWVGAAHQYGQV"
FT   gene            117014..117433
FT                   /locus_tag="Hneap_0125"
FT   CDS_pept        117014..117433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0125"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: nmu:Nmul_A1762
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94989"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ2"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACX94989.1"
FT                   /translation="MSIVRYEPFGLLSQLQRELARSEGSTATAEWSPSVDIKEEPDRFV
FT                   ILADVPGVQPQDIDVHMENGQLTIKGEKKTEATAEDKNYKRIERTYGSFYRRFGLPDSA
FT                   EADKISARTKHGVLEIVIPKRESVQPRKINVVSED"
FT   gene            117857..118837
FT                   /locus_tag="Hneap_0126"
FT   CDS_pept        117857..118837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0126"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   nha:Nham_2823 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94990"
FT                   /db_xref="GOA:D0KWJ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ3"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACX94990.1"
FT                   /translation="MALFEFSSAGQRGTEQLDAAVAHYAQIGRVLVEPDQQSGFAYNAR
FT                   IMQERPLAVGSLSVTAARVTRTRAHAAEGNPYDVLGVVLDAGEVEVSLEGRAPFRYAHG
FT                   EAFLWRGDEAGRSHYLSPQTRLLNIALPRATLEGGLAHPDRAEGRRLAASPEFRLLAAY
FT                   ATAFLDVCPKLAPESTQTVALQLQDLALLALGANRDSAEQARNRGVRAARLVAIKSDVE
FT                   AHLLDPELSVRWVLRRHRISERYLRALFADEASSFGDFVLERRLARAWLRLIDPRQHST
FT                   PIGVIAAESGFGDPSWFNRAFRRRFGVSPSEARAIYLTGNGADRC"
FT   gene            119029..120123
FT                   /locus_tag="Hneap_0127"
FT   CDS_pept        119029..120123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0127"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: hch:HCH_01122
FT                   outer membrane protein and related peptidoglycan-associated
FT                   (LipO)protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94991"
FT                   /db_xref="GOA:D0KWJ4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ4"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACX94991.1"
FT                   /translation="MKQPFMAIVLTVSGSALLAAGSAIAFDFGDVLKRTVERATQSEVQ
FT                   RKVDQETRKTVRCALGDTRCEKAARADAEADAADADPAAGEHADAGGDHPLIAPYRGSV
FT                   RKERDVDAFNEYLRIVGRAGKAAKTERLEGKLTRLRYDNPKGRSTFEIERNYRDALTAR
FT                   GFRVDYECVKRTVCGTTDKPSWQSLNGINLGIAGDVRYFTGKLAYGSGAAYVSVAVNPT
FT                   VTYVHVLETASMERDMVAVDADALAAGLEKDGRVRLDGIFFDSGKALLKPESNPALDQA
FT                   VQLLRQQASLKLLIAGHTDDTGSHAANQKLSQQRAEAVRNALLARGIAADRLTAQGFGS
FT                   GVPLADNASDAGRAQNRRVELVKQ"
FT   gene            120120..121379
FT                   /locus_tag="Hneap_0128"
FT   CDS_pept        120120..121379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94992"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94992.1"
FT                   /translation="MKRGLVAGGVIAVVGLASMAAGFVPNPFDAPGVEVVESGGEAARG
FT                   AGEIRAPAPSDNPFDAPIPVVESGSPEARDLVGEEIIGPDPFVLPPIPVVESGSAEARA
FT                   LGERFSNPEAQRLREAAWRADSRFSVNPDSIPGHYRFDLRQRLRVDSADGLVDMSCFVN
FT                   SRDASLICPDWGLSGWGLDLETAQGKLDFVLRQADGDVFACGRHRDVGPACLQLGEEIG
FT                   PAFAWLRNMGLHQALLDSIPATPQALGEGPGGGVQGVRARTADGYLQLWFDRRASTIAT
FT                   QMPWLGLGVGVMKDSRARVNRTVRRARFEGADRDGGDVVIDLVELEPARLERRLDGYRV
FT                   VTAFTAQALDEATSLGQHLHALQREAVGIRAELDACPSGTVGRDCRKHHRERLKALDTR
FT                   ARDRALDFGERHGLPVPERP"
FT   gene            121407..121916
FT                   /locus_tag="Hneap_0129"
FT   CDS_pept        121407..121916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amr:AM1_2973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94993"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94993.1"
FT                   /translation="MTIKATCNAALLLIAAGFTPSVFAVECRVVERIGNHFKDHILTDI
FT                   RGLAVGEYEVSPRKNLIVHSVDDIRFTGCRAVVKATIEVERKVRRDAKGNARIAGDIDP
FT                   DSVKLVDPSVGKWEFCFTKEPRIEKMKLSNTAGIGERQYKKIANRVWPRERCYTFIVPK
FT                   DEERPR"
FT   gene            121913..122284
FT                   /locus_tag="Hneap_0130"
FT   CDS_pept        121913..122284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94994"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX94994.1"
FT                   /translation="MSRSVASRVVKPVALLAIASLLAAAAHATTGKLTKREPVQRPPTD
FT                   SNGCMIESISGSLSFSYQLEGRAKREAIDNWKKQVKRKAPPEFASWKHANRYTKSMNCD
FT                   KYKGKFSCWAKAHPCERPR"
FT   gene            122315..123301
FT                   /locus_tag="Hneap_0131"
FT   CDS_pept        122315..123301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0131"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   nha:Nham_2823 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94995"
FT                   /db_xref="GOA:D0KWJ8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ8"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACX94995.1"
FT                   /translation="MNLKNTPATLLPFNMVSGRYEGLEPVREAWSQLVCLDVMPAEPTV
FT                   PKLSASIWSLGDLKIGTFDGSAVKMVRTTKLAQDCADDLIICIERKTPTRATWGGAGAR
FT                   VFVPGDIHLWRADGTMQCETKGAFSALLLSIPRTVLSNHGIDIAPLLREGGICGNSPET
FT                   RLLCRYTDSVLGEVDALSPMGVSCCLSHLVDLAMLVLGGRNTVRLANRHRVRSVRLASI
FT                   KSDIDAHLLNPELSVGWVLRRHRISERYLRSLFADEDTSFTRFVLERRLMRAHAALDQS
FT                   GRSISEIAYDCGFSDLSWFNRAFRQRFDMTPSQARAGLLDLSLERDG"
FT   gene            123488..126406
FT                   /locus_tag="Hneap_0132"
FT   CDS_pept        123488..126406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0132"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: rpt:Rpal_2455 outer membrane autotransporter barrel
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94996"
FT                   /db_xref="GOA:D0KWJ9"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWJ9"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACX94996.1"
FT                   /translation="MFMDTRAQTKKAPWSSCRFQRFWLWVTTSALALVIAQLAQADEWT
FT                   GVTDDDWFNSANWSFFVVPTSSSPRLVIIDAGSSNPARIGGAGIDNAEATTMDIGVNRN
FT                   GVLEIEGGSRRLFSGDATLGRFWGSRGVVGVNGPDAQWGILGNLVIGNEGSGQITLENG
FT                   ATLGVSGNVDFARFRLAGFGQASEGALIINGGSFVQDPDTGTFGIGISGDATLEISNGG
FT                   QLVSGYTTLGLNADGTAEASIYSNDATRLSRWQANNLRIGGAGQAGLAIGQGAVVHVAG
FT                   DALIGDEAGSRGTVLVFREASSAVDAGILNIGGALAVGEGGHASLLIGNGGKVDVAGVV
FT                   VIADNASASGNLVVGSAGELNTHHDGIYVGALGEGELTLSEGGRALLHGGAVTLGFFAG
FT                   SSGTLNIGAADGSDARAPGVLDASNVRFGAGAGTLVFNHTGHDYVFSSDISGNGLIKHR
FT                   AGGTTLTGDGSAFTGGVFLEGGRLSVNGLLGGGIDVAGGTLAGTGQVGAVILRRGSQIA
FT                   PGNSIGTLKVAGDITIALGSDYEAEVNAAGASDLIHATGTATINGGSINVLPSPDFAVG
FT                   TPYTLLTADGGLVGAGFDAVNFDSLFVSPVLSDDANHVFLTITQTTDFVAVARTSNQVA
FT                   AAGGIQSVASGLLFGAIASLGDADEARRAFDDISGEVHASIKTALIEDTRFVRSATLSR
FT                   QIGEGEDSGLWTKSFGSWGRWDSDGNAGELSRHLGGLLFGRDSLVLEDIQLGWVAGYAR
FT                   SSLHIDERASTSTADSYTLGAYVGRRWDAFSLKGGVAHSWHRLDTARTVAFSGFTDNLS
FT                   ANYSARAFQTYGEAAYSLDIEGARIEPFTNLTYVHLSTDVYSETGGAAALTAASQSIAE
FT                   TFTTIGLRGKSQFDFGGAPTHISGSAGWRHAFGNTPTATHHFSGADNFTVTGVPIAVDA
FT                   LALDLGVSVNLTQDATIGLSYHGQFGSSLIDQGLRASLNVAF"
FT   gene            complement(126577..127962)
FT                   /locus_tag="Hneap_0133"
FT   CDS_pept        complement(126577..127962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0133"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="KEGG: sat:SYN_01079 GGDEF domain-containing protein;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; response regulator receiver; SMART: GGDEF domain
FT                   containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94997"
FT                   /db_xref="GOA:D0KWK0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX94997.1"
FT                   /translation="MADTHPCDAHIRHDLRTPLNHMIGYTEMLLDDLPPTCNDLLSPRL
FT                   KTLLDDAYRMLETINRPAPMSSGHFDGLFPDWRAKMALIEADFNGLKSTIENAWQEACP
FT                   DVEKIGSAIGNMRALLESLSAKPSIDLGDARSQQNARETATHATGGSGHAGGHLLIVDD
FT                   RQENLELMQRRLIREGYRVTVSNSGREALDRLESEQFDVILLDWLMPDMSGTEVLAKIR
FT                   SKSSAHEQPVIVVTARHGSETIVDALTQGANDYLAKPLDFPVALARIATQVYLRRVTQQ
FT                   LADANRQLKQFSYIDGLTAIANRRKFDEYLMTTWRRAQQEGAPVSLILIDVDYFKRYND
FT                   SLGHEAGDHALMRVAKAVSSSLYRVKDLAARYGGEEFAVILPETELADALSVAERVRSA
FT                   VMSLELPHPDSTVMPVVTASLGVGEWRPTAFCEPSALINLADKGLYQAKASGRNQVGTL
FT                   GQN"
FT   gene            complement(127966..128337)
FT                   /locus_tag="Hneap_0134"
FT   CDS_pept        complement(127966..128337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0134"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: cyn:Cyan7425_0748 response
FT                   regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94998"
FT                   /db_xref="GOA:D0KWK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX94998.1"
FT                   /translation="MARILLVEDNEMNRDMLSRRLARKGYEVLLAVDGGEGVAMAKSQQ
FT                   PDLILMDMSLPVLDGWEATRAIRAEPATEAIPIIALTAHAMDGERAKALEAGCNDFDTK
FT                   PVDLPRLLEKIEQQMAKRD"
FT   gene            complement(128341..130917)
FT                   /locus_tag="Hneap_0135"
FT   CDS_pept        complement(128341..130917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0135"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   KEGG: syf:Synpcc7942_1816 periplasmic sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94999"
FT                   /db_xref="GOA:D0KWK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX94999.1"
FT                   /translation="MLQNLRIGTKLTGFLILAFLISIAVSGFFLSSAMNKKAEAEIQTR
FT                   AEMLSRMMNAVRSYTSLHISPKLQQRLFTEQQFISETVPAFSARIIFNSFRDDPAFADF
FT                   RYKEATLNPTSPHDQADAFESGLVAKFRADPSIKILSGFRELNGRNLFYTARPLAVTKA
FT                   SCLQCHSTPQAAPKSLVATYGDKNGFGWKLGEIVSAQTIYVPSDEIFAQGHQYLLWSMG
FT                   IFFGVFAVGTTLLIWQIRRTVVIPIQRLTAAARAIGTGSATREQMAVFDQPQMQQLARR
FT                   GDEPGELARSFQSMAHEVADREQNLNTAVMQRTEELEQALKIAGEARKEAEDANQTKSQ
FT                   FVANMSHELRTPLNAIIGYSEILLEESEDDGNTQYAPDLERILNSGKHLLALVNDILDI
FT                   SRIEAGKMELYLESFPICREIQTVIDTARPVIDKNQNSLVFECDDSLGHMRGDLTKFRQ
FT                   ILLNLISNAAKFTQVGTLTLSVRREDTDHFTIAVADTGIGMNEEQLGRLFQVFSQADAS
FT                   TTRKYGGSGLGLSISRHFARMMGGDITATSTPGSGSVFTVSLPLTVEPQTQTEPANATD
FT                   IPSQPSAPSTNAALDKQAETILVIDDDPSVHDLLKRSLGRAGYRVITASNGTDGLAMAR
FT                   IDRPDFITLDIMMPGVDGWSVLTSLKADPDLKDIPVFVLTMTNEKSLGYALGAAQFLTK
FT                   PVNKDALLGLLRQYKRHPDRCHVLMIDDDADNRNLIRRVLEPEGTVVDEATDGQSGLDW
FT                   LSSHAAPDLVILDLMMPNMDGFAFIDALRQRPEFNSLPVLVLTAKTLTDDDRQRLSQRV
FT                   EYIIERDGLNEELLVGRLHEQLCTHRKNIPSTPSGKAADGDERKET"
FT   gene            131124..131918
FT                   /locus_tag="Hneap_0136"
FT   CDS_pept        131124..131918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0136"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   azo:azo0896 putative phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95000"
FT                   /db_xref="GOA:D0KWK3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK3"
FT                   /inference="protein motif:SMART:SM00331"
FT                   /protein_id="ACX95000.1"
FT                   /translation="MNVELTTAPAPALEFMGADRHVGGRAYQQDQVICLSTPDMKYQLV
FT                   VVADGVGGHWGGEMASKTVIEVARRLFPAQLNQFPASGGFLEYFCQTANDEIRARAARE
FT                   NQEAFSTVVALLTTPGRAYWAHVGDSRLYGFKGAELVHQTNDHSLVQALFDQGRITADE
FT                   RRVHPERNRVLNVLGLNDTVQPTLGEISLTPDMAFLLCTDGFWEHVAVSEMPLILAAAD
FT                   LSFAASVWVRQAARRAGAGGDNVALALWRSPPRSKRGWLSFR"
FT   gene            131937..133043
FT                   /locus_tag="Hneap_0137"
FT   CDS_pept        131937..133043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0137"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: tgr:Tgr7_1992 magnesium and cobalt transport protein
FT                   CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95001"
FT                   /db_xref="GOA:D0KWK4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK4"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ACX95001.1"
FT                   /translation="MSFENRRVGTADRVGMAPGALLEDTHSVPAQIELIHYREHDSSAI
FT                   DPASLQAMQTAIAAHDGVTWLHVQGLPSKAFLEEMGARFGLHPLLLEDIQSRDQRPKLD
FT                   EYVEHLFAVFSVPRWQGDGAVLEQFSLLLGDGYVISIHDAQSDITDILRARLAQSSSRL
FT                   RQHGADYLFYSLIDLIIDQIYPLLETFGGTVDELEERLVTNPGHRALPDIQSAKRTLNQ
FT                   LRRQLWPTREVISHLIRGVSNEPLLEAGLRPYLNDLYDHTVSVMDMLETYRDTVTGLID
FT                   IHLSSVSNRLNEIMRTLTVISTLFIPLTFVTGIYGMNFGNNADSPFAMPELRWYFGYPL
FT                   ILSVMVAVALGMILFFKRRGWIFSRDRF"
FT   gene            133186..134403
FT                   /locus_tag="Hneap_0138"
FT   CDS_pept        133186..134403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0138"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   lch:Lcho_3607 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95002"
FT                   /db_xref="GOA:D0KWK5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX95002.1"
FT                   /translation="MYISLVTETFDPDINGVATTLKQIHSALLSSGHRVQLVCPRGKTA
FT                   RVLDDMLEVPGLALPFYTDVRLGLPVGRRLKRRWQNERPDLVHIATEGPLGYAALRTAK
FT                   ALGLPITSSLHTNFHTYMRFYRVGWLAAPVMRYLKWFHNRTARTFIPTGQQAEALGLSG
FT                   FDRLAVLGRGVDTALFNPERRDAALRAQWSQHSGRAAGDESKVALHVGRLAPEKNLDLL
FT                   LQTFNAMRVAQPDMIGVVVGDGPERARLEKALPWVIFTGMKRGAQLARHYASADLFIFP
FT                   SQTETFGNVLLEAMACGLICVSFDYAAGKHLIHDGKNGYLVPLGDDARFIKAAVDLIRV
FT                   DGPEIRQMGSRARDVAATYDWTRVTRAFEQHLKDVLQVESAQSASDEQPALQGSGRSTN
FT                   QGKTGV"
FT   gene            134405..134968
FT                   /locus_tag="Hneap_0139"
FT   CDS_pept        134405..134968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0139"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: mmb:Mmol_1697
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95003"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK6"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACX95003.1"
FT                   /translation="MTAFIRTVRSSSLLNRYLHWEEVIMYRLNLVNAMRGLRRLFAICS
FT                   RLGDGVAWYVAAALIALFVGEQAWLPMSAMMLSAGVGLGIYASIKRLTARPRPHMAHDG
FT                   LVLSVAPLDKYSFPSGHTLHAVNFAIQIAVFAPGLAWLVIPFALMVALSRMVLGLHYLS
FT                   DVLVGGVIGALIAVSSLWVVGTLS"
FT   gene            135220..136077
FT                   /locus_tag="Hneap_0140"
FT   CDS_pept        135220..136077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0140"
FT                   /product="general secretion pathway protein C"
FT                   /note="TIGRFAM: general secretion pathway protein C; KEGG:
FT                   tgr:Tgr7_0224 general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95004"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK7"
FT                   /inference="protein motif:TFAM:TIGR01713"
FT                   /protein_id="ACX95004.1"
FT                   /translation="MSWSKSRFVWIPSALFLILLATAGVLAARITWMWLAPAPAYVAPP
FT                   ESGAEASEQSQSASVEQIGSWHLFGQAATPDNPTATKISASQLGATLEGTISGSPLPLV
FT                   MLRVGGEVRLLQAGDTLSAGVRIVSIAPDRVVISNQGRLESIAFPKPQSLDQAPAPSAA
FT                   SLTTANPRDVSASAVAPTVRAQAEEIRHNPQTLLRFVTVSPVQQNGEISGYSLRPVPGQ
FT                   EALMRALGLMPGDVLTSVDGMPVNDPALLPRVMPLLNSGQPLQVLVERGGQPLSMTINL
FT                   DSLQ"
FT   gene            136074..138251
FT                   /locus_tag="Hneap_0141"
FT   CDS_pept        136074..138251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0141"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: tgr:Tgr7_0225 general secretion pathway
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95005"
FT                   /db_xref="GOA:D0KWK8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK8"
FT                   /inference="protein motif:TFAM:TIGR02517"
FT                   /protein_id="ACX95005.1"
FT                   /translation="MMNTARRIRGQASSLVIFMALTLVTAEVLINSPVRAADAPPPGIS
FT                   RVQGDNSDTDKVTLNFRDMDIGALIEAVSKVTGKNFIVDPRVKARVTVISAKPMSPQKL
FT                   YDVFLSILQVNGFAAVPAGAVIKIVPEINARSDAQPVNPGSSAVGDQMVTEVVHLRYVP
FT                   AAPLLTVLRQIMPQQAALSVYPDSNSLVITDRAGNIDRLKKILAKVDQPAVGDVEIIRL
FT                   KRASADSVVSTLKALFGASGGGGAKGAPVPGGGAGGNFSSVPAFAADDRTNSVLLSGDA
FT                   VSRAKMRAIILNLDMPQTNYGNTRVFRLKYANAEDLVDVLKGIVSTNGATSTGATATKE
FT                   ATTNPDNNQLEIAADKSLNALVVTASPSRMQTVESVIDQLDIRRKQVLVEAIIAEVSNG
FT                   VTKKLGTQFLVGGGSGTVPIGISTFNGLLSSVASSAAQAGTGSVGSAIGLGLAGALGDG
FT                   GNIGVGRYGQGGADFALLVSALAGNSGNNILSTPSLLTLDNQEASIVVGQNIPIVTGSY
FT                   AQTGSATSPTNPFQTITREDIGVKLKVTPTISPDGTVRLKIEQEVSSLDSAAQSSAGLI
FT                   TNKRNVTTTVQVDDGDVVVLGGLIDDSTNSNQQSVPGLGDIPILGNLFRYRSASTNKRN
FT                   LMIFIRPLIVGDGGKLSEFSREQYNRIRQSQQDTFDKRSLVNPSDWSVLSPEQNFQRNL
FT                   PIPMPQNIQTLMDQDRARSQTASGQTAAPRP"
FT   gene            138262..139770
FT                   /locus_tag="Hneap_0142"
FT   CDS_pept        138262..139770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0142"
FT                   /product="general secretory pathway protein E"
FT                   /note="KEGG: tgr:Tgr7_0226 general secretory pathway
FT                   protein E; TIGRFAM: general secretory pathway protein E;
FT                   PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95006"
FT                   /db_xref="GOA:D0KWK9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWK9"
FT                   /inference="protein motif:TFAM:TIGR02533"
FT                   /protein_id="ACX95006.1"
FT                   /translation="MTVDADTHAHLAKTSPLSYGYARRFGVLIEPDTTAEAAWIVRHCK
FT                   PLPVSVLAELGRKLPDGFTLDWLETDEFERRLARAYEGGSSVAQTMVDDLGDGGLDALA
FT                   NTLNTPIDLLEADDEAPIIRLINALLSEAVREGASDIHLESFESRMVVRFRVDGMLREV
FT                   LEPPRAVAGIIVSRIKVMANLDIAEKRVPQDGRISLRLAGRPVDVRVSTLPSGQGERVV
FT                   LRLLDKEAGRLTLDNLGLTRELQARLNKLIHRPHGILLVTGPTGSGKTTTLYAALSEIN
FT                   TRERNILTVEDPIEYYLDGVGQTQVNPKVEMTFARGLRAILRQDPDVVMVGEIRDVETA
FT                   EIAVQASLTGHLVLSTLHTNSAIGAITRLRDMGVEPFLLSSSLIGVLAQRLVRRLDARY
FT                   REAYTPDASECALLGLDASQPPTLYRVSEEARQRGQGYLGRTGVYELISIDADTRRLIH
FT                   DGAAEPAIEAQVRKHSSSILAYGAALVMAGVTTTEELLRVTAEG"
FT   gene            139777..141000
FT                   /locus_tag="Hneap_0143"
FT   CDS_pept        139777..141000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0143"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   Type II secretion system F domain; KEGG: tgr:Tgr7_0227
FT                   general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95007"
FT                   /db_xref="GOA:D0KWL0"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL0"
FT                   /inference="protein motif:TFAM:TIGR02120"
FT                   /protein_id="ACX95007.1"
FT                   /translation="MAAFEYSALDAQGKTRKGVIESDSARGARSLLRDQGLAPLTIEAV
FT                   VADQSTAGGMQGWMSRFQSLNPTELALFTRQISTLIAAGLPIDAALSGIIRQTENPRIR
FT                   RIVTAVRSKVVEGHSLAQGLATFPRAFSELYRATVAAGEESGHLEAVLERLADYTEGRQ
FT                   ATTQKVQMALFYPALLTLMAVAVVIGLVTYVVPQVVQVFVQMKQTLPPLTRGLIAVSAF
FT                   LREQWPWILLGMAAFAIWFYWALRQPKFAFRWAQIQLKLPLIGRLIRGFNAARFARTLS
FT                   ILSAAGVPMLKALTISGEVVASEPMRRAIKEATDRVREGAPIARSLEQSRLFPPMMLQL
FT                   IAAGEQSGALGNMLERAAVQQERELDTLINALLGLFEPILILVMGGVVLLIVLAILIPI
FT                   FDLNQMVH"
FT   gene            141003..141503
FT                   /locus_tag="Hneap_0144"
FT   CDS_pept        141003..141503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0144"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: tgr:Tgr7_0231
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95008"
FT                   /db_xref="GOA:D0KWL1"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL1"
FT                   /inference="protein motif:TFAM:TIGR01710"
FT                   /protein_id="ACX95008.1"
FT                   /translation="MMSYFSSRLSSQAARIERGNGLISRGFTLIEVMVVVVILAILATI
FT                   VVPKIMDRPDDARIAKAKQDIRAIDSALQLYKLDNLTYPTTDQGLEALVKPPANAKNWR
FT                   QGGYLDRLPIDPWNNPYQYLSPGQHGAFDVYSLGADGQPGGTGADADIGNWQEEGGATN
FT                   TGN"
FT   gene            141512..142153
FT                   /locus_tag="Hneap_0145"
FT   CDS_pept        141512..142153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_0925 general secretion pathway
FT                   protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95009"
FT                   /db_xref="GOA:D0KWL2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95009.1"
FT                   /translation="MLALRAVLDARHAPYAGRHQRMGRQRCAQGFTLIELIVVIVIIGI
FT                   LVGFVVMSMNKRAPDDVGVCQARMASWLAQQAVAANRLDQTIYIQNASTKSPSAFVLNH
FT                   PSAQLQTAASKQTSQNANESPAFVANIISRLDWDKGCALMARPSAADTFAAKDPRADAV
FT                   IAVTPDGIWSLPSGAPQSKPEITVRGDKQKTLPINLSSGFGEQASAGSAP"
FT   gene            142153..142545
FT                   /locus_tag="Hneap_0146"
FT   CDS_pept        142153..142545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0146"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; KEGG: psa:PST_0129
FT                   general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95010"
FT                   /db_xref="GOA:D0KWL3"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL3"
FT                   /inference="protein motif:TFAM:TIGR01707"
FT                   /protein_id="ACX95010.1"
FT                   /translation="MTTTTKTRAQGFTLLEVLIALVVLAIALAAVIKVSGQSAQTLDRL
FT                   RADTAATVIADDLCARLQLSAQAPELGTRQSQVEINGQSWRVRQTVSAGQVPGVLKVAY
FT                   LVETPAPYAGQASIVTYFYPPAQKAP"
FT   gene            142542..143303
FT                   /locus_tag="Hneap_0147"
FT   CDS_pept        142542..143303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0147"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; KEGG:
FT                   pmy:Pmen_2920 general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95011"
FT                   /db_xref="GOA:D0KWL4"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL4"
FT                   /inference="protein motif:TFAM:TIGR01711"
FT                   /protein_id="ACX95011.1"
FT                   /translation="MSVHDSLIQGVGSTRCSIKRAASGFTLLELLVAIAIFALVAVMAY
FT                   GGLNTVIKQSAIVEDQMGQLNAMQNGLRQMRGDLTFAVDRFARDALGGDVPEFAGGGLN
FT                   LLTLTRLGASNPWAAAEPQLALVRWRLENGNLERATFVPPDGAVGNSAEQPDWRIILRN
FT                   VSKIQLTFYDQNNQSMLDWPPINQPSAGLPKAVEVLLTVNNLPPLRMTVAMVSDWPEAA
FT                   PANPPGGTNNGAEPATSPQTQTQTEVEAERR"
FT   gene            143300..144247
FT                   /locus_tag="Hneap_0148"
FT   CDS_pept        143300..144247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0148"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   psa:PST_0131 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95012"
FT                   /db_xref="GOA:D0KWL5"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL5"
FT                   /inference="protein motif:PFAM:PF03934"
FT                   /protein_id="ACX95012.1"
FT                   /translation="MTRVNRFASPTRQQGVALIVALLVLAIATGLAAAVMVRNQNALDA
FT                   TAAFENGARADQLANSAFLLAKALLDRDDRNSDGPADLWAQPLANIPIDGATVSLTISD
FT                   LQGRFNINNLLLPDGKVNLLGKERFARLLNLLNLSPDISNEIIGWIDPSRSLSLGFNSA
FT                   ASRSGNMPAGQPMMSVTELRSLAGVTPAYYDKLAPYVTALPIGTPVNLNSAPPLVLQAI
FT                   GANAASLPVVADSKTPPPNIGSVADFLARPGFAGAVTQPDGLSVNSQFFLCAVTVQFDQ
FT                   VVRHRYALIYRPQSGPSQVIALSNEPCLTGSSCL"
FT   gene            144220..145470
FT                   /locus_tag="Hneap_0149"
FT   CDS_pept        144220..145470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0149"
FT                   /product="Type II secretory pathway component PulL-like
FT                   protein"
FT                   /note="KEGG: swd:Swoo_4726 general secretion pathway
FT                   protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95013"
FT                   /db_xref="GOA:D0KWL6"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL6"
FT                   /inference="protein motif:COG:COG3297"
FT                   /protein_id="ACX95013.1"
FT                   /translation="MSDRLFLFVTNREATELHWWQPEHSAQSASPALGDWDAFADWQAK
FT                   ANLRRPVTLSVLLPDSVCSRLIVPIPGTRREKALQALPFALEDLVADDLSQLYPVLAER
FT                   PLSPGRWPVLLVDADVRTRVLDALKDQGLVPQHLVAMADTLPQPEMGEFCVWVDPVQEH
FT                   ISVLTGPHEGMALAPSTVHNAAEQLAEWLPRMTPAPNRVAFHVPLDQPAHWPEGIEFTA
FT                   QAAPDWAQWHQLWQAGLEQNRALSAITSAKAVNDQQWQRRWWQVAAAAGVVLVLLLVAQ
FT                   GIKTAQMNHQAERLQTQITQDFHAALPQITRMVNVRVQLQQALDQRVGAHEDTFMPALA
FT                   AFGSAYQVAKPQDAQLVIKSIRFGEQQLTVELTAQKYAVLQQLLEHLKKNAPAEVKQID
FT                   AGVDAGVAHMRIGIKAL"
FT   gene            145507..146025
FT                   /locus_tag="Hneap_0150"
FT   CDS_pept        145507..146025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0150"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   aeh:Mlg_2384 general secretion pathway M protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95014"
FT                   /db_xref="GOA:D0KWL7"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL7"
FT                   /inference="protein motif:PFAM:PF04612"
FT                   /protein_id="ACX95014.1"
FT                   /translation="MMKAPVWFSSFWQQRNQSERRTLTLAAIALVALVGYQFVWSPMQQ
FT                   AVQRAHDRLAQAEQLAAFTAQAKKALMQAGPKSAQPSADSPMLWVEQAARTVGIEQQLV
FT                   QRQPDGDDRVQLKFAAVPFDLLLRWLAQANDAGLSVQSANITPKNGDSSDAAGLVDAEI
FT                   TLAKRAAAS"
FT   gene            146022..146858
FT                   /locus_tag="Hneap_0151"
FT   CDS_pept        146022..146858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0151"
FT                   /product="type II secretion system protein N"
FT                   /note="PFAM: type II secretion system protein N; KEGG:
FT                   cps:CPS_4581 general secretion pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95015"
FT                   /db_xref="GOA:D0KWL8"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL8"
FT                   /inference="protein motif:PFAM:PF01203"
FT                   /protein_id="ACX95015.1"
FT                   /translation="MSRTPLKELALRRPRSLVRLGVFIVLVSWFTALLATAPITLIPVS
FT                   RLTLPPGVQLQPLGGTVWHGQWRLSLPRAPDMTVQTDFLPSSVFRLQLAWHVQAQTDAR
FT                   TSPTNANPNIGADLAIGFKQLNVRNFQGRMSADSPLIASLTAWPLSGLIDFSGDASLVR
FT                   TKRGFDLQAARATANWRNAEITTTEPLALGDLVFDAKIAQGQLNATVKPAPNNAGPLLG
FT                   ELNLAGTWPVAKAPAVRGYVQPTARASAALRQQLSLLGRPDASGKITIQGVLPGRY"
FT   gene            147180..147905
FT                   /locus_tag="Hneap_0152"
FT   CDS_pept        147180..147905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95016"
FT                   /db_xref="GOA:D0KWL9"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWL9"
FT                   /inference="similar to AA sequence:KEGG:Tcr_0042"
FT                   /protein_id="ACX95016.1"
FT                   /translation="MWQTIKNLWFQDPSAKPILINDTAVRIRAGMLLAIPIYMGFTLWS
FT                   ARFGGHWIVDGDTIHDTLDTDWDGHIIYSANVIRRTWDYTIQTYVLFYGLFEMIAGMFV
FT                   WTSRLSPTILLSSFLARKQHALWKPLTPKRYAWSLGAFMIALCLIFFNPSTFADWVNAI
FT                   AGRTLLPDTSQYLSYWIPSLVFVCVAFMWLEAVLGFCVGCKIHWLLVKLGVHKEECLAC
FT                   NNIDWDEIARRKAEQAGNG"
FT   gene            complement(148001..149341)
FT                   /locus_tag="Hneap_0153"
FT   CDS_pept        complement(148001..149341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa2968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95017"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM0"
FT                   /inference="similar to AA sequence:KEGG:PSHAa2968"
FT                   /protein_id="ACX95017.1"
FT                   /translation="MSLADAPVAPVYDQAQLDQMAKAMATMQAQIKAMQAKLAAVRAKN
FT                   ATLEAQQETERKNQSAKKVNNKPDATKPSQTDKSLIQRVADAVAKKNAAPIKVGGAVRF
FT                   NYTLEQFNQNSRNTVGDLNFDTFRLNLDGQIDNVILSAEWRYYDYMQVIHHAWVGYKFT
FT                   PNWLVRAGVVKVPFGNLPFNSNSYYFSSLFYAGFEDNYQLGLSTTYDLGNWRFDAAFLK
FT                   NPQPNGFGTSSYSENVVGFDNGLDPSDPNYQRTDAKPINTVVGRAEYTWKANDDLTLKP
FT                   GLSLMRGSLYGQNQREGDYHAYAAHLVADWQRWNLKLEYADYDYALNNKLAERLVYGAY
FT                   AYNSFGPTSAKAVTAGVAYALPVHWGPISKLNFYNDFSRIYDKNDGIDPTWMNVSGVSV
FT                   VAGPVFAYFDFVQGKNQPFVGGNLAPARGSGNAPINRLFNINLGYYF"
FT   gene            150296..152344
FT                   /locus_tag="Hneap_0154"
FT   CDS_pept        150296..152344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0154"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: ilo:IL2388 choline-glycine
FT                   betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95018"
FT                   /db_xref="GOA:D0KWM1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM1"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ACX95018.1"
FT                   /translation="MSTSAPKKLNSTLLAPVFIPSIIVITLLVIGTVADPKRAGDAFSA
FT                   TLAFITNDFGWFYMLAVALFLIFIVVVAISPWGKIKLGPDHAEPEYSFSAWFAMLFSAG
FT                   YGIALLFFGVAEPVLHYADPPVGDPRTIEAARQSMQITFFHWGFHIWAIYGLVGLVLAY
FT                   FGFRHGLPLSMRSALYPLVGDRIYGPIGHTVDVFAVLGTMFGIATTLGLSVAQLNAGLN
FT                   YLWPSVPVNITVQIISIALITALATLSVVAGMDAGIKRLSQLNMLLAIALMLFVFAVGP
FT                   TVFILKTFMQNTGSYLSNIVERSFSLEAYTGGKWIGNWTLFIFGWTIAWAPFVGLFIAK
FT                   ISRGRTIRQFVLGVMVVPTLFTFFWFSVFGDTALHAIMVDGYTHLIDQVEQNKAIALFK
FT                   LFEHLPFASITSFLAIILIVTFFVTSADSGALVVDSLASGGALRTPVWQRIFWASSQGV
FT                   LAAVLLLAGGLSALQTASITSALPFAIIMLISAVGLWRALQIEGYRETSLQHHMNSGRH
FT                   NRLGDSNHWEKRLRNLVDFPSRENVSKYIETTVADSLKTVEAELKKQDWPVKLTQNKEL
FT                   CRYKLSVISGEDMAFEYEVRLRGFAKPSYAFPAITRDNDGDEQYYRAEVFMRRGGLAYD
FT                   VYGYEKDQLISDVLDHFEKYMHFLHTTPAILPWKVVDDEEGEVSGAK"
FT   gene            152452..153762
FT                   /locus_tag="Hneap_0155"
FT   CDS_pept        152452..153762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0155"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tgr:Tgr7_0929 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95019"
FT                   /db_xref="GOA:D0KWM2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX95019.1"
FT                   /translation="MLKTVVSIQALLLGMAILLAGSGMLSTLLGLRAQQEGMSTTVLGL
FT                   VMSGFYLGYILGTYLLPSLIRRVGHVRVFAAMAALSASAALLHGLWLNEWLWLTLRVIS
FT                   GFALLGLYMVIESWLNAQISHYRGQIFGIYMMVSLLALAVGQFLIGIYGVSGLASFMVV
FT                   ALLFALGLVPVALTRATQPVPVEAARLSVRAIYDNAPTGLIGSLLSGTATGALWGLAAV
FT                   YGAHIGLDAARAALFVALLIFGGALLQWPIGKLSDHYDRRWVLIGLGLAGILSGGVMIA
FT                   ITLISGPGNIADSPLRWALWIGGLLFGGFVFSVYAISVAQTHDRLSNDQVLEATRTLLL
FT                   VNGIGALFGPLSAGMFMSWFGANGLIGFIMLVLSVLGLFTYWRIRIDRPVPEDERGEFV
FT                   VTTRTSAAAADWDPRTPEAGDRLSEQFADELLTTKSG"
FT   gene            complement(153774..155000)
FT                   /locus_tag="Hneap_0156"
FT   CDS_pept        complement(153774..155000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0156"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   afr:AFE_1977 fosmidomycin resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95020"
FT                   /db_xref="GOA:D0KWM3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX95020.1"
FT                   /translation="MSTTLTDTPQPVSPAAPVETQYRVLGAISVSHFLNDLMQSLMISI
FT                   YPLFKSNFDLSFAQIGLITLCFQLTASILQPLIGQAIDRRPMPYSLVLGMGFTFSGLIT
FT                   LAFAPSYGFLLAGAAMVGIGSSIFHPESSRVARMASGKRPGLAQSIFQVGGNGGSAAGP
FT                   LLAALIVIPHGQVSISWFSAAALLAMVVLFFVGRWATVQHRKPKTARHLPPVDLSRSMR
FT                   LWILFGLLTLMFSKFLYLASMNNYLTFYLMHRFELPVQSAQLHLFILLFAVAAGTLMGG
FT                   PIGDRIGRQRVIWLSILGVAPFTLLLPHMGLEVQSILLLVIGFVLASAFPAMVVYAQEL
FT                   FPNRIGAVSGLFFGFAFGTAGIGAALLGQFADHFGIDTLIFYCSFLPLIGVIALLLPDL
FT                   REVPASSPT"
FT   gene            155248..156309
FT                   /locus_tag="Hneap_0157"
FT   CDS_pept        155248..156309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0157"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Peptidoglycan-binding LysM;
FT                   Tetratricopeptide repeat; KEGG: azo:azo0897 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95021"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM4"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACX95021.1"
FT                   /translation="MRASMVFSFRTMLLVTLLTLGAVSISGCAQVQDFGKMLKNAQTSS
FT                   ATPSSASDAATGVGQKKSADKPAPSLSLKQIMYLIENGEHAQARAALETFLKNDPKNPM
FT                   ARNLQKQLTIDPAKALGPAVSTYTVQPGDTLGGLAAKFLGNPMDFVILGRYNDIKRGRD
FT                   LQVGQTIKIPSKKKLKALPDEPQTIKANEPTAETPAVIPATSEGAESSTSTEKPALPAS
FT                   ESQTVNSTVVKSNTLVKPISPAEEAKALAAQQAGLAAMQKNQLEEAAKDFSRALAIDPS
FT                   LELAKTRAAQVQQKRVQQYHEAALVAYRKQHLDEAIALWDKALALDPNYEPALGYRARA
FT                   QELKRRLGQLNQQ"
FT   gene            complement(156405..158078)
FT                   /locus_tag="Hneap_0158"
FT   CDS_pept        complement(156405..158078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0158"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; histidine kinase HAMP region
FT                   domain protein; SMART: serine/threonine protein kinase;
FT                   tyrosine protein kinase; histidine kinase HAMP region
FT                   domain protein; KEGG: azo:azo0898 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95022"
FT                   /db_xref="GOA:D0KWM5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACX95022.1"
FT                   /translation="MSKMFGRFEIQGELGRGAMAIIYRGYDPKIERTLAIKTLRPEFSA
FT                   HAEYRERFLTEAKAAGTLNHPHIVTIFDVGEVDGIPFIAMELLTGMTLGQFGESHPEGI
FT                   PPGTLVELAIQIADALDFAHRHGVVHQDIKPENIILQHDQLNIKMMDFGIARIIRDADA
FT                   PSSKGARAFLSGTPQYMSPEQITDQPIDGRSDLYSLGVVLFELLAGHRPYQDDDHWVVW
FT                   QKVLKDPLPTLRPLNPRTPPDLIELVNTLLAKDPDGRYQSAAGVAADLRSIAQRMNEGT
FT                   ERWLSSSVIPLRIRWPLLMALVVAVAMVLGMIWVYHKQNNVITELAYDYGFSLSEWVAV
FT                   QTAEDLLLQDKLALQSWVDSMSHNREIVYMAIRGDKGQIEAQTRGDQLVARMAAQLKED
FT                   HVVLSRGDLRVYAVQQDAGAPFYVFETPITYQNHTIGQLRIGLTTDALATANRTTLLTL
FT                   LTWFAIVLLVVVAGTYWLTRRLQMPLDAVSNALDQIKMGRLEHRIRMHRRDDFERLFAA
FT                   YNAMADVLEARQLQRDASQIEQDLPLGVDKHLATVKDPVE"
FT   gene            complement(158292..158810)
FT                   /locus_tag="Hneap_0159"
FT   CDS_pept        complement(158292..158810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0159"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: azo:azo0899 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95023"
FT                   /db_xref="GOA:D0KWM6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM6"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACX95023.1"
FT                   /translation="MENVQYQTKPQYAGTQGTLLVAKNDDRIHSLDETEQPAHINLDQP
FT                   ALIGLTPPFINQRFTLRQGKTTIGRRADNNIVLADGSVSSLHAWIIEDNGQYRVMNILS
FT                   TNGSFVNDARITEAPLQDGDRIRFGGVELQLHTGLANKKTASSGKNILLAFAAIGIVAL
FT                   VALGWVFMR"
FT   gene            complement(159004..159393)
FT                   /locus_tag="Hneap_0160"
FT   CDS_pept        complement(159004..159393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0160"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="KEGG: aeh:Mlg_0678 GTP cyclohydrolase I; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95024"
FT                   /db_xref="GOA:D0KWM7"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM7"
FT                   /inference="protein motif:TFAM:TIGR03139"
FT                   /protein_id="ACX95024.1"
FT                   /translation="MSTQPSKTLETFPNPFPDRDYTIHMTIPEFTCLCPKTGQPDFATI
FT                   TLDFVPDQLCVELKSLKTYMWSFREEGGFHEAMTNGILNDLVAAISPRFMRVTGEWNVR
FT                   GGIYTNVVVEHRQPGWTPAPKIDLP"
FT   gene            159531..163034
FT                   /locus_tag="Hneap_0161"
FT   CDS_pept        159531..163034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0161"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="TIGRFAM: chromosome segregation protein SMC; PFAM:
FT                   SMC domain protein; KEGG: tgr:Tgr7_2026 chromosome
FT                   segregation SMC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95025"
FT                   /db_xref="GOA:D0KWM8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM8"
FT                   /inference="protein motif:TFAM:TIGR02168"
FT                   /protein_id="ACX95025.1"
FT                   /translation="MRLTRLYLAGFKSFAAPTEILLPAERVAIVGPNGCGKSNLIDAIR
FT                   WVLGESSAKQLRGQSLDDVIFAGSGQRPAASQAVVELSFDNSARRLSGPFGAYDQIVIC
FT                   RSLGRDGQSRYSINQTRVRRRDVVDLFLGTGVGARSYSVIEQGQINRVVDAKPEDLRAY
FT                   LEETAGISLYRERRRETESRIQQTQDNLSRLSDIADELGRQKTQLERQARTAERYRELQ
FT                   KKRRRQVVEQAAVQVVLTERANAALDAEWQTAQAHMTTVAERMAQVELRCAQEDEARTS
FT                   AQSDLQQVQARQYQLGAEQAQLQGRLGELAARIESAEQQRQDDLAQRTRLEAACTRLQA
FT                   ELSRLAEERRTLESQRQQAAEQRAKAQAELRAADTHLNEMRAEWARSHDDLARPQQDLA
FT                   AAKAEHAALLRQLQRLETERASVTSRDFTEPMAASIQQIQDAETRMGALEQSHSAGEVV
FT                   LAEQQTVLAELSDRAAAMQKEAQTLRQNADALQAERRGLERALAAHQTSKDDAPRAERL
FT                   IQRLAKAHADAWWGHALGAGIEAACVDDLDALMVAWRADQIPATGWWVAPDSQRSEPKS
FT                   DLEQKRSPSDALAPWLRDWQHTRHPAPSLNEALAQRHTLPSGHCFVLADGWQVGRHWIG
FT                   RGGSDQAAVRLAQQTRLAELQQAGTEAETTAEQAQIEYQRIQNQLAQQRKQVERLVAEQ
FT                   HQFEQQRQRLHWSLEDLRRKYQQLKQQQADRAANVARMEAEHKQLSADRGQLEDTIRRL
FT                   EQIVAQARSARDAFNARQQTAEQTVQVLRRQAGEAGQALQQLERTVDRNQHQFEQAQQS
FT                   LARDEAQMVQIDQRLAQFADRLDGLITQQSERQAEFTALSARQHEIAQAEKAALALVHE
FT                   HTQAVQTAGVERHETQVALEKARAAVQALELQRAQLAVREDHAGEALTLALDQWRDDQQ
FT                   SLDAEAIKRLADIPNIAEAQAAELSTLEQQIARLGAVNLTAIEAFAEAEARKSELDGQI
FT                   EDVQAALDQLQEAIRTLDKQTRAQFRSVFDAVNARIGPLFVQLFGGGEARLELSGADDL
FT                   DAGVLLFAKPPGKKVTQLSLLSGGERALTAVALIFALFELNPAPFCILDEVDAPLDEAN
FT                   VGRFCAMVSAMSDRVQFLFVTHNKTTMASASALVGVTMREAGVSRIVSVDVDRAVQLLE
FT                   S"
FT   gene            163039..164034
FT                   /locus_tag="Hneap_0162"
FT   CDS_pept        163039..164034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0162"
FT                   /product="cell division protein ZipA"
FT                   /note="KEGG: pay:PAU_01407 cell division protein zipa
FT                   homolog; TIGRFAM: cell division protein ZipA; PFAM: ZipA
FT                   FtsZ-binding region; SMART: ZipA FtsZ-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95026"
FT                   /db_xref="GOA:D0KWM9"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWM9"
FT                   /inference="protein motif:TFAM:TIGR02205"
FT                   /protein_id="ACX95026.1"
FT                   /translation="MEWLRWIFLAAGVLALAGIVWVYLRHKSEQAVELGSGRTEANLDD
FT                   PIDVRIRAQEDARAKSADITLDSALDEAINEGIIGQVKVKERVDPVITPATEPHEVEPE
FT                   PLRWQHPTFTRKNEPEPIDVDDALGLADAEGVIGAVRRKMLDDVPETTGSLFRRRQTPH
FT                   FSYQEKQDSSSDHAELEAPSSAQSTQKNIKQNMGRDADPVVLPLLVASTDGAVFPGDRV
FT                   ENLIEEIGFEYGALSIYHYPGELGETLFSLMNGVKPGTFDRGNSASFATPVLALFMQLP
FT                   LDGPSESLILDQMIDIARDIADQLGGEVLDDQRLPLTSESIDRYREQLNS"
FT   gene            164040..166097
FT                   /locus_tag="Hneap_0163"
FT   CDS_pept        164040..166097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0163"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: tgr:Tgr7_2024 DNA ligase (NAD(+)); TIGRFAM:
FT                   DNA ligase, NAD-dependent; PFAM: NAD-dependent DNA ligase
FT                   adenylation; BRCT domain protein; helix-hairpin-helix
FT                   motif; zinc-finger NAD-dependent DNA ligase C4-type;
FT                   NAD-dependent DNA ligase OB-fold; SMART: NAD-dependent DNA
FT                   ligase ; BRCT domain protein; Helix-hairpin-helix
FT                   DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95027"
FT                   /db_xref="GOA:D0KWN0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN0"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ACX95027.1"
FT                   /translation="MASSLPDLFSAPSEDGDRARLLALRDEIERHNFRYYVLDDPEISD
FT                   AAFDRLMRELQQIESAHPEWITPDSPTQRVGSPTFTTRFAPVTHHQAMLSLDNVFSVEE
FT                   WDAFTQRIQDRLKRDAPLVFAAEPKFDGLAINLIYRQGQLVQAATRGDGQTGEDVTLNV
FT                   RTIAAIPQQLPDSLLSCDLLEVRGEIVMSHKAFAALNAAADARGDKRFVNPRNAAAGSL
FT                   RQKDPRITAKRQLQFFAYGVGAVDGADLPDSQLGLLDWLADLGFTVSEWRRRCEGRDEV
FT                   LAYQQEMSARRSQLDYDIDGVVFKINAQSEQDALGFVAKAPRWAIAFKFPAEEATSRVH
FT                   AVDFQVGRTGALTPVARIDPVFVGGVTVSNITLHNIDEITRKDIRIGDTVVVRRAGDVI
FT                   PEVVRVLPELRPADARLVALPATCPVCGSEVVRAEGEAIARCSGGLFCPAQRREAIKHF
FT                   ASRKAMNIDGLGEKWIELLLEHKLVEHVDDLFHLTVPQVLTLPRMGEKSAQNLVDALSA
FT                   AKQTTLPRFLYALGIREVGEVTAAGLAAHFRNLDALNAATLEDLQAVPDVGPVVAQHVF
FT                   TFLRQPHNQEVIRNLIDAGVHWPAIVATDANALPLAGRTYVLTGTLVGMSREEAGERLK
FT                   ALGAKVSGSVSSKTTAVIAGSEAGSKLTKANDLGVPVLDETDLQKLLRNL"
FT   gene            166146..167123
FT                   /locus_tag="Hneap_0164"
FT   CDS_pept        166146..167123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0164"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: dar:Daro_0658
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95028"
FT                   /db_xref="GOA:D0KWN1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN1"
FT                   /inference="protein motif:PRIAM:2.5.1.30"
FT                   /protein_id="ACX95028.1"
FT                   /translation="MPNMTVDQIRELAAPDMARVNTVIQAKLASDVALINQLSQYIIGA
FT                   GGKRFRPMVLMLAAQALGGTSPWAAQMAAVVELIHTATLLHDDVVDESTLRRGRDTANA
FT                   LFGNAASVLTGDFLYSRAFEMMVEVQEPRVMAILAQATNRIAEGEVLQLMNMGDADVSE
FT                   DRYVDVIVRKTATLFAAATQLAAVLEGQPEEVEAALTAYGLHLGTAFQLIDDVLDYTGD
FT                   EAHTGKHVGDDLAEGKPTLPLIIAMQRGDEATVAMIRRAITEQDARDIEAICSAIEHTG
FT                   ALAYTAHRAQAEADRAKQAIAAVPDSPFKEALLALADAAVVRNH"
FT   gene            167157..167233
FT                   /locus_tag="Hneap_R0002"
FT                   /note="tRNA-Pro1"
FT   tRNA            167157..167233
FT                   /locus_tag="Hneap_R0002"
FT                   /product="tRNA-Pro"
FT   gene            complement(167318..167785)
FT                   /locus_tag="Hneap_0165"
FT   CDS_pept        complement(167318..167785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0165"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type; KEGG:
FT                   tmz:Tmz1t_0193 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95029"
FT                   /db_xref="GOA:D0KWN2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN2"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACX95029.1"
FT                   /translation="MTLDRYDRQILTLLQENGRLSNQELADAIGLSASPCLRRVRALEE
FT                   SGLILGYRALLDARKLGLNLVALLHISMDQHTPERFAHFEQQVARLPEVIECLLITGQT
FT                   ADYQLKVIVTDMDAYQILLLNQITRIEGVTGVQTSFVLRRVLDKTSLPIPD"
FT   gene            168060..169853
FT                   /pseudo
FT                   /locus_tag="Hneap_0166"
FT                   /product="hypothetical protein"
FT   gene            169850..171724
FT                   /locus_tag="Hneap_0167"
FT   CDS_pept        169850..171724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0167"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tgr:Tgr7_0690 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95030"
FT                   /db_xref="GOA:D0KWN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX95030.1"
FT                   /translation="MIQLQSVSLRRGTQLLLENANLTLQPGYRLGLVGRNGTGKSSLLA
FT                   LLEGKLTPDAGNVDRAGGQRLATVAQEMDDLDVSAVESVLAGDVEYDRISKAIATAELA
FT                   EDGMALATLYHDLEAIDGFTARSRAARLLDGLGFAPDAIDRPVRSFSGGWRMRINLARA
FT                   LLAPSDILLLDEPTNHLDLDAVFWLEQWLINYPGSLVVVSHDRDFLDQVCTHIAHLENK
FT                   SLTVYTSNYSGFEQMRAERQAQNAALSAKIERERAHLTAFVDRFRAQATKAKQAQSRIK
FT                   ALARLPVLAATHADSTFTFSFRPAPNSPDPLLTMEHLELGYNGKALLKNIDLTVRAGDR
FT                   IGLLGANGAGKTTLMRVLGGAEKPMAGELFISAGVRVGYYAQHQLEQLDPRDTPMTALE
FT                   RIAGRASTQEVRNFLGGFGFIGDRAFENIEPFSGGEKARLALALLVWQAPNLLLLDEPT
FT                   NHLDLEMREALAAALQTFEGALVVVSHDRSLIEMVCDNFWRVHDGKVGVFDGDLDDYRR
FT                   VLTDERRAANAPAKPAETTKPKSESTWRPATKKPAGKPDKRTDKRVAEIEHRLSAVVLA
FT                   LQALDTQLADPDLYAGPDATRANELTSQRQTLAEEHEALELEWLSLND"
FT   gene            171813..172319
FT                   /locus_tag="Hneap_0168"
FT   CDS_pept        171813..172319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0168"
FT                   /product="phosphohistidine phosphatase, SixA"
FT                   /note="TIGRFAM: phosphohistidine phosphatase SixA; PFAM:
FT                   Phosphoglycerate mutase; KEGG: afw:Anae109_0423 putative
FT                   phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95031"
FT                   /db_xref="GOA:D0KWN4"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN4"
FT                   /inference="protein motif:TFAM:TIGR00249"
FT                   /protein_id="ACX95031.1"
FT                   /translation="MDILLIRHAPAEDREQFALTGQADELRPLTPRGIERMQLAVRGLV
FT                   TLALPIERLITSPLVRAQQTAQIVAPALEIRQFDTEAMLSPQVPNASLIDWLRKQPRVD
FT                   GLALIGHEPNLSQLAETLLCGSANGCMPLKKGGAILLRFAEGIAAGQGQLIWSLTPGIL
FT                   RTLAD"
FT   gene            172415..172978
FT                   /locus_tag="Hneap_0169"
FT   CDS_pept        172415..172978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0169"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: tgr:Tgr7_0230
FT                   membrane protein, rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95032"
FT                   /db_xref="GOA:D0KWN5"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023826"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN5"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACX95032.1"
FT                   /translation="MTDRNQKWLISFLVVAIAVAILLLHGGNELRYDRADILHGQFWRV
FT                   FTGNFVHANWRHLASDMAGLLIWTALAGYLETRRSYLVLLAGTGLGVGVGLLLLDPHVG
FT                   WYVGLSGILHGLFAASAIRLLSRKEWLGGFALLAALTLKILWEQRYGDLGTAKLLGVPV
FT                   LVDAHLYGAVTGAVIVLALLFFRR"
FT   gene            173038..174135
FT                   /locus_tag="Hneap_0170"
FT   CDS_pept        173038..174135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0170"
FT                   /product="transaldolase"
FT                   /note="TIGRFAM: transaldolase; PFAM: Transaldolase; KEGG:
FT                   eba:ebA4676 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95033"
FT                   /db_xref="GOA:D0KWN6"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN6"
FT                   /inference="protein motif:TFAM:TIGR00876"
FT                   /protein_id="ACX95033.1"
FT                   /translation="MSQNDLSVLHSSQGQSLWLDNLSRALLNEGQLAELVQNFGIRGLT
FT                   SNPSIFKKAIVGSPYYTDDIAALKKQYDDVESVYEHLVVKDIQQACDLLRPIFDESHGE
FT                   DGWVSWEESPRIAHNATSTVASAERLKKLTDRPNLLIKVPATDEGIEAFELLIARGISV
FT                   NVTLMFSLDQVKRVFAAYVRGLKALRASGGAVSRVRAVASLFMSRVDTLVDQQLNEIGT
FT                   EAALQLRGKAALALGGMAYQHYRDVFEGEAFAELAKFGARSQYLLWASTGTKNPDYSDV
FT                   LYVENLIAPKTINTLPEATLKAFADHGRIASTLKPRLAEDKKVWDALAGVGIDMDGAVG
FT                   HQLLDEGLDQFAQAFEDLLAAIAQS"
FT   gene            complement(174196..174966)
FT                   /locus_tag="Hneap_0171"
FT   CDS_pept        complement(174196..174966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0171"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   tbd:Tbd_1835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95034"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN7"
FT                   /inference="protein motif:PFAM:PF08754"
FT                   /protein_id="ACX95034.1"
FT                   /translation="MKHAQQNEHQDTSISVEEINAFIDDELIHEDRQRVREHVKKNPEL
FT                   TQLICDIDQVQDWIKEAYEIVPEPPHTKANWRIHALLPGALAAMALLSVGALAGWFASK
FT                   ISSADTDGAHAATMLQANNQIQNVEFASAPTAQTRNVILRLGSDSPRKFTETLNRIEHV
FT                   MKTSAHQPGFQMEVLANSDGLNFLRADTSPYAKQIEALMKKYPNLHFMVCGTSLKNLEE
FT                   SGQKAALLPNVRVTSSAVEQVAQRIREGWSYSAI"
FT   gene            complement(174963..175553)
FT                   /locus_tag="Hneap_0172"
FT   CDS_pept        complement(174963..175553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0172"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   tbd:Tbd_1836 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95035"
FT                   /db_xref="GOA:D0KWN8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACX95035.1"
FT                   /translation="MGPSSFFSGSFLFGRLTFNHRLEQLRPRLYRLAFSWCKESYLAED
FT                   LVQEAMIRALQKQAQLRDEELLDRWVIRILANQWMDHVRSHVRDENIDDMEQTISTDEH
FT                   QSPDSVHGRDEMIERVRSAVMRLPEMQRIVVTLVDLEEFSYKEVATTLDLPIGTIMSRL
FT                   SRGRQSLRNLLIETKNAATEERRKSECHLRRVV"
FT   gene            175789..176268
FT                   /locus_tag="Hneap_0173"
FT   CDS_pept        175789..176268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0173"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   tgr:Tgr7_2583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95036"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWN9"
FT                   /inference="protein motif:PFAM:PF08754"
FT                   /protein_id="ACX95036.1"
FT                   /translation="MIRLRQKIVMTALLLGLIGTAPTVMANPAAEPVSQAVQDKPFAEA
FT                   RVALQISDAAGPKQQLVLNVASNLIKFYGADKVDVEIVAFGPGLRLLFKDNALGDQIQS
FT                   LAAEGVRFSACANTIAAMSKKLGYEPELNPEARIVPAGIVRLVQLNKAGFFVSRP"
FT   gene            176452..177756
FT                   /locus_tag="Hneap_0174"
FT   CDS_pept        176452..177756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0174"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   tcx:Tcr_2159 phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95037"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP0"
FT                   /inference="protein motif:PFAM:PF07396"
FT                   /protein_id="ACX95037.1"
FT                   /translation="MNNNIRILPSAVSKKILIAGLCSGLLIAAPNAFSANWIMLQGTEK
FT                   PGIAPPVKLWGFIQPTYQKDFSSSYNGKYVPPKLIGPNLDSQSSFNIMRARIGVRGAPF
FT                   FLDDKVNYFLLTEFGDNAMTDGGRYGSYRPTLTDASVTLNYIKGARIRLGLFKYPGAEE
FT                   GLQGIGSLNYINYTDVTNQMLLERFPDAGDKNIPPQSTPNADMNAFSNPATGFRDVGVQ
FT                   VFDAFDVGKWEHTYAVMLGNGSGVRMSDGNASKDVYLYWSSAYLFDKKNKGPMSPSVKM
FT                   FSWYQSGKRTNAYNTAQEQDRKRYGAGVTYLKKPYRVTAEYMWGKGMIYQGANNPQTLF
FT                   NDYKANGGYVEGGWFIPNTKWELDLRYDRYQRNVDLPTQTRFSTWTAGVQYHFTPKTRV
FT                   TLDYAMRRYSSDVVPQNNQLQDVGGRLALQVTAIF"
FT   gene            complement(177803..178861)
FT                   /locus_tag="Hneap_0175"
FT   CDS_pept        complement(177803..178861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0175"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="KEGG: dia:Dtpsy_0071 diguanylate cyclase with GAF
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; SMART: GGDEF domain
FT                   containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95038"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX95038.1"
FT                   /translation="MTKKAQNTLDPILDRLASVLAKSTDTATLVRPLLELMEHLTGLDS
FT                   VYLTRIDWSNQVQTIMFTRNCHELVIPEGLEVPLEHTLCRRAIEEQHFFEPDVPKHWAD
FT                   AHLAIDMGIQTYLSAPVRLADEEIFGTLCALGADSTEISPSTQRIVQLFANLIAHQIDR
FT                   ERLITHLQADNRAIGELAMTDALTGLPNRYSLRRALKRELANVRRMDQVLHLAFIDLDQ
FT                   FKEINDRHGHDAGDQFLQAIADALRNGLREGDFVARYGGDEFVAFGISKNTAIAADEAA
FT                   FAARLSDLTVGRFALASTIIDYPGASIGVVTSTPEDHDIDELIERADQAMYRLKKNRRA
FT                   TRRLSDGGENNT"
FT   gene            complement(178858..179517)
FT                   /locus_tag="Hneap_0176"
FT   CDS_pept        complement(178858..179517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0176"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ses:SARI_01884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95039"
FT                   /db_xref="GOA:D0KWP2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP2"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACX95039.1"
FT                   /translation="MTRSAPPDDKHDRTPHGVPDSSGNSPRNSPEKTPETPPEKPPETS
FT                   PKKRRRWRRWLIEIAVFVGVLLAVRAYMAPAIPTDFADAPLPAITFPTLTNGTTGPGTI
FT                   TLGSNPRPTALVFWATWCGVCHVELPWLNELAKTHRIITVAMQSGSADAVRQYLNKNQL
FT                   DHLPVINDPDGQIAKKFGVSVTPTLFFIAPDGRIAMAETGITSPWGIRLRLWWLGL"
FT   gene            179601..180782
FT                   /locus_tag="Hneap_0177"
FT   CDS_pept        179601..180782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0177"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: tgr:Tgr7_0102 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95040"
FT                   /db_xref="GOA:D0KWP3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP3"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ACX95040.1"
FT                   /translation="MRILVGISGGIAAYKSIILIRRLRDAGAEVRVVLTENAAQFVTPL
FT                   SLQAVSGQPVRTHLFDPEAEAGMDHIALARWADVIVIAPASADILARMASGMANDLLTT
FT                   LVLATTAPVTVAPAMNQQMWAHPAVQANLNTLEKRGVRVIGPASGTQACGEVGAGRMVE
FT                   PEEMATQILRARSCVDWRGKQVVITAGGTREPIDPVRFIANRSSGKMGFAMAAAAREAG
FT                   AEVTLICGPNGLPAPAGVHRVDVETAVEMQSAVAAVERMDVFIGAAAVADYRVQTPAEH
FT                   KLKKSAEFDSLTLTLVKNPDIISEVARRVPKPFVVGFAAETENLQTYAEQKRRAKGMDV
FT                   ICANAVGEGLAFDQPDNALSVIWSGGVHHFERAEKTQLSAHLIELIDKIMSRE"
FT   gene            180787..181272
FT                   /locus_tag="Hneap_0178"
FT   CDS_pept        180787..181272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0178"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: pmr:PMI3154 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95041"
FT                   /db_xref="GOA:D0KWP4"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP4"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ACX95041.1"
FT                   /translation="MPIEQGNKTARPTVEVKWLDARLGDTIPRPDYATSGSAGLDLRAC
FT                   LAEPMVLNPGQTELIPTGMAIHIEDPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQG
FT                   QLFVSVWNRSAQPFTIDIGERIAQLVVVPVVQVAFETVEEFTPSHRGSGGFGHTGRA"
FT   gene            181310..182197
FT                   /locus_tag="Hneap_0179"
FT   CDS_pept        181310..182197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0179"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: tgr:Tgr7_0104 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95042"
FT                   /db_xref="GOA:D0KWP5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP5"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACX95042.1"
FT                   /translation="MTSYAPEVTAEVLMEALPYIQRLFDKTIVIKFGGNAMVDEALQDA
FT                   FARDIVLLKQVGLNPVVVHGGGPQINQLLEKLGKQGEFVQGMRVTDRETMDVVQMVLGG
FT                   LVNKDIVALINRHGGRAVGLTGRDAGLVRARKLKVSRQTAEMLEPEIIDIGHVGEVASI
FT                   DPSILNLLESKDFIPVIAPIGVGEDGAAYNINADVVASKIAQVLGAEKLLLLTNTAGVL
FT                   DKEGKLLTGLSARDVEALIENGTIYGGMLPKIDFALDAVRGGVKTVQIIDGRVPHAVLL
FT                   ELLTDKGVGTLIRS"
FT   gene            182291..182836
FT                   /locus_tag="Hneap_0180"
FT   CDS_pept        182291..182836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0180"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   tcx:Tcr_2157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95043"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP6"
FT                   /inference="protein motif:PFAM:PF08754"
FT                   /protein_id="ACX95043.1"
FT                   /translation="MHHTKSIQILGLAGLLGLSVVLPVSGYAAPPEHAAHVDVAALTKA
FT                   ANYPEAESIAAIKAKTADVKARYVLQISDADAQKRGMDMKVASHLLKYYGKGKVDVEIV
FT                   AFGPGLKLLLAENNPQAPMIAKLSAEGVRFSACGNAIHHATQMLGYAPKLVPAARVVPA
FT                   GIVRVHDLAVAGYFADKP"
FT   gene            complement(182847..183512)
FT                   /locus_tag="Hneap_0181"
FT   CDS_pept        complement(182847..183512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95044"
FT                   /db_xref="GOA:D0KWP7"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95044.1"
FT                   /translation="MSSVKIHTGFSSPLPLLPRFRTLCFSHVFVVSITMMCTGFVSVAH
FT                   ADLYRWTTKDGMVHYGDNMPSSQALEGYDLINPATGEVIRHIDRARTPQELAAEAAAKT
FT                   AEEKKRAEEVAQAQRDRMLLDLYSNTSDLERARKQRLDEIDALIKQNQNALDRANERSK
FT                   HAQASSEQKAAFKDVIQLRKNLFDLQERRDETSKRFAEDLQRLEQLQAKGKPLDQAGK"
FT   gene            complement(183708..184925)
FT                   /locus_tag="Hneap_0182"
FT   CDS_pept        complement(183708..184925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0182"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tcx:Tcr_0094 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95045"
FT                   /db_xref="GOA:D0KWP8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACX95045.1"
FT                   /translation="MTPVHGIRPNAAQFMLQLLQVFLVGSLVGMTRTVLPELAESDFGL
FT                   TAGSFLALATFVVVFGLVKALLNLFAGSLSDRWGRRRVLIAGWVSALPIPLLILYGPNW
FT                   GWIILATVFLGINQGLSWSMALNSKLDLTHARQRGLVNGFNEFAGYGGVAIAGMLSALA
FT                   VHALGARTGLFIFTLAIIVLALLIALAAVRETRPWAMLHQGNPTIEPIGMRALFAYASW
FT                   KNRSLLALNQAGMVEKFTDAMVWLFFPVFFMGKGLSLVASGSLIAIYGVVWGAGQLITG
FT                   PLSDRIGRTIMIVGGMWLCGLGVVAVSLSHSIVLWGLELGLIGIGMAMLYPTLGAAVAD
FT                   QAEPAQRASILGIYRFWRDLGYAVGGLLLGLTAQWSGGILLPFWLVGLSMAASGLWAAV
FT                   VANESQ"
FT   gene            185244..185927
FT                   /locus_tag="Hneap_0183"
FT   CDS_pept        185244..185927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0183"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Rhodanese domain protein; regulatory protein
FT                   ArsR; SMART: Rhodanese domain protein; regulatory protein
FT                   ArsR; KEGG: tgr:Tgr7_1961 transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95046"
FT                   /db_xref="GOA:D0KWP9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWP9"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACX95046.1"
FT                   /translation="MAFKQDLNDQFARMGKVLGSGRRLELLDYLAQAPRSVEQLAEVSG
FT                   LTVANTSQHLQKMQQAGLVRANRQGKYIIYQLADGEVVTLLNTLHTLADRHLAEVRALV
FT                   ATHLAPRDALAPITLDELRPHMASGDMTLIDVRPPQEFAAGHLPSAVNIPPDQLASALD
FT                   RLDPKRPVVAYCRGRYCAFSYDAVAALRERGFSARRLAVGFPEWQLAGHPVIYPATSPT
FT                   NQASL"
FT   gene            185924..186892
FT                   /locus_tag="Hneap_0184"
FT   CDS_pept        185924..186892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0184"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: tgr:Tgr7_0048 ATPase associated
FT                   with various cellular activities AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95047"
FT                   /db_xref="GOA:D0KWQ0"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ0"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACX95047.1"
FT                   /translation="MTEPTAIAALRTHLAHHIVGQAALVDRLLIGLLTGGHLLVEGLPG
FT                   LAKTTAVKALAEGVHARFKRVQFTPDLLPADLLGNEIYHPETRTFTFEAGPLFNEIILA
FT                   DEINRAPAKVQSALLEAMAERQVTVAGESRKLPALFLVMATQNPLEQSGTYPLPEAQLD
FT                   RFMLHVSLSYPERQDEYDILARTLAGTLGRDDDEATGLTVDEVLNARADVRAVHCDAAL
FT                   QRWVVDVVAATRAPEKASDALESLAGMVLVGASPRGALAWVQSAQALAWLNGRDFIVPD
FT                   DLLELAGDVLRHRLILSPKALVSGLSRDAIITRLCAEIPFP"
FT   gene            187055..188128
FT                   /locus_tag="Hneap_0185"
FT   CDS_pept        187055..188128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0185"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   psa:PST_2395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95048"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ1"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACX95048.1"
FT                   /translation="MNTLRYLFHSLKNRSTHHAAGEPVDAVAPTSAVIETAWQLGGQLP
FT                   PLASEQLPAAVWFPGDQRAVRLGQGMDFESLRAYQPGEPSHLIDWRISARTPEPVVRVF
FT                   REPAQRQCHIVLDTSDSMFFGTRRQLKITQALTVAHLLTAAALHQNLSVALHTPGLANR
FT                   VPRHPATSRAALLNQLQEIGQWLAPPATPQPIDWTGFRGRMQGCLPEGQIVIVLSDFQT
FT                   DFTEDASLMGWLPLAKKQRLMLLSVIDPAERLLPDMGAVTFMAQPPQRLDTHDPAVRAE
FT                   LSERFTRRQSAVRAFCQGVGGLFDEIQTVTDVPALIDGFGELLLTGHSRQSAEQPQHHP
FT                   VNNAPNRASNRSMGASS"
FT   gene            188140..188670
FT                   /locus_tag="Hneap_0186"
FT   CDS_pept        188140..188670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95049"
FT                   /db_xref="GOA:D0KWQ2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95049.1"
FT                   /translation="MIHPPDGLPDGAPKGLVDVWMPNAPTAASHAKAMLGHAIEHHAVG
FT                   IVVWGLLLGVLIGFAIWFWRDWRGRVLRWQIRRLQHLLRRHPDQVPEPLGAALTWALSK
FT                   YFQPRYFKASSALDRRALSPDWRTLVMRLDILRFGPKAAHEDWFALLRAMQECSRRNAT
FT                   AAATAQVNRMPHS"
FT   gene            188678..189697
FT                   /locus_tag="Hneap_0187"
FT   CDS_pept        188678..189697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0187"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: tgr:Tgr7_0051 von
FT                   Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95050"
FT                   /db_xref="GOA:D0KWQ3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ3"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACX95050.1"
FT                   /translation="MSGFDGMTSLGMTSLGLTSLGMASPWWLLALLPLPWAFAPLKRYL
FT                   THRPAAIMLRHPLIVDHQHTPPPARRAGLIVGLWLASYAALVIALTHPVWQGEFLPAPP
FT                   PARSILLLVDASPSMQAEDFPAGKDRFIARIDAMKQGLLRFIAARPQDRFSVIVVTNSA
FT                   GTLVPMTTDHAVLDYWIRQLRAGINGSDTALGDGLAMAIRSIAAQSQAGQPAPLLVVWT
FT                   DGFSTGGLMTPAEALALARAYGIKLFTVNLAPKGSPPDQGQPSLAQLADLTGGKPILAS
FT                   DLAAMNAVTDQIAASVAPKSATPTERRHIPLYAGFVILATALFLWAQILLWREPEAAS"
FT   gene            189700..191658
FT                   /locus_tag="Hneap_0188"
FT   CDS_pept        189700..191658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0188"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat;
FT                   KEGG: tgr:Tgr7_0052 von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95051"
FT                   /db_xref="GOA:D0KWQ4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ4"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACX95051.1"
FT                   /translation="MLSSTANIFGLHDVLVWLSQRPLVMPHLAEPLWLGLLLVPLALFI
FT                   WRWRARQKILNYADESLQHWAMQRASQASTTWAGRLRGRLIPSFWLLFWFSLALTLAGP
FT                   QVMKAKNEQLATRPPVLFVVDDTAAMSVADVSPNRQSRATALLELLGQALNTHRLGLMI
FT                   DNGEAGLLLPPTGDANLFAFYLKQLAHLAHPLAVPHPDRAFDWIAQMPDMRGGVVVWLT
FT                   SGDANSFQGALGSRELAAAQALNKADVRLIAVTVAGAGGPLLKDGLPLKNTQDQVITSQ
FT                   PAPQRVAELAKLTGGAATQTHTLPQDVAFIRQAVSAVPNRAPDKNSAKAQRSLHELPLM
FT                   LAWLSLLALAALSLGLKPLNGFVARLLRPNKTKPPIAAFLLVAIHGALMSALVAGLSFA
FT                   PSGAWAADKPNHTAATFMSRSADDAEVAAGNRALKAGSYAQAQVAFSAAKGYAARFGAG
FT                   LAAFRRADYAFAVDQLQMAVTLAHTPTQKAQAAFNLGDALTLAGRYAEARDAFTYVLSI
FT                   KPPDETLTAAALTNRGIVQKMLQSFAKNGKNSTRFQGHQAAKYGYFKDPEKSRMDKEIQ
FT                   KSQGASAGSSQASTTATQPTTPFALNAATESSARSKLTLIHDAPAPLLDGLLRQQPYHL
FT                   PTLTAPGKNQAMPAGAP"
FT   gene            191655..193094
FT                   /locus_tag="Hneap_0189"
FT   CDS_pept        191655..193094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95052"
FT                   /db_xref="GOA:D0KWQ5"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95052.1"
FT                   /translation="MSWVTCISMPVFWVNIRRFFLLLVFAGGGLMGQPACAFDIPTPQN
FT                   QPKTINTTPFGVPQDFGPVTALPPITDLDTQSGAGHLPDGMTVQTRITPMPNATANGFL
FT                   ERAPFLVTLTITDRNKTLASLTLHRPYGEHIQTRRIDIDQQLRSIDGRMANVRVYRFAV
FT                   TPLAAGDIELKFAEMTFREVGDSATRYAFIPVARTLTVRPLPGFWPAYLPVTPRLAISS
FT                   EPLPKLAAGQPVDWVLHITGQNLTTYALSKLLDEQLIGTAALGVGHAEIRRATDDKPPA
FT                   DDPLAQTFTVRISLLPDPQGQGDTNGMLPELRLPFIDSTVADPGQHISETVLPARSISW
FT                   PAPASARVLDAVQFWWWRVLLLLVVAYGLGYALNDARKRWQRRCQHRAAQVELAELDTP
FT                   RAVLHRLRQLTGESSIKGMIERAPNPRFIAALQALDAACYGNSDGPVSENCLDNWPQTH
FT                   QELVRWLPKVFFNAPRPTASD"
FT   gene            complement(193091..193690)
FT                   /locus_tag="Hneap_0190"
FT   CDS_pept        complement(193091..193690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95053"
FT                   /db_xref="GOA:D0KWQ6"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95053.1"
FT                   /translation="MTKMPTHHRASARRRFSLMLLMTAFFIATPVYAAAQNGGDSDSGV
FT                   EMVGNVAYVDHLTNLPADFAVMREKKIPMMIFFHASYCGYCVQVDNQFLIPMRLDPEFK
FT                   GRLLIRRVLVDGDTKYIGLDGKEHDYPHLANKLEVRGVPYILFLAPDGSRITSIQGTAY
FT                   EFYDYYLSKDINLATDCAKHPNQKKCDGSKNGPGLN"
FT   gene            complement(194015..194362)
FT                   /locus_tag="Hneap_0191"
FT   CDS_pept        complement(194015..194362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0191"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   bpr:GBP346_A0154 high-potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95054"
FT                   /db_xref="GOA:D0KWQ7"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ7"
FT                   /inference="protein motif:PFAM:PF01355"
FT                   /protein_id="ACX95054.1"
FT                   /translation="MSTHHSDSASSPTRRHFLSVAVKSAVLIPMAGMGMARLAVAADLP
FT                   HLSPSDPTAKALNYVEVASESKSSAYQSGDACDNCALYQGDRKADWGPCAVFPGKDVAS
FT                   KGWCSSYVKMG"
FT   gene            194496..195998
FT                   /locus_tag="Hneap_0192"
FT   CDS_pept        194496..195998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0192"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   afr:AFE_0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95055"
FT                   /db_xref="GOA:D0KWQ8"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ8"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ACX95055.1"
FT                   /translation="MSFTSKQDDSNWYLEQTLAYAVADLCLPAQADRVPNPRMIAWNES
FT                   LAAEMALDLPSEETRAQIFSGNIIPSGAAPSAQAYAGHQFGNFVPLLGDGRALLLGEVI
FT                   DRHGKRRDIQLKGAGRTPFSRGGDGKAALGPVLREYLVSEAMHALGIPTTRGLAAVTTG
FT                   ETLWRKGEVPGAILTRVAASHIRVGTFEFLAARGGDAVRLKQLADYVIHRHYPTLKDSA
FT                   LPYSALLEAVVDAQANLVARWMSVGFVHGVMNTDNTSIAGETIDYGPCAFMEAYHPKTV
FT                   FSSIDLQGRYAYGNQPNIARWNLARFAESLLPLIDTDGDAAIAQANAVLADFPGRYSQH
FT                   WLAAMRPKLGLSSDTGVSDSADTELIHWFLAAMQSERVDFTKGFRQLSTVVRGNVEPLR
FT                   SLFNGSADFADWLEHWNTRIAQEKGTADERAERMDAVNPVIIPRNHQVEAMIEAAVREG
FT                   DFSPFHALLAAVTHPFEDRPEWQNYCEPAPASFGPFTTFCGT"
FT   gene            complement(196011..197153)
FT                   /locus_tag="Hneap_0193"
FT   CDS_pept        complement(196011..197153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mms:mma_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95056"
FT                   /db_xref="GOA:D0KWQ9"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWQ9"
FT                   /inference="protein motif:PFAM:PF10129"
FT                   /protein_id="ACX95056.1"
FT                   /translation="MSHTPTQPTQTNRLLYLDFLRGLMLIGITLGHFGPTFEWLMWQPL
FT                   GFFSNAEGFVLLSGTVFGLVYAKLEQRDPASMAVKARKRAWLIYLSHLGLLLFVALYTW
FT                   ATNGWADDWRSHAQFIAEAPALGLILGTLLIYQPPLLDILPMYALFVLIAPGIIRQLVA
FT                   GRVWLVLGVSLVIWWLFSQVVGGGHWRTTIADSLGMGFPFQVGEFDPLTWQVLFFFGTA
FT                   LGVLMFQRRLPRQPQIVLALIAMVAVVLFFGLRHELIAMPAFWNPAWVDRHELAWLRLV
FT                   NIAALIYTFWTLLYLARKVNWPAWARALPKPFACLGRHSLAVFSVHVVLIYLTIPIQMT
FT                   YPLFWRYVIGLSLILILLALACGLDIRAKRQRQTQLIPVR"
FT   gene            197336..197824
FT                   /locus_tag="Hneap_0194"
FT   CDS_pept        197336..197824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0194"
FT                   /product="L-2,4-diaminobutyric acid acetyltransferase"
FT                   /EC_number="2.3.1.178"
FT                   /note="KEGG: hha:Hhal_1732 L-2,4-diaminobutyric acid
FT                   acetyltransferase; TIGRFAM: L-2,4-diaminobutyric acid
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95057"
FT                   /db_xref="GOA:D0KWR0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012772"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR0"
FT                   /inference="protein motif:TFAM:TIGR02406"
FT                   /protein_id="ACX95057.1"
FT                   /translation="MTLDYREPRLDDGARIHQMVLEAGTLDVNSAYLYFLLSDHFRDTC
FT                   VVAESDSVLCGFLTAYRLPRAPDTLFIWQVAVHPDWRGQGMASGLLEALTGRAWFDDIR
FT                   RVELTISPDNTASQALFRRWAARLDRPLTVSPYLSSELLNAGQDTGHQPEDLYSIALR"
FT   gene            197858..199147
FT                   /locus_tag="Hneap_0195"
FT   CDS_pept        197858..199147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0195"
FT                   /product="diaminobutyrate/2-oxoglutarate aminotransferase"
FT                   /note="TIGRFAM: diaminobutyrate/2-oxoglutarate
FT                   aminotransferase; 2,4-diaminobutyrate 4-transaminase; PFAM:
FT                   aminotransferase class-III; KEGG: noc:Noc_1561
FT                   diaminobutyrate--2-oxoglutarate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95058"
FT                   /db_xref="GOA:D0KWR1"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR1"
FT                   /inference="protein motif:TFAM:TIGR02407"
FT                   /protein_id="ACX95058.1"
FT                   /translation="MDIDLFEKYESNVRGYIRSFPTIFTRAKNATVWDHHGKSYIDFFG
FT                   GAGSLNYGHNDPAVQEAMIDYIQRDGMLNALDKATDAKYHFIKKFQETILLPRGLDYKI
FT                   QFVGPTGTNAVETALKLARKVKQRSKIVAFTNAYHGHTLGALAVTGNEFYHDDYYGVPL
FT                   NVTKMPFDQYFDEDDQMDSIDMMRRYYEDGSSGYEVPAGIIVETIQGEGGINVSSIEWL
FT                   KKLEKMCRDLDILLIIDDIQVGNGRTGNFFSFERAGITPDIITISKSIGTGLPMAIVLM
FT                   RPEIDQWSPGEHTGTFRGNSLAFIAGATALKRWDNDEFAKEIRRKGEWVEKRFRAIKAR
FT                   FPDHISDVRGLGMIWGIESSIEGFCNEVSREAFEHGLLAETAGATDQVIKFLAPLTISQ
FT                   AELDKGLDILEAAIEATAAKHPTTKQEVTA"
FT   gene            199144..199551
FT                   /locus_tag="Hneap_0196"
FT   CDS_pept        199144..199551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0196"
FT                   /product="Ectoine synthase"
FT                   /EC_number="4.2.1.108"
FT                   /note="PFAM: Ectoine synthase; Cupin 2 conserved barrel
FT                   domain protein; KEGG: dol:Dole_0960 L-ectoine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95059"
FT                   /db_xref="GOA:D0KWR2"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR2"
FT                   /inference="protein motif:PRIAM:4.2.1.108"
FT                   /protein_id="ACX95059.1"
FT                   /translation="MIVRRLTPDILGTEREVEAENGNWVSRRLVLADDGVGFSFHDTII
FT                   RAGTETYIHYANHIEGVYCVSGNGEIHDIANDTTHKISDGMMYLLNNHDRHYLRGGTED
FT                   MRLICVFNPPLTGKEVHDENGHYPLLLPGID"
FT   gene            complement(199779..200633)
FT                   /locus_tag="Hneap_0197"
FT   CDS_pept        complement(199779..200633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0197"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: tcx:Tcr_0995
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95060"
FT                   /db_xref="GOA:D0KWR3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR3"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACX95060.1"
FT                   /translation="MTSNQPDLPAVDSGLNWSADWPQTCEAMRRIARQHMSMAATEVET
FT                   KADGSWVTAVDHAVQAAVQDWLAERFPAIGFLGEEMTDEEQNAAWARCLAGEQALWVVD
FT                   PLDGTSNFRAGFPVFSLTLTLLQHGRVIAGLVYDPERDELFHARRGSGAFLNETRLDVR
FT                   TLPALPLARCLAIVDFKRLNKMLACRLAGDAPYASQRSIGSVALDWCWIAAGRVQVYVH
FT                   GKQKPWDYAAGQLIALEAGASSAALDGHRDALDDELKLAPRSAVVAVSESLMDEWLAVL
FT                   LNP"
FT   gene            complement(200739..201752)
FT                   /locus_tag="Hneap_0198"
FT   CDS_pept        complement(200739..201752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0198"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: pnu:Pnuc_0792
FT                   rhodanese domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95061"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR4"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ACX95061.1"
FT                   /translation="MRQRCLGKFAFWCFFSFLSCAATQAHATAMLTLPGPVVCAQWLHA
FT                   HSRDVQIVDVRDDPDSLSTPPIFYTQNGQKHLKRVGGHIPSALSVDFLALRNTHRVDGL
FT                   SLDFQFPTPAEFQSLMQSICLQSNEPIVIAPTGDSAISLQEGALLALELTVYGVPTSEI
FT                   ALLNGGTHAWITAGFPISTNTIFPASGSHWRAKPARASILAHTADVRRQLDRGGLVLDA
FT                   RPLDQFVGITHSPVVTLPGRIQGATALPAEVMYTRAEDGSWHFLTPEQYRNVLAALDIE
FT                   MDSRTKADAIVYCNTGQYAAGAWFILNRIIGDSDIRSYEGSLYNWEHHGLPVVGLK"
FT   gene            complement(202045..202794)
FT                   /locus_tag="Hneap_0199"
FT   CDS_pept        complement(202045..202794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0199"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="PFAM: Protein of unknown function DUF2076; KEGG:
FT                   xfm:Xfasm12_2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95062"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR5"
FT                   /inference="protein motif:PFAM:PF09849"
FT                   /protein_id="ACX95062.1"
FT                   /translation="MNAQEHTLLTDLLNKLKEAAPGAAAAKDPEADQLIRDTLAATPDA
FT                   AYLLVQRHLLLEMSLERAQAELKAIQAKASGSFLGGSIGYAADSRPTQTNAYGQPIGRA
FT                   EPAAVAATTSQAATSTTRPPFGGGSFLGTAAATATGVLGGALLFQGIEHLMGGGLGGSA
FT                   LAGNQPVEDVTSLTENVYESPADMSADTASGGWDNASMADNGSAFDDPMADPIDPMQSD
FT                   NSGLFDQGNSGGGLFDGLFGGGDDDWV"
FT   gene            complement(202943..203884)
FT                   /locus_tag="Hneap_0200"
FT   CDS_pept        complement(202943..203884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0200"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF;
FT                   cytidyltransferase-related domain protein; PFAM: FAD
FT                   synthetase; Riboflavin kinase; KEGG: hip:CGSHiEE_07145
FT                   bifunctional riboflavin kinase/FMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95063"
FT                   /db_xref="GOA:D0KWR6"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR6"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACX95063.1"
FT                   /translation="MQLIRGLCALPAFPDGCVVTLGNFDGVHLGHQAVLRQAADQAREF
FT                   GLPLVVLIFEPLPREFFAPHAPVARLTRLRERAAFIAELGVVDVLLVHPFNAAFAQSTA
FT                   EAFVEQVLVDALHARRIVIGDDFRFGKNRQGDFALLEQLGQRFDFSVQAAATWALDGER
FT                   VSSTRIRSHLTERDVAGAARLLGRPFTLCGRVIHGDKRGRQLGFPTANVALHRRLSPLR
FT                   GVFAVKTTLPDGAIVNGVANVGTRPTVDGQDARLEVHLFDFDRDIYGQMVRVAFCHPLR
FT                   DEQKFSSLEALMEQITRDASAARAWHDHAAHP"
FT   gene            204104..204946
FT                   /locus_tag="Hneap_0201"
FT   CDS_pept        204104..204946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0201"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="PFAM: Restriction endonuclease EcoRV; KEGG:
FT                   hps:HPSH_07075 type II restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95064"
FT                   /db_xref="GOA:D0KWR7"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR015314"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR7"
FT                   /inference="protein motif:PRIAM:3.1.21.4"
FT                   /protein_id="ACX95064.1"
FT                   /translation="MNKKSDFEKALKEFVTTLQGYISSEDGQWTIKGFVDMYKNIYTIS
FT                   SDTKIISKILEIHIFPKLLELSEKHGYKIVLADHQNYYPDISFVDNDDDSVRFAVDFKT
FT                   TYRQPSKPHLCNGFTLGSHGKYFEDRTSTKNIQFPYGSYSGHYCLGIIYDRVDSRDIDE
FT                   TKIYSLDSLTSITSVVGKFSFFVAEKWRIASDKSGSGNTANIGSINNIADIIEGKGMFS
FT                   NLGEEWFDDYWMNYKKITVPDGKGGTKKITNLKEFVAYRKGDVSLIVPKQNRTPGKSK"
FT   gene            204946..205860
FT                   /locus_tag="Hneap_0202"
FT   CDS_pept        204946..205860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0202"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: hps:HPSH_07080 adenine-specific DNA metylase;
FT                   TIGRFAM: DNA adenine methylase; PFAM: D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95065"
FT                   /db_xref="GOA:D0KWR8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR8"
FT                   /inference="protein motif:TFAM:TIGR00571"
FT                   /protein_id="ACX95065.1"
FT                   /translation="MKVSVPPIKSQGIKTKLVPWIKSLVPEKFRGRWVEPFMGTGVVAF
FT                   NVAPDKALMCDTNPHLINFYSAIKSGAITPEIVRGYLVKEGALLQEKGGEHYYSIRERF
FT                   NESHSPLDFLFLNRSGFNGMIRFNRKGWFNIPFCKKPNRFAQAYVTKIVNQVSSVSRLI
FT                   AAKDFDFKCQSFDETISEAKTGDIIYCDPPYIDRHADYFNSWDESHEISLFKNLSEARC
FT                   DFILSTWHHNDYRKNEYIESHWNNFNILTKEHFYHVGGSEKNRNPMIEAIVTTIDTKLY
FT                   EYPEAPKQEQLTLLEPKLHYKSA"
FT   gene            complement(206010..206315)
FT                   /locus_tag="Hneap_0203"
FT   CDS_pept        complement(206010..206315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95066"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR021634"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95066.1"
FT                   /translation="MIPNALMLSLIARQSLEGELVDQLSELADYPLFLVSNVRGHNDTH
FT                   HGLSVAEQVEGTAPLIRLSLFTDEPTANRIIDHLRANFRNAGIRWWRIPLATGMID"
FT   gene            complement(206312..209416)
FT                   /locus_tag="Hneap_0204"
FT   CDS_pept        complement(206312..209416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0204"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: tgr:Tgr7_3246 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95067"
FT                   /db_xref="GOA:D0KWS0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS0"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ACX95067.1"
FT                   /translation="MLNRLIAFSLAQRLMVLLAAILVAGFGWMAFSTIPIDAYPDISPT
FT                   QVQIILKAPGVTPTEVETRITAPLETSLLGIPNQTMLRSTSKYGISVITLDFAEGTDIY
FT                   WARQQVNEALSSARGDLPAGTTGGVAPITTPLGEAFMFTLQSPTLSLTERRHLLDWVIR
FT                   PALRAVKGVADVNSLGGFVRTFEVIPNPTQLAAQKLTTDDLMRVIEQNNRNDGAGRLDV
FT                   GEEAWLVRSEGRIKTLDDLGNLVIAQHNGQPIHVRDVATVRIGAITRLGAVTHSGKGET
FT                   VEGLVLTLRGANARAVVAGVEQRLAEIKPSLPPDLKINVFYNRADLVNAAVHTVSKALL
FT                   EAVVLVLILLILFLGNLRAAVTVALTLPMAALITFILMKQFGMSANLMSLGGLAIAIGM
FT                   LVDAAVVVVENTVAHLAEAHKHPNLPRLHIVYRSVREVAAPVFSGILIIMLVFLPLLSL
FT                   QGLEGKLFSPVALTIIFALGASLVLSLTLIPVIASLILGKVTDHEPWLVRQLHRIYEPA
FT                   LNFALKRPLPVVAVAIAGLVVAGLLYTQIGKTFMPSLDEGTIVMQVENLPSTNLGTTIA
FT                   LNTNIQKTLMAKVPEIAQIVGRSGSDELGLDPMGLNDTDTFIILKPKDQWQASSIDEVR
FT                   EKIRAVISTLPGFNFSFTQPIEMRVSEMLTGSRGDLAIKIFGSDLTEINTLSNEIKSVV
FT                   SAIPGAQDVATTDNEGLLYLNIAVNQAAAARNGLSVNQLEDILRAQIEGQLAGIVQEGV
FT                   ARTPILIRADALTDAPQKLSSLPIALPNGTVQPLSNLAIVERTTGPVFVTREMGSRFAV
FT                   VRANVSGRALTDFVADAKNQIAEKVEMPTGYRLEWGGQFENQQRAAARLAIVVPIALGL
FT                   IFVLLFTTFNSVRQATLVFANIPFALIGGVVALYISGEYLSVPASVGFIALLGIAVLNG
FT                   LVLVSYFNQLAAQGLDIEQVVRQGALRRLRPVMMTASIAALGLVPLLFATGPGSEIQRP
FT                   LAVVVIGGLVTSTLLTLILLPILYKRFGQSSDQRRAQQPLPEAKA"
FT   gene            complement(209416..210552)
FT                   /locus_tag="Hneap_0205"
FT   CDS_pept        complement(209416..210552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0205"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: app:CAP2UW1_4537 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95068"
FT                   /db_xref="GOA:D0KWS1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS1"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACX95068.1"
FT                   /translation="MNQHKHTSLTLMRTTALALLAISATVSTNSLAAAEASSPTAITIP
FT                   DAMRPNLNVKTQPIEFSKQVPVTQGMVTISAASSNQASMQVSAPADGQVMGTLPQVGQA
FT                   VQAGDILFEIASAQLGDAMAQWQMAKAKVTLAQQNLNRDTALFKDGLIAKKRLEATRGE
FT                   AQMASAELKAASARLKAAGADSSAQNGGINLGVRAPITGVITQRMVMPGERVTTGQSLF
FT                   DITATQDQWWLLAISPNKAPAAGQKAELKIAGCPESASVQLMDLAVDPTNQLITLRARP
FT                   NAPCATLRPGQVSTATLWVEQAKPAASLPISALTELDDNTHVFVQRGQNYFSIPVTRVG
FT                   EADGQAFVTGQFEPGDRVVSSGISQLKALSMGMGMGGE"
FT   gene            complement(210549..211913)
FT                   /locus_tag="Hneap_0206"
FT   CDS_pept        complement(210549..211913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0206"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: azo:azo0224 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95069"
FT                   /db_xref="GOA:D0KWS2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS2"
FT                   /inference="similar to AA sequence:KEGG:azo0224"
FT                   /protein_id="ACX95069.1"
FT                   /translation="MSFLIKSTQPAKSGVSFAPSIPPGRKGLGLALIINLSLTLLSGTA
FT                   WAAAPPQTEPAQKTWAQLINQTEQRIEQNLVTEADRVRFESEQARANGILAGAPVVDGL
FT                   YRSDRLMSDFGANEMEIGVRLPLRRFGQSDAWRALAEQSALSAKTRTEANRLILLGDLR
FT                   QMAWDWRRAEVELSTAKERNRIMQRDLAAVTKQLKHGEAAEVDRMSVESRALAVQEAVT
FT                   AAQMQLDTIQTRWQQLTGTSQLPLDLGQVTPTEQALLNNPELNTPDGLLAQQPLLRQMA
FT                   SEVGMSTARIEAERAAGAGTPEIGLGVKRDRGDRGVPYDNSLQLTLSIPFGGQKYRDPA
FT                   LAEMAQQRATAQVALIKNTQQILGEVMALRQRIAAWPSRLTQLDRRAALSEKTLTLKQK
FT                   ALRLGELDWTRLLDFEREAADARLQARLAHIAYQADQSSLKQTLGLMPAANRDSQ"
FT   gene            212094..212882
FT                   /locus_tag="Hneap_0207"
FT   CDS_pept        212094..212882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0207"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: mei:Msip34_2112 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95070"
FT                   /db_xref="GOA:D0KWS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX95070.1"
FT                   /translation="MTDTIHDSAISPNAPRILVVDDDPGIQTLLGRYLREQGFDVRVVG
FT                   SGAEMDIALAADPRVDLLVLDIMLPGEDGLSIARRLDPKTRPPVIMLSARGEDIDRIVG
FT                   LEIGADDYVPKPFNPRELLARIRAVLRRQRMEPDARGKQDERIRVGDFAIDPQTRQAFL
FT                   SDGALDLTHGEWQLLQFFMERPNRVINRDQIMDYLKGYERSAFDRSIDVRITRLRRKIE
FT                   TNPTEPRYLVTIWGEGYLFAPSGRSPRSPDASTAVVGERT"
FT   gene            212879..214294
FT                   /locus_tag="Hneap_0208"
FT   CDS_pept        212879..214294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0208"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   tbd:Tbd_2353 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95071"
FT                   /db_xref="GOA:D0KWS4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX95071.1"
FT                   /translation="MIRKNRTPRVWSLFSTTALTLIASVSFILVFALSAVTWFAMVPMA
FT                   KRSADDLAALIVLSAQTWVELPKDAQPLLAAELKDQHGIEIEEIQTLSRQHGTVLPYVR
FT                   FLHDAVVRRLNACPPNTKDPATGECVYMGILPNNAGYWLELPMADDVLRFEFSPDRVGY
FT                   RIPFTLGIILIGGIVLTLILALFLTRRLTRPVSQLAEQVSRGLPDAPLPLTGPQETRVL
FT                   IDAVNRRSAEVARLLENRTVLLAGISHDLRTPLTRLSLGLALTQDDIEPALQAQMQADI
FT                   EQMNRLIAEVLHIARGVSQDSSEPIPLYPWLTRFAAEWEQRDTGIALMVDEATKMLEID
FT                   VATDSLQRILDNLVENAHRYGRPPIILRSVQTEDAQILCVEDEGQGLTVAEIGRLREPF
FT                   ARKDEARSGVTGYGLGLSLAQALAQAQGWTLDLYAPGEHPYTPDGLMPKGLVACLRLPR
FT                   AVAPVRPLSPRNI"
FT   gene            214686..216095
FT                   /locus_tag="Hneap_0209"
FT   CDS_pept        214686..216095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0209"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: mca:MCA1677 glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95072"
FT                   /db_xref="GOA:D0KWS5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS5"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ACX95072.1"
FT                   /translation="MSVSHAMKMMEENGVKFVDFRFTDTRGKQQHVTYPAGRVDEDSFE
FT                   SGIMFDGSSIAGWKGINASDMILMPDAGSAVMDPFSEESTMILICDVIEPDTMQGYTRD
FT                   PRSVAKRAEAYIQASGLADVAYFGPENEFFVFDDVRWGNEMSGSFVKIDSKEAAWNTGK
FT                   EYEDGNMGHRPGVKGGYFPVPPVDSLHDLRQTMCLVLEDMGQTVEVHHHEVATAGQCEI
FT                   GVAFNTLVKKADEVQNLKYVLHNVAHSYGKTLTFMPKPMFGDNGSGMHVHQSMAKDGKN
FT                   LFSGDSYAGLSEMALYYIGGIIKHAHALNAFCNPSTNSYKRLVPHYEAPVKLAYSARNR
FT                   SASIRIPFVSNPKARRIELRFPDSTANPYLAFAAMLMAGIDGIQNKIHPGEAASKNLYD
FT                   LPPEEEKNIPEVAFSLDEALDALEKDREFLKRGDVFSDDLIDAYLELKRGEVQRLRMLP
FT                   HPVEFEMYYSL"
FT   gene            complement(216269..216736)
FT                   /locus_tag="Hneap_0210"
FT   CDS_pept        complement(216269..216736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0210"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: bpy:Bphyt_6800
FT                   TspO and MBR like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95073"
FT                   /db_xref="GOA:D0KWS6"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS6"
FT                   /inference="protein motif:PFAM:PF03073"
FT                   /protein_id="ACX95073.1"
FT                   /translation="MSSFLVYAISFVLVILVAASGGRFRPDRWYAELKKPVGLPPNWVF
FT                   PVVWISLYAMMAVAAAWVWLAEPSDLRTAGLIIYAAQLVFNAAWSWLFFGLHRTGLALI
FT                   DLLVLITLVSINTWLFVQVDTWAGLLLVPYLIWLLIALYLNASVCWLNRRT"
FT   gene            complement(216936..219419)
FT                   /locus_tag="Hneap_0211"
FT   CDS_pept        complement(216936..219419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0211"
FT                   /product="Protein of unknown function DUF2309"
FT                   /note="PFAM: Protein of unknown function DUF2309; KEGG:
FT                   afe:Lferr_1358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95074"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS7"
FT                   /inference="protein motif:PFAM:PF10070"
FT                   /protein_id="ACX95074.1"
FT                   /translation="MTTLTSLQRSEAQRNHIVDLIDKACLRIAPIWPLDSFVAVNPYLG
FT                   LIDQPFDTVGRYLEQTVGESLFMDHGWFADKIAQGEITDDDLAQAAQQLDPSISLDTIK
FT                   QQLAVHRQPAPALPLVTNELDRRDAPPVSEFVIEQVSQFMANYYDRGQALWHLPKEASA
FT                   SLFAQWRRYTLINRSASAVGLKQVRQHLLAVPSDAIDALFWALDQINLPESRLPDYLFT
FT                   LLKTIGGWASWCRYLHFQAGLHGESQHDLRDLLIIRLVWVALVIKETSSAGRQQWRAKL
FT                   NDWFDPAKLVASPSATATASTKAQSSRIDEILLAAAEQAFRRRINAGLNRQPADAPDQQ
FT                   AERPTVQAAFCIDVRSEVFRRHLEASSPGLETIGFAGFFGLPIDYCRMGESEARLQNPV
FT                   LINPAYRAQETGDPAIAQHRHARQSRGAIWKQFKLSAASCFTFVESAGLSYVPRLLADS
FT                   LGWHRSSLPPDAPGLTPEERARLHPQLVKLDGGALSTQEKVDLAEKVLRGLGLTHTFAP
FT                   IVLLAGHGSSTTNNPHRAGLDCGACAGQAGDVNARVAVQLLNEAAVRLGLIERGIAIPR
FT                   DTRFVAALHDTTTDHIELLDLDQSGIESDQLSSLTQALKQAGELTRLERLVTLEAQVDT
FT                   VDAEKQATFRGRDWSQVRPEWGLAGNAAFIAAPRWRTRGLDLGGRAFLHDYDWRHDKEF
FT                   GVLNVIMTAPLIVANWINLQYYGSTVDNLHQGAGNKVLHNVVGGTVGVIEGNGGDLRVG
FT                   LAMQSLHDGEQWRHEPLRLSAYIEAPIAEIDKIIAGHDMLNALINNRWMHILHIDDNGI
FT                   PHRRHAHGDWRPEPI"
FT   gene            complement(219465..221120)
FT                   /locus_tag="Hneap_0212"
FT   CDS_pept        complement(219465..221120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0212"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: afe:Lferr_1359 NADH/ubiquinone/plastoquinone (complex
FT                   I)"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95075"
FT                   /db_xref="GOA:D0KWS8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS8"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACX95075.1"
FT                   /translation="MTIEFSHTTGLLLLAMPALLLMAAVIKPKQGAAYARAYRQRVQWT
FT                   SFAAFGLALLAVVSFLFARQQNLMLGAGSLPAGLGLLALSIQVNGLTLVLASLVSFVLS
FT                   VIARYSVQYLDGDPQQARFFRLLAVTGGFFLLVVISGNLGLFTLAIIATGFGLHRLLSF
FT                   YADRPRAIMATHKKSIFSRTADALLLAATVLIGHQIGSLEFSQISAYVHAQDHLSIALH
FT                   VAAWLIVLAAILKSAQFPFHGWLIQVMEAPTPVSALMHAGVVYSGAIIVLRTSELLAAD
FT                   GTALLLLALIGLMTLAIGSLVMLTQSAIKSSLAWSTAAQLGFMMLELGLGLFGLALLHL
FT                   VGHSLYKAHAFLSSGSMTDHLRQAKVLKNRPISVVAWFTTVIVSGLFTLGIAAAMGLSI
FT                   DQEPMLPAVLTIIALATAQLMLKALSHGTWREILVAAGAAIAMTGVYVFLHEVFITGFA
FT                   DTLAATPQRAPLLDLLLMAITIITFLFVAWLQGPGKTLMSPERQFALFVHLNNGLYLDR
FT                   WVERLAFRFWPEKVGRAPKKSCAVIPPNPSGIEP"
FT   gene            221411..222358
FT                   /locus_tag="Hneap_0213"
FT   CDS_pept        221411..222358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0213"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tcx:Tcr_0852 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95076"
FT                   /db_xref="GOA:D0KWS9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KWS9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACX95076.1"
FT                   /translation="MTDAATLGARKLLRHATLRQVEVFESVARHVSFTRAAEELHLTQP
FT                   SVSAQVKSLAEVVGEPLYEQVGRRIYLTDAGQIVERSCREVIDILSNAEMSLSELNGMR
FT                   KGRLRLSVITTAKYFAPLALGDFSLQYPDIDLELVISNRDTLLKRIEDNRSDLYVMGQL
FT                   PRTRLDLEVIPFAPNPLVVIAHRDHILAKERNISMERIAQESFIMREPGSGIRHKVEEH
FT                   FARHQQSIKTRLVLDGNEAIKHAVAGRLGISVVSAHALNLENSQEPLVKLDVQSFPLQS
FT                   MWNIVYPRGKALSVVARQFLSFLKIHGGDYLHIG"
FT   gene            222448..222801
FT                   /locus_tag="Hneap_0214"
FT   CDS_pept        222448..222801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi00515 YdzA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95077"
FT                   /db_xref="GOA:D0KX63"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95077.1"
FT                   /translation="MTGTYPEKAQPSASRLLRHLNVMTLVEGASLIALVLIAVPIKYGL
FT                   DFPLAVKVVGPIHGALFVWTMGVLLVSVIAGRLAISKGAGVFLAALIPFGGLWSHRLLD
FT                   RELAHHEPKSPVK"
FT   gene            223050..223448
FT                   /locus_tag="Hneap_0215"
FT   CDS_pept        223050..223448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0215"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   bbr:BB3074 peptidyl-tRNA hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95078"
FT                   /db_xref="GOA:D0KX64"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX64"
FT                   /inference="protein motif:PFAM:PF00472"
FT                   /protein_id="ACX95078.1"
FT                   /translation="MTISIDVNDVEFTAIRSQGAGGQHVNKVSTAIHLRFDIRASALPD
FT                   EAKEKLLAVSDSRISRDGVIVIKAQRFNSQDKNRADALARLQALVAQALRPVKPRKPTK
FT                   PTRGAQLKRLAKKVQRGQTKLLRGRVVE"
FT   gene            223467..224009
FT                   /locus_tag="Hneap_0216"
FT   CDS_pept        223467..224009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0216"
FT                   /product="YaeQ family protein"
FT                   /note="PFAM: YaeQ family protein; KEGG: hch:HCH_00909
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95079"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX65"
FT                   /inference="protein motif:PFAM:PF07152"
FT                   /protein_id="ACX95079.1"
FT                   /translation="MAQKATVYKVDLDISDMDRSYYLSHHLTLALHPSETESRMMFRLL
FT                   AFALNAQEALQFTRGLSADDEPDIWLKDLTGAIDLWIEVGLPDERRLRKACGRAKQVLV
FT                   YAYGDRAVSVWWAKSAREFARLDNLRVFSIDDESLDGLTALIGRGMHLSVSIQDGDIWF
FT                   SDGEGNVPITVRSLQPA"
FT   gene            224238..225791
FT                   /locus_tag="Hneap_0217"
FT   CDS_pept        224238..225791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0217"
FT                   /product="protein of unknown function DUF255"
FT                   /note="PFAM: protein of unknown function DUF255; KEGG:
FT                   chu:CHU_2821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95080"
FT                   /db_xref="GOA:D0KX66"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX66"
FT                   /inference="protein motif:PFAM:PF03190"
FT                   /protein_id="ACX95080.1"
FT                   /translation="MKRYTRWVGLFSVLLLLPQWAQAADIHWQPYGPAVFAKAKAENRL
FT                   ILLDMVAVWCHWCHVMEDKTYSDPAVANEINAHFVAVRVDHDARPDLAERYRNYAWPAT
FT                   IILRPDGGEVLRKAGYIPPERMMKLLHQAEQLPVLAPEPEQVADAAPSSGDPLSSTVRN
FT                   MLIRNHLSLNDPVLGGLKLPQKFLVEGEVRWDMYLAAHGDKQAKKRAIAYLNAALKLID
FT                   PVFGGAYQYSTHGDWQHPHFEKIMSVQADYLRVYSQAYTQFGDDRYRQAIAAIAGYLNQ
FT                   FLSAPDGGFHPSQDADLVQGEKANTYFAKDRAARLAEGVPRVDPHQYTAQTAMAIEGLL
FT                   DAYHATGDRQYFFRAMAGLDWVLRHRRLDDVGFKHDAKDVAGPYLIDNLYMARVYLALY
FT                   RITQTPMWLTQAEQLGDWISTHFTRSEGGLFSAVPDGTPVLPVPQVDQNLQAAGFYLGL
FT                   AQASRKRHYLETATNILAYLARPAVASARSSNAGILLYDAQRDALAKSLPKKTKDAPAS
FT                   "
FT   gene            226041..227918
FT                   /locus_tag="Hneap_0218"
FT   CDS_pept        226041..227918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0218"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: protein of unknown function DUF839; KEGG:
FT                   tcx:Tcr_0864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95081"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX67"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ACX95081.1"
FT                   /translation="MNKNILALAIAGVFSLGLAGCNSSDDTTASATPEPANPAPTGTTL
FT                   ATPTGAAQNEFMVATDFTVPGYTSNLNGASDTLQTAAVDAAKTQPFGFHKLVATGYEDN
FT                   NETFGWIKDKDKKGLVFADGSKYICNGTNQGVGSGLDNSSLIKQADGSLRLVAQFECQV
FT                   GAMYTAGIDQDAVTGALSMKPNSLQFIDQSSEFGGYTHCAGMVTPWNTHLGSEEYEPNA
FT                   RLDSQTSVGKTDDTFYNATFPFWTGSVDSAQNNDPATGMNPYFYGWIPEVKADGTGFTK
FT                   HYSMGRVSHELAYVMPDQKTAYLSDDGTNDGFYKFVADKAGDLSAGTLYAAKFTQTDAT
FT                   AGGKFTLSWISLGHADDATIRAEVAKRPVFDDLFATATPDATTNACPADFTRINTEAGL
FT                   ECLQIKTGMDEIASRLETRRYAAMMGATTELRKTEGITFDAATKTMYVAISSIERGMED
FT                   GYSTVKKTDKYDKGGNNDIRLPANTCGAVYALPVDTNYNATAWNVVIAGTPTTYDANSP
FT                   YTNNYCDVNGIANPDNINMIPDTSLLMIGEDSGAHINNVYWAYDLDTKSLKRVLTVPKG
FT                   AEVTSTFWYQFGNFAYLSVVGQHPLKKESTATPDQKQTLLGYIGPFVKN"
FT   gene            228104..229846
FT                   /locus_tag="Hneap_0219"
FT   CDS_pept        228104..229846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0219"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: ttu:TERTU_3358 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95082"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX68"
FT                   /inference="similar to AA sequence:KEGG:TERTU_3358"
FT                   /protein_id="ACX95082.1"
FT                   /translation="MRRSVDKTILITSLVALPFLLANCGGSGTDTAKTTTSDGAADKTV
FT                   VSLNSDAMLNPAAYIPPQCYTQTRDETGAFAGKSSNPCFACHNMGKEPNYTNDADLQLT
FT                   YAMPAFAQKNNWSNLFIDRRPEIAAIDDAKILEYVRQDNYHDAAGLVALQRVLNAPLPA
FT                   GWDANGDGKWNGYIPDAYFSFDETGFDHAPDGSYTGWRAFAYAAFLGTFWPTNGSTDDV
FT                   LIRLASAFREKTDGTFDLTIYTVNLAIMQAMIQRQNVPIAAVDERIFGVDLNRDGQLGT
FT                   ATQITYDWSPTEGRNMQYVGLAGEHLAQGQVHIAAGLYPEGTEFIHTVRYLDPVGGEVG
FT                   IGMSARMKEVRYAVKRGWNNFAQLKSYADGEVLEDMRFPDRLRRFVGNIETGLQNGTGW
FT                   YYAGFIEDKQGDLRPQSKEELSACMGCHSALSVTTDSSFAFPRKLNADQADGWYHWTQR
FT                   AKGLNGLPEPQYANGVYEYTHYLDINHAGDEFRENKEVIAKFYGTGSTLIPAEVDALHH
FT                   DIGTLLLPSKERAIALDKAYYLIVQEQSFNKGRDAIIEPPVNIHKTVGEDEATGVNEIY
FT                   LIPR"
FT   gene            229934..232051
FT                   /locus_tag="Hneap_0220"
FT   CDS_pept        229934..232051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0220"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein; KEGG: ttu:TERTU_2148 PKD domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95083"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032185"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX69"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ACX95083.1"
FT                   /translation="MKRLFLFVFALVLSLGHLPIVNATTFFSEDFASKSLGQMTTVNVA
FT                   SNANWVYGSYQGDDFAKMNGYGADVASDDWLLTPQITLPAGAAANLFYTTIKGFDGPAL
FT                   QAMISTDYDGSGTPTAVQAATWTTLGGALPTNTTGYSSATSSGPVDLSAYADQKVTIAF
FT                   HYTSTGTVSGAAATWEVLDVQVGDGGAAPSVAASASETSVLTQTPLTFNAKINGGTPPL
FT                   QAVWQFSDGLTQTGAQVQHQFLNPGDYTATVTVTDANGLSATSAPVNVTALKPQAYVLP
FT                   EPKGTLRVATFNTYLNRTVEGELAADLGAGDAQAAAVAEIIQRVRPDVILLNEFDYDPS
FT                   GDALDLFERRYLAIGQNGAHSIQYPYHYVAPVNTGVQSGKDLDHNGTPGDPGDAFGFGS
FT                   FPGQYGMVILSMYPIEADKVRTFQKFLWKDMPNALLPKNPDGSSYYTPAELDVFRLSSK
FT                   SHWDVPVYVNGKTLHILASHPTPPVFDDGTLGVDKDVVDWNGTRNHDEIRLWADYIDPA
FT                   KSGYIVDDKGGKGGLSANARFVIVGDENADPKKGDSTNKAILQLLDNPLVTDTDPTSIG
FT                   ALDNTDARFGASADDTIEDGLRLDYVLPSTFGVTVDQGQVFWPGRTYDLSRLTGFQTVI
FT                   SSDHRMNWQDMTLNVTAVDDVMPSEPAPDSGNTATSNDGGSGAVGPWALLLLTGPLLLA
FT                   RIIRRKHNNPA"
FT   gene            complement(232259..233416)
FT                   /locus_tag="Hneap_0221"
FT   CDS_pept        complement(232259..233416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3579 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95084"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95084.1"
FT                   /translation="MQRLSFRSVLRASLPPIDTWAPRNTRYSSFPRKLEPRKINKLDSR
FT                   IRGNDGFFELPTYRLAALFCLLFFIGHSTFAATLPAIVDEASGLTRSPQHVGVYWTHND
FT                   NINLPASSKKGVPLLFAINNDGKLLGTLKLDGVRQRDWEAITHLDLDGNPTLVIGDIGD
FT                   NRGTWPDYRLWFVPEPVALKTNITQRPTAIIRFRYSDQVPAPRRQGGFSGGHDAESLVF
FT                   DAEHREFLILTKREKSARLFAIPLTSRVNLSDGKPISAQEKKAAVVTARFIANLPTLPA
FT                   PDLVSWLLHPFTSPYADQPTAMALTPDGHLLAILTYSAVYYFYRRAKEDWPTALQKPFA
FT                   SVSLPSIEQWEGASFSADGKKLVIVHEGRGENTVTILQAPWALKN"
FT   gene            complement(233428..233628)
FT                   /locus_tag="Hneap_0222"
FT   CDS_pept        complement(233428..233628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_0811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95085"
FT                   /db_xref="GOA:D0KX71"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX71"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_0811"
FT                   /protein_id="ACX95085.1"
FT                   /translation="MKTNVGSIDKILRIVVGLALIALSVFKPEVVGYWGYIGIIPLLTG
FT                   LFNFCPAYTLLGLNTKGKSAE"
FT   gene            complement(233704..234051)
FT                   /locus_tag="Hneap_0223"
FT   CDS_pept        complement(233704..234051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xop:PXO_00888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95086"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95086.1"
FT                   /translation="MDQRTSPFFSRFARNLSAIGIGVALVMGAQVASADELVMRPDINQ
FT                   AKPGSTYYVHGLSMNQITKKFGQPSRKLAPDPAKGTKYQPPITRWVYPEFTVYFEHGHA
FT                   IHLVKHHKRPK"
FT   gene            234504..235751
FT                   /locus_tag="Hneap_0224"
FT   CDS_pept        234504..235751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0224"
FT                   /product="lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family"
FT                   /note="TIGRFAM: lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family; PFAM: protein of unknown function
FT                   DUF214; KEGG: tgr:Tgr7_1365 lipoprotein releasing system,
FT                   transmembrane protein, LolC/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95087"
FT                   /db_xref="GOA:D0KX73"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX73"
FT                   /inference="protein motif:TFAM:TIGR02212"
FT                   /protein_id="ACX95087.1"
FT                   /translation="MFRSFEWLIGLRYTRAKRRNRFVSFISATSIIGITLGVTALIVVI
FT                   SVMNGFQDELRHRILGMTAHATISENGQALQDWRSLAKKVQNEPDVMASAPYVQAEAML
FT                   SAQPNVSGAIIRGIEPKYEDAVTDIGKHMVAGSLSDLKPGGFGIVLGEALAQSLGVAVG
FT                   DKLMLITANVAVTPVGGLLRQRQFTVVGIFKVGMYEYDRGSAFIDLKDAQALFRMGDGV
FT                   TGLRLKLDDMFRAPWVARDLNLKLGNPYWTTDWTQANGNFFRAVQTERTVMFIILSLIV
FT                   AVAAFNIVSTLVMVVTDKRGDIAILRTLGASPGSIMRIFLISGTVIGLIGTLIGVGFGV
FT                   LIASNVETIVPWIEHLTGTQFMPADVYYISEVPSRLDWNDVWHVGLMAFGLSFLATIYP
FT                   AWSASRVQPAEALRYE"
FT   gene            235744..236451
FT                   /locus_tag="Hneap_0225"
FT   CDS_pept        235744..236451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0225"
FT                   /product="lipoprotein releasing system, ATP-binding
FT                   protein"
FT                   /note="KEGG: mpt:Mpe_A2747 putative lipoprotein releasing
FT                   system ATP-binding ABC transporter; TIGRFAM: lipoprotein
FT                   releasing system, ATP-binding protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95088"
FT                   /db_xref="GOA:D0KX74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX74"
FT                   /inference="protein motif:TFAM:TIGR02211"
FT                   /protein_id="ACX95088.1"
FT                   /translation="MNKPSQAAPTPDIVLETRHLHRTYREGDLVVPVLKGIDLAVKKGE
FT                   MLAIVGASGSGKSSLLQLMGGLDKPTGGEVWLAGHLLSTQSEAARGTLRNRHLGFVYQA
FT                   HHLLPEFSALDNVAMPLLIRRLPRVEAHARARGMLEAVGLGARGEHRPGELSGGERQRV
FT                   AIARALVTEPAVVLADEPTGNLDSHSSDSVFNAMVSLNQRFGTAIVLVTHDNQLAELMQ
FT                   RVLVMHDGVLKPR"
FT   gene            236581..238059
FT                   /locus_tag="Hneap_0226"
FT   CDS_pept        236581..238059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0226"
FT                   /product="neutral invertase"
FT                   /note="PFAM: neutral invertase; KEGG: tgr:Tgr7_0707 neutral
FT                   invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95089"
FT                   /db_xref="GOA:D0KX75"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX75"
FT                   /inference="protein motif:PFAM:PF04853"
FT                   /protein_id="ACX95089.1"
FT                   /translation="MAQKNPDSCFQNPKYAGFSPALDDAYRLIDSALIYYQGQIVGTVA
FT                   STDHTAPAVNYSDCFVRDFFSAGLIMLLEGRADIVRAFLHVIMQLRGQQEALEGQQIAP
FT                   GVLPASFRVHRDADGEETIIADFGDRAIGRVAPVDSMMWWAALLRAYVRYTGDEAFAHT
FT                   PEIQRMLRMILSLCLQSRFEVFPTLLVPDGSFMIDRRMGVNGHPLEIQALFDMTLCCAD
FT                   LLVPEEGSQWLIDLAHRRRVVLRQYLQRYYWLDMDVLNRIYRFSTEMFGEDVENLFNIY
FT                   PESIPEWLPEWLPDGAGYFVGNLGPGRVDFRFFSQGNLLMLVSDLALPEQVKGLMNLID
FT                   LRWNDLIGRMPMKLVYPAIKTHEWRLITGSDPKNIPLSYHNGGNWPVLIWPFVAAAIKA
FT                   GRYDMASRAWAEAEERLLKDNWPEYYDGRTGRLVGRRSNVRQVWSATGLLLARHFLDEP
FT                   DVLNRLGFAPQPPDDPELMGAQWTPQGTQHGGPR"
FT   gene            238056..240410
FT                   /locus_tag="Hneap_0227"
FT   CDS_pept        238056..240410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0227"
FT                   /product="sucrose-phosphate synthase"
FT                   /note="TIGRFAM: sucrose-phosphate synthase; PFAM:
FT                   sucrose-6F-phosphate phosphohydrolase; glycosyl transferase
FT                   group 1; KEGG: tgr:Tgr7_0708 sucrose-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95090"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR012822"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX76"
FT                   /inference="protein motif:TFAM:TIGR02472"
FT                   /protein_id="ACX95090.1"
FT                   /translation="MNDTPAHAKERPAETRPEPMIEPKIESTVESSAEGRKPGLYIVLI
FT                   SVHGLIRGSELELGRDADTGGQTLYVVELARALAKHPVVSRVDLFTRLVRDDRVSADYA
FT                   QPEESLADAPNARIVRVPAGPDEYLPKEQLWDHLDSLSDHALDYIRQTGLKPALVHSHY
FT                   ADAGYVGMRLSLQLGVPLAHTGHSLGRVKRQRLLASGESAKVIEQKYALSRRIRVEEEV
FT                   LAASSLVVVSTQDEIETQYGLYDWADPSRMEVIPPGVDLTRFDPKITGPMPIADELARF
FT                   LREPDKPAILALSRPDERKNIATLVHAYGRNPALQDVANLVIVAGNRDDIRDMDPGSRQ
FT                   VLTEILLLIDRYDLYGKVAYPRHHQSQDVPDFYRWTAQTRGVFINPALTEPFGLTLIEA
FT                   AACGLPILATEDGGPRDIIRACKNGELINPLDAEGMGEQLLALLTDTARWDSYARNGIK
FT                   GVRHHYTWPAHAEQYFETLASMPLHQQTSAPAGASETAAHAASTPMTADRMILIDDRIL
FT                   NTDIDVAALRELIGLLRRHRRQVAYGLVSDRPRHDILALLKKQGLVVPDVLITRGGTQI
FT                   HYGARLSRDKGWSRHISYSWQGDRVYELLAETPGVRLSGRSHQGLYAVHAYIDDPDVFA
FT                   GLNELADAFHQADISARLTALNEREFLVTPQRASKGFAIRYLAAQHDIALMNMLVVGSA
FT                   EADSDLLGGNVLSAQLCAEPDEECVVQGADNSIYCPSASGVAGIRAAMDFYDFLGECRA
FT                   PSTDPEAGGANDEPKPATAASGPASSKEDEV"
FT   gene            240407..241288
FT                   /locus_tag="Hneap_0228"
FT   CDS_pept        240407..241288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0228"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: sucrose-6F-phosphate phosphohydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase type 3; KEGG:
FT                   noc:Noc_2718 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95091"
FT                   /db_xref="GOA:D0KX77"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX77"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACX95091.1"
FT                   /translation="MTSTDITPSAILLCCDLDRTLIPNGAQPESPEARARLRALCAHPD
FT                   IHLVMVSGRHIELVLEAIDQWDLPQPDYIIGDVGTTIYTHPEPEEGPPDSWAMWRSWAA
FT                   ELGPDWGGMTHNDITDLFRDIEAIKPQPIDRQGVFKASYFVDIDANSEILEAELVRRLW
FT                   QLGVNARLIWSVDEAAHTGLLDVLPASASKLHAIEFLSATQKYPMAHTVFAGDSGNDLE
FT                   VLGSHIQSVLVANAPEDVRARALALAESADVAHSLYLARGGLFGMNGNYSAGVLEGLAH
FT                   FLPETLPWMELE"
FT   gene            241531..242199
FT                   /locus_tag="Hneap_0229"
FT   CDS_pept        241531..242199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0229"
FT                   /product="Small-conductance mechanosensitive channel-like
FT                   protein"
FT                   /note="KEGG: afr:AFE_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95092"
FT                   /db_xref="GOA:D0KX78"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX78"
FT                   /inference="protein motif:COG:COG0668"
FT                   /protein_id="ACX95092.1"
FT                   /translation="MSGLDQFFLALGQWLKEWQALVPFFLLLIFGGGSVLLAQRFLRRH
FT                   FNRMVSHAPISPGTLLILRRAISLSLWAVLALLLLRQAGVNVDGIWTMLASMLAVIGVG
FT                   LLAVWTMVSNITASLFIWIWRPYELGETIEMLPNNVKGRAVDRSLMFTTLREADGTLLM
FT                   IPNNQFFQNVTRRWPNRTRVTDYEAWEAERNLGAAEYASHPASPNPAVPDSSPKDDVVT
FT                   "
FT   gene            242272..242757
FT                   /locus_tag="Hneap_0230"
FT   CDS_pept        242272..242757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0230"
FT                   /product="Fimbrial protein pilin"
FT                   /note="PFAM: Fimbrial protein pilin; KEGG: xcb:XC_1059
FT                   pilin"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95093"
FT                   /db_xref="GOA:D0KX79"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX79"
FT                   /inference="protein motif:PFAM:PF00114"
FT                   /protein_id="ACX95093.1"
FT                   /translation="MLTVSGHKVIPAHHERGFTLIELMITIAIIGILASIALFAYQDYI
FT                   IRAQVSEGVTLVSGPELALAEWTGGHPNFPNSGNPGNNTSLGLAAPGSISGSYVQSVAV
FT                   INGGKIELTYGNKANAAIAGAAKKCTLSPLTSAPGAIRWQVDSCGFNSRYLPQAWRP"
FT   gene            243082..244044
FT                   /locus_tag="Hneap_0231"
FT   CDS_pept        243082..244044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0231"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: mei:Msip34_2489 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95094"
FT                   /db_xref="GOA:D0KX80"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX80"
FT                   /inference="protein motif:TFAM:TIGR02070"
FT                   /protein_id="ACX95094.1"
FT                   /translation="MQNQEQALSIHPLFSKGDIFSSGVILIPVKIKQNSVRVMQKLSFF
FT                   AIFYGTALIHAQYSNFIITALLMDHPFRKIPYASPMPSTKKSRRPIRRLIFLLFALALL
FT                   VFVLVQAWFYVQVWQLRTHNPQTTAFMRERLALIQAVNPKAKLDYHWVNYAAIAPIAKR
FT                   AVVASEDDRFMEHYGFDWTGIQDAFEKNLAEGEFAAGGSTISQQLARNLFLSPSKNLWR
FT                   KGEEAIITLMLETTLGKRRILELYLNVVEWGNLLYGIDAASHYYFHKSPAALTPHEAAF
FT                   LAAMLPNPRFYQDNPGSRGLQKRIRAVEGRMNYSRIPPQ"
FT   gene            244073..245356
FT                   /locus_tag="Hneap_0232"
FT   CDS_pept        244073..245356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0232"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: bpt:Bpet4030
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95095"
FT                   /db_xref="GOA:D0KX81"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX81"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACX95095.1"
FT                   /translation="MKSKEAAEPIIAVIGLGYVGLPLAVEFGKIRPVIGFDVDATRIDQ
FT                   LKSGHDRTREVEPDELQNARHLSYTVDPADLRKASLFIVTVPTPIDAHKRPDLSPLIKA
FT                   SETVGRALKRGDIVIYESTVYPGATEEDCVPVLEQYSGLRFNHDFYCGYSPERINPGDK
FT                   THRLPAIKKVTAGSTPAVAEAVDALYRQIITAGTHPAPSIRVAEAAKVIENTQRDVNIA
FT                   LINELAILFGKLGLDTQAVLEAAGSKWNFLPFRPGLVGGHCIGVDPYYLTHKAQQVGHH
FT                   PEMILAGRRINDGMGAYVAGQLIKAMLKKGITVQGARVLVLGLTFKENCPDLRNTRVID
FT                   VITELKDYGLTVDVHDPWADAACARHEYGLELTATPPSNTYEAIVLAVAHREFRTLGAP
FT                   AIHALGKEQHVLYDLKHLFHADEADIRL"
FT   gene            245635..245952
FT                   /locus_tag="Hneap_0233"
FT   CDS_pept        245635..245952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0233"
FT                   /product="DNA polymerase beta subunit"
FT                   /note="KEGG: aeh:Mlg_0863 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95096"
FT                   /db_xref="GOA:D0KX82"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX82"
FT                   /inference="similar to AA sequence:KEGG:Mlg_0863"
FT                   /protein_id="ACX95096.1"
FT                   /translation="MIEPHIMRLTPAVQHTIKTTAAEVFGAEAKISLFGSRTDDTRKGG
FT                   DIDLLVELPSPQSEVQRKRLSFVARLQQRLGDQPIDVLIVQPNTQKQAIHEVAQATSIP
FT                   L"
FT   gene            245949..246482
FT                   /locus_tag="Hneap_0234"
FT   CDS_pept        245949..246482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_1983 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95097"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX83"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1983"
FT                   /protein_id="ACX95097.1"
FT                   /translation="MNTNQLSDRARFLATLRIVAKESAHLEWSQQRLFSQPITPAWVEA
FT                   LDTHPELAERLEAFVSRYGRLQDTIADKLLPRWLRALAERPGSQIEVLNRAEQLGVLED
FT                   VSQWLEARQLRNTLIHEYMEDSATFAENIQLAEQYSHLLLATYQRIHNDAATRLNIAPH
FT                   ELPEHTGYPQHDRP"
FT   gene            246469..247197
FT                   /locus_tag="Hneap_0235"
FT   CDS_pept        246469..247197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0235"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: chl:Chy400_1643 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95098"
FT                   /db_xref="GOA:D0KX84"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX84"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACX95098.1"
FT                   /translation="MIAPKLRRLLGGLRQTPLHPQWLVFKDTRQQKQRIAKRIQGRLLD
FT                   IGCGEKPLTPFLSAGVNYIGLDYPPTVAKGYSGKADVFGDGQRLPFADASFDCITILDV
FT                   MEHLPNPEAAFGEMLRVLKPGGILISQTPFLYPLHDLPHDFQRWTGEGLSQFTQRHPAD
FT                   LIERHHHSKPLETAAILTNLALAKGMLDSLHAKHPGLLLLPLVILLVPIINLAGWAFAR
FT                   LLPDEGFMPLGYTAVFKKRA"
FT   gene            247194..248333
FT                   /locus_tag="Hneap_0236"
FT   CDS_pept        247194..248333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0236"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   scl:sce3582 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95099"
FT                   /db_xref="GOA:D0KX85"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX85"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX95099.1"
FT                   /translation="MKLLIVTTSYPDDSDGAAAAGVFVRDFALALVEQGHQVSVIAPSQ
FT                   TSRITDENNVRVQRFAVPKLPLSLLKPHDPRDWTAIIHTLRQGQHHVNHICATYRPDYI
FT                   FALWALPSGAWARQASRRYGVPYGTWALGSDIWSLGKIPLIRQGLRHVLRHAAHRYADG
FT                   LQLAQDVTDISGLNCDFLPSARRLLVTNPRTIASTPPYRLAFLGRWHPNKGIDLLLEVL
FT                   EQLTDNDWQRIEHLRIFGGGAMHAQVHQHCARLIALGRPIEIGGFLDQSAASELLNWTD
FT                   FVLIPSRIESIPVIFSDAMQARRPVIAMPTGDLPALLNEHGCGEVAADISAAAFAFALR
FT                   KALQSNASEYASGTQSACARFDIAESARRFTRNIELRSQ"
FT   gene            248330..249076
FT                   /locus_tag="Hneap_0237"
FT   CDS_pept        248330..249076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0237"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: vcj:VCD_003094 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95100"
FT                   /db_xref="GOA:D0KX86"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX86"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACX95100.1"
FT                   /translation="MSEFTTPTTDPRWGADKRNIKAEQIAHILENLGRVKLEQSNVLDI
FT                   GCGSGGIAAHLAPRVQSMTGMDPEPWPRWDIWLEAHPNLKFMQGSVESNSLEPHSFDVI
FT                   ICNQVYEHVPDPQALIQLIARLIKPEGIVYFAGPNLLFPIEPHVFWPFVHWIPRELAIK
FT                   IMKAFRAKYIDYLDAYSTHYWKLKSWLSPQFEIKNAIPFLIRETHPVIKDKKTLTSHIP
FT                   SSVLSILTPLTPGFVFLLKPRENVMK"
FT   gene            249073..249999
FT                   /locus_tag="Hneap_0238"
FT   CDS_pept        249073..249999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_39630 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95101"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95101.1"
FT                   /translation="MSWRKKPIWLILAALITLGSFIWLVLLLKDGFIQIMEQGMSLNTP
FT                   ALALSWILAVAATFITSQIFFNIMQASGARFSSFHEACELNFTAQVMRHLPGRFFGVAY
FT                   QVVKAKHVANTAEWICGNIAIILLSTWLALVFSSIILIALEKNMALAFMILISTLSAPF
FT                   IIYGINLLLGHFSSKNQKIEKFIKIFHAVPKALFSAKGRRALAWGTISWCVYAMAWAAF
FT                   GEALPLESWHDGLILGALYTLAWAIGFFSLITPSGLGVRELAFALLASSYPPEILLFVS
FT                   VAARLGLMLADFVLGIVFLVTAKREIL"
FT   gene            249996..250550
FT                   /locus_tag="Hneap_0239"
FT   CDS_pept        249996..250550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0239"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /note="KEGG: rha:RHA1_ro06420 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95102"
FT                   /db_xref="GOA:D0KX88"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX88"
FT                   /inference="protein motif:COG:COG0110"
FT                   /protein_id="ACX95102.1"
FT                   /translation="MTLKAVEMTLNTLGCIAIRNAMHPKLRSWLLRLFGANVGINVRIH
FT                   SCRFMNFELGFKNLKFDDGVYIGTDVLIDCACTLNIGKNTTISARSALITHSDPGTRQG
FT                   NAIAKIYPARKTGVFIGNDCWIGVGAIVLDGSVINDRCLVAAGSVVTGSTLDKESLYAG
FT                   SPAVFKKKLNFNSEKSSSHSL"
FT   gene            complement(250516..251679)
FT                   /locus_tag="Hneap_0240"
FT   CDS_pept        complement(250516..251679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0240"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: drt:Dret_0280 glutamine--scyllo-inositol
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95103"
FT                   /db_xref="GOA:D0KX89"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX89"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ACX95103.1"
FT                   /translation="MPEKQPFIVFGAPQIEQDEIDEVVDSMRASWLGTGPKVARFEREF
FT                   AAYKGMQPDHVAATNSCTAALHISMLAAGLKPGDEVITTALTFCATVNAIIHTGATPVL
FT                   VDVDPLTMNIDPQAVEAAITPRTRAILPVHFAGRSCDMDTLMRIARKHDLKVIEDCAHA
FT                   IETEYHGQKAGTFGDFGCFSFYATKNITTGEGGMVLAQDEHDIARIKVLALHGMSKDAW
FT                   HRFGDAGYKHYLVTEAGFKYNMMDIQAAIGIHQLARIEHNWKKRQALWTNYQSAFADLP
FT                   VTRPQDAETDTRHAYHLYTLLIDEQRAGISRDAFLEHMTHAGIGVGVHYLSIPEHPYYQ
FT                   QHFGWRPEDYPNAMRIGRQTVSLPLSAKIDDAIAERVIKSVMTTFQN"
FT   gene            complement(251829..252212)
FT                   /locus_tag="Hneap_0241"
FT   CDS_pept        complement(251829..252212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nam:NAMH_1673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95104"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX90"
FT                   /inference="similar to AA sequence:KEGG:NAMH_1673"
FT                   /protein_id="ACX95104.1"
FT                   /translation="MPLDEQKYIALTDDEVEHIDQFLFRFSKLQDSMGQKLFKSILMFL
FT                   EEDVEDKPFIDILNQLEKLHLIESANDWRTLREDRNELAHQYENEPEPMSAAINRVYER
FT                   RELLVAIYHRLKSAYSKANGVDS"
FT   gene            complement(252310..252606)
FT                   /locus_tag="Hneap_0242"
FT   CDS_pept        complement(252310..252606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0242"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: gem:GM21_2611 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95105"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX91"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACX95105.1"
FT                   /translation="MRFTHKEASSIKEAFQDVFQEGTILLFGSRVDDNKKGGDIDLYIQ
FT                   LSHPLSPREQLERKAQFKLKLYEALGEQKIDIVIAKDQQRSIEKSALKTGVPL"
FT   gene            252670..252822
FT                   /locus_tag="Hneap_0243"
FT   CDS_pept        252670..252822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95106"
FT                   /db_xref="GOA:D0KX92"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95106.1"
FT                   /translation="MGYIEIPVIRRFRESRNLEKSWRWILTNAGMTGFSSFPMMILLEL
FT                   RLMRS"
FT   gene            complement(252850..253179)
FT                   /locus_tag="Hneap_0244"
FT   CDS_pept        complement(252850..253179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0244"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: gdj:Gdia_1758
FT                   addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95107"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX93"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ACX95107.1"
FT                   /translation="MTKSDASPSATRYRLKFLPEALDEWNALDGSIKELLRKLLKKRLN
FT                   EPHTPGAQLHGDLRGCYKIKLRKQGYRLVYSVEDNVLVVLVLAIDKREDMAAYHSALDR
FT                   LISGQ"
FT   gene            complement(253166..253417)
FT                   /locus_tag="Hneap_0245"
FT   CDS_pept        complement(253166..253417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0245"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: eba:ebA5970
FT                   antitoxin of toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95108"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX94"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACX95108.1"
FT                   /translation="MDAIYADYSISMTEFKKNPAHVLRTAGEKPVAVLNHNRPAFYMVS
FT                   PKLFEAIAEELSDKNLLELARQRLMRKDSAIEVDIDQI"
FT   gene            complement(253598..253858)
FT                   /locus_tag="Hneap_0246"
FT   CDS_pept        complement(253598..253858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0246"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin Txe/YoeB; KEGG: sde:Sde_1844
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95109"
FT                   /db_xref="GOA:D0KX95"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX95"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ACX95109.1"
FT                   /translation="MKLTFSSKAWDDYLYWQQTDKTILKRINTLIKEIQRDPFDGIGKP
FT                   EPLKYSLTGYWSRRINDEHRLVYKISNDYLFIAQLCYQYEY"
FT   gene            complement(253855..254106)
FT                   /locus_tag="Hneap_0247"
FT   CDS_pept        complement(253855..254106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0247"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: sde:Sde_1845
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95110"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX96"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACX95110.1"
FT                   /translation="MNAISYTAARANFAKTMEKVCNDHHPIIITRKQEAPVVMISLEDY
FT                   QAMEETAYLLRAPANARRLLESMAELEAGKGTERELIE"
FT   gene            complement(254253..254816)
FT                   /locus_tag="Hneap_0248"
FT   CDS_pept        complement(254253..254816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0248"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   dia:Dtpsy_2541 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95111"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX97"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ACX95111.1"
FT                   /translation="MSTPAAHLPTISVTDYLNGEEHSEIRHEYIDGQVYAMSGASRRHG
FT                   LIATSLSLLLGPKAREKKCQLFIADMKVRLTISGKDIFYYPDLALNCDPDDRESHYSRT
FT                   PCLIIEVLSETTERIDRREKMLAYQTLPSLQEYVLVAQDYMQIEIYRRRADWLPEVHTE
FT                   GTFTIECLDLNTSVAEVYQDIEGF"
FT   gene            complement(254854..255018)
FT                   /locus_tag="Hneap_0249"
FT   CDS_pept        complement(254854..255018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95112"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95112.1"
FT                   /translation="MSPPTQTHTFMLDDFLIREAVEPLRHKLDATLSMPWQNGETLNLS
FT                   LTQVYQDIN"
FT   gene            complement(255234..256067)
FT                   /locus_tag="Hneap_0250"
FT   CDS_pept        complement(255234..256067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0250"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: tcx:Tcr_1289
FT                   2,3,4,5-tetrahydropyridine-2,6-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95113"
FT                   /db_xref="GOA:D0KX99"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:D0KX99"
FT                   /inference="protein motif:TFAM:TIGR00965"
FT                   /protein_id="ACX95113.1"
FT                   /translation="MTDLNALKNTIETAFEDRASITPAEAPQAVRDAVNTVLGMLDAGQ
FT                   LRVAERRGVGDWVVNEWLKKAVLLSFRLNPNEVVQGGDLRYFDKVPTKFANWNQAQFEE
FT                   AGIRVVPNAVARRGSFIAKGAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLS
FT                   GGVGIGGVLEPLQASPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKIYDRE
FT                   TGEVSYGRIPAGSVVVSGNLPSKCGKYSLYCAVIVKKVDAKTLSKVGINALLRDI"
FT   gene            complement(256158..257315)
FT                   /locus_tag="Hneap_0251"
FT   CDS_pept        complement(256158..257315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0251"
FT                   /product="Carbohydrate-selective porin OprB"
FT                   /note="PFAM: Carbohydrate-selective porin OprB; KEGG:
FT                   afr:AFE_2522 carbohydrate-selective porin, OprB family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95114"
FT                   /db_xref="GOA:D0KXA0"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA0"
FT                   /inference="protein motif:PFAM:PF04966"
FT                   /protein_id="ACX95114.1"
FT                   /translation="MSRLPSYVTILLIVLVIPPILGSGAWATEFILNRPAPTAASHPLP
FT                   LDESQIFSLHGHWDTDWVNNLSGGIRRGNALDSVAVGGFTLKGDRLGLPNSVFNFSLMA
FT                   TRVGDANAELIGADTNPSNIEGNRNRLVLNTAFWQQDWLNSPHIGLNTRLGVFDLSAEF
FT                   DSTDGAAQLLNSSFGLDPTITDNFAASTFPKNGTGLVTSIASAIDPDTAPFALKVGLIQ
FT                   GDVNQQTHPFTQGVLNIAEGQWRPSKGTAIKLGGWQKRGNGLHDLRGGYLSAETPLSSE
FT                   QHQHISGFIRASFASGMGAQTNGANRYLGAGLNWQAPFAHRPDDYLTLGAATLHLNHGG
FT                   DHERLLEAAYIMQITPRIFLQPDVQYIQQNNQPDTWVAIVRLHLE"
FT   gene            complement(257371..258576)
FT                   /locus_tag="Hneap_0252"
FT   CDS_pept        complement(257371..258576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0252"
FT                   /product="succinyldiaminopimelate transaminase"
FT                   /note="TIGRFAM: succinyldiaminopimelate transaminase; PFAM:
FT                   aminotransferase class I and II; KEGG: ppu:PP_1588
FT                   succinyldiaminopimelate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95115"
FT                   /db_xref="GOA:D0KXA1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA1"
FT                   /inference="protein motif:TFAM:TIGR03538"
FT                   /protein_id="ACX95115.1"
FT                   /translation="MNPDLTRLHPYPFEKLAELKAGISPATSDKPIALSIGEPQHAPPA
FT                   VAMRAMADSLGGLSRYPLTKGERSLRETIGHWLTRRFALEPGLVDPDRHVLPVAGTREA
FT                   LFSFAQAVVARPEDPAAPRPVVLMPNPFYQIYEGAALLAGAEPYYYPTTSDTDFLPDFA
FT                   AIPAEIWARAQLIYVCSPGNPSGAVIDRARIKTLFDLADRHDVIIAADECYSEIYFDED
FT                   APPVGFIQAAHELGRSDFNRLVIFHSLSKRSNLPGLRSGFVAGDAEILARYLKYRTYHG
FT                   CALSLPVQMTSIAAWNDEVHVHENRQHYREKFDAVLDILAPVLPVQRPDAGFYLWTDVG
FT                   GDERSFARDLFAEQAVTVLPGRFLSRPVESNDPGVGFVRMALVAELIDCVDAAQRIRAF
FT                   LS"
FT   gene            258629..259018
FT                   /locus_tag="Hneap_0253"
FT   CDS_pept        258629..259018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0253"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: tgr:Tgr7_1155
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95116"
FT                   /db_xref="GOA:D0KXA2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACX95116.1"
FT                   /translation="MNQTAAIELLGVDHVSVVVADVNAALPFYRQVLGLRLIDRPELGF
FT                   PGAWLKLSNGVDLHLLQLPNPDPVANRPAHGGRDRHVALQVRATEPFAQRLAALNWPFT
FT                   RSHSGRDALFCRDADGNAWELVARN"
FT   gene            complement(258946..259746)
FT                   /locus_tag="Hneap_0254"
FT   CDS_pept        complement(258946..259746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0254"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: dsh:Dshi_3147 protein of unknown function
FT                   DUF306 MetA and HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95117"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA3"
FT                   /inference="protein motif:PFAM:PF03724"
FT                   /protein_id="ACX95117.1"
FT                   /translation="MQNKKYLNISAVLVLAVGMFAGLTACSASKPVPPDNHTSQIALDW
FT                   AGGYYSALAKESNGQPDGAVSLWLAPNGGYRLDLENIKGIPRQSYTGKVKWIEGKEVDL
FT                   RGAPPEYARWLVQENQLRNATKGWAAKHVPALVAALALPDQWTLTELAGDQSDLTQKPP
FT                   ELTFNMAQRVFGFDGCNRLMGRYQLDADGKLSFKPLAGTRMACMQPTPERAFLAMLEKV
FT                   ADAKIQGETLEFFAADGKKLAQFRATSSQALPSASRQNNASRPE"
FT   gene            complement(259763..260512)
FT                   /locus_tag="Hneap_0255"
FT   CDS_pept        complement(259763..260512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0255"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   tgr:Tgr7_3056 ParaA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95118"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA4"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACX95118.1"
FT                   /translation="MAQIIALYSVKGGVGKTASVVNLAALSAMQGRKVLLWDLDPQGSA
FT                   SWYLQAEPESAPKLQQLLKVKSIAEGIRPTLHRNLSVLPSDQRYHDIEHALAEKKDAGF
FT                   RIAKLLDGLSEYFDEIWIDTPPGITLLGDNVLRAADLVLVPVVPTHLSERTWFQLKSHL
FT                   ASEKIKPGRLAGFLSMVDRRRSLHRDFYAAHRIDMPELFDADIPYAAIIEQMGEDQTPV
FT                   VFSHARHPAAQAFFKLWKQIDHVLAKF"
FT   gene            complement(260589..262061)
FT                   /locus_tag="Hneap_0256"
FT   CDS_pept        complement(260589..262061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0256"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: yen:YE0025 nitrogen regulation protein NR(I);
FT                   TIGRFAM: nitrogen regulation protein NR(I); PFAM: sigma-54
FT                   factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; response regulator receiver;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95119"
FT                   /db_xref="GOA:D0KXA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA5"
FT                   /inference="protein motif:TFAM:TIGR01818"
FT                   /protein_id="ACX95119.1"
FT                   /translation="MMTLNPSQQSSKNAAKIWVVDDDHSIRWVLERALKSAGFTVESFE
FT                   SAAMLRARLRTSTPDVLFSDIRMPGEDGLSLLSSLQNSHPELPIIIITAHSDLDSAVGA
FT                   FEGGAFDYLPKPFDIDDAVRLAQRALSSRQPQAAETTAEASTTADAQTDLIGNAPAMQE
FT                   IFRAIGRLARSNVTVLINGESGTGKELVARALHQHSLRRQGPFVALNTAAIPKDLLESE
FT                   LFGHEKGAFTGAAGQRVGRFEQAHGGTLFLDEIGDMPMDLQTRLLRVLADGQFYRVGGT
FT                   QLIRTDVRIVAATHQRLEDRVASGQFREDLFHRLNVIRLKLPALRERREDIPQLLRFFL
FT                   QRAAQELGVPIKSIHQQALAQLARYDWPGNVRELENTARWLTVMAPGHEIGIEDLPDNL
FT                   HQSSTPGAALGDDALLTQWTGDLKRWADARLAAGDQDLLAIAGPAFERTLLKAALHFTG
FT                   GHKQQAAALIGWGRNTVTRKLKELADIDDDTE"
FT   gene            complement(262058..263203)
FT                   /locus_tag="Hneap_0257"
FT   CDS_pept        complement(262058..263203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0257"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: tgr:Tgr7_3261 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95120"
FT                   /db_xref="GOA:D0KXA6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACX95120.1"
FT                   /translation="MTKPEIKMPIRTARLADALTTAIVVLDAQDKLLYINSAGEQFWDV
FT                   SYGVLLKQGFAPFFEQNPILAKAVAEARLTEQVVTLREAELVSIHGQTHIADCAITPSP
FT                   DISGADILLELADIERHMRITRDAQLHAMQISTRQLVRGLAHELKNPLGGLQGAAQLLE
FT                   RELPNADLREFTQIILNESSRLKNLIDRMLGPNNRPQMQRINIHEPLEQVRRLLSIEAE
FT                   ETLLQEPLQWHFDFDPSIPDVLADRDQLIQVLLNLSRNALQAMSENDTNNPTLRFKTRV
FT                   LRRFTIHQTLHRLVLRIDVENNGPPVPDTLVESLFLPMVSGRAHGSGLGLSIAQTIAEQ
FT                   HQGLIEFKQKPGAVRFSLILPLSQSLPGQDTQGQHHQETPP"
FT   gene            complement(263446..264264)
FT                   /locus_tag="Hneap_0258"
FT   CDS_pept        complement(263446..264264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_04g004330; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95121"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95121.1"
FT                   /translation="MRTAHLPRTAHFASTILLMSAFFSLSLAPMAAEAETIYKYTNSKG
FT                   EVVFTDQPTKGAQKLNIIPPPVIPLTPINLPPTTTPATESVKPATNTEASKSPAPLIPS
FT                   LQMQPPGSSSTADTNPSKPAAANPPEYNQITPAPAKTTTNAPQIIRQSLPETQPSSPAI
FT                   PPQERNGHYQSLIITEPKAGPVTARDGGTIFVQTKLSPVLDQSVGDRMRIVIDGNIRVD
FT                   DSTGQRFMISDLTPGTHAIIAIVMRKGKNIFQSNPVVIDLKQGTDGNAQK"
FT   gene            complement(264454..265569)
FT                   /locus_tag="Hneap_0259"
FT   CDS_pept        complement(264454..265569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0259"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rrs:RoseRS_1820 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95122"
FT                   /db_xref="GOA:D0KXA8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA8"
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /protein_id="ACX95122.1"
FT                   /translation="MRTPSPDPTPDQAHIGVIGAGQLGQMLALSGISLGLSFTFLDPSA
FT                   QAPAGRLGRHIQAEYDDELALEQLAVECDAITLEFENVPVSAVASIARHNQIHPGERPL
FT                   SIAQDRVHEKRFFESLGIPVAKYHAIDSFEDLKSAVADLGYPCILKTRRLGYDGKGQVV
FT                   VRHSDDLEPAWASIRGNPSILEQMIPFTREVSIISVRSTRGECAFYPVSENQHRSGILH
FT                   RTEIHMDDPAQERAEEYARHVLDGLDYVGVLAIEFFEHQGRLVANEMAPRVHNSGHWSQ
FT                   NGAVTSQFENHLRAILGWPLGSTACTGHSIMINLVGIIPPRAPILALPGVHLHDYGKEP
FT                   RTGRKLGHINIVADTKESCRKYATLIEQMIG"
FT   gene            complement(265585..266127)
FT                   /locus_tag="Hneap_0260"
FT   CDS_pept        complement(265585..266127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0260"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: xop:PXO_01312 phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95123"
FT                   /db_xref="GOA:D0KXA9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXA9"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ACX95123.1"
FT                   /translation="MSEQPLAPIAPNHPSPLVGVVMGSRSDWETMQHACATLTTLQIPF
FT                   EAEVVSAHRTPDRLFQYAETAIERGLRVIIGGAGGAAHLPGMLAAKTRLPVLGVPVQSK
FT                   SLSGWDSMLSIVQMPAGIPVGTLAIGRAGAVNAALLAAAQLAVHDADLAQRLDAYRHAQ
FT                   TKTVLAGTDPRTPPPSF"
FT   gene            complement(266124..266546)
FT                   /locus_tag="Hneap_0261"
FT   CDS_pept        complement(266124..266546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0261"
FT                   /product="Invasion gene expression up-regulator SirB"
FT                   /note="PFAM: Invasion gene expression up-regulator SirB;
FT                   KEGG: pna:Pnap_1330 invasion gene expression up-regulator,
FT                   SirB"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95124"
FT                   /db_xref="GOA:D0KXB0"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB0"
FT                   /inference="protein motif:PFAM:PF04247"
FT                   /protein_id="ACX95124.1"
FT                   /translation="MTIAQISVHIHGLAVVLSLIGFILRGIWMLKDSPRLKARWVKITP
FT                   HIVDTVLLVSALIASYLMFWRYGVNPDYVTVMIVGLIVYIVLGLFALRLGKTKAIRASA
FT                   WVLAIAVFLYISAAGTLKTATPFLSAPTTTASVSAR"
FT   gene            complement(266669..267649)
FT                   /locus_tag="Hneap_0262"
FT   CDS_pept        complement(266669..267649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0262"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: maq:Maqu_0374 C4-dicarboxylate
FT                   transporter/malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95125"
FT                   /db_xref="GOA:D0KXB1"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB1"
FT                   /inference="protein motif:PFAM:PF03595"
FT                   /protein_id="ACX95125.1"
FT                   /translation="MSESSTADNAHSRLAHMPISMFGMVMGMAGFAIAMHKGEQLVQWS
FT                   HATSTIFTYVTFGLFGILALAYLAKFVKYPGEVRAEFNHVVRLSFFPAISINLILLSII
FT                   ALSFNKTLALWLWSIGTPLQLLFTLIILSNWIHHEKFQIHHSNPAWFIPIVGNILVPIT
FT                   GAALGYIQISWFFFSIGVIFWIVLLTILMNRYFFHAPTPSKLMPTLFIMIAPPAVGFIS
FT                   WHALHPSGLDDMGHILYNFALFITLLLFFQAKRFVTIPFGLPFWAYTFPIAAMTIATLI
FT                   MHQITGLIFYAYLGGFLFVFLTLLIAYLLVKTARAMWAGEICVPE"
FT   gene            267796..268461
FT                   /locus_tag="Hneap_0263"
FT   CDS_pept        267796..268461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0263"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: aeh:Mlg_1271 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95126"
FT                   /db_xref="GOA:D0KXB2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB2"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1271"
FT                   /protein_id="ACX95126.1"
FT                   /translation="MNVPDGLISSDLLWLNWLLFIALMGLGVYRSPWRALLHAPQRLNL
FT                   IAASVVFLAMLWLFSSSALPGLSLHFLGLTVVTLVVGWPLALVVGGVTLLLLSLAGQMA
FT                   FSGIGLDMLGMVVPPVLVTALINAGAQKLLPANYFIYLFVNSFLSAILGAMAAALASAS
FT                   LMLVFGIYTWDVLTSSYFPLLPIQWVPEAMINTMIILGLTLLRPDWVITFDDQRYFKN"
FT   gene            268701..269039
FT                   /locus_tag="Hneap_0264"
FT   CDS_pept        268701..269039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0264"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: tgr:Tgr7_3091
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95127"
FT                   /db_xref="GOA:D0KXB3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB3"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACX95127.1"
FT                   /translation="MKKLTVLMLAAGLMTSGAAMAAGDAAAGKTLYDASCASCHGMQAQ
FT                   GQGMFPKLAGLTSERIKTTLVAFKSGDTATLKKEGLGGPNSAIMAPNAAGLSEQDMDNL
FT                   SAYIATLK"
FT   gene            complement(269152..269865)
FT                   /locus_tag="Hneap_0265"
FT   CDS_pept        complement(269152..269865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0265"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG: noc:Noc_2395
FT                   phosphate transporter PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95128"
FT                   /db_xref="GOA:D0KXB4"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB4"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ACX95128.1"
FT                   /translation="MDSYNGTPHTLTRYDEDINALRTMLMNMGGVAEQHFADALAYLLD
FT                   GDAERGARALKQDYEINRMESSIDELAIQIIARYSPMANDLRTIMSVVKAITDLERIGD
FT                   KSEKMARIAEEIGPILRHTDFIGHLRVMGRIVGGMMHDALDAFIRLDAIAAEEIIRRDT
FT                   HVNEEYNAVHRVLLKYMNENPNSADVGLRILSCMRAIERVGDHCTNIAEYVIFQQKGDD
FT                   VRHSNISKEKQRTQI"
FT   gene            270053..272128
FT                   /locus_tag="Hneap_0266"
FT   CDS_pept        270053..272128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0266"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase; KEGG: tgr:Tgr7_2466
FT                   polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95129"
FT                   /db_xref="GOA:D0KXB5"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB5"
FT                   /inference="protein motif:PRIAM:2.7.4.1"
FT                   /protein_id="ACX95129.1"
FT                   /translation="MTETSLTPVAPVFINRELSLIAFNRRVLELAQDVSLPLLERLKFL
FT                   CISSSNLDELFEVRIGSLTQQIRVGLNRPDDSGLTPGEQLDQVYTAAHSLVADQYHTLN
FT                   DEVIPALAEEGIHFLRRTHWNEAQSLWVKQFFRRELLPLLTPLGLDPSHPFPRILNKSL
FT                   NFVVSLEGTDDYGREAWMAIVQAPRALPRIIRMDEEASGTSSSFVFLSSIIHAHVHELF
FT                   PGMTVTGCYQFRVTRNSDLAVAVDDDDDLLKTLQGGLFERNYGDAVRLEVADNCPQEMI
FT                   DFLCDRFKLNNQAVFQVHGPVNLNRLMALYGLVNRPDLKDEPFTPKLKKEFSSEANIFE
FT                   TIEQRGAVLLHHPYESFMPVVEFVRQAASDPKVVAIKMTLYRTGRDSAIVDALEAAARA
FT                   GKEVTAVVELRARFDEEANIDITTRLQKAGAYVAYGIVGYKTHAKMTLVLRRDGSRLKR
FT                   FVHMGTGNYHPGTARIYTDFGLLTDDRFLGDDVNKLFMQLTGLGRGMRLKRILQSPFTL
FT                   HSGMLDRIEREIEHAQAGRKALIRAKMNALIDRQIIEALYRASQAGVQIDLIIRGVCCI
FT                   QPGIAGLSENIRVRSVMGRFLEHPRVFYFLNDGDDELFLSSADWMPRNFFVRVETCFPI
FT                   DAPEIKARVINEAFERYLADNTGAWSLEADGQYHRVKRHHNAKPRSAQQSLLDDLT"
FT   gene            complement(272175..273347)
FT                   /locus_tag="Hneap_0267"
FT   CDS_pept        complement(272175..273347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0267"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: tgr:Tgr7_3209 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein; SMART: PUA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95130"
FT                   /db_xref="GOA:D0KXB6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB6"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ACX95130.1"
FT                   /translation="MVERDANPAMGVDTGVDLRAHLKTDRRWVIKIGSAMVTGNGAGLD
FT                   LSAIDRWAEQIAAMRAEGREVVIVTSGAVAEGMARLGWPERPSALPELQAAAAVGQMGL
FT                   VQAYADVLLRHGIHTAQILLTHDDLSNRQRYLNARSTLRTLLDLGVVPVVNENDTVATD
FT                   EIRFGDNDTLAALVANLVEADVLVILTDQLGLFDADPRKNPSARLLTEVTAGDPALETM
FT                   ASPEGGRLGRGGMYTKVMAAKRAAQSGAATVVASGATPHVLLQLAAGTSGVGTVFQPAQ
FT                   TRLAARKQWLAGQLRARGTVRVDTGAAAALRQGGRSLLPIGVLEVTGEFTRGDLVRIVD
FT                   EAGTDLGRGLINYGSTHAKRLCRQPSNAIAELLGFAEEDELIHRDNLILL"
FT   gene            complement(273354..274481)
FT                   /locus_tag="Hneap_0268"
FT   CDS_pept        complement(273354..274481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0268"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; PFAM:
FT                   GTP1/OBG sub domain protein; GTP-binding protein
FT                   HSR1-related; KEGG: ppg:PputGB1_0722 GTPase ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95131"
FT                   /db_xref="GOA:D0KXB7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB7"
FT                   /inference="protein motif:TFAM:TIGR02729"
FT                   /protein_id="ACX95131.1"
FT                   /translation="MKFVDEAKVKVKAGDGGNGVIGFRREKYVPYGGPDGGDGGDGGSV
FT                   YFLGDANLNTLADFRFVRHYEAQRGENGSGSNMTGAKGADLWVRVPLGTVVHDIDTGEI
FT                   LGEVLDPAQPLLVAQGGWHGLGNARFKSSTNRAPRQKTEGTPGDERRLLLELRVLADVG
FT                   LLGMPNAGKSTLIRAISQAKPKVADYPFTTLHPNLGVVAPEPHRSFVVADIPGLIEGAA
FT                   EGAGLGHQFLRHLARTNLLLHIVDVAPLDEADPIESVAIIEEELVRYDESHQTHSAERP
FT                   RWLILNKIDQWLEEERSEQINLLTQRFRHELDFKGPIFAISALEKQGTTALVWAIMEFM
FT                   EAARAADQAAAAEAAKAPVVPPAKFDNPDLEWTEE"
FT   gene            complement(274634..274891)
FT                   /locus_tag="Hneap_0269"
FT   CDS_pept        complement(274634..274891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0269"
FT                   /product="ribosomal protein L27"
FT                   /note="TIGRFAM: ribosomal protein L27; PFAM: ribosomal
FT                   protein L27; KEGG: kpu:KP1_4904 50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95132"
FT                   /db_xref="GOA:D0KXB8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB8"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ACX95132.1"
FT                   /translation="MAHKKAAGSTRNGRDSESKRLGVKRYGGQVISAGSIIVRQRGTQF
FT                   HPGANVGCGRDYTLFALTDGAVKFEVKGDKSRRFVSIVPV"
FT   gene            complement(274945..275256)
FT                   /locus_tag="Hneap_0270"
FT   CDS_pept        complement(274945..275256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0270"
FT                   /product="ribosomal protein L21"
FT                   /note="TIGRFAM: ribosomal protein L21; PFAM: ribosomal
FT                   protein L21; KEGG: avn:Avin_40790 ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95133"
FT                   /db_xref="GOA:D0KXB9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXB9"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ACX95133.1"
FT                   /translation="MYAVVVTGGKQYRVEPGEWLRVEKLEGEEGSAVTLDRVLMIADGD
FT                   AIKVGAPALAGASVTAEIIGQGRGKKVDIIKFRRRKHHRKHQGHRQAYTEIKITSING"
FT   gene            275425..275892
FT                   /locus_tag="Hneap_0271"
FT   CDS_pept        275425..275892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95134"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95134.1"
FT                   /translation="MKVVAKFSRLINTLFMKYRRLISSIMLLLAVWLPLDNALAGAVVQ
FT                   GCPMMSHAFERGLHTTFMPNADQSTSDGATDAPHCPMMHMATDNTSSSSGHDQCSNGCT
FT                   HCGLCLLLGGVALQLNAPAIPVTPVLPHKIISSLPATHTSVSAPLFRPPIA"
FT   gene            276080..278050
FT                   /locus_tag="Hneap_0272"
FT   CDS_pept        276080..278050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0272"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase type 3; multicopper oxidase type
FT                   1; multicopper oxidase type 2; KEGG: bpt:Bpet4591 copper
FT                   resistance protein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95135"
FT                   /db_xref="GOA:D0KXC1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC1"
FT                   /inference="protein motif:TFAM:TIGR01480"
FT                   /protein_id="ACX95135.1"
FT                   /translation="MPIKSAFQANTRPINSSRRIFIQGLVAGGVMAALGLNPAEAATIN
FT                   GRRQPPSLRGTEFDLVIDERPVNFTGQPRTAMTINGSIPGPTLRWREGDVVTLRVTNRL
FT                   KVSTSLHWHGIILPFEMDGVPGLTYEGIAPGTTFTYRFRVAQSGTYWYHSHTGFQEQNA
FT                   VYGAIVIDPAQSDRVAYDQDHVVMLNDWTDASPDFIFNRLKTADGYYNYVKPDLMDLIR
FT                   QSEKMGFGKAVEDRLMWDKMRMSPRDLLDVTGATYTYLMNGNTPAGDWTALFRPGERIR
FT                   LRFINGSSMSYFDVRIPGLKMTVVAADGQDVHPVTVDEFRIGVAEIYDVIVEPVADQAY
FT                   CIFAQSLDRSGYARGTLTPHVDLRAPIPPMDPVPTLSMADMGMAMSGMDMGDTDMSAMH
FT                   MGNHAKDNSGVGSMGGMDMSQQKPMAGMTHDQTSQHGTSGMKMDNHAMKGMADRQPDGA
FT                   AHGAMSHNPMDLPGLHNRNLKDGTLKIDWHPKTEHGVGVGMRAQQVSMSLSDPGAGLRN
FT                   NGRKVLTYGDLRGIDGPISQQEPARGIELHLTGNMDRYIWGFNGVSYRDAAPIELKYGE
FT                   TVRIVLINDTMMNHPIHLHGMWSELENDRGEYLARKHTLSVAPGHAISYRVNANAIGRW
FT                   AYHCHLLYHMNAGMFREVRVV"
FT   gene            278073..278897
FT                   /locus_tag="Hneap_0273"
FT   CDS_pept        278073..278897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0273"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   tbd:Tbd_1325 copper resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95136"
FT                   /db_xref="GOA:D0KXC2"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC2"
FT                   /inference="protein motif:PFAM:PF05275"
FT                   /protein_id="ACX95136.1"
FT                   /translation="MKTIPTFLPPVATLLLAVTTSLAQAAGYETSANNSGHYQAPSLAQ
FT                   QRADVAAMVAQSARHETHSPLIYKVMIDRLERDFGNKGNYSQFEGQAYIGTDTNKLWLK
FT                   GEGKRLGGKTEDADIEAYYSHAIAAFWDAQIGMRHDFSAGSIPSRNWLGFGVQGLAPYK
FT                   FDTSATAYVGNEGRTALRLSSEYDFFITQRLIFWPGVELNLYGKNDPERNIGRGLADSR
FT                   LVLRLRYEIRREIAPYVGIQWTNKYGQTASYARTNGEATSDMQLIAGLRLWW"
FT   gene            279022..279285
FT                   /locus_tag="Hneap_0274"
FT   CDS_pept        279022..279285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0274"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: rxy:Rxyl_3081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95137"
FT                   /db_xref="GOA:D0KXC3"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC3"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ACX95137.1"
FT                   /translation="MPFFNEHWGMGAGFGGFGLIFMLLGVVVMALVVFAILRLLTGSNR
FT                   PGPTDREDRRALSILEKRFANGEIDEAEYNERRRILEGRDRS"
FT   gene            279331..281040
FT                   /locus_tag="Hneap_0275"
FT   CDS_pept        279331..281040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0275"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 1; multicopper oxidase type 2; KEGG:
FT                   xau:Xaut_2898 bilirubin oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95138"
FT                   /db_xref="GOA:D0KXC4"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC4"
FT                   /inference="protein motif:PRIAM:1.3.3.5"
FT                   /protein_id="ACX95138.1"
FT                   /translation="MSHDFSNKYPNKPVPAAQQDMAIDSPKRRHALKTLVQGAATVLTG
FT                   VALTEQITTSAQAQAMGMMGGMMGGMPGQNQSASISSGLFTHPMPIPPQLKGEADSSGV
FT                   RTYALNVMAGQHSELVPGLKTATWGYNGAILGPTIRVPQGKPVRFDISNGLDQSTTVHW
FT                   HGAHVPGHADGGPHNLIAAGKQTSVSFSLNQPAATLWYHPHPDGRTGPQVYAGLAGFLL
FT                   VDDGLDARLGMPHTYGVDDFPVVIQDRRITETGQLDYMDSMMDIMGMKGDRFLVNGVEQ
FT                   PFVAVPGQWIRLRLLNGSNARIYNLCFADERPFHVVASDAGLLEQPVKRTELVLAPAER
FT                   AEIMVDLNDMQGKKLVLRSDSAKVIPGLNRMPMATDGYDKGRFDLLEFRVGAPTAKTGH
FT                   LPERMASIPTLKADAPIRKFTLQDMNMGKMRRMMMGGGLQSDNKSTGPGGMSMGIGGRH
FT                   LFSINDQYMNPKVINERVKLGSTEIWHVANDGMMAHPFHIHGISFQVLSRDGAQPPAYE
FT                   RGWKDVVLVHSGQTVQLIARFDQPAGDDHPFMYHCHILEHEDNGMMGQFTVS"
FT   gene            281209..282558
FT                   /locus_tag="Hneap_0276"
FT   CDS_pept        281209..282558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0276"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   kko:Kkor_1300 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95139"
FT                   /db_xref="GOA:D0KXC5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC5"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACX95139.1"
FT                   /translation="MPFLSPSPWCLTRWVLTRSLMPIQHSLRTLGMLLIVILALSGLAQ
FT                   AGQNTSGRSEQPVFSISPDATLSLQEAEQLAVQNDQGLAAAVATESAETSSAKAADQLP
FT                   DPEISLGVSSLPLDTFSFTQTPMTTTEVSISQSLPPGDTLAQRALAADAKIQAATANIA
FT                   VQQQILRREVGRFWLTVYRDQQTLALLAQEKSLYQRLLRSAQTAYSTGRARATDLVRLQ
FT                   VRLAELDDRIDRQRGSTAATKARLARWIGARAQQDWPTALPSALTTLPEGSVEHQPEIK
FT                   ALQANLAEARAQTGEARAAFKPKFGVSLGYGIKAGNQPDTVSVGVSMSLPLFTGERQAP
FT                   LLAAAQKRQQARQLALESRAADFHAEAQSLNADVDSLTSRIDRYDRQILPKLRQVATLA
FT                   QNQFGSGSGDFTAIIDAEQAEITGRQQRLDLTIDRAQRLIDLRYLLENPA"
FT   gene            282555..284438
FT                   /locus_tag="Hneap_0277"
FT   CDS_pept        282555..284438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0277"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   saz:Sama_3474 heavy metal efflux system protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95140"
FT                   /db_xref="GOA:D0KXC6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACX95140.1"
FT                   /translation="MKSSKNKIRLIAVVSTGMAAGAGALIWAHTPINFIRPVLAEATQS
FT                   PSASSSQGDQTHKATTAGTDAKFVTKYTCPMHPQIIEDHPGTCPICGMDLVAKQFPAKS
FT                   SDQSAAPASADTSHDHAGHAAATAAPSSSGPKAEKSTSDAKFVTKYTCPMHPQIIEDHP
FT                   GTCPICGMDLVAKQFPAKSSDQSAAPASADASHDHAGHTETAATAAPSSSGPKAEKSAS
FT                   DAKFVTKYTCPMHPQIIEDHPGNCPICGMTLVPKLFPAGTKDNTGSAAAKTEQTAPAPV
FT                   ASNSAPLPEVAVPQRTLRDMNVVMARAQWRNLTRQIHSVGLVALDENRLSHVHPRASGW
FT                   VETLNVRALGDTVKKGETLLTVYSPDILSAEKDFLVAQKSGMSEMRDAARDRLRLLNVP
FT                   ESVIEQIARTGKVARTIPVLAPQSGYISVINLRDGMYVTPNLDMFTIADASKIWVQVEV
FT                   LPRDMEQVAVGQPAEMTVDGVPGRVWKGTVDFIYPELDPKSRTLKVRLVFDNPDGVLKP
FT                   NQFAEVGIRGVAQADVLTVPTTAVIPTPQGARVVRKNADGSFQPVRVEVGQSADGWTQI
FT                   TAGLSPDDTVVASGQFLIDSESAIQASFARMTGTAQPADDAAPAASGHHNH"
FT   gene            284451..287723
FT                   /locus_tag="Hneap_0278"
FT   CDS_pept        284451..287723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0278"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: cps:CPS_4858 cation
FT                   efflux system protein CusA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95141"
FT                   /db_xref="GOA:D0KXC7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC7"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ACX95141.1"
FT                   /translation="MLKAVIDASINNRVLVLLLAAILAVVGWYSWKATPLDAIPDLSDT
FT                   QVIIKTTYPGQSPQVVQDQVTYPLTTALLAVPGSTAVRGYSFYGDSYIYVTFKDGTNLY
FT                   WARSRVLEYLNQARSSLPAGVEPQLGPDATGVGWVYEYALTDPSGQMNLSQLTTLQNWF
FT                   LKFQLQTVSGVSEVATVGGMVREYQIVVDPDRLRAFGVSLATLRKAVADANKEVGGGVL
FT                   ELGGAEYMVTSRGYLKSVADIERIPVGVTQSGTPILVRDLGTVRLGPAPRRGVADLDGK
FT                   GEVVGGIIVMRSGENARQVIDAVKTKIEHLKPSLPKGVEIVPVYDRSGVINRAVDTLSS
FT                   KLVEEFLVVALVCAIFLWHLRSALVAIIGLPLGVLMAFIVMHAQGINANIMSLGGIAIA
FT                   IGAMVDAAIVMIENAHRHLVAWRETHGSPPKGDDHWRLIAQSAGEVGPALFFSLLIITL
FT                   SFIPVFTLQAQEGRMFAPLAFTKTYAMAAAAGLAITLIPVLMGYFIRGRIPREEANPLN
FT                   RFLIALYRPVLHTVLRFPKTLMAISLIFVLSAVLPLAGVGGYLAPLKWVGSSAWQLHVS
FT                   DWQNDWAKRWASTFSFAPKIAELGRGLGSEFMPTLDEGDLLYMPTTAPGLSIGDARLLL
FT                   QQVDALIAEEPVVKSVFGKIGRADTATDPAPLTMIETTIQFKPKSEWPAGMTLQKVIDN
FT                   LNQKIQFPGLNNAWVMPIKTRIDMQTTGIQTPVGVKITGPDLHQIDRIGKQVEAVLQTV
FT                   PGTQTAYADRTNGGRYIEITPDRIKAARFGLNIGEIQDVISSAVGGVEVTQTVEGLERF
FT                   PVSIRYPRADRDSVSKLKDLPIVTPTGATVALGQIATVQVTDGPPMIRSEDSRPAGFVF
FT                   VTTQGVDLGSYVNNARRIVDAKVKLPPGYAISWTGQYQYLQRATERLKQVVPLTLAIIF
FT                   VLLFLIFRHGGKASLIMVTLPFALVGGFWLLWALGFELSIAVAVGFIALAGVAAEFGVV
FT                   MLIYLDHAIEDRRRAGRLNTRTDLRDAIMEGAVLRVRPKAMTVAVILAGLIPILVGHGT
FT                   GSEVMSRIAAPMIGGMITAPLLSMLLLPAVYWLWQRRHLPAG"
FT   gene            287821..288228
FT                   /locus_tag="Hneap_0279"
FT   CDS_pept        287821..288228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0279"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: app:CAP2UW1_0994 conserved hypothetical
FT                   cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95142"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC8"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_0994"
FT                   /protein_id="ACX95142.1"
FT                   /translation="MATAINGLRGMTDAMLQECKAQGIKDVDQLTDALASPAARKQWAD
FT                   KLGETTQDVLAIANRADLSRINGVGGVFSDLLEASGVDTVKELAHRRPDNLHEKMAQVN
FT                   ADKTLATRTPTEAECAEWVEQAKALGGKITY"
FT   gene            complement(288319..288597)
FT                   /locus_tag="Hneap_0280"
FT   CDS_pept        complement(288319..288597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95143"
FT                   /db_xref="InterPro:IPR031552"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXC9"
FT                   /inference="similar to AA sequence:KEGG:Neut_1816"
FT                   /protein_id="ACX95143.1"
FT                   /translation="MSFALKQTRRFARAYKKLHDQVAADVDIAAAVVAANPSVGERKKG
FT                   DLADLFVYKFHSHNQLYLLGYTLDEAVRLIYLEAIGPHENFYRDIKR"
FT   gene            complement(288597..288824)
FT                   /locus_tag="Hneap_0281"
FT   CDS_pept        complement(288597..288824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_1817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95144"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD0"
FT                   /inference="similar to AA sequence:KEGG:Neut_1817"
FT                   /protein_id="ACX95144.1"
FT                   /translation="MTSTSIRIDQTLYEQARSEALTEHRSIAGQVEYWAKVGRAALDNP
FT                   DLPVSFIAESLVSLAEPREEATAFIPRKSC"
FT   gene            complement(288905..289603)
FT                   /locus_tag="Hneap_0282"
FT   CDS_pept        complement(288905..289603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95145"
FT                   /db_xref="GOA:D0KXD1"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD1"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2923"
FT                   /protein_id="ACX95145.1"
FT                   /translation="MPADMTFWAALLVGFFGGVHCIGMCGGIVGALTFGLPPEKRATPG
FT                   QLLPYLLAYNLARISSYVIAGAIAGLIGAFGLSLIPMQHAQLYLLMVAGGFMVLMGLYV
FT                   GGWWFGLTRIERVGSRLWRYIEPLGRRLMPVKTPKQALLLGFVWGWLPCGLVYSVLIWA
FT                   LSAGSATQGALLMLGFGLGTLPNLLLMGAFAAQLSALTRKKWVRWIAGGAVLGFGLYTI
FT                   GSAIWNIQVS"
FT   gene            289695..293879
FT                   /locus_tag="Hneap_0283"
FT   CDS_pept        289695..293879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0283"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="KEGG: tgr:Tgr7_0254 ATP-dependent helicase HrpA;
FT                   TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   helicase-associated domain protein; protein of unknown
FT                   function DUF1605; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95146"
FT                   /db_xref="GOA:D0KXD2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD2"
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /protein_id="ACX95146.1"
FT                   /translation="MNSTLNEPQDAAAPQSAPLSTEPADIIDFLRANLAELPLVDQPAL
FT                   SRRLAGAERALQQNRLDAGRLAELVTAFEASAALLTERRSAELNIDYPAELPVSGQREA
FT                   IMDLIRAHPVVIVAGETGSGKTTQLPKMLLELGFGVKGQIGHTQPRRIAARNVASRLAE
FT                   ELGVTGAGVVGYKVRFSDQTRASSRVAVMTDGILLAEIHSDPDLLRYDALIIDEAHERS
FT                   LNIDFLLGIVRRLLDRRPDFRLVITSATIDTARFARHFAGTDASGEPQPAPVITVAGRS
FT                   FPVEYRYRSLTAPQNDNDTETEEERDLPAAVVAAVDELHAEAQTTGGGDILVFLPGERE
FT                   IRECAHRLGRHGLRHTEILPLFARLSAAEQQRIFAQHTGRRIVLTTNVAETSLTVPGIL
FT                   YVIDSGLARIARYSPRSRVQKLAVEAISQASANQRAGRCGRIAPGVCIRLFDEADYAGR
FT                   PAFTDPEILRTNLASVVLRMIELRLGEPEHFPFIEPPDSRQLAGARRLLFELGALDERQ
FT                   RITPLGRQLARLPVDPTLGRMVLSNLSKADATSVDILIVVAFLSIQDPRERPADHAQAA
FT                   DQAQQAFRLADSDFAGILALWDQWHTVVRHENQRKRRDWAKKHFLSYNRLLEWHDLFGQ
FT                   LREQADEIGRVKLPDPLPLPVMTDGDEAPLRARLDALHQAMLPGLLAQIGLRDEATRTD
FT                   KNTPKDSRDQRGKKQRTPTIYIGANNRRFQIFPGSQLAKTQPKWLMSAEIVETTRVYAR
FT                   MNATINPRWIEDMAAHLTTREYSEPRWDQRGGRVAAFETVKLFGLPIVTKRRIDFGRID
FT                   PLGARAIFIRAALVEGEFDSGLKFWRHNQALIDEIREIEARNRRPDLLIDDQTLFDFYE
FT                   THLPAEVYDAHTLVRWLKTITPKQPDVLCMTRDDLLAREPVELDPAGFPDRLSMGAFSL
FT                   PLAYHFAPGSADDGVTLRLPLAALKQIDADRASHLIPGLRREKIEALIRSLPKADRRHF
FT                   VPAPEFAASVNERVSVDRGGLPAQVAEQLARMTGHKITADAFDERRLEPHLRMRFALID
FT                   AKQTDPDKQIIDADRDLSALRARHAAAAERALVERTRHRLERDDLIDWSFGELPESLTV
FT                   EELGAELTAYPALIDQGDCAEVRLFDAPERAVLAHRSGVVRLMLIALGEQIRHLSQYLK
FT                   QERSLDPARLQYSQWSNTRPLPAFGLTLPQRRDAAFDQALIARSIAKLAVDALPFIRDE
FT                   STFRARVERLKPQLDDTVRRLAAQIRTIFAQHQALRAKLKGRLPLSQIEAAREIAEQFD
FT                   LLFYPGMIWNTPQTLLDNLPRYLTAAEKRLEKIDRHPERDRMLRVQFMPVCARVTDKIT
FT                   ATAPTPEAFAALNQLHEQLEEWRVATFAQELARKGAPGAKEIEQAIKQLSH"
FT   gene            294221..295990
FT                   /locus_tag="Hneap_0284"
FT   CDS_pept        294221..295990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95147"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD3"
FT                   /inference="similar to AA sequence:KEGG:Pcar_0163"
FT                   /protein_id="ACX95147.1"
FT                   /translation="MNQEWILQTKETRRAFSNATWVPLRASINDEKGNVKNIGYISEYF
FT                   GCGSAAFPPENRKLVEERLGWSDIGIGHTVAPYAYEDGYYASIDQFQYNDKEPIGVNLV
FT                   FEHPQPVVGGKQLILNPDLVVALRLIKEGTNWVRPEENFVVVARESFDDKGEHRLIEIK
FT                   REFLVDYLAARNLSLRLSYYRQRVENVPLLKGSEYANLKEHREERDGGRFELLIRGIND
FT                   VFGGGWAMFRAWRTDVDEDEDAPVMGPEDDHNTDHESSKGHRGGYEGVRVEGEFWRDEW
FT                   VEHQSQSIRVRGDTDINLPQFIAETDGKRMSSSELDNEDIGRWLWFRSSVVTDLLGHRG
FT                   FALKWYTAETGAICSTSGYATHFGINSADLLTVYAYDIARLPAWEQHIWAAHNVAPDGK
FT                   VSGELLSAQVKTEPASTHAVEEMLFGSMRLLEQGFRDKFGIDLFSHDIDDESAMQQISR
FT                   FHSRDQASLLRLAKELVRVFSDRLNISDLRKLSTHAEKERLGSNKLLQDVLSQKVGADK
FT                   ARQVFAEIAGAYDMRVGDAHPTGSKVADAIKLAGIDQSRSHLRQGEQLIHNFGRAVWFI
FT                   GKCLFGQPEPRES"
FT   gene            296366..296713
FT                   /locus_tag="Hneap_0285"
FT   CDS_pept        296366..296713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VV1848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95148"
FT                   /db_xref="InterPro:IPR021388"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD4"
FT                   /inference="similar to AA sequence:KEGG:VV1848"
FT                   /protein_id="ACX95148.1"
FT                   /translation="MAFSEFELKKHEKMLKAYIEKHRPPAHIRNEIDLGYRQAGQSVEI
FT                   FEIRSRWDNPKEKMENPVAKATYVKTQDIWKIYWQRADQKWHSYVPHPTVKSLEAFLKV
FT                   VEDDECACFYG"
FT   gene            complement(296954..297256)
FT                   /locus_tag="Hneap_0286"
FT   CDS_pept        complement(296954..297256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0286"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   vvu:VV1_2525 plasmid stabilization element ParE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95149"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD5"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACX95149.1"
FT                   /translation="MGKFSLSHSAKADLRGIARFTEKHWGRAQRLHYLKGLDETFKILA
FT                   DSPTLGNACDYIETGVRKYPFQSHVVFYECLSNEEILVVRMLHKNMDVHQAVFPA"
FT   gene            complement(297256..297495)
FT                   /locus_tag="Hneap_0287"
FT   CDS_pept        complement(297256..297495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0287"
FT                   /product="putative addiction module antidote protein,
FT                   CopG/Arc/MetJ family"
FT                   /note="TIGRFAM: addiction module antidote protein, CC2985
FT                   family; PFAM: protein of unknown function UPF0156; KEGG:
FT                   vvu:VV1_2526 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95150"
FT                   /db_xref="GOA:D0KXD6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD6"
FT                   /inference="protein motif:TFAM:TIGR02606"
FT                   /protein_id="ACX95150.1"
FT                   /translation="MAKNTSVSLGNHFDQFIAAQLSKGRYGSATEVVRAGLRLLENEEQ
FT                   KLETLRQLIAEGRASGTAEYNYEKFMAELDNELS"
FT   gene            complement(297650..298324)
FT                   /locus_tag="Hneap_0288"
FT   CDS_pept        complement(297650..298324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0288"
FT                   /product="Anti-sigma-K factor RskA"
FT                   /note="PFAM: Anti-sigma-K factor RskA; KEGG:
FT                   bur:Bcep18194_C6587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95151"
FT                   /db_xref="GOA:D0KXD7"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD7"
FT                   /inference="protein motif:PFAM:PF10099"
FT                   /protein_id="ACX95151.1"
FT                   /translation="MNESTEHIEYVLGLLDEPTDRLTERAIKASPEQRRAVTNWSLIIS
FT                   DHLLSQCESRPLLGWVWSRIERQLDHQAQDVGSALLRWRMAAAIVAMIGIGLLVGVFVP
FT                   NKPTMQADSIAMMPMAQGQSAMWEAKADTTTQQLQVTCLTNADQEINKQAVLWLITPQG
FT                   QTVAVGSLPMKKGESVTVRPALWSNTIAQTKLAISLEPTGKPIGNKPVGPVVWQGDWSK
FT                   AS"
FT   gene            complement(298326..298949)
FT                   /locus_tag="Hneap_0289"
FT   CDS_pept        complement(298326..298949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0289"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   xca:xccb100_2963 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95152"
FT                   /db_xref="GOA:D0KXD8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACX95152.1"
FT                   /translation="MSMKPNRSNKDRNQDDDQLTQWLQATAAGDRSAFQKLYQRTSGPL
FT                   YGLCLRILKEEGRAQECVQDVFLAVWQQAGRFDSARAQPMTWLAAIAHHRAISLLRRFN
FT                   REITTADWADFLALADAPLLSPEGHQGGSADGDPHDWQLMDREAMTRCLEALRAEPRQA
FT                   IHKAFWFGHTYQEIADELSTSLSTVKSWIRRALINLKSCLGLVN"
FT   gene            299368..299625
FT                   /locus_tag="Hneap_0290"
FT   CDS_pept        299368..299625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_1836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95153"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXD9"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_1836"
FT                   /protein_id="ACX95153.1"
FT                   /translation="MKTRTLKAAVIASTALSAALVAGTALANPFVSQHGASLVKVSDAS
FT                   CGANMKKSDSSCGANMKKSDSSCGANMKKSDSSCGANMKK"
FT   gene            299957..300805
FT                   /locus_tag="Hneap_0291"
FT   CDS_pept        299957..300805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0291"
FT                   /product="protein of unknown function DUF692"
FT                   /note="PFAM: protein of unknown function DUF692; KEGG:
FT                   saz:Sama_1305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95154"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE0"
FT                   /inference="protein motif:PFAM:PF05114"
FT                   /protein_id="ACX95154.1"
FT                   /translation="MITDAKHVLVGVGLRRGSLMQQIETDHPDLDFLEVAPENWMRLGG
FT                   AVKRQFESLLERYPLYLHGLSLSIGGPAPLDVDFLKSLRAFIDRYQPVLYSEHLSFCTD
FT                   NAHLYDLMPIPFTRVAMRHVVERIHRAQDILGQRLTLENVSYYTAPDAEMNELEFLTEI
FT                   LQQADCDLLLDVNNVYVNSVNHRYDPVAFLDALPVERVRYLHVAGHLQLSPDLIVDTHG
FT                   AAVADPVWDLLAHTYTRFGAVPTLLERDFDIPPLADLMQEVAQIRRVAAGAHNKVLEPV
FT                   A"
FT   gene            300802..301551
FT                   /locus_tag="Hneap_0292"
FT   CDS_pept        300802..301551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0292"
FT                   /product="Protein of unknown function DUF2063"
FT                   /note="PFAM: Protein of unknown function DUF2063; KEGG:
FT                   abo:ABO_1517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95155"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE1"
FT                   /inference="protein motif:PFAM:PF09836"
FT                   /protein_id="ACX95155.1"
FT                   /translation="MNTDFLTLQSQFTAFIRNPEHAPVPEGCDPERMKLYHQLFFNNFD
FT                   GILENTFDRTRAHLADEQWQVLVKLFFSSVPQHSPYLVDVPARFLEFLQEQNTVPLAEA
FT                   LLELAAFEATLHECRMAEDITLPQAPQTQAEDVFDGAWQPHPQGVLFESAYPVNQADFP
FT                   LDEAPAQPTLLWIQRDDAGVVQIYNLSAASARWLVLLDAHAGATPNVSLAQLAQELNVE
FT                   PDSLAEFACAQLADWIADGVLIPALSH"
FT   gene            301556..304075
FT                   /locus_tag="Hneap_0293"
FT   CDS_pept        301556..304075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0293"
FT                   /product="protein of unknown function DUF255"
FT                   /note="PFAM: protein of unknown function DUF255; KEGG:
FT                   hch:HCH_06582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95156"
FT                   /db_xref="GOA:D0KXE2"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE2"
FT                   /inference="protein motif:PFAM:PF03190"
FT                   /protein_id="ACX95156.1"
FT                   /translation="MQRHRNCWIKVFVRLALASTVLIVPVTVPAANTQPTQAEQQITRP
FT                   QVDWPVLPTALQKKLNKALADQAQQNGQSTRDYHTRWLNADGLPMFTNRLILSDSPYLL
FT                   EHAHNPINWYAYGPEALAAAKAQNKPLFISIGYASCHWCHVMARESFESPAVARELNRH
FT                   FIAVKVDRQQQPALDHRYQIAVALVNQGQSGWPASVFALPDGRPFFTQLYQPEPSFLAT
FT                   LNNVHHVWQTKRPEVTNDAVKLTALMRQVLDQQAKAAKLDDSVLARTVNALTAQFDPFQ
FT                   GGFGDGAKFPQATRLLFLLDWLAREQAHLSHPNAAGGVSTAQTKALQSELVLTLNHMAR
FT                   GGLFDQIGGGFFRYSTTPDWQVPHFEKMAYYQAMLAQTYLKAGLVLGNARDWRVAERTL
FT                   DFVIRDMSAADGGFIAALSADSAVSHRAGAAKEEGYFYTWTPKEIAEALPHYEALLAER
FT                   YWSITASGTVDGRSVPHQGDAAVQATMAKDEGMSLPALTAKMVAIRAKLESARKRRPAP
FT                   GRDDNRILSWNGLLIEALADGGRVLGVPRFIAAAQKAAEFIDTNMRLPDKTLAHSYNRG
FT                   VASGRANLADHADFALGLVALYDATGKNHWLRAAQKQAQIIMQDFAAANGGYYDHKALH
FT                   TKADSDVLNLPSRPIDDGAEPAGNAQALALQLALAARTDDATYQEAAERMLASFSGLIV
FT                   RDPTDFTGLLAGLSDLRHGSVGSLAFAGKGNVRIEAARTAKHTAEVRLHYTAPWHSNAH
FT                   DASPGLIPTAITVSPDAFVRQIDYPQGEKVKLAFSDQPLNLYTGTQVLDIKLNPHVSGP
FT                   MRIRVQIQACSDATCLAPEDLAIWLPL"
FT   gene            complement(304266..304814)
FT                   /locus_tag="Hneap_0294"
FT   CDS_pept        complement(304266..304814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0294"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: mlo:mll1880
FT                   fatty acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95157"
FT                   /db_xref="GOA:D0KXE3"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE3"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ACX95157.1"
FT                   /translation="MSLLSFKLGKVAYTVDLAVYLVAPFLAVASLFYFSEKREAIPILA
FT                   AALLGFVGWTLLEYILHRFVLHHLSPFKEWHGEHHHNPTEAMGTPTLLSLLLIVGIIFL
FT                   PSVYLAGWQIGGGFAMGLLLGYSIYTWLHHGEHHWRGHNKWFRNLKRAHAIHHYGHNEH
FT                   NFGVVTSFWDRVFGTYTRK"
FT   gene            305082..305684
FT                   /locus_tag="Hneap_0295"
FT   CDS_pept        305082..305684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: let-526; LEThal ; K11653 AT-rich interactive
FT                   domain-containing protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95158"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95158.1"
FT                   /translation="MKFRQTMIVVIAMAPFFPMTSWAEDATVYQCKDKNGTVIFSGTPC
FT                   GSDAKERVITAPNAGTGGDTKGIKELASQYDQRQAQERKEAAKIAAARAAAQARAQAEQ
FT                   PLPSNEPEIIGYPVTGYYPGYVPNNGVSWGLNVSGDGWSAGISTRPPHDGHAHHRPPRP
FT                   HPNPPPIPYVYKNPGISGQFPGGAPGSSGSNFQPVRP"
FT   gene            complement(305666..306682)
FT                   /locus_tag="Hneap_0296"
FT   CDS_pept        complement(305666..306682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0296"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   har:HEAR0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95159"
FT                   /db_xref="GOA:D0KXE5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE5"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACX95159.1"
FT                   /translation="MSQRSPNTADERTLALLVFVRSHFPDAPPPAIASSDASARRYWRL
FT                   RLTNGDTRIIMDAPPPGEDIRPFIEMQERLTVAGVAVPNIFERDTGQGFLVLEDLGDCT
FT                   FFQWRHGHSIDAVNARLEEAVRLLAPVAQTQTADLPRFDTATLNREMDLFVDWYSAQYH
FT                   DTPFNAEQTARWQRLRDEISARLQTMPQGFVHRDYHSRNLMVQDDRLVAIDFQDAVRGP
FT                   RPYDLVSLLRDSYIDWPEELVSKLQAVFWQQCPPDLREIWPLEQMRNDFAWVAVQRHLK
FT                   VLGIFARLSIRDVKHGYLKDLPLTWKHLHKALAQLPELSGLAELIAPLGPKDQGRTG"
FT   gene            306894..307613
FT                   /locus_tag="Hneap_0297"
FT   CDS_pept        306894..307613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0297"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cyh:Cyan8802_1589 hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95160"
FT                   /db_xref="GOA:D0KXE6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE6"
FT                   /inference="protein motif:PRIAM:3.1.2.6"
FT                   /protein_id="ACX95160.1"
FT                   /translation="MAIFKQLFDEATSTFTYLIADEHTRSALLIDPVHEQYERDRALLD
FT                   ELGLSLKYVLETHVHADHITGGGRLRHETDALFIVGKGTGLDCADRLVADGETIEMDSI
FT                   TIQVIATPGHTDGCTSYRWEDRLFTGDTILIDACGRTDFQQGSPERLYQSIQKLLAFAD
FT                   ETLIYPAHDYNGKRVSSVGQEKTINPYIAGLNEAAFVAKMRALNLPKPKRIDVAVPANS
FT                   LCGGADVPRQPGETEAA"
FT   gene            307610..308758
FT                   /locus_tag="Hneap_0298"
FT   CDS_pept        307610..308758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0298"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tcx:Tcr_1381 sulfide-quinone
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95161"
FT                   /db_xref="GOA:D0KXE7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACX95161.1"
FT                   /translation="MNSVANITVIGAGFGAVTAIKTLRKSNPSARITLIAPEPTMQYYP
FT                   SLIWVPAELRSRDDIMVDLKPLLARLDVIYQPGRVVGVEGSGRRVLVEQGGETIGVDND
FT                   GLIVASGGRFIKKLPGIEHAITVCEGIDAAERIRDRLAAMTGGTIAIGFGGNPNEPSAV
FT                   RGGPMFEMLFGIDRLLRKQGRRDQFKIVFFNPSNRPGNRLGESAVDNLLARMKKFNIEA
FT                   RLGAKMLRFEADKVVTEAGEFAADLILFMPGMTGPTWLEHAPFPKSPGGMIQAEATTRV
FT                   VGFEKVYVVGDSGSYPAPDWAPKQAHMADLMAVAAAHNLLAEQAGKPANQTFKWELICV
FT                   MDMLDRAVLVFRNEKRQFITPPCRLLHYAKRLFEWWYLRSIR"
FT   gene            complement(308958..310787)
FT                   /locus_tag="Hneap_0299"
FT   CDS_pept        complement(308958..310787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0299"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: afr:AFE_2194 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase RecQ; ATP-dependent DNA
FT                   helicase, RecQ family; PFAM: RQC domain; DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; HRDC
FT                   domain protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; HRDC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95162"
FT                   /db_xref="GOA:D0KXE8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE8"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACX95162.1"
FT                   /translation="MNPNVISSPLHILNTVFGYPAFRGPQAEVIDTVMSGRDALVLMPT
FT                   GGGKSLCYQVPALALSGTAIVVSPLIALMQDQVAALRQAGVAAAFLNSTQTGEEAQLVR
FT                   KQLRAGTLDLLYVAPERLLNADTLSLLRDASINLIAIDEAHCVSQWGHDFRPEYIRLGE
FT                   LGQYFPDIPRIALTATADGTTQQEILYRLGLNNARVFISSFDRPNIRYHIAQNHAGSAR
FT                   DALLRFIRDNHANEAGIVYCLSRKRVEEIAAWLSDQGLTALAYHAGLPATQREQTLRRF
FT                   LDEDGVIVVATIAFGMGIDKPDVRFVAHLNLPKSIEAYYQETGRAGRDGLPAEAWMRYG
FT                   LQDVITLRQMMSESNADEAIKRIEQHKLDAMLGLSESTACRRQTLLGYFGEQSTEPCGN
FT                   CDNCLTPPQMWDATLPARQALSTVHRTGQRFGVNYLIDVLRGKTDERITQLGHDKLSVF
FT                   GVGHAHTIDIWRGIFRQLIAQGYLSVDTEGFGGLALCERCRPLLRGEESLWLRQITKPV
FT                   KISRKTRDRPDFVSDEESELWEALRACRKRLATERGVPPYTIFHDASLLDMLHARPTTL
FT                   DAFTDISGVGAHKRDTYGAAFLSVIAPFVRRTR"
FT   gene            310900..311427
FT                   /locus_tag="Hneap_0300"
FT   CDS_pept        310900..311427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_2006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95163"
FT                   /db_xref="GOA:D0KXE9"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95163.1"
FT                   /translation="MAWLSYLQLVIFRVGPEDMPAGWHATTWAFIWFLVTGSMMVFADR
FT                   AAGESLQAALGQSFFDNVLNAVLVAGYAWGWLVIRKHPERLAQLLTALYAALGVLSLVL
FT                   AALWWLMPITPGKAPTNGWWIIVLFVWDVLVVGQIFRRALDWGAALGALISLGYFILAG
FT                   VGVVWAHALVFG"
FT   gene            311494..312861
FT                   /locus_tag="Hneap_0301"
FT   CDS_pept        311494..312861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0301"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: Mur ligase
FT                   middle domain protein; cytoplasmic peptidoglycan synthetase
FT                   domain protein; KEGG: tgr:Tgr7_2447
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95164"
FT                   /db_xref="GOA:D0KXF0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF0"
FT                   /inference="protein motif:TFAM:TIGR01081"
FT                   /protein_id="ACX95164.1"
FT                   /translation="MKKIHILGIAGTFMGSLAQLAKAMGFEVSGRDLAIYPPMSDQLAQ
FT                   AGIPVQTDMNAPLPQDAEIIVGNVMRRDMPVIDELLSGFFRYRSGPQWLGEEVLCDKFV
FT                   LGVAGTHGKTTTSSMLAWILEQAGMAPGFLIGGVPGNFGVSARLGETPFFVIEADEYDT
FT                   AFFDKRSKFLHYRPRGVILNNLEFDHADIFPDLAAIERQFAHFLRLVPNKGLVVMADAT
FT                   PALERVVEQGCWSPIERFGARDSAQPWRLVGEAIWLEGQHLGDMPANIIGRHNRLNALA
FT                   ALALARFAGVPPEQGLNALAGFVGVARRLQNRGTVAGVTVFDDFAHHPTAIIETIAALR
FT                   EQQSASPHSGRLIAVVDPRSNTMRAGVHQHQLAEALAGADLVVFHSPANLGWSPREALA
FT                   SLGTRIRFSPTVDAVLTDVLALAQPDDKILVMSNGSFDGVHQRLLDALAARTASIG"
FT   gene            312896..313486
FT                   /locus_tag="Hneap_0302"
FT   CDS_pept        312896..313486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0302"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; SMART:
FT                   peptidase S16 lon domain protein; KEGG: tgr:Tgr7_2427
FT                   peptidase S16, lon domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95165"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF1"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ACX95165.1"
FT                   /translation="MKDVTLLPLFPLHTVLFPGGHLPLRIFETRYIDMVRTCLREGRPF
FT                   GVVLLKQGSEVRQSDDDLSEFYDVGAGAVIVDTDLGTDGMLHIETQGQGRFRVLRSWSE
FT                   RDGLFRAEVEWLPEATIVTRSNADERLRDFLLRIMEDAAPPYPNALFDDPVWVVYRLLE
FT                   RLPVKLEDRQRVLGAERLDLTVRHLSAMIAAFE"
FT   gene            313660..314040
FT                   /locus_tag="Hneap_0303"
FT   CDS_pept        313660..314040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0303"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: tbd:Tbd_0223 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95166"
FT                   /db_xref="GOA:D0KXF2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF2"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACX95166.1"
FT                   /translation="MTIHEATFANIDNLIKENDILIIDFWAPWCGPCRSFAPVFEAAAE
FT                   ANPSVAFAKANTEAEQQLGAYFQIRSIPTLMIFREQILLFNQAGALPASALDELIGKVK
FT                   ELDMDVVRQEIEKAESESQQQQ"
FT   gene            314071..314985
FT                   /locus_tag="Hneap_0304"
FT   CDS_pept        314071..314985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0304"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: tgr:Tgr7_2425
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95167"
FT                   /db_xref="GOA:D0KXF3"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF3"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACX95167.1"
FT                   /translation="MFSVIAQMAFTIGLGVLWRYYPVGGLTADRARIALTTSVYYFFLP
FT                   ALVLDVLWRAPLGVDTFKIMLAAATGVLVSMAAMFLAARFMTLTRGQLGALVLAASFPN
FT                   ATYMGLPLLSSLYGDAGKAIAIQYDLFACTPLLLSVGLLLAARLGQHDEVVHPIKSLLL
FT                   VPPLWAAIFGAVFNLIGLPQPDWAQGFLGRMGGAVVPIMLLALGMSLRLSTLTPRHLWR
FT                   VSPALLIQIILMPLVVLAVVTALHLTGDLRVAVVLEAATPVMILGLVLCDRFGLDTEMY
FT                   ATTATASILLVLVTLPLWHYLLV"
FT   gene            315048..315608
FT                   /locus_tag="Hneap_0305"
FT   CDS_pept        315048..315608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0305"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   mca:MCA0081 peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95168"
FT                   /db_xref="GOA:D0KXF4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF4"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACX95168.1"
FT                   /translation="MQIEKNVVARLNYVLKDDDGAIIDATQTRVFEYIHGFGNLIPALE
FT                   NQLSGKKEGDRCQITIEPEDAYGLHDETAVIKVPRSRFDPAVELVEGNMVETLGPEGRI
FT                   EMLILSVDGDEVTVDLNHPLAGLRLHFDVEVGGLRMGHPDEIKHGRVHPGGHHLMVGDS
FT                   TYMGDWEGGPEVDSTKEQGETRG"
FT   gene            315601..317409
FT                   /locus_tag="Hneap_0306"
FT   CDS_pept        315601..317409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0306"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein; KEGG:
FT                   noc:Noc_1493 peptidase M61"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95169"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF5"
FT                   /inference="protein motif:PFAM:PF05299"
FT                   /protein_id="ACX95169.1"
FT                   /translation="MVEAVANLPTVHYRLDFSRAHMRYIGVCLSLPSGNAASGAAAWQL
FT                   SLPAWIPGSYLIRDFAKNLVGMKARTVTGQPVAITPLDQQTWQLPTCDQAIEVRFEVYC
FT                   ADFSVRTAHVDPDHAFFNGSSVFLRVHGLEQQPHSVCLEGAPAHWRVATTLPEVAVDDL
FT                   GFGDYRADDYEALIDFPVEMGVFEVVRWVSAGVPHRMVFSHPHPKTDFARIAQDVSRIC
FT                   STEIDFFGEAPFSRYLFLVALDRQGFGGLEHRDSTALIFPRDDLPLMGETEVTPAYQRF
FT                   LSLCAHEYFHSWNVKRIRPDAFTQLPLARPAHTRLLWLFEGFTSYLDDWMVRRAGLITE
FT                   SAYLDALAQTINRAVRGKGWSRQTLEESSFYAWTRFYQQDENAVNAIVSYYTRGALVAM
FT                   MLDLQLRLCGGSLAAVMREIWREFGAKPLPEGAAIERFIERVGELSLGDFFEQALRGTE
FT                   PLEFAALLARFGVNAEPVAESALSSVDAGAVIGGDDPRVAKVQVVFEDRPAAQAGLVSG
FT                   DEIIAVDGLATSGADWGNRICRYQAGDAVQLTGFRQGRLHQWTLVLSEPVLNQWRLRLA
FT                   SELTAVEPEALLRRRDWLAASPSARS"
FT   gene            317409..318233
FT                   /locus_tag="Hneap_0307"
FT   CDS_pept        317409..318233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0307"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: vcj:VCD_001305
FT                   biotin-protein ligase/biotin operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95170"
FT                   /db_xref="GOA:D0KXF6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF6"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACX95170.1"
FT                   /translation="MVPFDFHALRLRLDERAFVEQAAAVVLPSVDSTSDYLRAHWPDQA
FT                   EAGASWSICVAQTQTAGRGRHGHHWRSEPGSGLWFSCAVPVVPCTAEVVPPLSLVVASE
FT                   LIRVLNAVGFEIGLKWPNDLWCHDSKVGGLLVEQMGVGVARYWLIGIGINWLAPTHLPQ
FT                   DKTGVVPSVTGLFEEGELSSIDREALAEQLIMVAIHAARHPESWSESMRRANHWNALLG
FT                   RRVQLWHAGEAGETGLAGDIKLNGELGFVSDVGDFRSIGGSISVRLVQDEGC"
FT   gene            318234..319001
FT                   /locus_tag="Hneap_0308"
FT   CDS_pept        318234..319001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0308"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: maq:Maqu_0703 Baf family
FT                   transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95171"
FT                   /db_xref="GOA:D0KXF7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF7"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACX95171.1"
FT                   /translation="MKCYIDAGNTRIKWQIGPKGKAKALAWSEKSQWLEQMSSSSGKKQ
FT                   TISKFVVATVSSESLRQWLAETLAENFANVPVQWLKSRARCCGVKLAYPEVSQFGVDRF
FT                   CALVATRQRCPDQAVLVINAGTAITVDYIAPTGQHEGGIIMPSLAAMKAGLNALAPNLS
FT                   DRREPHESGVGAQTAWLATNTADALQLGRQWMLVSALSQTINAMRAHAAPCSLAVVVGG
FT                   GDAIAVQAMIDPAAHVVENLVLEGVKILARQRE"
FT   gene            319074..319149
FT                   /locus_tag="Hneap_R0003"
FT                   /note="tRNA-Thr1"
FT   tRNA            319074..319149
FT                   /locus_tag="Hneap_R0003"
FT                   /product="tRNA-Thr"
FT   gene            319250..319334
FT                   /locus_tag="Hneap_R0004"
FT                   /note="tRNA-Tyr1"
FT   tRNA            319250..319334
FT                   /locus_tag="Hneap_R0004"
FT                   /product="tRNA-Tyr"
FT   gene            319388..319461
FT                   /locus_tag="Hneap_R0005"
FT                   /note="tRNA-Gly1"
FT   tRNA            319388..319461
FT                   /locus_tag="Hneap_R0005"
FT                   /product="tRNA-Gly"
FT   gene            319485..319560
FT                   /locus_tag="Hneap_R0006"
FT                   /note="tRNA-Thr2"
FT   tRNA            319485..319560
FT                   /locus_tag="Hneap_R0006"
FT                   /product="tRNA-Thr"
FT   gene            319633..320823
FT                   /locus_tag="Hneap_0309"
FT   CDS_pept        319633..320823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0309"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: tgr:Tgr7_2338
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95172"
FT                   /db_xref="GOA:D0KXF8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF8"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACX95172.1"
FT                   /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITKVMAEAHGGASL
FT                   GYDQIDKAPEEKARGITINTSHVEYESDARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVEMEIRDLLSKYEF
FT                   PGDDTPIVTGSALKALEGDTSDIGVPSVIKLVKAMDDYFPEPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRIERGIVKVGEEVEIVGIRDTTKTTVTGVEMFRKLLDQGMAGDNVGILL
FT                   RGTKRDDVERGQVLCKPGSIKPHTKFEAEVYILGKDEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGSCVLPEGTEMVMPGDNVAMTVSLIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE"
FT   gene            320906..320981
FT                   /locus_tag="Hneap_R0007"
FT                   /note="tRNA-Trp1"
FT   tRNA            320906..320981
FT                   /locus_tag="Hneap_R0007"
FT                   /product="tRNA-Trp"
FT   gene            321067..321441
FT                   /locus_tag="Hneap_0310"
FT   CDS_pept        321067..321441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0310"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: aeh:Mlg_0445
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95173"
FT                   /db_xref="GOA:D0KXF9"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXF9"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ACX95173.1"
FT                   /translation="MSEKAVEPARSSGLESAKIGLAIVLLLGGVAAFYWLSKEPLFVRV
FT                   ASLLVPLLLAAAVLYATAVGRSIWRFAFDSRVEVRKMVWPTRQETTQTTLVVVLLIVVI
FT                   SLFLWGVDSLLAWIVRSIAG"
FT   gene            321454..321987
FT                   /locus_tag="Hneap_0311"
FT   CDS_pept        321454..321987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0311"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: tgr:Tgr7_2336 NusG antitermination factor;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: NGN domain protein; KOW domain protein; SMART:
FT                   NGN domain protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95174"
FT                   /db_xref="GOA:D0KXG0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG0"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ACX95174.1"
FT                   /translation="MAMRWYVVQAFSQFENSVKKALEERIEREGLQSLFGEILVPSEEV
FT                   VEMRDGVKRRSERKFYPGYVLVQIDMTDEAWHLVNSVPRVLGFVGDSGGKPTPISSKEA
FT                   EAIMTRVKDSTDKPKPKTLFDVGEMVRVCDGPFNDFTGVVEEVNYEKSRLHVAVSIFGR
FT                   STPVELGFDQVAKT"
FT   gene            322062..322493
FT                   /locus_tag="Hneap_0312"
FT   CDS_pept        322062..322493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0312"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: aci:ACIAD0302 50S ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95175"
FT                   /db_xref="GOA:D0KXG1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG1"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ACX95175.1"
FT                   /translation="MAKKVTGYIKLQVKAGQANPSPPIGPALGQKGVNIMAFCKEFNAA
FT                   TQTLEQGSPIPVVITVYADKSFTFIMKTPPVSFLLKKTAGIKAGSAVPNKTKVGTLTRQ
FT                   QIEDIAKIKQPDLTAKDMEAMVRTIAGSARSMGLNVEGL"
FT   gene            322493..323188
FT                   /locus_tag="Hneap_0313"
FT   CDS_pept        322493..323188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0313"
FT                   /product="ribosomal protein L1"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: tgr:Tgr7_2334 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95176"
FT                   /db_xref="GOA:D0KXG2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG2"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ACX95176.1"
FT                   /translation="MAKLTKRQKAIAAKVNANQPYAAADAFNLLKEVSTVKFVEAVDVS
FT                   VHLGVDPRRSDQMVRGATVLPNGTGKSVRVAVFAQGANAEAAKAAGADIVGFEDLAAEI
FT                   KQGRMDFDVVIATPDAMRVVGQLGQVLGPRGLMPNPKVGTVAVDAAMAVKNAKAGQVRY
FT                   RTEKGGIIHCTIGKVNFTPEALTENLNALLADLNKAKPAASKGIYMKRVSVSSTMGPGL
FT                   LVDLASLAV"
FT   gene            323424..323951
FT                   /locus_tag="Hneap_0314"
FT   CDS_pept        323424..323951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0314"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: tgr:Tgr7_2333 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95177"
FT                   /db_xref="GOA:D0KXG3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG3"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACX95177.1"
FT                   /translation="MALTIDQKQLIVAEVTEVAGKALSAIGAEYSGLTVSQMTQMRVKA
FT                   RESGVYLRVIKNTLARRAMADTPFSCMSEALTGPLVLAFSMEDPGAAARLMKDYAKDFA
FT                   KLEIKVVALGGQLLSVADVDRVASLPTRDEALSQLLAVMKAPIGKLARTLNEVPGKLVR
FT                   TVAAVRDQKQAA"
FT   gene            323983..324360
FT                   /locus_tag="Hneap_0315"
FT   CDS_pept        323983..324360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0315"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: mca:MCA1065 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95178"
FT                   /db_xref="GOA:D0KXG4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG4"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ACX95178.1"
FT                   /translation="MAISKDDILEAISNMSVMEVVDLISAMEEKFGVSAAAAVAVAGPA
FT                   AAGPAAAVEEKTEFDVVLKSFGANKVGVIKAVRELTGLGLKEAKDMVEGAPATIKEGAS
FT                   AADAEAMKAKLTEAGAEVEVK"
FT   gene            324553..328719
FT                   /locus_tag="Hneap_0316"
FT   CDS_pept        324553..328719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0316"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: aeh:Mlg_0451 DNA-directed RNA polymerase
FT                   subunit beta; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   Rpb2 domain 7; RNA polymerase Rpb2 domain 3; RNA polymerase
FT                   beta subunit; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95179"
FT                   /db_xref="GOA:D0KXG5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG5"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ACX95179.1"
FT                   /translation="MSYSFTEKKRIRKEFGHRADILPVPYLLATQVESYKSFLQSGVPA
FT                   KGRTNAGLHAALSSVFPIRSHSGNAEIAYVDYYFGEPAFDVRECQIRGLSYGAPLRVKM
FT                   RLVIYDRDAPAGSKVVKDIREQDVYLGEIPLMTESGTFVINGTERVIVSQLHRSPGVFF
FT                   DHDKGKTSSSKKILFSARIIPYRGSWLDFEFDQKDILYARIDRRRKIPASIILRALGYT
FT                   NQNMLDIFFDHDEFHIDKDGGLALTLVADRLKGTDAAFDIDINGENLIKTGKRITARHV
FT                   RELVAAKVTSLPVPVDFVVGRVLASDVIDTSTGEVLAQGNEELTTELVAKLAKAGITQF
FT                   KTLYFNDVDRGPFMSLTLRADPSTTPLEAMVEIYKMMRPGEPPTKDSAEALFHGLFFTE
FT                   DRYDLSEVGRMKFNRRIEREGDVGPGVLYDGKYFTTRAAQGDEAAKQLLKEQGGVSDIL
FT                   DVMKELIDIRNGNGKTDDIDHLGNRRIRSVGEMTENVFRIGLVRVERAVKERLTQAESE
FT                   GLTPQDLINAKPVAAAIKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAG
FT                   FEVRDVHTTHYGRVCPIETPEGPNIGLINSLATYARTNGYGFLETPYRTVKDGVVSKEV
FT                   DWLSAYEEEKFTIAQANAPLDDNGVLQGNLISVRRAGEFMLASPEEIQYMDVSPKQIVS
FT                   IAASIIPFLEHDDANRALMGSNMQRQAVPTLRADKPLVGTGMERVVATDSGSCVVARRG
FT                   GVVDRVDAARVVVRVNAEEASQGDVGVDIYNLTKYTRSNQNTCINQTPLVKAGDVIAKG
FT                   DVLADGPSVDMGELALGQNILCAFMPWNGYNFEDSILLSERVVREDRLTTIHVEELNCI
FT                   ARDTKLGAEEITADIPNVAESLLNKLDAAGVVHVGAEVRPGDILVGKVTPKGETQLTPE
FT                   EKLLRAIFGEKASDVKDTSLRVPPGMEGTVIDVRVFTRDGIEKDSRARAIEEADLEAVR
FT                   KDLKDRMRIIEGDILARVKSVLVNQVAVGGPGVKAGSKITAAQLEKIEPSKWLEIRVEG
FT                   EEAAQAMEEYIAQLAQAQVDIDKRFEDKKKKIQQGDDLAPGVLKMVKVYVAVKRRIQPG
FT                   DKLAGRHGNKGVVSMIVPEEDMPYMENGQPVDICLNPLGVPSRMNIGQILETHLGFAAR
FT                   GLGVKIEEMLKLERAKALIELRAFLDKVYNYKSDKPVDLDALSDDELIELARNLKKGVP
FT                   MATPVFDGAVEDEIKYMLELAGLPTSGQVQLYDGRSGEPFERTTTVGYMYMLKLNHLVD
FT                   DKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVN
FT                   GRNKMYKNIVDGDLKMDAGMPESFNVLLKEIRSLAINVELEQGKE"
FT   gene            328797..333002
FT                   /locus_tag="Hneap_0317"
FT   CDS_pept        328797..333002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0317"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: tgr:Tgr7_2330 DNA-directed RNA polymerase
FT                   subunit beta'; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95180"
FT                   /db_xref="GOA:D0KXG6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG6"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ACX95180.1"
FT                   /translation="MKELLNLMSREVTDDDFDGIRISLSSPEMIRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPVRDYECLCGKYKRLKHRGVVCEKCGVEVTLSKVRRERMGH
FT                   IELACPVAHIWYLKSLPSRIGLLLDMTLRDIERVLYFEAFVITDPGMTTLNKGDLLTDE
FT                   MYIDAIEQFGDEFEADMGAEAIQKLLKDIDLDQQILTLRDELASTGSETKIKRLSKRLK
FT                   LIEAFKESGNRPEWMVLTQLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LIEINAPDIILRNEKRMLQESVDSLLDNGRRGRAVTGTNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLRLHQCGLPKKMALELFKPFIFGKLHRRGLATTIKAAKK
FT                   LVEREGPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCSAYN
FT                   ADFDGDQMAVHVPLSLEAQAEARALMMSTNNVLSPANGDPVIVPSQDIVLGIYYMTRAK
FT                   VNGRGEGMVFADLDEVQRAYDNHQVELGAQIKVRVNDWIRYDDGTAESVRHILETTVGR
FT                   ALLYKALPEGVPFEQINKDMGKKAISALLNYVYRQLGLKDTVLFADQLMYTGFRYATRS
FT                   GISICSDDMLVPPSKPAELAKAEAEVGEIQNQYSQGLVTEKERYNKVVDIWSRANDQIS
FT                   RAMMEQLGTEKVVDREGNTVKQSSFNAIFMMADSGARGSAAQIRQLAGMRGLMTKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDIVITID
FT                   DCGTQSPGLKVTAVIEGGDVVQGLGARILGRTTSQDVLMPGSDEVLVPSGTVINEVLVA
FT                   RLEESGVDEVWVRTPIGCESRHGICQKCYGRDLARGNLVNIGESVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRSASASSVQNKAAGVVRLHNLKTVKNRDNDLVAVTRSGELGMIDDQ
FT                   GRERERYKIPYGAVIRVKEGEKVAGGTTLATWDPHTHPVVSEMQGQARFSDFVDGQSVK
FT                   SDTDEITGLSSQVVIDPKHRNSAAKELRPAIALIDDAGEPVCLAGTDIPAFYVLPAGAI
FT                   IGIEDGAAVQVGDIIARIPQESSKTRDITGGLPRVADLFEARKPKEPAILAEYTGTISF
FT                   GKETKGKQRLVITDEHGEAHEELIPKYRVINVFEGEHVARGEVIADGELTPHDILRLRG
FT                   IPDLAAYIIKEIQDVYRLQGVIISDKHIEVIVRQMLRKVEISEPGDSGYLRGDQVDKAR
FT                   LLEENRMLEQAGKFAAKFDPMLLGITKASLVTESFISAASFQETTRVLTDSSTRGARDE
FT                   LRGLKENVIVGRLIPAGTGLAHHQERRRRRHLTMDSANALFMDSDSSDARVDEGENVS"
FT   gene            333122..333499
FT                   /locus_tag="Hneap_0318"
FT   CDS_pept        333122..333499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0318"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: avn:Avin_06190 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95181"
FT                   /db_xref="GOA:D0KXG7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG7"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACX95181.1"
FT                   /translation="MATVNQLVRKPRKRLVEKTKVPALEGCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTSGFEVTGYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSLDT
FT                   QGVDKRRQGRSKYGAKRPKAK"
FT   gene            333527..333997
FT                   /locus_tag="Hneap_0319"
FT   CDS_pept        333527..333997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0319"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: aeh:Mlg_0454 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95182"
FT                   /db_xref="GOA:D0KXG8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG8"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACX95182.1"
FT                   /translation="MPRRREVPKREILPDPKYGNVTVAKFINMIMLSGKKSVAESILYG
FT                   AMTIAEAKGKGHPVELVERALENVAPAVEVKSRRVGGANYQVPVEVRAVRRSSLAMRWL
FT                   IDAARKRGEKTMAAKLAGELMDAAESRGSAVKKREDTHRMAEANKAFAHFRW"
FT   gene            334015..336114
FT                   /locus_tag="Hneap_0320"
FT   CDS_pept        334015..336114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0320"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: pay:PAU_00341 elongation factor g (ef-g)"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95183"
FT                   /db_xref="GOA:D0KXG9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXG9"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACX95183.1"
FT                   /translation="MARTTPLERYRNFGIMAHIDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWGGMDKQFEPHRFNIIDTPGHVDFTIEVERSLR
FT                   VLDGAVFVLCAVGGVQPQSETVWRQANKYSVPRLAFVNKMDRSGADFYRVMEQLKKRLG
FT                   ANPLPVVLPIGAEEGFEGVIDLLRMKAIYWNTEDMGLTYDEKEIPAELLEKAKTYRSQM
FT                   MEAAAEANEEVMEKYLETGDLTDDEIVSGLRQRTLNNEIIPALCGTAFKNKGVQKMLDA
FT                   VIDYLPSPTQVPPIKGELPDGTPSVRKTGDNEPFSALAFKIMSDPFVGSLTFFRVYSGV
FT                   VNAGDGVLNSTKGNKERLGRILQMHANSREEIKEVRAGDIAAAVGLKNVITGDTLCDLA
FT                   NPIILERMIFPEPVISVAVEPKTKGDQEKMGMALGRLAQEDPSFRVFTDEESGQTIIAG
FT                   MGELHLEILVDRMRREFKVEANIGKPQVAYRETIRGTVEQDGKFVRQSGGRGQYGHVKI
FT                   RIEPLEVGGGYEFVNGIVGGVVPREYIPAVDKGIQEQIKNGVIAGYPVVDVKVTLFDGS
FT                   YHEVDSNEMAFKIAGSMAFKEGAVKANPVLLEPMMKVEVETPEDYMGDVIGDLNRRRGM
FT                   IQGMEDTVGGGKQVKAEVPLSEMFGYATDLRSATQGRATYSMEFARYGEAPKNVADAVI
FT                   KGKSA"
FT   gene            336147..337337
FT                   /locus_tag="Hneap_0321"
FT   CDS_pept        336147..337337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0321"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: tgr:Tgr7_2338
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95184"
FT                   /db_xref="GOA:D0KXH0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH0"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACX95184.1"
FT                   /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITKVMAEMHGGASL
FT                   GYDQIDKAPEEKARGITINTSHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVEMEIRDLLSKYEF
FT                   PGDDTPIVTGSALKALEGDTSDIGVPSVIKLVKAMDDYFPEPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRIERGIVKVGEEVEIVGIRDTTKTTVTGVEMFRKLLDQGMAGDNVGILL
FT                   RGTKRDDVERGQVLCKPGSIKPHTKFEAEVYILGKDEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGSCVLPEGTEMVMPGDNVAMTVSLIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE"
FT   gene            337343..337654
FT                   /locus_tag="Hneap_0322"
FT   CDS_pept        337343..337654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0322"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: mca:MCA2373 ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95185"
FT                   /db_xref="GOA:D0KXH1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH1"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACX95185.1"
FT                   /translation="MASQTIRIRLKSFDHRLIDRSAAEIVDTARRSGARVKGPIPLPSR
FT                   KERFTVLVSPHVNKDARDQYELRTHKRVLDIIEPTDRTVDLLMQLDLAAGVDVQIRLN"
FT   gene            337802..338446
FT                   /locus_tag="Hneap_0323"
FT   CDS_pept        337802..338446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0323"
FT                   /product="50S ribosomal protein L3"
FT                   /note="TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal
FT                   protein L3; KEGG: tau:Tola_0099 ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95186"
FT                   /db_xref="GOA:D0KXH2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH2"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ACX95186.1"
FT                   /translation="MSLGVVGRKVGMTRVFDDAGVSTPVTVIEVEPNRVTQLKTPEVDG
FT                   YTAVQVTTGTRRASRVTKAMAGHYAKAETASGRMSTEFRISADELAGFQPGAEITVSIF
FT                   DGVEKVDVAGQSKGKGFAGTVKRYNFRTQDATHGNSRSHRVPGSIGQNQTPGRVFPGKK
FT                   MSGHMGDERVSSLGLKVVRVDVERGLILVKGAVPGSTGGDVIVRPSVKIKG"
FT   gene            338455..339063
FT                   /locus_tag="Hneap_0324"
FT   CDS_pept        338455..339063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0324"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: hha:Hhal_0857
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95187"
FT                   /db_xref="GOA:D0KXH3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH3"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACX95187.1"
FT                   /translation="MELQVKDGAAISVSEQIFDRSYNEGLIHQAVVAFMAGARSGTKRQ
FT                   LTRSEVSGGGKKPWNQKGSGRARAGTTRSPIWRTGGVTFAARPRNFEQKINRKAYRVAM
FT                   ASIFSELVRQDRLIVVESLTVSSPKTREVLGLVKNLGIQGGRTLFVAEAFDEHFFLGSR
FT                   NVIELGYLTADMLDPVSLVGAERVVITRAAVKMVEEWLS"
FT   gene            339060..339353
FT                   /locus_tag="Hneap_0325"
FT   CDS_pept        339060..339353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0325"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: smt:Smal_0758
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95188"
FT                   /db_xref="GOA:D0KXH4"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH4"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACX95188.1"
FT                   /translation="MMREKLFDVLRSPLVTEKTARANQENQYAFRVATTATKAEIKAAV
FT                   EQLFSVNVMAVQTLNVAGKARRFRGVAGRRADWKKAYVTLAEGQAIDLGQAN"
FT   gene            339383..340207
FT                   /locus_tag="Hneap_0326"
FT   CDS_pept        339383..340207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0326"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: avn:Avin_06280 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95189"
FT                   /db_xref="GOA:D0KXH5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH5"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACX95189.1"
FT                   /translation="MALKIAKPTSPGRRSVIEIDRSHLYKGAPYAPLLEKKSNTGGRNN
FT                   LGRITTRHIGGGHKQHYRLVDFKRVKDGIPATVERIEYDPNRTAHIALIMYADGERAYI
FT                   LAPRGVVPGQVVLSGVEAPIRAGNCLPMRNIPIGSTIHAVELKPGKGAQIARSAGAAVQ
FT                   LVAREGAYVTLRLRSGETRKVLAECRATLGEVSNHEHSLRSLGKAGATRWRGIRPTVRG
FT                   VVMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGYKTRTNKRTDKLIVRRRSK"
FT   gene            340232..340507
FT                   /locus_tag="Hneap_0327"
FT   CDS_pept        340232..340507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0327"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: ttu:TERTU_0912 ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95190"
FT                   /db_xref="GOA:D0KXH6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH6"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACX95190.1"
FT                   /translation="MPRSLKKGPFVDHHLLKKVEEAAAANNRRPIKTWSRRSMILPDFI
FT                   GLTIAVHNGRQHIPVLVNENMVGHKLGEFAPTRTYRGHVADKKAKR"
FT   gene            340517..340849
FT                   /locus_tag="Hneap_0328"
FT   CDS_pept        340517..340849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0328"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: vcj:VCD_001772 LSU ribosomal protein
FT                   L22p (L17e)"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95191"
FT                   /db_xref="GOA:D0KXH7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH7"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACX95191.1"
FT                   /translation="MQATALHRYARISPQKARLVADLVRGQGVAQAIETLTFSDKKGAD
FT                   LIKKVLESAIANAENNEGADVDRLRIATIMVDEGPVLKRFRARAKGRGARILKKTSHIL
FT                   VTVSER"
FT   gene            340860..341534
FT                   /locus_tag="Hneap_0329"
FT   CDS_pept        340860..341534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0329"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: tgr:Tgr7_2318 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95192"
FT                   /db_xref="GOA:D0KXH8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH8"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACX95192.1"
FT                   /translation="MGQKVHPVGFRLGISSDWTSRWYADSKLFPVQLNQDVRTRAFIKD
FT                   KLKEASVSRIQIERPARSASVTIHTARPGIVIGRKGEDIERLRGEIAPMLGVDRNAVKL
FT                   SVEEIRKPELDAQLVAESIAQQLERRIMFRRAMKRAVQTSMRLGAGGIKVNVSGRLGGA
FT                   EIARNEWYREGRVPLHTLRADIDYGFAEAQTTYGVIGVKVWIFKGEVFGVPGNRDGKAA
FT                   TA"
FT   gene            341566..341979
FT                   /locus_tag="Hneap_0330"
FT   CDS_pept        341566..341979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0330"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: Ribosomal
FT                   protein L10e/L16; KEGG: mmw:Mmwyl1_4269 50S ribosomal
FT                   protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95193"
FT                   /db_xref="GOA:D0KXH9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXH9"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACX95193.1"
FT                   /translation="MLLPKRTKFRKQFRGKNRGIATTGNKVSFGEFGLKSLERGEITSR
FT                   QIESARRAISRHVKRGGKIWIRIFPDTPITKKPLEVRMGKGKGSVEYWVAKIQPGKMLY
FT                   EIEGVTEDIARQAFSLASAKLPVKTTFVTRVLM"
FT   gene            341979..342176
FT                   /locus_tag="Hneap_0331"
FT   CDS_pept        341979..342176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0331"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: csa:Csal_0429 50S ribosomal protein
FT                   L29P"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95194"
FT                   /db_xref="GOA:D0KXI0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI0"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACX95194.1"
FT                   /translation="MSKITNELREKSPEGLREELLAIKREQFNLRMQKATGQESKSHLI
FT                   REARKNVARIKTILTEKEQG"
FT   gene            342178..342447
FT                   /locus_tag="Hneap_0332"
FT   CDS_pept        342178..342447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0332"
FT                   /product="30S ribosomal protein S17"
FT                   /note="TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal
FT                   protein S17; KEGG: msu:MS2039 30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95195"
FT                   /db_xref="GOA:D0KXI1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI1"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ACX95195.1"
FT                   /translation="MSTETNENVIRTRVGRVTSDKMDKSITVAIERRVKHPLYGKFITK
FT                   TTKLHVHDEDNQSRVGDSVEIRESRPISKTKSWTLVRVITRAAV"
FT   gene            342460..342828
FT                   /locus_tag="Hneap_0333"
FT   CDS_pept        342460..342828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0333"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: tbd:Tbd_0415 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95196"
FT                   /db_xref="GOA:D0KXI2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI2"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACX95196.1"
FT                   /translation="MIQMQTILDSADNSGAKKIQCIKVLGGSHRRYAGIGDIIKVSIKD
FT                   AIPRGRVKKGDVYNAVVVRTAKGVRRADGSLIRFDGNAAVLLNAKLEPIGTRIFGPVTR
FT                   ELRGEKFMKIVSLAPEVI"
FT   gene            342839..343162
FT                   /locus_tag="Hneap_0334"
FT   CDS_pept        342839..343162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0334"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: tgr:Tgr7_2313 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95197"
FT                   /db_xref="GOA:D0KXI3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI3"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACX95197.1"
FT                   /translation="MRKIRQGDEVVVIAGKDKGRRGTVLRVINDGARVVVENINKVKKH
FT                   MKPNPMLGQTGGIIEMEKSIDISNVMLFNPASEKGDRVGFKHLEDGTKVRFFKSNGEVV
FT                   DTK"
FT   gene            343174..343713
FT                   /locus_tag="Hneap_0335"
FT   CDS_pept        343174..343713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0335"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: pag:PLES_06771 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95198"
FT                   /db_xref="GOA:D0KXI4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI4"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACX95198.1"
FT                   /translation="MARLQELYTSTYLPQLKEKLGLDNVMAVPKLTKITLNMGLGDSAR
FT                   DKKVIDSAVDEMAAISGQKPVVTYARKSIAGFKLREGMPLGVKVTLRGSTMYEFFDRLI
FT                   QISVPRIRDFRGLNPKSFDGRGNYSMGVKEQIIFPEIDYDKIDQIRGMDITITTTAQND
FT                   DQARALLECFGFPFRR"
FT   gene            343725..344030
FT                   /locus_tag="Hneap_0336"
FT   CDS_pept        343725..344030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0336"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: tgr:Tgr7_2311 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95199"
FT                   /db_xref="GOA:D0KXI5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI5"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACX95199.1"
FT                   /translation="MAKKSMLNREEQRQKLSARYQAKRDQLRAVLNDPNADFDAKMQAS
FT                   AALSKLPRDSSVCRQVRRCAITGRPKGVYRKFALGRNKLRQLAMSGEIPGLRKASW"
FT   gene            344043..344435
FT                   /locus_tag="Hneap_0337"
FT   CDS_pept        344043..344435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0337"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: asa:ASA_4073
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95200"
FT                   /db_xref="GOA:D0KXI6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI6"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACX95200.1"
FT                   /translation="MSMSDPISDMLTRIRNAQNARKPNVSMPSSKFKQAIAKVLKEEGY
FT                   IGDFQVSGDAKPTLSIALKYFQGKPVIDMIKRVSKPGFRVYKNADELPTVIGGLGVAIL
FT                   STSQGVMPDREARRQNIGGEVICLVS"
FT   gene            344449..344976
FT                   /locus_tag="Hneap_0338"
FT   CDS_pept        344449..344976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0338"
FT                   /product="ribosomal protein L6"
FT                   /note="TIGRFAM: ribosomal protein L6; PFAM: Ribosomal
FT                   protein L6, alpha-beta domain; KEGG: pen:PSEEN0505 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95201"
FT                   /db_xref="GOA:D0KXI7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI7"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ACX95201.1"
FT                   /translation="MSRVAKKPVAIPKGVEVKLNGQVISFKGPKGQLELTLHKSVSVDM
FT                   AANELRFEPESDQFIAMAGTMRALANNNIQGVSAGFEMKLQLVGVGYRAQVQGSTLNLA
FT                   LGFSHPINFAIPAGITIETPSQTEIIIRGADRQKVGQVASNIRGYRPPEPYKGKGVKYH
FT                   DEVIFRKEAKKK"
FT   gene            344986..345342
FT                   /locus_tag="Hneap_0339"
FT   CDS_pept        344986..345342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0339"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: cja:CJA_0715 ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95202"
FT                   /db_xref="GOA:D0KXI8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI8"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACX95202.1"
FT                   /translation="MNEKSQNRLRRARRTRAKIVRLGVHRLTVYRTAQHTYAQIFTPDG
FT                   ATVVASSSTLHPGVIEAGKHGGNIDAAKRVGEMVAKAALAKGITNVAFDRSGFIFHGRI
FT                   KALAESARESGLQF"
FT   gene            345354..345869
FT                   /locus_tag="Hneap_0340"
FT   CDS_pept        345354..345869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0340"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; KEGG:
FT                   tgr:Tgr7_2307 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95203"
FT                   /db_xref="GOA:D0KXI9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXI9"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACX95203.1"
FT                   /translation="MSRNSNEVATDGLIEKLVAVNRVAKVVKGGRIFSFTALTVVGDGE
FT                   GRVGFGYGKAKEVPAAIQKAMDRAKRNMVDVPLRDGTLHYSTVGHHGAAQVFMKPASEG
FT                   TGVIAGGAMRAVFEAVGVRNVLAKCIGTRNHMNVIRATVNGLQSISSPEMIASKRGKRV
FT                   EEIVGSAS"
FT   gene            345866..346057
FT                   /locus_tag="Hneap_0341"
FT   CDS_pept        345866..346057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0341"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: aeh:Mlg_0476 50S ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95204"
FT                   /db_xref="GOA:D0KXJ0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXJ0"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACX95204.1"
FT                   /translation="MSQPAMIRVKLIRSTIGRLASHKACVKGLGLRRMNHEVEVMDTPE
FT                   NRGMINKIEYLLEVQESK"
FT   gene            346057..346485
FT                   /locus_tag="Hneap_0342"
FT   CDS_pept        346057..346485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0342"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: pin:Ping_3505 ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95205"
FT                   /db_xref="GOA:D0KXJ1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXJ1"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACX95205.1"
FT                   /translation="MRLNTLSPADGSRKERTRVGRGVGSGLGKTAGRGHKGQKSRSGGF
FT                   HKTGFEGGQMPIQRRLPKMGFRSLRALASAEIRTSELNKLDGVVSLETLKAAGLIRNDV
FT                   RFVKIMLSGEVTKPVQVQGIRVSKGALSAIVAAGGKAE"
FT   gene            346489..347823
FT                   /locus_tag="Hneap_0343"
FT   CDS_pept        346489..347823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0343"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: tgr:Tgr7_2304 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95206"
FT                   /db_xref="GOA:D0KXJ2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXJ2"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACX95206.1"
FT                   /translation="MALSNAGVASLAGAGRLTELRQRIFFVIMVLVVYRIGTFIPLPGI
FT                   DVDVMRTLFTQHSGGILGMMNMFSGGALSRMSLFALGVMPYISASIIVQLLSSVLPSLE
FT                   RIKKEGEAGRRKITQYTRYGTLGLGLVQALGVSIALQGQSVGGQSLVYTPGFGFLFVAT
FT                   MTLLTGTMLLVWLGEQITERGVGNGISLIIFAGIVAGLPTAIGGTAELVRTGELGVITL
FT                   LILAVLIVAVTAFVVFVERGQRRITVNYARRQQGRGMAGQQSSHLPLKLNMAGVIPPIF
FT                   ASSIILFPATLGNWLGQQENMAWLRSVSTALSPGQPLYVGLYATAIIFFCFFYTALVFN
FT                   SRETADNLKRSGAFVPGIRPGEHTARYIDKVLTRLTFWGALYITAVCLLPEFLILYWNV
FT                   PFYFGGTSLLIIVVVLMDFMAQVQSHLVSHQYDSLVRKAHFKSGL"
FT   gene            347900..348256
FT                   /locus_tag="Hneap_0344"
FT   CDS_pept        347900..348256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0344"
FT                   /product="30S ribosomal protein S13"
FT                   /note="TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal
FT                   protein S13; KEGG: tgr:Tgr7_2302 30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95207"
FT                   /db_xref="GOA:D0KXJ3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXJ3"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ACX95207.1"
FT                   /translation="MARIAGINIPVQKHVVIALTSIYGIGTTRAQAICQASGVEPSRKV
FT                   RDLSESEVEALRAEVAKFIVEGDLRRDVSMNIKRLMDLGCYRGLRHRRGLPLRGQRTRT
FT                   NARTRKGPRRLVKR"
FT   gene            348299..348688
FT                   /locus_tag="Hneap_0345"
FT   CDS_pept        348299..348688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0345"
FT                   /product="30S ribosomal protein S11"
FT                   /note="TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal
FT                   protein S11; KEGG: ppg:PputGB1_0506 30S ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95208"
FT                   /db_xref="GOA:D0KXJ4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXJ4"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ACX95208.1"
FT                   /translation="MAKSNAPARKKIKRVVTDAVAHVHASFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQVAAERAGEAAKAYGVKNIDVEIKGPGPGRESTIRALNSVG
FT                   FKVGVITDVTPIPHNGCRPPKKRRV"
FT   gene            348702..349325
FT                   /locus_tag="Hneap_0346"
FT   CDS_pept        348702..349325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0346"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: eic:NT01EI_3571 30S ribosomal protein S4
FT                   (BS4); TIGRFAM: ribosomal protein S4; PFAM: ribosomal
FT                   protein S4; RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95209"
FT                   /db_xref="GOA:D0KXN6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXN6"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACX95209.1"
FT                   /translation="MARYLGPKCKLSRREGTDLFLKSGVRSHEDKCHHDRAPGQHGAAR
FT                   KQKVSEYGVQLREKQKLRRIYGVLERQFANYFKKAAQLKGSTGENLLQLLECRLDNVVY
FT                   RMGFGSTRSESRQLVSHRAITVNGEVVNIASYQVAANDVVAVRESSRKQQRIKDSLEIA
FT                   AQRPDVSWISVDAAKMEGVFKSAPSRDELPAEINESLVVELYSK"
FT   gene            349342..350337
FT                   /locus_tag="Hneap_0347"
FT   CDS_pept        349342..350337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0347"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: avn:Avin_06500 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase insert; RNA polymerase alpha
FT                   subunit domain protein; RNA polymerase dimerisation; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95210"
FT                   /db_xref="GOA:D0KXN7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXN7"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACX95210.1"
FT                   /translation="MQLGSTELLKPRLVDVQVLDATRARVVLEPLERGFGYTLGNALRR
FT                   ILLSSIPGVAVTEAEIEGVVHEYTTIEGVHEDVLEILLNLKGLSVMLHGRDEAMLSIKK
FT                   TGAGAITAADIKADHAVEIINPEHHIATLNDQGSLVMTFKVTRGKGYVPASARREEAGG
FT                   QIGRLLVDASFSPLRRVSYSVERARVEQRTDLDSLVLDIETNGSISAEDAIRQAAGILV
FT                   DQLSVFVDLKAEKVEPVVEQAPAVDPVLLRPVDDLELTVRSANCLKAENIYYIGDLIQR
FT                   TEIELLKTPNLGKKSLTEIKDVLAKQGLSLGQRLENWPPAELLNLAESKI"
FT   gene            350367..350747
FT                   /locus_tag="Hneap_0348"
FT   CDS_pept        350367..350747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0348"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: msu:MS2022 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95211"
FT                   /db_xref="GOA:D0KXN8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXN8"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACX95211.1"
FT                   /translation="MRHRLSGRQLGRNSAQRNALMRSLTNSLIEHELIKTTLPKAKELR
FT                   RFAEPLITLAKDDSVHARRMAFAQTRNKEVVGKLFSDLGPRFKARAGGYVRILKCGNRA
FT                   GDNAPMAYVEFVQRGDAASVAE"
FT   gene            350881..351531
FT                   /locus_tag="Hneap_0349"
FT   CDS_pept        350881..351531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95212"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXN9"
FT                   /inference="similar to AA sequence:KEGG:Tcr_0940"
FT                   /protein_id="ACX95212.1"
FT                   /translation="MSVSNKIRGIRHSALALGVVLGLMSVGTYAEDAPAAPAAQPAMPT
FT                   LSPEQMELMKDFQQTRQEIGALEQKLQGIEAEAYKKNPKLGKQRDGLRDSIKNAMSDKN
FT                   FDAQAEYDELKALVTKIQGMKENDPERAKDIQKFREGQQAFEQRQAKAFQDPKIQKQSE
FT                   KLRNDVRAAMIKVDPKAKDMFADLDAKEKHMRDLQEKAMKMHGSEQMAPAPSK"
FT   gene            complement(351594..353633)
FT                   /locus_tag="Hneap_0350"
FT   CDS_pept        complement(351594..353633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0350"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: cja:CJA_2425 excinuclease ABC, B subunit;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; type III restriction protein
FT                   res subunit; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95213"
FT                   /db_xref="GOA:D0KXP0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP0"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ACX95213.1"
FT                   /translation="MQDTRFTLVTDYQPAGDQPAAIARLVEGLQDGLAQQTLLGVTGSG
FT                   KTFTIANVIDRLQRPALVLAPNKTLAAQLYGELKGFFPNNAVEYFVSYYDYYQPEAYVP
FT                   ASDTFIEKDASVNEHIEQMRLSATKALLERRDVIIVATVSSIYGLGDPDAYLKMILHLV
FT                   RGEKADQRQILRRLAEMQYTRNDMEFRRGTYRVRGDVIDIHPSESDDEGVRVELFDDEI
FT                   EQISLFDPLTGAIRRRLPRFTIYPSSHYVTPRERILAAVESIKDELTQQLDHLNAENKL
FT                   VEAQRLAQRTRFDIEMMYELGYCNGIENYSRYLSGRHPGEPPPCLYDYLPPDALLIIDE
FT                   SHVTVPQLGAMYKGDRSRKETLVNFGFRLPSALDNRPLKFDEFERMMPQTIHVSATPGP
FT                   YEGSHSAQVVEQVVRPTGLIDPQIEIRPVASQVDDVLSEIRDRASRRERVLITTLTKRM
FT                   AEDLADYLAEHDVRVRYLHSDVDTVERVEIIRDLRLGLFDALIGINLLREGLDIPEVSL
FT                   VAIFDADKEGFLRSERSLIQTIGRAARNLHGKAILYADRITDAMRKAIDETDRRRAKQI
FT                   EHNLEQGITPKGIDKRVDDILQSGDYKIPGSRGASQRSRKMALVAEAASDFSVTMSSEQ
FT                   ILKQIKEREAKMYRLAKDLEFEAAAHIRDEIHRLQEQLIAADAK"
FT   gene            353784..356195
FT                   /locus_tag="Hneap_0351"
FT   CDS_pept        353784..356195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0351"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: mca:MCA1976 ribonuclease R; TIGRFAM:
FT                   ribonuclease R; VacB and RNase II family 3'-5'
FT                   exoribonuclease; PFAM: ribonuclease II; Ribonuclease B OB
FT                   region domain; RNA binding S1 domain protein; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95214"
FT                   /db_xref="GOA:D0KXP1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP1"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ACX95214.1"
FT                   /translation="MSQETVSDPQAAQEAEKYDNPVASREFILQLLSEQDGPLTLNRLI
FT                   SHLEYDGDDERIEGLSRRMRAMERDGQVIRNRRGGYVPVTHAELVRGRVLGHRDGFGFL
FT                   VPDDGGDDVFLSPRVMRALLNGDRAVVQVTGLDRRGRREGNLVEVIERANAEIVGRLVL
FT                   EAGIAFVVPDHARITQDILVPMTDLMGARDGQIVRVALVEQPTLRHKPVGKVVEVLGDH
FT                   MSPGMEIDVAINSHGIPHEWPEEVLAAIDGLNPEVEESHKSGRVDLRSMPLVTIDGADS
FT                   KDFDDAVFCQAAPEGFRLLVAIADVSHYVNVGSALDREGFNRATSVYFPGRVLPMLPEV
FT                   LSNGLCSLNPAVDRLCLCADMLINNEGHIAKFRFFEGVMKSAARLTYDTVAKVLVDQDA
FT                   EARAAHAHLLEPLETLHGVYKVLRSARERRGAIDFDTVETKIVFGEGRKIEAIVPYERN
FT                   DAHKIIEECMIAANVAAGRFVADHKIPALYRVHDRPTAEKITDLRAMLAEKGLSLGGGD
FT                   QPSPKDFNALLSQVQGRADFLTIQTMILRSLKQAVYSPDNLGHFGLAHEFYAHFTSPIR
FT                   RYPDLMVHRAIRHLLRTGAPDRFPYNHDEMVIIGEHCSNNERRADEATRDATDWLKCEF
FT                   MLDKVGEVFEGRVASVLGFGLFVELKDFFVEGLLHITALTKDYYHFDPVTLSLRGERSG
FT                   RVYALNDAITVRVARVDLDERKIDFVLPDDDEALSESSGDARSEPRDDQESDEDDAAKK
FT                   KRKPRRRRRKKPAGDAPAGDDDENADSDDDGSDTSSAPESEPGDAEESRK"
FT   gene            356195..357001
FT                   /locus_tag="Hneap_0352"
FT   CDS_pept        356195..357001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0352"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: cja:CJA_2994 RNA
FT                   methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95215"
FT                   /db_xref="GOA:D0KXP2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP2"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACX95215.1"
FT                   /translation="MAERKSASSTQWLSGFHAVEAALQHDPERVLSVIFEQGRQDKRVQ
FT                   QLRVLAESRGVSIEEAPEKVFADRVRADRELARHQGVLARYQPKPAGNEHDLFALLDNL
FT                   DEPAFLLILDGVTDPHNLGACLRSAEAAGVHAVISPKDRAVGLTPTARKAASGAAERLP
FT                   FIQVTNLARTLADLKSRQIWIVGAAGGGMVSLYESDFAAESVALVMGSEGEGLRRLTQE
FT                   GCDQLIFIPMRPPVESLNVSVAAAVCLFEFRRVRDQVINQARALSQ"
FT   gene            357115..358290
FT                   /locus_tag="Hneap_0353"
FT   CDS_pept        357115..358290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0353"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mca:MCA2202 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95216"
FT                   /db_xref="GOA:D0KXP3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP3"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACX95216.1"
FT                   /translation="MIFSDRVRRVRPSPTLAVTAKAAELKAQGRDIISLGAGEPDFDTP
FT                   EPIRAAAIDAINAGFTRYTAVEGILSLRQAIAKRLRDDQGLDYAPNEIIVSTGGKQSIY
FT                   NLFQALLNPGDEVIIVAPYWVSYPDMVLLAGGEPVIVLAGQNQGFKVSPAQLEAAITDK
FT                   TRIVMLNSPSNPTGVAYTRDDWAAMAKVLRAHPKLLIATDDMYEKILWADESFSNIAMV
FT                   APDLKARTVVLNGVSKAYAMTGWRIGYAAGPADIIKAMNVIQSQSTSGACSIAQVAAQA
FT                   AIEGDQSEIRAMVHSFRTRHDFVVGRLNEMPDVVCLPSQGAFYSFPDVSAVIARLGLKD
FT                   DVALSEMLLEKAGVAVVPGTAFGAPGHIRLSYATSMGALDEALRRMADVMG"
FT   gene            358362..359411
FT                   /locus_tag="Hneap_0354"
FT   CDS_pept        358362..359411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0354"
FT                   /product="RecA protein"
FT                   /note="KEGG: tgr:Tgr7_1287 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95217"
FT                   /db_xref="GOA:D0KXP4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP4"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ACX95217.1"
FT                   /translation="MDENRKKALTAALSQIERQFGKGAVMRMNDTAGVDVPVVSTGSIA
FT                   LDAALGIGGLPRGRVVEIYGPESSGKTTLTLQVIAQAQKTGGVCAFVDAEHALDPTYAQ
FT                   KLGVNVDDLLVSQPDTGEQALEITDMLVRSGAVDVVVVDSVAALVPKAEIEGEMGDAHV
FT                   GLQARLMSQALRKLTGNIKRTNCMVIFINQIRMKIGVSYGSPETTTGGNALKFYASVRL
FT                   DIRRVGAVKKGEEIIGNQTRIKVVKNKMAPPFKVVDVDILYGEGISRLMELIDMATTHG
FT                   LIQKAGAWYSCGDIRLGQGKDNARQYFVEHPELADDIEAKLRASMLASTGKVAVRASED
FT                   DESSAVLED"
FT   gene            359427..359933
FT                   /locus_tag="Hneap_0355"
FT   CDS_pept        359427..359933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0355"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: aeh:Mlg_1482
FT                   recombination regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95218"
FT                   /db_xref="GOA:D0KXP5"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP5"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="ACX95218.1"
FT                   /translation="MAWHWQAKAQEDKTDAAKIEKVAVGLLARREHSAFELQRKLSQRG
FT                   FDSLVIDDVISRLAEQGWQSDARYAEAYVRMRVERGYGRESIRAELGQRGVARAVIQTA
FT                   LDEADIDWLACAKRQIHRHYHAAPDGHDDQLRRYRHLLSRGFTPEQSRIASGQWRDAEG
FT                   MDDAF"
FT   gene            359920..360090
FT                   /locus_tag="Hneap_0356"
FT   CDS_pept        359920..360090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95219"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95219.1"
FT                   /translation="MMPFNYCFCGWKADRQIPVAAWRISSLEAVFAVTATMGHRLITAF
FT                   RYTRAQHRFTF"
FT   gene            360104..362722
FT                   /locus_tag="Hneap_0357"
FT   CDS_pept        360104..362722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0357"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: tgr:Tgr7_1289 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: Alanyl-tRNA synthetase, class
FT                   IIc-like; phosphoesterase DHHA1; Threonyl/alanyl tRNA
FT                   synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95220"
FT                   /db_xref="GOA:D0KXP7"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP7"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ACX95220.1"
FT                   /translation="MMKTTAELRTAFLEFFNQRGHEIVPSSSLIPAHDPTLLFTNAGMV
FT                   QFKDAFLGLEHRANPRAVSCQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFK
FT                   PEAIRYGWDFLTQVLKLPADRLLVTVYQTDDEAYAIWRDEIGLPEEKVLRIGDKPSGGS
FT                   DNFWQMGDTGPCGPCTEIFYDHGAHIPGGPPGSADEDGDRFIEIWNIVFMQYDRTVDGQ
FT                   LHPLPKPSVDTGMGIERLAAILQGGHSNYDIDIFRHLITAAQAVTGAADQKSSSLKVLA
FT                   DHIRSCAFLIVDGVRPGNEGRDYVLRRIIRRAARHGHKLGVDEPFFYRLVAPLVEVMGP
FT                   AYSELANAQAEVARVLRQEEERFLQTLASGMQVLETELADMTPGGTIPGEVVFKLYDTH
FT                   GFPFDLTADIARERGLVLDESGFEHAMAERRAQSRAASQFAQQTHVLEIETPTCFEGYA
FT                   QDKAQGALIAIVHDGEQIDVLEAGQSGALVLDHTPFYAESGGQVGDTGVITTAGGRFVV
FT                   TDTQKQGANFLHLGEVIEGRVALGDVADAQIDVERRHSIRLNHSATHLLHAALRQVLGT
FT                   HVHQKGSRVGAESLRFDFSQSEPITDAQLREIERIVNAQIRENHSVETREMPVDEARAA
FT                   GAMALFGEKYGDVVRVVTMGPFSMELCGGTHARRGGDIGLIKIVSESGVASGVRRIEAV
FT                   TGASALAVLEQTDDALAEIASMVRGSRQDAVSRVSQVIERARQLERELAEIKAKQAAEA
FT                   GGDLLTTAVAMGDVNYLVAELPDADVNTLRDTVDQLKNKLGTSAVMLASVEDGKVRLIA
FT                   GVSKDLTGRIKAGDWVNVAAQIVGGKGGGRPDMAQAGGPDSAQLPAAMEAARAWMKKQL
FT                   S"
FT   gene            362922..364154
FT                   /locus_tag="Hneap_0358"
FT   CDS_pept        362922..364154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0358"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tgr:Tgr7_1290 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95221"
FT                   /db_xref="GOA:D0KXP8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP8"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACX95221.1"
FT                   /translation="MALIVQKYGGTSVGSVERIGAVADRVIRTCRAGHDVVVVVSAMSG
FT                   ETNRLLDLAKQLQARPNERELDALVSTGEQVTTALLSMALLQRGQDARSYTGAQVKITT
FT                   NSAFNKARIQSIDTQAVMGDLAAGRVVVVAGFQGVNEKGDITTLGRGGSDTSAVAIAAA
FT                   LNADECQIYTDVDGVYTTDPRVEPRARRLDRITFEEMLEMASSGSKVLQIRSVEFAGKY
FT                   NVPLRVLSSFSDGAGTLITMEDDVVEQAVISGIAFNRDEAQLTVKGVPDSPGIAYAILG
FT                   PVAEANIEVDMILQNMGADNTTDFTFTVQHVDYEKTLDIVRVQAEALGAREVSGNPKIV
FT                   KVSVVGVGMRSHAGIAAKMFKVLADEKINIRMISTSEIKISVVVDDKYLELAVRTLHDA
FT                   FELDAPSALIG"
FT   gene            364233..364448
FT                   /locus_tag="Hneap_0359"
FT   CDS_pept        364233..364448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0359"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="TIGRFAM: carbon storage regulator; PFAM: carbon
FT                   storage regulator; KEGG: tgr:Tgr7_1291 carbon storage
FT                   regulator, CsrA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95222"
FT                   /db_xref="GOA:D0KXP9"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXP9"
FT                   /inference="protein motif:TFAM:TIGR00202"
FT                   /protein_id="ACX95222.1"
FT                   /translation="MLILTRRIGEVLRVGDEVSITVLGIKGNQVRIGIDAPKDVSVHRE
FT                   EIYQRIKNEGHSQEDGVSGQQSSVEE"
FT   gene            364525..365724
FT                   /locus_tag="Hneap_0360"
FT   CDS_pept        364525..365724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0360"
FT                   /product="ammonium transporter"
FT                   /note="PFAM: ammonium transporter; KEGG: mei:Msip34_1153 Rh
FT                   family protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95223"
FT                   /db_xref="GOA:D0KXQ0"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ0"
FT                   /inference="protein motif:PFAM:PF00909"
FT                   /protein_id="ACX95223.1"
FT                   /translation="METASLVSAVDVLFVLSGAIMVLAMHAGFAFLEVGTVRRKNQVNA
FT                   LAKIMADFAVSAIAYFFIGYFVAYHIDFWSSASQLTADHGHELVKFFFLLTFAAAIPAI
FT                   ISGGIAERARFYPQLAATFLLVSLVYPFYEGLIWNGNFGFQAWLTHQFGAAFHDYAGSM
FT                   VVHGMGGWIAIAAVLLLGPRHGRYGKNGEIFAHPPSNIPFLALGSWILAVGWFGFNVMS
FT                   AQNIAGISGLVAVNSLMAMVGGILSALVVGRNDPGFLHNGPLAGLVAVCAGSDVMHPVG
FT                   ALVTGLIAGGLFVWLFTFVQNRLKIDDVLGVWSLHGVCGLWGALAAGIFGLKALGGVGG
FT                   VSFISQFIGSAVAIAVALGAGFVIYGMLKLFIGIRLTEEQEYEGADLTVHRISATPKYD
FT                   "
FT   gene            365792..365881
FT                   /locus_tag="Hneap_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            365792..365881
FT                   /locus_tag="Hneap_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(367010..369424)
FT                   /locus_tag="Hneap_0361"
FT   CDS_pept        complement(367010..369424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0361"
FT                   /product="Relaxase/mobilization nuclease family protein"
FT                   /note="PFAM: Relaxase/mobilization nuclease family protein;
FT                   KEGG: lhk:LHK_00918 relaxase/mobilization nuclease
FT                   topoisomerase/primase fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95224"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ1"
FT                   /inference="protein motif:PFAM:PF03432"
FT                   /protein_id="ACX95224.1"
FT                   /translation="MKAKITRGMGFRGVLDYALDTGNQKGKNPEIVGGTLTVGNARAMS
FT                   AQFAVTRRLRPDIKAPVWHASLALPIGERLSSDKWSSIADEFMQAMGFPSDSLYTVIRH
FT                   NDTQYDHVHIIASRISLSGALWHGQWEVYRAIKATQTLERIHDLILTPGLGEPKDEKSL
FT                   TKNEIEMALCTGEEPPRQRLQRLVKEAAQGRPTAVMFAERLALAGVGVRFQIQKTGITG
FT                   VSYEIDGIAFKGQSLGDAYKWSKFSKKQAVSYEQARDSEGIRQFTTAIADRARGDKLGD
FT                   SSTHLENDTGIATTNHRGADDPSTGTPDLVEGGSNTSPDRLRHSDSSAAPGTGRADAGD
FT                   DRQSSAGIRAEGGEAESDHLDFVAASAGTEIKHRQDDENRPPDRIDTPETRRITSANDY
FT                   SGRGTDADGTTDAATKVENSTGADSGRDGQRSGSSDWSRRFREASAAKRRTAERGMGGS
FT                   RLGERNARRASVADEDRQSAREIDPSSYLKTMGFAVKKQGRHVSVSLNGDETYRGTLKP
FT                   DGHFVWCDRYENGIGHNIDLVNEIEPGSGYATAVYRLLGAPSVNPNLQRAAPKRQPPRL
FT                   PEQAVANRLSGRAYLGNERGISKDTLDHAEACGMLRYADGGVLFVGYDAKGTPQSITRR
FT                   ATELADPIQKRDFARSDKSYAPILSGDPSTVWIVEGGVDALALHDLAKRQEQPSPTVIV
FT                   SGGANVRSFLDNPFIQMIIRAAKRIFIAMEREKDAATQAKTDAAHEQQAQRVEEITGIR
FT                   PLIWQPKKDKDLADMNHRQQKPQPVRLMRDAIKQSTVKLPSTVMKDDFTQG"
FT   gene            complement(369414..369818)
FT                   /locus_tag="Hneap_0362"
FT   CDS_pept        complement(369414..369818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhk:LHK_00917 auxiliary mobilization protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95225"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95225.1"
FT                   /translation="MKPIDQSRTSRRPRRGHALPETERRRHAVMLRVNDAELAEIDARR
FT                   GIYDRGEFLRMALFGMTQARPRPAMVIPTLNQSAWLELSRSASNLNQFARHLNEAGIQL
FT                   GDLPQIIILLNQFRDALIGVRLTEDMDDES"
FT   gene            complement(370195..371868)
FT                   /locus_tag="Hneap_0363"
FT   CDS_pept        complement(370195..371868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0363"
FT                   /product="protein of unknown function DUF637 hemagglutinin
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF637
FT                   hemagglutinin putative; KEGG: aci:ACIAD2784 putative
FT                   hemagglutinin protein (FhaB)"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95226"
FT                   /db_xref="InterPro:IPR006915"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ3"
FT                   /inference="protein motif:PFAM:PF04830"
FT                   /protein_id="ACX95226.1"
FT                   /translation="MLIEPRIDLLPGLPSEAKPGKPSNRTMGALLTIGLVFAWFSSQGH
FT                   MTAGHIQANQGDLTLAAVQAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLASVSTES
FT                   YQRTDEKHKDKAWQETHGEGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRDSAAMLAQ
FT                   SPDMAWLRQLQQNPKLVGKVDWQQIEEAHQHWDYKHQGLTPAASAVVALVVAYFTMGAG
FT                   SAIVNTAAGSTTAAASGAGAVAAGMTQAAVSTMASQAAVSFINNGGDLSKTLNDLGSSQ
FT                   SMRQLATAVVTAGVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIGKNLIDGVARATVN
FT                   SAITGTDLQTNIRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNGNVNEFAHEFAHAI
FT                   VGCAAGVAGASASGSGASTGQGCSAGALGAVVGELSAQFYGGTDPNQTIAFAQMMGGIA
FT                   AAAAGLGSEGVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGGVNCGAILSLTEPT
FT                   SVQTHQTLSPLAQCAQAHRLSGRHERSDLPSRDFASSFDI"
FT   gene            complement(372103..372546)
FT                   /locus_tag="Hneap_0364"
FT   CDS_pept        complement(372103..372546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95227"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95227.1"
FT                   /translation="MSNFSKLQAIVNGFNFKKGDYVGAEDQLSRFAESYAQLSLEDAEL
FT                   LRSKFDSKDRLGWLRIASTLFVKGFADADSMEKEKLCRIFFALYSFENLEFGFDGAMDV
FT                   ISVSDQRKAMLAWLKGIGSNLANSLVMMPQKTIWKIRYSLPNE"
FT   gene            complement(372550..372795)
FT                   /locus_tag="Hneap_0365"
FT   CDS_pept        complement(372550..372795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_0928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95228"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ5"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_0928"
FT                   /protein_id="ACX95228.1"
FT                   /translation="MKLLELEKYLSKLKLHPDAYSIGIGLPEADETYCIVNEDGLWRIY
FT                   YAERGQRGDMREYDSEDEACNAFIELLKSDKSVWLR"
FT   gene            complement(372792..377507)
FT                   /locus_tag="Hneap_0366"
FT   CDS_pept        complement(372792..377507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0366"
FT                   /product="protein of unknown function DUF637 hemagglutinin
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF637
FT                   hemagglutinin putative; KEGG: rso:RS02477
FT                   hemagglutinin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95229"
FT                   /db_xref="InterPro:IPR006915"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ6"
FT                   /inference="protein motif:PFAM:PF04830"
FT                   /protein_id="ACX95229.1"
FT                   /translation="MWVKAVEFGCADQGLNGRRSFACPLATGKQPVLFAHRNRPNGVFH
FT                   WVVVNRQVTGFGVADQCRPAFDGVVHGPGCATARRHALAGGGEPVIEFVQCAPGLLAQG
FT                   LSFTQGSRRGFRLQGIQTGNVSQCGFCNGALVGLVQFIELAPGMRPAGQLGNPPLGKQM
FT                   LVATVVIHHQMTVPVPEETIGMFTCPAGLVVEYHNGRTSIPIIAAPGPQVGSSGFAGTG
FT                   IQLGNRGFIGTGRRFLTGYSSDEAQFQALMNAGVAYAKQWHLIPGVALTAAQVAQLSSD
FT                   MVWLVAKDVQLPNGKTERVLVPQVYAASNPNDPGSNGSLISANRIQTLGQGTWTNSGTI
FT                   AGRQLVAVGADDINNLGGRILGQSVSLSARNDINNIGGSIVAGDALSLNAGRDINIVST
FT                   HQHVSNTVGASQFSRDSILQTAQLKVRNTDGMLLASAGRDLVLTAANVDNAGTGTTGSE
FT                   GPATQLQAGHDIRLTTLTTGQENRVVWDADNHDTHGNQQDVGTRIHSAGDLAMIAGNDI
FT                   QAKAAGIHSDNGTLNLQAGHDIQLTDGQSSTLWDEAHKLSSSGLFSSSTSISRDNVSDS
FT                   RSVATKLSGQSVQLSANHDIALQGSQIDANGNIALLAGDNISLLAGRNQHSESHYREER
FT                   KSGFTTKGYGKSHTIDTVDMASLLNDGSSLHSTQGNITLAANLAEQNQADQGAVLIEGS
FT                   QVHADHGRVDVSGKHVILSTSEDQQQYSHSHQSTHSNWAFITGLPDGMRDGLDTQQQTI
FT                   TVNGSTLQGQKGVGAQATGLVDMTAAHLKASQGDIDISGAQVAIRSGTNQQASSSRETH
FT                   KKSGISWRDLTGLFTPGKGVGYDATLDKKSSKTTVAHATLEGQNIHIQANQGDLTLAAV
FT                   QAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLASVSTESYQRTDEKHKDKAWQETHG
FT                   EGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRDSAAMLAQSPDMAWLRQLQQNPKLVG
FT                   KVDWQQIEEAHQHWDYKHQGLTPAASAVVALVVAYFTMGAGSAIVNTAAGSTTAAASGA
FT                   GAVAAGMTQAAVSTMASQAAVSFINNGGDLSKTLNDLGSSQSMRQLATAVVTAGVLSSI
FT                   GQVTFGEGKNAFRLNDVKVSDGLVPNIGKNLIDGVARATVNSAITGTDLQTNIRTNVVA
FT                   GILGAAEQQGANWIGNQTLLGGDFNTNGNVNEFAHEFAHAIVGCAAGVAGASASGSGAS
FT                   TGQGCSAGALGAVVGELSAQFYGGTDPNQTIAFAQMMGGIAAAAAGLGSEGVAIAANTG
FT                   ANAAQNNYMAHYDTYEADLKDCQQNPGGVNCGAILSLTEGTNARYLGMTQGGYRVAANM
FT                   GKDGAASYTVVSPNGEMMVMQPTEWAYFSQMTSGQQATIFAGSQWQLDLTSATEYGLAG
FT                   DTTAAMANYAHMLTQPDYWIGMGAAFLPAGVLGRAATATDEAALLGRGAAGDATRGIPR
FT                   NKSLVPFNPPNDGFLGAPLDFTLILGTRIDRIGFDGGRFLSPAGTPIPMRALRPGTETR
FT                   PLRTFEVIRPLDVRAGEIAPAFGQPGLGTQFVTDRPVRDLLREGFLRSVDP"
FT   gene            377511..377576
FT                   /pseudo
FT                   /locus_tag="Hneap_0367"
FT                   /product="hypothetical protein"
FT   gene            377617..378168
FT                   /pseudo
FT                   /locus_tag="Hneap_0368"
FT                   /product="hypothetical protein"
FT   gene            complement(378521..378835)
FT                   /locus_tag="Hneap_0369"
FT   CDS_pept        complement(378521..378835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95230"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95230.1"
FT                   /translation="MVKIDDWNDPKLMEAILIWTGYGDSMSPRRDSSMVVQRFGSEATK
FT                   WISLIELLEDEFYESKANFESANMQEMSAMVIADFRKKYPEVPDEITKALAWCYTFDNR
FT                   "
FT   gene            complement(378823..386088)
FT                   /locus_tag="Hneap_0370"
FT   CDS_pept        complement(378823..386088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0370"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: filamentous
FT                   haemagglutinin domain protein; Haemagluttinin
FT                   repeat-containing protein; protein of unknown function
FT                   DUF637 hemagglutinin putative; KEGG: pct:PC1_2330
FT                   filamentous hemagglutinin family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95231"
FT                   /db_xref="InterPro:IPR006915"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ8"
FT                   /inference="protein motif:TFAM:TIGR01901"
FT                   /protein_id="ACX95231.1"
FT                   /translation="MKIEQKCNSIARTAQQRQSVPAVAPIGYRVLVFLLSAIIPPSANA
FT                   SGIAADHQAPAYQQPTIQVTANGTPEANIQTPGVDGVSHNVYKQFDVGSKGVILNNART
FT                   NAQTQLGGWIQGNPNLANGSARVILNEVNSSQPSQLNGYVEIGGQRAELVIANPSGINV
FT                   DGGGFINASRATLTTGKPVFQNGTLAGYQVSNGSININGAGLDASSTDYTDILARAINV
FT                   NAGIWANQLKLVTGSNDISPDGTQITPTSGDANKPGFGIDVAQLGGMYAGKITLIGTEA
FT                   GVGVRNAGQIGASDNLVLNANGELTNSGQITSQGTTTAQTNVIDNSGTIYAQDNAQLNA
FT                   NGDITNSGRILAQGNLGLDAATDVVNLDGAILGAGVQPDGSLGGARNLTIASGQNARLQ
FT                   GKNLASGNLTAKGNTVDLSHSQTQADSITLTATHGDIDASSATITAQHQLQANASGSFI
FT                   NDQAQTAAGTLQLKAANLSNLDGLILLGDSSGASDITLSNLFDNRGGLLHTTGEMQITA
FT                   NQVDNRNTTQSAQGIQGNDVTITADRINNGSGHILANQNIQLNSAGQIDNSQGLVSAGG
FT                   NLSAQDGQATRSLAITNTQGTFVAGQNLAVTSATLSGDGQLYAQQDIHLLLDGGFDNSG
FT                   TLIANHDTDLNIGGILTNSGTLQAGNTLTAHAGTIDNQASGQISAAEDRINATGKLTNR
FT                   GLIDGGTTRLQANTIDNLGTGRIYGDHIAIGANDLTNENENGTAGTIAARNRLDIGVQT
FT                   LENKEHALIYSAGDMSIGGALDANDQATGQAVHLTNSSATIDADGQIQLSAQTIDNLNA
FT                   HLVTSQVDDATVTHEYVQPRGQSQLFDISACSGIGGGQDKNSCNGYPGTFEDYTLFIVH
FT                   STPSHTIVVSSDPGKIQAGGDIVINGALNNRDSAVIAGGDLVASQPVSNTATKGQDITR
FT                   STGTAELTTVESCGLFGSDHCREWHGQSAYNPAPVYGTPYDLPTLTYQTHTLIGGTAPT
FT                   IGNRSATGTSQPVSQPINTSGGYAWTQPNITLRSSSLFQVHDDNGNHPLIETDPRFADY
FT                   RQWLSSDYMISALSLQPDSLLKRLGDGYYEQKLVQDQVAELTGRRFLTGYSSDEAQFQA
FT                   LMNAGVTYAKQWHLIPGVALTAAQVAQLSSDMVWLVAKDVQLPNGKTERVLVPQVYAAS
FT                   NPNDPGSNGSLISANRIQTLGQGTWTNSGTIAGRQLVAVGADDINNLGGRILGQSVSLS
FT                   ARNDINNIGGSIVAGDALSLNAGRDINIVSTHQHVSNTVGASQFSRDSILQTAQLKVRN
FT                   TDGMLLASAGRDLVLTAANVDNAGTGTTGSEGPATQLQAGHDIRLTTLTTGQENRVVWD
FT                   ADNHDTHGNQQDVGTRIHSAGDLAMIAGNDIQAKAAGIHSDNGTLNLQAGHDIQLTDGQ
FT                   SSTLWDEAHKLSSSGLFSSSTSISRDNVSDSRSVATKLSGQSVQLSANHDIALQGSQID
FT                   ANGNIALLAGDNISLLAGRNQHSESHYREERKSGFTTKGYGKSHTIDTVDMASLLNDGS
FT                   SLHSTQGNITLAANLAEQNQADQGAVLIEGSQVHADHGRVDVSGKHVILSTSEDQQQYS
FT                   HSHQSTHSNWAFITGLPDGMRDGLDTQQQTITVNGSTLQGQNGVGVQATGLVDMTAAHL
FT                   KASQGDIDISGAQVAIRSGTNQQASSSRETHKKSGISWRDLTGLFTPGKGVGYDATLDK
FT                   KSSKTTVAHATLEGQNIHIQANQGDLTLAAVQAKATGTSEPSDGSDGPVHSPGQISLKA
FT                   AGNINLASVSTESYQRTDEKHKDKAWQETHGEGNYDQQTHYNQLTAGQLDLQAGGSITA
FT                   DMSVRDSAAMLAQSPDMAWLRQLQQNPKLVGKVDWQQIEEAHQHWDYKHQGLTPAASAV
FT                   VALVVAYFTMGAGSAIVNTAAGSTTAAASGAGAVAAGMTQAAVSTMASQAAVSFINNGG
FT                   DLSKTLNDLGSSQSMRQLATAVVTAGVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIG
FT                   KNLIDGVARATVNSAITGTDLQTNIRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNG
FT                   NVNEFAHEFAHAIVGCAAGVAGASASGSGTSTGQGCSAGALGAVVGELSAQFYGGTDPN
FT                   QTIAFAQMMGGIAAAAAGLGSEGVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGG
FT                   VNCGAILSLTEGTNARYLGMTQGGYRVAANMGKDGAASYTVVSPNGEMMVMQPTEWAYF
FT                   SQMTSGQQATIFAGSQWQLDLTSATEYGLAGDTTAAMANYAHMLTQPDYWIGMGAALIP
FT                   TSVLGRTAGMTNQLATGTNKAMFWSGLGRGGDKIAARAAAQQGKMTLESTLAARGIKLP
FT                   KWDPDNPEVVSAWRQASHDFAAGARGNVRVLQGDVLRGNSVWAEVEFPALKANPTVKSI
FT                   TSIDAATGKEVLLWSR"
FT   gene            complement(386116..387873)
FT                   /locus_tag="Hneap_0371"
FT   CDS_pept        complement(386116..387873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0371"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; Hemolysin activator HlyB domain protein;
FT                   KEGG: rso:RS02577 activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95232"
FT                   /db_xref="GOA:D0KXQ9"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXQ9"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ACX95232.1"
FT                   /translation="MFQPTDGLSLHQQSRQPFDVFMRRVFLCALFSLLWGASGAWAQPP
FT                   VASSSVQQELLQQQRQRALEQGQQATPDVRLQKGLAKLPSTLPKHETPCVFINQVTLGG
FT                   EGAGQFSWAIKTASRALGGIKGRCIGTNGIQILVKQVQNAILARGFITTRVLVTQQNLN
FT                   DHKLTLTIIPGRIGAIRLAKGSNPRGTLWNAFPAKPGDLLNLRDLEQGLENLQRLPTAS
FT                   THINIKPGEQPGTSDIVTDWQQRFPFRLSMWVDDAGSEATGHYEGTVVLSYDDWFTLND
FT                   LFYASFTRDLGLDNGRNKRGTQSYTFHYSVPYGYWLLGFTTNRFRYYQTVAGINQDYRY
FT                   SGTGTRQDLKLSRIIHRNAHGKTRVSLDAYLQTYGNAIDDTTIEVQQRRMAGYIFDIHQ
FT                   RQFIGRATLDMDVGYRWGTGALGAEPAPEEAYGGGTSRPHIASASIQFNTPFSALGQSW
FT                   RYQGELRGQYNYTPLIPQDRFAIGGRYTVRGFSGEQVLSSERGLIFRNDLGIVIAGNNE
FT                   LYLGLDYGQVGGSSAQQLLGTRLAGGVIGIRGAYKLLNYDVFAGHAIAKPDGFPAKGIT
FT                   AGFNIGWTI"
FT   gene            complement(388197..388487)
FT                   /locus_tag="Hneap_0372"
FT   CDS_pept        complement(388197..388487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0372"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /note="KEGG: noc:Noc_0437 plasmid maintenance system
FT                   antidote protein; TIGRFAM: addiction module antidote
FT                   protein, HigA family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95233"
FT                   /db_xref="GOA:D0KXR0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR0"
FT                   /inference="protein motif:TFAM:TIGR02607"
FT                   /protein_id="ACX95233.1"
FT                   /translation="MTVHNQPHPGAFIRQIYLEPHQLSVRALAESLGVAPSTVTRIING
FT                   HSAISPEMALRLAKALGRSAESWLAMQHNYDLWQAKQITDLIRVKSIEFAA"
FT   gene            complement(388487..388765)
FT                   /pseudo
FT                   /locus_tag="Hneap_0373"
FT                   /product="hypothetical protein"
FT   gene            complement(388837..389127)
FT                   /pseudo
FT                   /locus_tag="Hneap_0374"
FT                   /product="hypothetical protein"
FT   gene            complement(389298..389554)
FT                   /pseudo
FT                   /locus_tag="Hneap_0375"
FT                   /product="hypothetical protein"
FT   gene            complement(389710..390156)
FT                   /locus_tag="Hneap_0376"
FT   CDS_pept        complement(389710..390156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0376"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   tcx:Tcr_0949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95234"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR1"
FT                   /inference="protein motif:PFAM:PF03625"
FT                   /protein_id="ACX95234.1"
FT                   /translation="MRAILFIFLFLSFSSSAMADEGMIEQASPYSVTQTMQRLEMAIRK
FT                   GGLTIFAVIDHAKGAAKVGQKLRPTQLIIFGSPKGGTPLMQCNQTAGIDLPLKILVWEN
FT                   AQGKVMLGYNDPVWIAKRHNVPDCAVAPKLHKNMAKLVQKALEQ"
FT   gene            complement(390584..390784)
FT                   /locus_tag="Hneap_0377"
FT   CDS_pept        complement(390584..390784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95235"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95235.1"
FT                   /translation="MNTANAHNTHLHQFALLATGGLLLALAGCSAGAVSGPRSSCKPKM
FT                   STSGRGPAAKHAHERRMRPES"
FT   gene            391181..391453
FT                   /locus_tag="Hneap_0378"
FT   CDS_pept        391181..391453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0378"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   bmu:Bmul_2476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95236"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR3"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACX95236.1"
FT                   /translation="MTSPHTFECRAGCGACCIAPSISSPIPDMKRGKPAGVACVQLTDD
FT                   FRCAIFGKPERPRCCSGLSPNIEMCGVSQAQALEWLTSLEEDTKP"
FT   gene            complement(391719..393110)
FT                   /locus_tag="Hneap_0379"
FT   CDS_pept        complement(391719..393110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0379"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: tgr:Tgr7_2202 SalD"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95237"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR4"
FT                   /inference="protein motif:PFAM:PF03349"
FT                   /protein_id="ACX95237.1"
FT                   /translation="MVFKRSLLAASVAATLIASGAAHATNGYFSHGFGVKSIGMGGSGV
FT                   ALPNDSAMIIATNPAGITETGTQINFDISWFHPVRGYDQTGVPASGDSNSNNFYIPELS
FT                   ASYQLNDNSALGIAIYGNGGLNTDYEPNATSIATGQPAGAFATAPGTGGEGGVNLKQMF
FT                   IAPTYAHKFMNGKLSVGATLLFARQTMQVKGLDGFGGFSTDPTHLTSNKVSSSTGWGGK
FT                   IGVLYHATDAISLGGSYQTKMHMSKFDDYSGLFSDGGKFDIPSTWTVGGAFKVAPTWTL
FT                   TADFQRINYADVAAIGNPSTGYLLGNGMPGNGCAGGDTSKCLGGSNGAGFGWSNVNVIK
FT                   IGAQWQATPALQLRAGFNHGTNPVGSEDVVFNALAPGVMKNHFTAGFTYAIDKHQEISG
FT                   AFMYAPKVTVTGSNPIPSALTYQGALMSGATQAQAQAAAGNVPATTTSIHMKQYEATIG
FT                   YAYKF"
FT   gene            complement(393520..394365)
FT                   /locus_tag="Hneap_0380"
FT   CDS_pept        complement(393520..394365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0380"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: avn:Avin_47710 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95238"
FT                   /db_xref="GOA:D0KXR5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR5"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ACX95238.1"
FT                   /translation="MTIHFTKMHGLGNDFMVIDAINQAIELNPEQIRQWANRHFGIGFD
FT                   QLLIVEPPKTADTLFTYRIFNADGGEVEQCGNGARCFARYVYDKGLTTEKEIPVGTASG
FT                   RIVLHINDSGDVTVDMGRPMFTPTNIPFITECEATSYPLTLDDGSEWVIDAVSMGNPHA
FT                   VLEVENVDTAPVSHLGPMIEHHRQFPNRVNVGFMQIVDRQHIRLRVFERGSGETLACGT
FT                   GACAAVVSGIRRNRLDSPCLVDVRGGRLSVAWTGKTQDSVLMTGPAQSVFEGQITQTIA
FT                   "
FT   gene            complement(394425..394526)
FT                   /pseudo
FT                   /locus_tag="Hneap_0381"
FT                   /product="hypothetical protein"
FT   gene            394554..394997
FT                   /locus_tag="Hneap_0382"
FT   CDS_pept        394554..394997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95239"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95239.1"
FT                   /translation="MIVQAVWVDLAALFDFQPDDKLVLFPDALDAFEQWRALELKVVGI
FT                   TADVRRYGSRLSSVFDETFVVIDRPLPQWRQMETWLDLAQEMAVSPEQIVFITSTPMLM
FT                   SFARRTGLRTVGVLRDPHTMAVLDGYWVDSLADIDWQDPRFFE"
FT   gene            395075..396916
FT                   /locus_tag="Hneap_0383"
FT   CDS_pept        395075..396916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0383"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; KEGG: tgr:Tgr7_3148 GTP-binding protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95240"
FT                   /db_xref="GOA:D0KXR7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR7"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACX95240.1"
FT                   /translation="MDAPVISHLRNIAIIAHVDHGKTTLVDKLLQQSGTLDARTDTGER
FT                   MMDSNAIEKERGITILAKNTAIRWTSPSGEEYRINIVDTPGHADFGGEVERVLSMVDSV
FT                   LLLVDAVDGPMPQTRFVTQKAFEHGLKPIVVINKIDRPGSRPQWVVDQVFDLFDRLGAS
FT                   DEQLDFPIVYASALNGYAGLEDSVREGDMTPLYQTIVDSVAPPDVDAEGPLQMQVSSLD
FT                   YNPYMGVMGIAKIQRGRIKTNTQVKVVDREGAIRSGRILQIMGFHGLERIEVPSAQAGD
FT                   IIVFSGLDPLFISDTICDPEHVEMLPPLTVDEPTVSMSFNVNTSPFAGKEGKFITSRQI
FT                   RDRLHKELLHNVALRVEDTEEGDKFRVSGRGELHLSVLIENMRREGFEMGVGRPEVIIR
FT                   EVDGVKQEPYEQLVVDIEEQNQGAVMEKLGTRRAELRNMEPDGKGRVRLEYIIPSRGLI
FT                   GFRTEFMTATQGTGLLFSVFDHYGEYKPGNVGQRINGVLIANETGKALSYALYNLQDRG
FT                   KMMIGHGDEVYEGQVVGIHSRDNDLTVNVLKGKKLTNMRASGTDEALTLVPPIRFTLEQ
FT                   ALEFIDDDELVEVTPASIRIRKKWLTELDRKRYGRGD"
FT   gene            396964..398319
FT                   /locus_tag="Hneap_0384"
FT   CDS_pept        396964..398319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0384"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: sbc:SbBS512_E2999 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95241"
FT                   /db_xref="GOA:D0KXR8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR8"
FT                   /inference="protein motif:TFAM:TIGR00959"
FT                   /protein_id="ACX95241.1"
FT                   /translation="MFENLSQRLGGLFDGLRGQGRLTEDNIKDALREVRMALLEADVAL
FT                   PVVRDFVNQVKERAVGAEVIKSLKPGQVFIKVVSDELTALMGAENSALNLAAQPPAVVL
FT                   MAGLQGAGKTTTVGKLGRLLRTREQKKVLVVSADVYRPAAIKQLETVAKQVGVDFFPSD
FT                   AGQKPLDIVQSALKQARVGFYDVLIVDTAGRLHVDAEMMDEVRQLHAALNPVETLFVVD
FT                   AMTGQDAANTAKAFNEVLPLTGVVLTKADGDARGGAALSVRAITGKPIKFIGMGEKLDA
FT                   LEPFHPDRIASRILGMGDVVSLVEEAQRTLDTSKAQALAEKVRTGKGFTLVDMRDQFEQ
FT                   MLNMGGIHGLMDKLPGMGKLTADAKANIEDRDVHRMIAIINSMTIQERLHPELIKGSRK
FT                   RRIALGSGMQVHDVNRLLKQHRDMSDMMKKFSGGGMKKMMRALKGRIPGMPM"
FT   gene            398461..398544
FT                   /locus_tag="Hneap_R0009"
FT                   /note="tRNA-Leu1"
FT   tRNA            398461..398544
FT                   /locus_tag="Hneap_R0009"
FT                   /product="tRNA-Leu"
FT   gene            398612..399910
FT                   /locus_tag="Hneap_0385"
FT   CDS_pept        398612..399910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0385"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: trigger factor
FT                   domain; trigger factor domain protein; peptidylprolyl
FT                   isomerase FKBP-type; KEGG: psa:PST_2060 trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95242"
FT                   /db_xref="GOA:D0KXR9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXR9"
FT                   /inference="protein motif:TFAM:TIGR00115"
FT                   /protein_id="ACX95242.1"
FT                   /translation="MQVELQSSEGLIRRLAIEVPASEIDVEVDRRIKDMSRRVRLDGFR
FT                   PGKAPLPVVRQRYEGQVREEVVGDVMGRNYQAAIAEQQLRPAGNPVIESVDAQPGTNLK
FT                   FVAAIEVYPEFEIGDLSVIEIETTTAEVTDADVADMLSTLREQHADWQNVDRAAKDGDR
FT                   VTVNFAGKVDGEAFQGGSGEGMQVVLGEKRMLADFEKGLAGIAVGEPERVFDVAFPEDY
FT                   PVENLQGKTAQFTVTATAVEEKVLPELNDEFAARFGSATVAELESDVRKNMERELKQAL
FT                   KRHTKDVVLTAVTDSLTFDVPKALVDEEAVVMRDGFVRQQMPHADASALDAGLFSEQAA
FT                   KRVKMGLVIMEIVKSADLQVDDALVDEFINDIAAAYDEPDQVVATYKGDREMMSNARTV
FT                   VLEQQAVDHVLSKAKVTQKSQDFKSVMNPAPQA"
FT   gene            400076..400708
FT                   /locus_tag="Hneap_0386"
FT   CDS_pept        400076..400708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0386"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: vha:VIBHAR_01417 ATP-dependent Clp protease
FT                   proteolytic subunit; TIGRFAM: ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; PFAM: peptidase S14 ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95243"
FT                   /db_xref="GOA:D0KXS0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS0"
FT                   /inference="protein motif:TFAM:TIGR00493"
FT                   /protein_id="ACX95243.1"
FT                   /translation="MIFGSQTTAGLSSPELAALVPMVVEQTSRGERAYDIYSRLLKERV
FT                   VFVVGPIEDHMANLIVAQLLFLESENPDKDIHLYINSPGGVVTAGMSIYDTMQFIKPHV
FT                   STLCIGQAASMGSILLSGGEPGKRFALPNSRVMIHQPLGGFQGQASDIKIHAEEIIKLR
FT                   HSLNGVLAKHCNQPMEVIERDTDRDKFLSASEAVEYGLIDAVLDKRA"
FT   gene            400769..402073
FT                   /locus_tag="Hneap_0387"
FT   CDS_pept        400769..402073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0387"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="KEGG: cja:CJA_2005 ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit ClpX; PFAM: ATPase AAA-2
FT                   domain protein; zinc finger C4 domain protein; Clp
FT                   ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95244"
FT                   /db_xref="GOA:D0KXS1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS1"
FT                   /inference="protein motif:TFAM:TIGR00382"
FT                   /protein_id="ACX95244.1"
FT                   /translation="MAKSTQSEQDLSCSFCGKPQAEVRKLIAGPSVYICDECVELCNDI
FT                   LREEISAAKDESPARLPTPKELVEALDEYVIGQQRAKRALAVAVYNHYKRLNLFGSTRK
FT                   VAEKDKDSDSEPVELSKSNILLIGPTGSGKTLLAQTLARVLDVPFAIADATTLTEAGYV
FT                   GEDVENILQKLLQRCDYDVEKAQHGIVYIDEIDKITRKSENPSITRDVSGEGVQQALLK
FT                   LIEGTQASVPPQGGRKHPQQEFVQLDTTNILFICGGAFSGLDSIIRQRIEKGGIGFSAE
FT                   VKSKDDKRAADELLTQIESEDLTRYGLIPEFIGRLPVIATLNELDEAALVKILVEPKNA
FT                   LTKQYMRLFEMEGVELDLREDALREVARQAIKRKTGARGLRTIVEHVLLDTMFDVPSTE
FT                   NVQKVVVDASVVRGENAPYLLFDQAESLPKAASDK"
FT   gene            402135..402251
FT                   /locus_tag="Hneap_0388"
FT   CDS_pept        402135..402251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95245"
FT                   /db_xref="GOA:D0KXS2"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95245.1"
FT                   /translation="MSGSGRLDSVALYFVLSFMVPTAFVSVPLEKLPFGINY"
FT   gene            402313..404745
FT                   /locus_tag="Hneap_0389"
FT   CDS_pept        402313..404745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0389"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: aeh:Mlg_2286 Lon-A peptidase; TIGRFAM:
FT                   ATP-dependent protease La; PFAM: peptidase S16 lon domain
FT                   protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95246"
FT                   /db_xref="GOA:D0KXS3"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS3"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ACX95246.1"
FT                   /translation="MPHNDTTSEVIAGTPRTVPVLPLRDVVVYPHMVIPLFVGREKSVS
FT                   ALEEAIKGSKQLLLVAQKDADLDDPGRKDLHAVGTLASILQLHKLPDGTIKVLVEGVER
FT                   VRCVQVHEVDQYLVAEVHAIEEPKEQPDRELEVEARTLLNQFDGYVKLNKKTPPEVLTS
FT                   LAGIDDVSRLADTIAAHMALGLDEKQKILETIDLHARIEQLMVLIESEIDTLQVEKRIR
FT                   GRVKQQMEKSQREYYLNEQMKAIQKELGDLEEGGSDLDELERKILTAGMPKEALEKAKS
FT                   ELNKLKMMSPMSAEASVVRNYLDWIVAVPWKKRTKIKHDLGVAEQVLEADHFGLEKVKE
FT                   RILEYLAVQQRVRKMNGPILCLVGPPGVGKTSLGQSIAKATNRKFGRIALGGVRDDAEI
FT                   RGHRRTYVGALPGRIVQTLSKIGSRNPLILLDEIDKMASDFRGDPASALLEVLDPEQNK
FT                   AFADHYMDMDIDLSEVMFVCTANSLNIPGPLLDRMEVIRIAGYTEDEKTEIAERYLLPK
FT                   QLEKNGLKDKELSIDTSAVRDVIRYYTREAGVRNLERELAKVSRKVVRKLVTNEEKAPI
FT                   TVDSSSLDQYLGVHRFDFGKVEHPDQVGQVTGLAWTEVGGDLLTIEAATMPGKGNLKYT
FT                   GQLGEVMQESIQAAMTVVRSRAVSLGIDPDFSQKTDIHVHVPEGATPKDGPSAGGAMCT
FT                   TIVSALTGIPVKSTVAMTGEITLRGEVLPIGGLKEKLLAAQRGGIKLVLIPEGNRKDLA
FT                   EIPEKIKASLDIRPVRWIDEVLDVALVTPPTPKPVALQDAVPSAEVKRADDQSAHAH"
FT   gene            405027..405299
FT                   /locus_tag="Hneap_0390"
FT   CDS_pept        405027..405299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0390"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   tgr:Tgr7_0942 histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95247"
FT                   /db_xref="GOA:D0KXS4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS4"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACX95247.1"
FT                   /translation="MNKSELIDAMAAKSGMKKTESAAALDAFIEAVGDALKKGDQVTLV
FT                   GFGTFLVREREARTGRNPRSGETIEIAASRLPSFKAGKGLKDAVN"
FT   gene            405502..407439
FT                   /locus_tag="Hneap_0391"
FT   CDS_pept        405502..407439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0391"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: mca:MCA0533 peptidyl-prolyl cis-trans isomerse D"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95248"
FT                   /db_xref="GOA:D0KXS5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS5"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACX95248.1"
FT                   /translation="MLMDLRERIQGWIAYAIIGLISIPFVLWGVGEYFSGGKNQPVAEV
FT                   DGLPISQQAFEQAVSQQRQAIIQKLGGSVSAEMLQSLNLDQQVLDQMINERVLRVFVQK
FT                   AGFRAPDAVVADLIRSEPAFKTDGAFDVKKYEAFVAARGTTVANFEAGLKQDIVMQTLE
FT                   NAISESTIVTAPELDQIVKLRDQTREIGMVRLDRARVIDTVAAPTDGAIEAYYAAHKGE
FT                   FIRPERVKLRYIELSPKTLAPSVKVTDAQVEQAYANYVKKQEAQVVRTVRHILISVPKN
FT                   ADGAAIEAAKNKALAARAAIVSGKTSFADEARAVSDDPGSKNKGGDLGEVAPGQMVKPF
FT                   EEAMDALKVGEVSEPVRTQFGWHLIEVTKESHPDIKPLADMRDKMVAEVQEQQVEKIYY
FT                   NEGEKLSDQSYEHPDSLIPSAEALGLKVQASDWLDRNSGTGIAANEKVRQAAFSKEVLK
FT                   QKLNSNLIELGVNHAVVIRVDQHEPATQLTLAEVKDQIATTLKDQAIDKALADAAKNIG
FT                   KKLTADADPQAVATAAGATWVAPVWLKRTARDAPIPAEAIQAAFALAPAPDGQLASKAL
FT                   ALSDGNEALVVVEAIKDGDPATISEQDKEALSAQIQQAQAQQTLGVLLKALRDEAKITI
FT                   NQKAEKTATP"
FT   gene            complement(407619..408407)
FT                   /locus_tag="Hneap_0392"
FT   CDS_pept        complement(407619..408407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0392"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tgr:Tgr7_0946 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95249"
FT                   /db_xref="GOA:D0KXS6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX95249.1"
FT                   /translation="MGFLSGKRVLIVGIANNRSIASGIAEAMQREGAELAFTYLNDRFK
FT                   EKVEKATAELGSNIYLPLDATSDEQIDALFPALAEHWPEGFDILVHSIAFAPREALDGD
FT                   YLDGMSREAFRVAHDVSAYSLAALAKAGRSTMRDNGAIVTLSYLGAERVMPNYNVMGVA
FT                   KAALEANVRYLAGSLGGRGIRVNSISAGPIKTLAASGIGEFKSFLDYVALNSPLKRNVT
FT                   IEQVGNTAAFLCSDLASGITGENVYVDSGYFITGMGQCPK"
FT   gene            408537..410513
FT                   /locus_tag="Hneap_0393"
FT   CDS_pept        408537..410513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0393"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: lhk:LHK_02060 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95250"
FT                   /db_xref="GOA:D0KXS7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACX95250.1"
FT                   /translation="MKNEHPSRHDQFTDDQRSRRDFLRYLLATGALAAGAGAFSRVGHA
FT                   AGFADALGYSPKYPANFNAFNYVNPDAPKGGRLSLSVFGNFDSLNPFVLKGLAASGLNE
FT                   LCFESLTARAWDEPFSAYGLLADRADLAADGLSITFRINAKARFYDGSPVTARDVLFSF
FT                   NTLMSKQAHPRYRIYWADIAGTELTDARHVRFSFKRVNPELHLIIGELPVFSERWLAGR
FT                   DFASLSREAFLTSGPYRVGRVDYGNTITYERNPDYWAKDLDVRRGQFNFDQIVFKYYKD
FT                   ETVSLEAFKAGEFDVFYETNSKRWARDYTGANFDDGRIIRREIPHKNNAGMQGFGMNTR
FT                   QALFSDRRVRRALDLALDFGWSNTHLFYGQYTRCDSYFSNSELACRGLPQGDELALLEP
FT                   FKAQLPPELFREPYQVPVANNPAEQRANLLKARDLLAEAGWRVEEGVLKNAEGQPFSFE
FT                   ITLAMRGFERIVAPYAYNLKRLGIEVSYRTIDVSLYQRKMDRFEFDMAVVAYGESQSPG
FT                   NELRDRFGSAAAHTDGSSNYMGIDSPVVDALIDRVIYAKSRAELVTACRALDRVLLWGE
FT                   YLVPNWYIGAHRLAWWNRFGFHQPLPLYFDAMTWVMQTWWQVYEHPQKQSKGHLEKPTA
FT                   LSDCVVACSFTRSWLKPAPRLST"
FT   gene            410515..411264
FT                   /locus_tag="Hneap_0394"
FT   CDS_pept        410515..411264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95251"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95251.1"
FT                   /translation="MSRCSLNAKLAQARGSLHSNMLTRSWRQPVTVFRGAPLLLWLKRS
FT                   LLLAAVAALAGCATPQYATQTSYTPPQTAKGLICVAQCQDSLKQCQNSCSAARQSCIAH
FT                   IEPAARAAFDSALKTYEVQRRQYETDRQFYELNRSLRMGFFNPVFVPGYGWVMRPGYYD
FT                   DYYDDAPTPPVAPSLAKERQRMIHEQCDSAPCPCQENFEQCYVGCGGGVKKSVVCIANC
FT                   KDSDPKPSSGAESSPVVQQQTGSPSAN"
FT   gene            411276..411950
FT                   /locus_tag="Hneap_0395"
FT   CDS_pept        411276..411950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0395"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   bbr:BB0424 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95252"
FT                   /db_xref="GOA:D0KXS9"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXS9"
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /protein_id="ACX95252.1"
FT                   /translation="MYRPPAFVENDRDTIARMIRAHPFGQLITCDQGRSEVTHLPFMLH
FT                   WDKTIQGQGQGYGNSKGKLISHIARANPQWQHFAHGEEVLVVFQGPHTYISPSWYTNFG
FT                   VPTWNYAAVHVRGTVRLIEDEARLIAMLTELTETHEAAQPTPWVFDIDRERRAHLMTML
FT                   VGFEIDISDIQATFKFNQNRSAEDRAGVIAALSQSPDANDQAVARLMREQMKSQKKAGT
FT                   NE"
FT   gene            411947..413011
FT                   /locus_tag="Hneap_0396"
FT   CDS_pept        411947..413011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0396"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pnu:Pnuc_1236
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95253"
FT                   /db_xref="GOA:D0KXT0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX95253.1"
FT                   /translation="MTGYIFKRLLLMIPTLFGILAISFAVIQFVPGGPVEQLVAQLKSG
FT                   GAGAAGAESGGGLSGGLYRGDQGLDTRQLDQIKSFYGFDKPAWQRFGDMLGNYLTFNLG
FT                   TSYFYQRSVTDLILEKLPVSISIGLWTFFLTYLVSIPLGIAKAVRDGSRFDTVTSTVIL
FT                   VGYAIPGFVLGLVLIVLFGGGSFWQWFPLRGLTSDNFDQLSIFGKITDYLWHIVLPVTA
FT                   MMVGNFAVMTMLTKNSFLEEIRKQYVLTARAKGLSERRILYGHVFRNALIPIVTGFPAA
FT                   FLGAFFTGSLLIETIFSLDGLGLLSYNAVIQRDYPVVLGTLYVFTLIGLIGKLLSDLAY
FT                   VWVDPRINFQAVNS"
FT   gene            413008..414048
FT                   /locus_tag="Hneap_0397"
FT   CDS_pept        413008..414048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0397"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lhk:LHK_01099 DppC2"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95254"
FT                   /db_xref="GOA:D0KXT1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACX95254.1"
FT                   /translation="MSEQAAQVSHQGPWRRVWQRFVRHRRGYLSLWLFSILFVLSLGAE
FT                   LLANNRPLLVYYQHQLYLPLIHNYPETTFGGDFATNADYTDPYVIGKIREHGWLLRAPI
FT                   PFSYDTIDYYNPAPNPAPPNARHWLGTDDRGRDVAARLIYGFRLSVLFGFALTAIGMVI
FT                   GMLAGAVQGYLGGKVDLFFQRFIEVWGSLPELYLLIIFASIFQPSIGLLLILLSLFGWI
FT                   GLSDYVRAEFLKGRNLEYVRAARALGVSGPRIMFRHLLPNALTPVITFLPFRVSGAILA
FT                   LTSLDFLGLGVPPSTPSLGELLAQGKNNIDAWWLSLTTFGVLVGTLLLLIFIGEALRAA
FT                   FDTRQK"
FT   gene            complement(414118..414513)
FT                   /locus_tag="Hneap_0398"
FT   CDS_pept        complement(414118..414513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0398"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dze:Dd1591_2181 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95255"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT2"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACX95255.1"
FT                   /translation="MGNPCQRCGACCAYFRVSFYWAESVPFLDGQVPPELTEQINPHLV
FT                   SMKGTLTSPARCVALEGGIGDCVSCSIYPNRPTPCRELEPWDEHGQPDEKCSRARAAHG
FT                   LPPLEPLYEPTAPHTPEIVDPLRTGTD"
FT   gene            414775..415542
FT                   /locus_tag="Hneap_0399"
FT   CDS_pept        414775..415542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0399"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tbd:Tbd_2270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95256"
FT                   /db_xref="GOA:D0KXT3"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACX95256.1"
FT                   /translation="MVKRFLGFVGLMALALSNISSAQAQETIYVYGPGGPAPAMKEAAA
FT                   VFEKETGTKVEVTAGPTPKWIEQAKTKGDIIYSGSENMMTDFTFQLDGQIKSDQVIPLY
FT                   LRPMAILVRPGNPKKIKGFEDIIKPGVKVLVVQGAGQTGAWEDIAGRLGNIQTVQSLRS
FT                   NIVDYAKNSALAKKAWIDQPDIDAWLIYNIWQVANPKLADVVEIEPQYAIYRDVGVVLT
FT                   QRAQANAQSKAFIKFLQSEQGEKIFVKWGWKAN"
FT   gene            416111..416392
FT                   /locus_tag="Hneap_0400"
FT   CDS_pept        416111..416392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_4201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95257"
FT                   /db_xref="GOA:D0KXT4"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT4"
FT                   /inference="similar to AA sequence:KEGG:PFL_4201"
FT                   /protein_id="ACX95257.1"
FT                   /translation="MAITHNSYFDGAVQSLAFDFGNAGATVGVLAPGDHVFNLKARETM
FT                   TVVAGKMFVTINDMAEFPAAAGTTFDAPEGCTLRMRCDVDTAYLCEFH"
FT   gene            416802..418271
FT                   /locus_tag="Hneap_0401"
FT   CDS_pept        416802..418271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0401"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: dar:Daro_0423 D-alanyl-D-alanine
FT                   carboxypeptidase PBP3; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95258"
FT                   /db_xref="GOA:D0KXT5"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT5"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACX95258.1"
FT                   /translation="MFLILPRRLRFFLLAAFFLGIGSANIQSATAAGAVGMPPSVLETL
FT                   KKQKLSLGDLGIWVQAVDSNKPLLTHLPDDLFNPASVMKLVTSVVALDVLGTNFQWTTR
FT                   VYADALPVNGVVHGNLYIKGEGDPWFRSEDLWDLVRQLSDLGIHEVTGKLVLDNSYFDP
FT                   GPADPSDFDDHPERVYNALPQALLLDNRATRVLIVPPDRSGAGAVVRAWPPNSNIAINN
FT                   DVKLVKGACTGQTNQPSIAVLGPDTNTPTLNVSGKISTECQPDQFYLVAGNANDAFYSA
FT                   FKHLFEGQGGKIDGTWAEGVVPKTAVYLVQHNSENLTQYLYLQNKWSNNLMARQIFLTM
FT                   GAEIKGAPGTLLKSKAVIADWLKRQGFNWPGFDIENGSGLSRKARISPKEMGQLLMYAW
FT                   RSPTMPELMASLPIAGIDGTMRKRMRGEPARGMIHLKTGTLRDVRAGAGYIITQSGRRY
FT                   VVVILQNEQNVQNGGGSKVQDAILDWLYDNG"
FT   gene            complement(418294..419646)
FT                   /locus_tag="Hneap_0402"
FT   CDS_pept        complement(418294..419646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0402"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: aha:AHA_3080 metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95259"
FT                   /db_xref="GOA:D0KXT6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT6"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACX95259.1"
FT                   /translation="MSIPSLLPETTLRLRQSEIIGALSHALDLTEGLPAGHAQRCCWIG
FT                   MHIGQELNLNDHDRADLYYALLLKDAGCSSNAARIFNVYGCDDRILKRDFKLIDTHKID
FT                   DMAKFAWSHVAPGESWLKRLPMLASLITKGSEIGEDLFLTRCEQGAEIAEQLGFSAQVC
FT                   DAVRGLDEHWDGRGNPRQLKGEQIPLFARIALLAQVIEIFFAEGGSALAMQTVRARAGT
FT                   WFDPTLVHHLEKLAQNDEFWAGLQDPDIAARLVTIEPADYVRTVDDEELDRLAGAFAAV
FT                   IDAKSPYTFGHSSRVCQYAQRIGGEVGLSEKQLFWLRRAALLHDIGKLGVSNSILDKPG
FT                   KLTDEEFAQIKLHPVHSMDILSKVGIFDSLAPVASGHHERLDGCGYPWGLKGDQIDFAT
FT                   RIISVADVFDAVSAERPYRGAMPVAQALSILDDLSGPALDGDLVAALKRTL"
FT   gene            complement(419701..421494)
FT                   /locus_tag="Hneap_0403"
FT   CDS_pept        complement(419701..421494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0403"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: aeh:Mlg_1819
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95260"
FT                   /db_xref="GOA:D0KXT7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT7"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ACX95260.1"
FT                   /translation="MTPPPNEQRLIQRRQQPQIPEAMSSIDSRLAAILVNRGIVHPRQI
FT                   NPDLEFLLPPADMPGIDVAADILADAVRENARILIIGDFDADGATATALCVRALRAMGA
FT                   KQVEYTLPDRQRHGYGLSPALLKDWIAEADAPPDIILTVDNGIAAFAGVAAALTLNATV
FT                   IITDHHLPGDTLPPAHAIVNPNLNGSDFASKAIAGVGVAFYVMAALRERLSAQDWFAGG
FT                   IARPNLARWLDLVAVGTVADVVSLDDNNRRLVAQGLARIQAQQCVPGISALFAVAGKDP
FT                   RYASSTDLGFVVGPRLNAAGRLEDMRIGVDCLLADDPISARQYAMTLNEINHERRALEQ
FT                   EMLFSLKKQGKSSGLNELDLDRPIDPADWVIFDDSFHQGVIGIVAGRLKERWQRPVFVF
FT                   APENNDAPRAKLKASGRSIPGVHLRDVLVSMATTAPDLMHAFGGHAMAAGLSLSFDQLD
FT                   TFRRLFAREMAKHRLHFPDQAIVHTDGPLSANELTLDFAQQLQTCTPWGTDCPEPIFDN
FT                   RFEVLERTPLKEGRHWRLRLRLLKTEPATPTIGADLTAVWFGIGDHIPAGKYWHLAYRI
FT                   DINRFRGQQTLQLMIVSGVAA"
FT   gene            complement(421502..423019)
FT                   /locus_tag="Hneap_0404"
FT   CDS_pept        complement(421502..423019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0404"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: tgr:Tgr7_2467
FT                   guanosine-5'-triphosphate,3'-diphosphate diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95261"
FT                   /db_xref="GOA:D0KXT8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT8"
FT                   /inference="protein motif:PRIAM:3.6.1.40"
FT                   /protein_id="ACX95261.1"
FT                   /translation="MMQNDSLVAAVDLGSNSFHMLIARVSDGQVQVVDRMKEMVRLAGG
FT                   LQSDGSLAEDAMDRGVACLTRFGQRVSGMPPGSVRIVGTNTLRAAKNGAEFIKRGEKAI
FT                   GHPIEIIAGREEARLVYLGVSRSEIPIDGDRLVVDIGGGSTELILGKGITPFKMESVPI
FT                   GCVALMRDFFADGVFDAARMDHAKTRAELELSPYKMAYLKAGWTQAIGSSGTARSLATV
FT                   IKANDWGEGAITAEGLAKVQSAVLKAGSLSALKLPGLSDDRKPVFVGGLIAMQAVFAAL
FT                   NIRQMFVSDGALREGLVFDWLDRDDHDDIRIATIRRLQRLFTVDVRHADRVAKTAADLL
FT                   AQVAPNWGLDCHPESIDAPRYAVWLDIAARLHEIGLAVSHSGFHHHGAYILSYADMPGL
FT                   TRPAQMIIASLVHTHRRKFKLQRFGEVDERLREQIVRLSAVLRLAVLLHRDRSPRPNLS
FT                   RVRLEAGADNLHVSFPDGWLKTRPLTRVDLELEQSYLAMANIRLSFA"
FT   gene            complement(423167..424231)
FT                   /locus_tag="Hneap_0405"
FT   CDS_pept        complement(423167..424231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0405"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: tbd:Tbd_0163 fructose-1,6-bisphosphate
FT                   aldolase; TIGRFAM: fructose-bisphosphate aldolase, class
FT                   II, Calvin cycle subtype; ketose-bisphosphate aldolase;
FT                   PFAM: ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95262"
FT                   /db_xref="GOA:D0KXT9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXT9"
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /protein_id="ACX95262.1"
FT                   /translation="MALISLRQLLDHAAEHSYGMPAFNVNNMEQIHAIMQAADAVDSPV
FT                   ILQGSAGARKYAGEPFLRHLVSAAVEMYPHIPVVMHQDHGADPGVCFRAIQSGFSSVMM
FT                   DGSLMPDMKTPSSFEYNVEVTRKVAEMSHFVGVSVEGELGCLGSLETGKMGEEDGHGAE
FT                   GELDHSMLLTDPEEAAQFVKMTDVDALAIAIGTSHGAYKFTQKPTGKVLRIDRVKEIHA
FT                   RIPNTHLVMHGSSSVPEDWLEIINNYGGDMGQTYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   MASTGAIRKHLHDNPANFDPRKFFAEATKAMKSICQARFEAFGAAGKASLIKPLNLDEM
FT                   HKRYASGSLKQQIK"
FT   gene            complement(424313..425788)
FT                   /locus_tag="Hneap_0406"
FT   CDS_pept        complement(424313..425788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0406"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: tgr:Tgr7_2890 pyruvate kinase; TIGRFAM:
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95263"
FT                   /db_xref="GOA:D0KXU0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU0"
FT                   /inference="protein motif:TFAM:TIGR01064"
FT                   /protein_id="ACX95263.1"
FT                   /translation="MHAQNPPGYLSTKRRTKIVATLGPASDNPKVIADLISAGVDVVRL
FT                   NFSHGKAADHQHRADMVRAAASAQGKFVAILGDLQGPKIRIDRFKNGKVELADGAHFTL
FT                   DADLDRDSGDETTVGITYKALVTDSKAGDILLLDDGRIVLQVESVSGNKIQTKVVVGGE
FT                   LSNNKGINRQGGGLSAPAITEKDREDIKTAAAIGVDYIAVSFPRSGEDIHEARRLLQEA
FT                   GCTAHIVAKIERAEAIECIRDIIQASDAIMIARGDLGVEIGDAELPAVQKAFIRMARDM
FT                   NRPVITATQMMETMITNPIPTRAEVFDVANAVLDGTDAVMLSAETAAGKHPVRVVETMA
FT                   RICHRAEYQIEAKRGQPPLDIPFERIDQAIAYSAIYTANHLSVAAIVALTESGATALWM
FT                   SRVSTDIPIYAFTRNEVAARRMALYRGVQAVHFPYSSTDHAEVNRLTIEALTQMECLDD
FT                   GDVVIITKGDLMGQMGGTNAMKIVRVGQIINAD"
FT   gene            complement(425798..426997)
FT                   /locus_tag="Hneap_0407"
FT   CDS_pept        complement(425798..426997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0407"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: nmu:Nmul_A0386
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95264"
FT                   /db_xref="GOA:D0KXU1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU1"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACX95264.1"
FT                   /translation="MANFLRMTDLDLAGKRVFIRADLNVPVKNGKVTSDARISASMATI
FT                   THCIKAGAKVMVTSHLGRPEEGIYSEENSLAPVAADMGAKLGKSVRLIKDWVDGGFNVA
FT                   PGEVVLLENVRFNAGEKKSLDETAKKYAALCDVFVMDAFGTAHRAEASTHGIAKFAPVA
FT                   CAGILLAQELEALDKALANPARPMVAIVGGSKVSTKLTVLEALSEKVDQMVVGGGIANT
FT                   FIKAVGHNVGKSLCEDDLVPTAQMLMKKMEARGASIPVAVDVVVGTELPFLPGNENTPA
FT                   TLKPVDSVSDDDMIFDIGPKSAQELADIIMKAGTVVWNGPVGVFEYDQFGEGTKTIAMA
FT                   IAKTKAFTLAGGGDTIAAIQKYDIYDQVSYISTAGGAFLEYLEGKTLPAVAILEQRASA
FT                   "
FT   gene            complement(427153..428151)
FT                   /locus_tag="Hneap_0408"
FT   CDS_pept        complement(427153..428151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0408"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: tgr:Tgr7_2892 glyceraldehyde-3-phosphate
FT                   dehydrogenase (phosphorylating); TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I; PFAM:
FT                   glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95265"
FT                   /db_xref="GOA:D0KXU2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU2"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ACX95265.1"
FT                   /translation="MTIKVGINGFGRIGRMVFRAAAKDFPEIEVVAINDLLDADYLAYM
FT                   LKYDSVHGRFDGDVSVDGNHLVVNGKRIRLTAERDPANLKWNEAGADIVIESTGFFLTK
FT                   ETCQAHINAGAKKVIQSAPSKDDTPMFVYGVNHDKYAGENIVSAASCTTNCLAPVAKVL
FT                   NDAFGIKRGLMTTVHAATATQKTVDGPSAKDWRGGRGILENIIPSSTGAAKAVGVVLPE
FT                   LNGKLTGMAFRVPTSDVSVVDLTVELNKETTYADICKAMKSASESGSLKGVLGYTDDSV
FT                   VSTDFRGVAQPSVFDAKAGIQLDPTFVKVVAWYDNEYGYTSNLMRMVKVIG"
FT   gene            complement(428269..430257)
FT                   /locus_tag="Hneap_0409"
FT   CDS_pept        complement(428269..430257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0409"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain protein; KEGG: vcj:VCD_001133
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95266"
FT                   /db_xref="GOA:D0KXU3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU3"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ACX95266.1"
FT                   /translation="MSTRRELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNGYL
FT                   KHNPKNPQWPNRDRFVLSNGHGSMLIYSLLHLSGYELPMEELKNFRQLHSKTPGHPEYG
FT                   YTPGVETTTGPLGQGITNAVGFAIAEKMLAGQFNKPGHNVVDHYTYCFLGDGCMMEGIS
FT                   HEACSLAGTLGLGKLIAFYDDNGISIDGHVEGWFTDDTPARFEAYGWHVVRDVDGHDAE
FT                   AIDAAIREARSVNDKPTMICTKTVIGFGAPNLCGTHDCHGAALGEAEVKATRDNLGWHH
FT                   EPFVIPAEIYAGWDATEAGIRNESAWEDAMNAYAKAYPAEAAELKRRLAGDLPADFTSK
FT                   MDAFIAEVAAKGETIATRKASQNSITAIAAILPEIVGGSADLAPSNLTTWKGCRALTAT
FT                   ESDANYIHYGVREFGMSAIMNGMVLHGGFVPFAATFLMFSEYARNALRMSALMKIGSIF
FT                   VYTHDSIGLGEDGPTHQPVEQIATLRMIPRMNTWRPCDAVESAVAWKAAIMRRDSPSTL
FT                   IFSRQNLAHQNRTPEQIANIARGGYILRDCAGTPDLILIATGSEVALATAAAEKLAGKK
FT                   VRVVSMPCTEVFDAQDPAYRESVLPAAVRARVAVEAGVTGFWGKYVGLDGKVVGIDTFG
FT                   ESAPAGDLFKLFGFTVDNVVATAQSVL"
FT   gene            complement(430447..430998)
FT                   /locus_tag="Hneap_0410"
FT   CDS_pept        complement(430447..430998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0410"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   dar:Daro_3587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95267"
FT                   /db_xref="GOA:D0KXU4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU4"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACX95267.1"
FT                   /translation="MVSTTTPICEFNRPAIDFSLPDTEGRLWTLQDCRGPKGLLVMFIC
FT                   NHCPYVQAILPKIVRDTAELKRSGINSVAIMSNDIADYPEDSPEHMHRLAREYDFSFPY
FT                   LYDETQEIAKAYNAVCTPDFFGYNADLKLQFRGRLDASGRQNQPDAPRELFHAMQLIAE
FT                   TGTGPSDQTPSIGCSIKWRP"
FT   gene            431225..432082
FT                   /locus_tag="Hneap_0411"
FT   CDS_pept        431225..432082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_1818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95268"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU5"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1818"
FT                   /protein_id="ACX95268.1"
FT                   /translation="MSVQGLTVPLRFRNGGFARKIGRYISGFVALWLCFVMSVSAEAAA
FT                   LKFAIPPFLPKAELEKSFGPLVQRLSEMTGTPIDLEVFPNYLAFWQETRTGSPFDIALD
FT                   AAPTTDFRVARQHWHVIAKLSGTVTQSLVTGPNDAVLDPSELINKKIAVQPSPSVSALT
FT                   LYQLFPNPVQQPQLVFVDSNRAAAEAVKAGEVAAAVIPTPIAAGYPSLNMVTTTAPLPF
FT                   LAVSVSPNVSPELAKSLQSALIRLSETPEGEAMLQQSQLRAFTKATDSDYAGQEKLLEG
FT                   TFGY"
FT   gene            432113..433252
FT                   /locus_tag="Hneap_0412"
FT   CDS_pept        432113..433252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0412"
FT                   /product="ISBmu8 transposase"
FT                   /note="KEGG: bmj:BMULJ_05850 ISBmu8 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95269"
FT                   /db_xref="GOA:D0KXU6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU6"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_05850"
FT                   /protein_id="ACX95269.1"
FT                   /translation="MNHYAYWRSELENPLRRLPMKSPILLEDEQRDVLERWSRSRTVSL
FT                   RWRERAQIILAATEKVSDAVIAARLGTTRHRVARWRRRFASGGVEALKKDRPRAGRPPR
FT                   VDAAKVKQIVRLTTQTQPTHATQWSTRSMAKRVGVSDTTVLRVWHAHGLKPHRVRTFKL
FT                   SNDPQFTEKLEDIVGLYLAPPEHALVLCCDEKSQIQALDRTQPGLPIKKGRAQTMTHDY
FT                   KRNGTTTLFAALNILDGQVIGHCQSRHTHVEWLKFLKKVDRNTPKGKELHLIVDNYATH
FT                   KHPEVKAWLALHPRFHIHFTPTSASWLNMVERFFRSITVDRLRCGVFHSVADLEKAISG
FT                   YINHYNKNPKPFVWTAKANDILEKVVRAQTTLDKMGQTA"
FT   gene            433325..434497
FT                   /locus_tag="Hneap_0413"
FT   CDS_pept        433325..434497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0413"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: tgr:Tgr7_2894 methionine adenosyltransferase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95270"
FT                   /db_xref="GOA:D0KXU7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU7"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACX95270.1"
FT                   /translation="MTVHREPVHFFTSESVAEGHPDKIADQISDAVLDAILRKDPHARV
FT                   ACETLVKTGFVVLAGEVTTSAWVDLDELVRKVIVDIGYDSSELGFDGNTCGVLNAIGKQ
FT                   SSDIAQGVDRMVAEEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKSHTL
FT                   SWLRPDAKSQVTFRYKKGKPVGIDAVVLSTQHGPEVSQKDLREAVMELIIKPTLPADWL
FT                   DEKTKYHINPTGNFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAA
FT                   YAGRYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIDTFGTGKISDQRITDLVRAHFD
FT                   LRPYGIVRMLDLIRPIYQKTAAYGHFGREDADFTWEKTDKADALRADAGL"
FT   gene            434628..436040
FT                   /locus_tag="Hneap_0414"
FT   CDS_pept        434628..436040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0414"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: afr:AFE_0534 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95271"
FT                   /db_xref="GOA:D0KXU8"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU8"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ACX95271.1"
FT                   /translation="MQNPNAFKLAIDCKVADITLADYGRKELRIAEREMPALMAIRAKY
FT                   REAQPLAGARIVGSLHMTVQTAVLIETLVDLGASVRWSSCNIFSTQDHAAAAIAAAGIP
FT                   VFAWKGETEEEYWWCIEQTITGPNGWTPNLILDDGGDLTGLIHDKHPELLAGIHGVSEE
FT                   TTTGVHRLLDMLKAGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRATDHLLSGKQ
FT                   ALVIGYGDVGKGSAASLRQEGMIVKVTEIDPICAMQACMDGYEVVSPYLNGHNDGSDTC
FT                   VDKQLLGKIDLIVTTTGNVNVCDAPMLKALKNGAVVSNIGHFDNEIDTAYMRKNWVWEE
FT                   IKPQVHKIYRETAPGSEPNLDSDNYLILLSEGRLVNLGNATGHPSRIMDGSFANQVLAQ
FT                   LHLFANKFADQPAARKAELLRVEVLPKALDEEVARYMVAGFGGVLTKMTDKQASYLGVE
FT                   VNGPYKPDSYRY"
FT   gene            436058..436909
FT                   /locus_tag="Hneap_0415"
FT   CDS_pept        436058..436909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0415"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: tgr:Tgr7_2896 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95272"
FT                   /db_xref="GOA:D0KXU9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXU9"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACX95272.1"
FT                   /translation="MHTPLSCEFFPPKSDEGALKLRAVTEQLTSALKPEYFSVTYGAGG
FT                   STQDRSFATVQAIQTESGVPAAPHLSCIGSTRASIAAILDQYRALGIKRIVALRGDLPS
FT                   GMRDPGDFRFASELVAFIREHSGDWFHIEVAAYPEFHPQSANARADLLHFKQKVEAGVD
FT                   GAITQYFYSIEAYARFLDDCEKLQIMIPIVPGIMPISNYTQLARFSDASGADLPRWLRK
FT                   RLEAFGDDMDGLRAFGHDVVTGLTSDLVQAGAPGLHFYTMNQAVPVINICRDAGLMPSQ
FT                   PN"
FT   gene            437084..437998
FT                   /locus_tag="Hneap_0416"
FT   CDS_pept        437084..437998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0416"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   ddr:Deide_07280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95273"
FT                   /db_xref="GOA:D0KXV0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV0"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACX95273.1"
FT                   /translation="MGTFAIVLLVLAAATIFAGIKQVPQGSMWTVERFGRYTRTLEPGL
FT                   NLIVPYIDRIGRKINVMEQVLDVSSQEIITRDNAMIKVDGVVFFQVLDPARAAYEVHQL
FT                   DYAILNLVITNIRNVMGSMDLDEILSRRDDINARLLSVVDEATSPWGTKITRIEIKDIT
FT                   PPQDLVAAMGRQMKAEREKRANILEAEGFRQAAILKAEGEKQSNILQAEGDREAAFRDA
FT                   EARERLSQAEAFATKTVSEAIAAGNVQAINYFVATKYIEAFQAVATAPNQKVIMLPIEA
FT                   SNMLGSLEGIAELAKEAFKVNPK"
FT   gene            438038..438391
FT                   /locus_tag="Hneap_0417"
FT   CDS_pept        438038..438391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dba:Dbac_1947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95274"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV1"
FT                   /inference="similar to AA sequence:KEGG:Dbac_1947"
FT                   /protein_id="ACX95274.1"
FT                   /translation="MNMTRNFFAALSVLVVLALAGCSSGAPSSSDVEQALKSGMAKAMS
FT                   QASSVEGGQAVSAMMAKVEIKSVKVLECNKDASGTGFDCKVETEVSTPFAGDQKNTRML
FT                   HLVKGSDGWVIAR"
FT   gene            438432..438884
FT                   /locus_tag="Hneap_0418"
FT   CDS_pept        438432..438884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0418"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   xau:Xaut_1881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95275"
FT                   /db_xref="GOA:D0KXV2"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV2"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACX95275.1"
FT                   /translation="MPLDTLIWDYWAWFILGVLLVVVEIFAPSSFFLWLGVAAGVVGGI
FT                   SFFMPDIGWPVQIGLFAVLSIVAVLIGRRVFVPNKQATDHPMLNRRGQQYIGRHFTLEA
FT                   PIVNGVGWVRIGDSRWRVLGPDMPSGSVVEVTSVDSSNLVVAPVTR"
FT   gene            438898..440259
FT                   /locus_tag="Hneap_0419"
FT   CDS_pept        438898..440259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0419"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   mca:MCA0017 adenosylmethionine--8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95276"
FT                   /db_xref="GOA:D0KXV3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV3"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ACX95276.1"
FT                   /translation="MMSSNQSWIDRDLAVLWHPCTQMKEHETLPPIPVARGEGSWLYDF
FT                   DGRRYLDVISSWWVNLFGHANPVINARLKAQLDQLEHVILAGFSHQPVVELSERLVQLT
FT                   PPGLERVFFADNGASGVEVALKMSFHYWRNQGRAEKTRFIALENSYHGETMGALGVGNI
FT                   PIFTETYAPLIQPAFIAPSPDCQQAEPGESCADVTERALAAMRALLERVASQTCAIIIE
FT                   PLVQCAAGMRMHEPAYLTGLRALCDEFEVHLIADEIAVGFGRTGTLFACEQGGITPDIL
FT                   CLSKGITGGYLPLSAVLTTEDIYQAFYCEAPASRAFLHSHSYTGNPLACTAALATLDIF
FT                   EQNNVIERNRQRGAMIDRLTAPLAELPNIAHMRRCGMIVAMDLVDDRAGNRGKPFPRAE
FT                   RRNQKAYRYALDHEVLLRPLGNTIYWMPPYIMDDDQWQMLADVTFDAVRFAVQD"
FT   gene            440276..441010
FT                   /locus_tag="Hneap_0420"
FT   CDS_pept        440276..441010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0420"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   pfo:Pfl01_5288 16S ribosomal RNA methyltransferase RsmE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95277"
FT                   /db_xref="GOA:D0KXV4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV4"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACX95277.1"
FT                   /translation="MRIPRIYLDAALAEGATLPLPAERLNYLKNVLRLRDGQALRVFDG
FT                   QNHEADATLSLGKREGSLAIGRVAAHSVESPLQTHLIQAMGKGEKMDWVIQKAVELGVT
FT                   RFTPVSTERSVVELKGERADKRHARFIDIAIGACEQSGRNFLPRVDPILSLEEALTQTD
FT                   AALKWVLHPNPGSGAALPAVAPDSVALLIGPEGGLSDHEVEAAIASGFMPLTLGSRVLR
FT                   TETAPIVALSVLQMQWGDFFVG"
FT   gene            441129..442227
FT                   /locus_tag="Hneap_0421"
FT   CDS_pept        join(441129..441203,441205..442227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Hneap_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_3602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95278"
FT                   /db_xref="GOA:D0KXV5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95278.1"
FT                   /translation="MLEINPILFKIKDLSARAAALRGYLDFDVKKERLEEVDRELEVPD
FT                   VWNDPARAQALGKERASLERVVHTLANMAQGLNDNADLLEMAAEEDDEATVASIEKDVV
FT                   EFEKQIADLEFRRMFSGEMDESNAYLDIQSGAGGTESQDWASILMRMYLRWGDRRGFKT
FT                   EVMEMSDGEVAGIKSATIRFEGEYAFGWLRTEIGVHRLVRKSPFDSDNRRHTSFASVFV
FT                   SPEVDDNIEIEVNPADLRVDVFRASGAGGQHVNRTESAVRFTHLPTGVVVACQAERSQI
FT                   QNRERAMKMLKAKLYELEVQKRNAVSQALEDTKSDVSWGNQIRSYVLDQSRIKDLRTGH
FT                   ETGNTQAVLDGDLDPFIEASLKSGL"
FT   gene            442272..443807
FT                   /locus_tag="Hneap_0422"
FT   CDS_pept        442272..443807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0422"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: tgr:Tgr7_1462 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95279"
FT                   /db_xref="GOA:D0KXV6"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV6"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACX95279.1"
FT                   /translation="MTANEQVNGAAEERSAESLLAEENKLIAERRDKLSRIRAAGNAFP
FT                   NDFRRDASAAELQAEYAEKEADYFEQNPRRVVVAGRVMAKRLMGKASFLSILDHSGRIQ
FT                   LYVARDALGEATYDDFKTWDIGDIVGGEGALFKTQKGELSVRVDSIRLLTKSLRPLPDK
FT                   FHGMSDTEQRYRQRYVDLIMNEPVRDTFRKRTQIIQFMRNYLNAKDFLEVETPMMHVIP
FT                   GGASAKPFTTFHNALDMDLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGLSTRHNPE
FT                   FTMIEFYQAYADYIDLMDMTEDLLRRLSESVCGSTTLTYQGVEFDLAQPFARLSVVNAI
FT                   LEHNPDVTREQLSDIDSARRIAEGLGINIKDSYGLGKIQIEIFEETAEHKLIQPTFITE
FT                   YPAEVSPLARRSDDNPFVTDRFEFFIGGREIANGFSELNDAEDQAERFMAQVAEKDAGD
FT                   DEAMHFDSDYIRALEHGMPPTAGEGIGIDRLVMFLTDSPSIRDVLLFPHMRPE"
FT   gene            444379..445509
FT                   /locus_tag="Hneap_0423"
FT   CDS_pept        444379..445509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0423"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; protein of unknown
FT                   function DUF59; KEGG: lhk:LHK_00741 Mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95280"
FT                   /db_xref="GOA:D0KXV7"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV7"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ACX95280.1"
FT                   /translation="MFGLFGKKIDTARSEALRNALGSLVDPHAGETLADAHFIERAEVV
FT                   GDEAQIDVVLDYPAAGFEAELTELLERTALQIEGIKSAKTTIAFVSPLGSSQNGKPLPG
FT                   VRNIIAVASGKGGVGKSTTSVNLALALAAEGATVGLLDADIYGPSQPLMLGAKETPVVD
FT                   EQRAMQPVMAHGLQTMSIGYLIDDAQAMVWRGPMVTSALMQLLNDTRWHDLDYLIVDMP
FT                   PGTGDIQLTLAQKVPVAGSVIVTTPQDIALIDARKAITMFEKVNVPVLGVIENMSVHVC
FT                   SNCGHVEPIFGSGGGEKLASENHIDLLGQLPLDLAIRTDVDEGWPTVVRDSESVNALIY
FT                   RQTARKLAAALGRHLRQDHFDGPNISIDEDGGDADG"
FT   gene            445496..445978
FT                   /locus_tag="Hneap_0424"
FT   CDS_pept        445496..445978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_1047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95281"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV8"
FT                   /inference="similar to AA sequence:KEGG:Anae109_1047"
FT                   /protein_id="ACX95281.1"
FT                   /translation="MLTVEVPGDFNGGTPLSLAHLVLDYNGTIAEDGALIAGVPERLAQ
FT                   LAEHLTIHVITADTHGTAAQKLAGLPVSLHILSPGAQSEAKADFVRALGSKQCVAVGNG
FT                   RNDALMLQTAVVGVAVVQAEAAAQITLAAADVVCASIEHALDLLIYSKRLVATLRN"
FT   gene            446044..446544
FT                   /locus_tag="Hneap_0425"
FT   CDS_pept        446044..446544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0425"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   pen:PSEEN2672 thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95282"
FT                   /db_xref="GOA:D0KXV9"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXV9"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACX95282.1"
FT                   /translation="MSQVTFLGNPVEVAGVMPAVGSPAPAFTLTDGELQEKSLGDFAGK
FT                   KKILNIFPSLDTPTCAQSVRSFNEKANSHPDTAVLCISADLPFAQGRFCGAEGLDNVIT
FT                   LSTFRHPEFLRDYGVLLADGALAHLAARAVIVLDEHDQVRYVQLVPEIADEPDYAAALA
FT                   ALA"
FT   gene            446561..447502
FT                   /locus_tag="Hneap_0426"
FT   CDS_pept        446561..447502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0426"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: pla:Plav_2811 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95283"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACX95283.1"
FT                   /translation="MTVQATDENTLKPKGRLRLGVDLGGTKVEVAVLDDADEFLFRERL
FT                   PTPQGDYSGTIETIATLIQKAEQQLGRVHSIGVGTPGTTSPRTGLMKNANSVVLNDQPL
FT                   KYDLETRLNRSVSMANDANCLALSEAHGGAADGADSVFGVILGTGVGGALVVNGQLIMG
FT                   QNAIAGEWGHNPLPWTHEGEYPGPVCWCGHQGCIEQWLSGPAFMRDFQNASGRSLTGAE
FT                   IIAAVEQGDAEAKAALTRYTDRLARALAHVINIFDPEVIVLGGGLSNVAALYTEVPSRW
FT                   DEFVFSDPISTKLVAPKFGDSSGVRGAAMLSS"
FT   gene            447499..448800
FT                   /locus_tag="Hneap_0427"
FT   CDS_pept        447499..448800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0427"
FT                   /product="arsenical pump membrane protein"
FT                   /note="TIGRFAM: arsenical pump membrane protein; PFAM:
FT                   Arsenical pump membrane protein; Citrate transporter; KEGG:
FT                   ppf:Pput_3035 arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95284"
FT                   /db_xref="GOA:D0KXW1"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW1"
FT                   /inference="protein motif:TFAM:TIGR00935"
FT                   /protein_id="ACX95284.1"
FT                   /translation="MTAAAIFLATLILVLWQPTIGRFQLGIGWSAAAGALVAFAAGVIQ
FT                   PADVPVVWAIVWNATFTFIALIIISLLLDEAGFFNWAALHLARWAGGSGPRLFVVMVLL
FT                   GGLVAAFFANDGAALILTPIVIGILLALRMPPTATLAFVMAAGFIADTASMPLVVSNLV
FT                   NIVVADYFKLGFADYAAVMVPVTLVSVLASLGVLWLYFRRSIPKTYACDALDSPSKAII
FT                   DRSVFRAGWWALAWLLFGFFVLDSWGVPISLVAAIGAFILWLIARRGAKINTRTVLIHA
FT                   PWQVVIFSLGMYLVVYGLKNAGLTDVLTYWFDQLAHLGLWGATLGTGFTMAALSAVLNN
FT                   MPAVLMGTLAIDGTQASGTTHLAMVYANIIGCDLGPKFTPIGSLATLLWLHVLARKQIV
FT                   ISWGYYFKVGLILTTPVLLLTLLALALRLSVNLP"
FT   gene            448808..450313
FT                   /locus_tag="Hneap_0428"
FT   CDS_pept        448808..450313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0428"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: ppw:PputW619_4197 exodeoxyribonuclease VII
FT                   large subunit; TIGRFAM: exodeoxyribonuclease VII, large
FT                   subunit; PFAM: Exonuclease VII, large subunit-like; nucleic
FT                   acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95285"
FT                   /db_xref="GOA:D0KXW2"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW2"
FT                   /inference="protein motif:TFAM:TIGR00237"
FT                   /protein_id="ACX95285.1"
FT                   /translation="MSTILSVTSLNAMAKQILEANLSGVMVQGEVRSLTRAASGHMYFS
FT                   LKDQQAEVRCALFRGQAMRVKTAFANGDAVVVRGSVSLYAPRGDYQLIVTGVELAGDGQ
FT                   LAVLFEALKKKLFAEGLFDAARKRAIPTLSRRILVISSAAGAALQDVLSTLTRRLPLVE
FT                   INLVPVAVQGEAAAAELTAAVRGITSDSEFDVVLLVRGGGSMSDLWAFNDEGLARAIAA
FT                   CPVPVISGVGHEIDFTISDFVADARAATPTAAAELATPITLGELQAALVLQQEQLSRLI
FT                   EDRLNAAGQRLDSSLNRLRQQRQRWLPQGHHQMMLSLRLQRAIRARWQDNLGQIRALTH
FT                   RLQQRSPVHWVRQNHSRLEQMRWRLQQAIDQRLAAQRQNNLRLAAGLRPLIVLRQIELR
FT                   QQNSQRITAHLHAAARQRLVRQQQRLEQAFGVLSALSPQRVLERGYSLVEAESGLLWHA
FT                   AALQSALAESDRPLPLRLHFGDGVVPIEARSAQSGSIETGATE"
FT   gene            complement(450375..450752)
FT                   /locus_tag="Hneap_0429"
FT   CDS_pept        complement(450375..450752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0429"
FT                   /product="cytoplasmic domain of flagellar protein FhlB-like
FT                   protein"
FT                   /note="KEGG: drt:Dret_0648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95286"
FT                   /db_xref="GOA:D0KXW3"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW3"
FT                   /inference="protein motif:COG:COG2257"
FT                   /protein_id="ACX95286.1"
FT                   /translation="MSRNIPKPKSEKHPISRAVALKYEGTELPQVVATGQHLVAEQIVA
FT                   RAKAADVPLVEDPALADMLASLDIGDHIPNNLFRAVAEVLSYALYVSGKHEEVLKRAQQ
FT                   TRDEAQNYRSNNGEKKDEPPE"
FT   gene            complement(450780..452120)
FT                   /locus_tag="Hneap_0430"
FT   CDS_pept        complement(450780..452120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_2338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95287"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95287.1"
FT                   /translation="MKIDSTLTASTTTELRGLPLRTGQTLAAIVLQANQGTGKALLSLA
FT                   GGQVAVTTQLPLTTGSAIQLKVKDAGPPVVMGLLSSAQETMTTKTTVQSAVQTLLTLLM
FT                   TRLSANTNAATASAPLKSEIGPAQGSQTQTTTTANATPTTQAGNMTAAVASPPIKLDLP
FT                   LNVRTALLNLDEVLSALRTGQPVAKQTLAQNLTQLIAANSLPPAPSNSSLDQATSDIKS
FT                   QLKLAAQQLKMQASLESMGNNQMATARGARSAASASQAQTHTATQTAAQTAAQTAAQTV
FT                   AQNPGQTASLQLSIEQWIGRLDVSQLRTALLQIQGQPTWVVDVPMMLAEQPRRVQIAIQ
FT                   EQAQNTNPPTESTWQLDFAIDLPALGPLHGSLSLQSTNLTVRLYADKPEARMQLDASLD
FT                   QLAEHLRAASLTPKELRIYPGPPPKAVQERLSPAPFLDEHATFRCQV"
FT   gene            452328..453797
FT                   /locus_tag="Hneap_0431"
FT   CDS_pept        452328..453797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0431"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase;
FT                   KEGG: aha:AHA_2826 FleQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95288"
FT                   /db_xref="GOA:D0KXW5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW5"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACX95288.1"
FT                   /translation="MSDQLPRIWIDAPAEIGADLTQWLTLLGVQAESVSHSIHAVTDDV
FT                   IGGICFADACETHLDRPQTLPWIALDADPARWLGAVQTPFATLTWPCTLSGLQGIVQRL
FT                   ISRWRGEQLVAAGRGLVGQTPVMRQLRAEIEQVAPSDATVLILGESGTGKEVVARMIHR
FT                   LSNRADKPFVPVNCGAIPAELLESELFGHEKGAFTGAISARAGRFELAEGGTLFLDEIG
FT                   DMPLPMQVKILRVLQERTFERVGGRHTFTADVRIVAATHRDLEVHIQEGSFRQDLYYRL
FT                   NVFPLETQPLRVLCEDIPEIVRALTQRFALAGRPVAQLTDGALTALSALPWPGNVRELG
FT                   NVIERLGILYPDQVVDIAQLPEKIRMQLPADWQMPEMPAPTVTKPPEPLSHHGATPEDV
FT                   DPRDMFAAGRASVDQSADIRLPVDEQELAQCQCVLPEMDFDLKNQLEAIERAWIEQALI
FT                   NNDGVVAQAARQLGIRRTTLVEKLRKYQMSA"
FT   gene            453896..454237
FT                   /locus_tag="Hneap_0432"
FT   CDS_pept        453896..454237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0432"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="TIGRFAM: flagellar hook-basal body complex subunit
FT                   FliE; PFAM: flagellar hook-basal body complex protein FliE;
FT                   KEGG: pap:PSPA7_4271 flagellar hook-basal body protein
FT                   FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95289"
FT                   /db_xref="GOA:D0KXW6"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW6"
FT                   /inference="protein motif:TFAM:TIGR00205"
FT                   /protein_id="ACX95289.1"
FT                   /translation="MSSGMSVDQILSQMRVMRQEATQRLAQPASVPPTVSPAGGDSFSS
FT                   LLTKAIGQVNDLQQNSSQLKTRFELGDPNVDLTQVMLASQKASLGFNATLQVRNRLVQA
FT                   YQDIMNMPV"
FT   gene            454266..456038
FT                   /locus_tag="Hneap_0433"
FT   CDS_pept        454266..456038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0433"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: tgr:Tgr7_1969 flagellar FliF
FT                   M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95290"
FT                   /db_xref="GOA:D0KXW7"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW7"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ACX95290.1"
FT                   /translation="MAQNSMAPLSAAHQPATGTPAWIRQIDGFTQSSSFRQLLILVALA
FT                   ATLSFMVGFFLWGQKPSLVPLYTNLGPKESAAVVEALRAAKKNYQLSADGAILVDPAQL
FT                   PAVRMLLAGEGLPSGNGVGLEMLDKDQSLGTSQFVEQARYQHAIEIELARSIETIQGVS
FT                   AARVHLATPKQSVFVREQQKPTASVVVELSPGQSLTADQVRAIVHLVASSVAGMKPENV
FT                   SVIDQRGELLSQNSDDASGMGLTDKQFAYRQRVERAYARQIEALLTPIVGANQVRAQVS
FT                   ADIDFSRQEGTSETYGPKTGVVLSEQTNDTTRALGDQGINGGVPGALSNQPPGGGTVTP
FT                   QTSGGLQPPANLDVQQYQQIIQTPISTQKNETRNYNVDKDIRHTQYASGAVDKLNVAVL
FT                   LDEKTVTDKDGKTKTEPMSDAELARIKDLVSQAVGLDEQRGDKLTLASIPFVEQKIEKV
FT                   SVPLWQQEWFMPLLKNLGLGVAMLLIFLMVVRPLLKMLADKSRPEALPHQPGAALPNGT
FT                   EDNGMNEEGVSFTRQASEGGQIPGPDDEDNLEGVPQLVGAASYADKLRQLKQSINHDPK
FT                   AVAAVIKQWTHSEN"
FT   gene            456040..457080
FT                   /locus_tag="Hneap_0434"
FT   CDS_pept        456040..457080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0434"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="TIGRFAM: flagellar motor switch protein FliG; PFAM:
FT                   flagellar motor switch protein FliG; KEGG: tgr:Tgr7_1968
FT                   flagellar motor switch protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95291"
FT                   /db_xref="GOA:D0KXW8"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW8"
FT                   /inference="protein motif:TFAM:TIGR00207"
FT                   /protein_id="ACX95291.1"
FT                   /translation="MAEALTNADQNPSDLIAGLKGPERAAILMMALGEESAAQLFTKLD
FT                   PREVQKIGQAMAVLPNVTRSQIQAVLDQFVLDLGDQTGLALGTTDYIRNVLNRALGEDK
FT                   AAGLLERISSGGNRRNLEFLKWLDPRSIAEIIRYEHPQIIAIVLSHLESDQGAEILQML
FT                   PENMRADIVLRIAHLDGVSPQALMELDDIMERQVSGAGGGKSSKVGGVKIAAGIMNFLE
FT                   GNVEEVVMNAVKSTDAELGTQIEDLMFVFANLIDVDDRGIQTILREVPSDRLLMAMKGA
FT                   DNDLKEKFFKNMSKRASEMMRDDLESLGPTRLSDVEAAQKEILQAARKLADEGKISLGG
FT                   GGEEFV"
FT   gene            457064..457846
FT                   /locus_tag="Hneap_0435"
FT   CDS_pept        457064..457846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0435"
FT                   /product="Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE"
FT                   /note="PFAM: Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE; KEGG: pfs:PFLU4437 flagellar
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95292"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXW9"
FT                   /inference="protein motif:PFAM:PF02108"
FT                   /protein_id="ACX95292.1"
FT                   /translation="MKSSSDPVQSATVDEVPLVRPLTAGADASAISAWALPDFDVPEAP
FT                   SEVLSEPLDPHAEELARARQVAEQAGFAAGHAQGEKAGFAAGHAEGLAAALAEQTHIQQ
FT                   RFQGWLQSLTQPLADLDAEVSLQMARLAAQMARAIIYRELTIEPEHLDVVARTAIEALP
FT                   VAVRAVTLVCHPDDADALQAAVDQDTIQSQHAQTVTVRRDATVTPGGLMVESNTVGVES
FT                   LVDASLEARWAALCLRVLDEQVAGPADPIETEMNEAAE"
FT   gene            457843..459240
FT                   /locus_tag="Hneap_0436"
FT   CDS_pept        457843..459240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0436"
FT                   /product="flagellar protein export ATPase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: tgr:Tgr7_1966 flagellar biosynthesis/type III
FT                   secretory pathway ATPase, FliI/YscN; TIGRFAM: flagellar
FT                   protein export ATPase FliI; ATPase, FliI/YscN family; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95293"
FT                   /db_xref="GOA:D0KXX0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX0"
FT                   /inference="protein motif:TFAM:TIGR03496"
FT                   /protein_id="ACX95293.1"
FT                   /translation="MTAGRNPAVFDPPSMRVGGVGLDWARHLMGLQARVQRPPLQAEGR
FT                   IVRVVGLALEASGLTAAIGDQCRIFLDDDPAGRFVDAEVVGFAERNTYLMPLEALRGIA
FT                   PGCRVQNQGASIRMPLGPELLGRVLDARGQPLDDGPAIFGDIPVDLQGRSNNPLKRRPI
FT                   REPLDVGVRAINALLTVGRGQRMGIFAGSGVGKSVLLGMMTRYTTAEIIVVGLIGERGR
FT                   EVREFVAEILDDEARSRAIVIAAPADASPLMRLHGASLATAIAEYFREQGHDVLLLMDS
FT                   LTRYAQAQREIGLAIGEPPATKGYPPSVFARLPALVERAGNGESARGSMTAFYTVLVEG
FT                   DDQNDPIADAARAILDGHIVLSRAIAERGRYPAIDIEASISRLMPALVSPEHLDLMQRF
FT                   KQLMSTYNQSRDLLAVGAYRRGHDVRLDRAIDAQPDLEAFISQSIHESADLDSSFAALE
FT                   SLMHSAA"
FT   gene            459252..459713
FT                   /locus_tag="Hneap_0437"
FT   CDS_pept        459252..459713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0437"
FT                   /product="flagellar FliJ protein"
FT                   /note="PFAM: flagellar FliJ protein; KEGG: aeh:Mlg_0713
FT                   flagellar export protein FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95294"
FT                   /db_xref="GOA:D0KXX1"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX1"
FT                   /inference="protein motif:PFAM:PF02050"
FT                   /protein_id="ACX95294.1"
FT                   /translation="MTIVNQQRIERVKGVEKITERGANIAKESQIQCQRRLDEQRARLQ
FT                   QLTEYLQEYAAGIGFASGGQAKAFALQNYRAFMGRIEETIAHQKEVVAQVEAELLACKQ
FT                   AAAEANSQHRSVEKLRGRFENERNRMQNKQEQAVNDAHAAQHRHNPLDV"
FT   gene            459731..461245
FT                   /locus_tag="Hneap_0438"
FT   CDS_pept        459731..461245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0438"
FT                   /product="flagellar hook-length control protein"
FT                   /note="PFAM: flagellar hook-length control protein; KEGG:
FT                   vsp:VS_0828 polar flagellar hook-length control protein
FT                   FliK"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95295"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX2"
FT                   /inference="protein motif:PFAM:PF02120"
FT                   /protein_id="ACX95295.1"
FT                   /translation="MAQLNSPALSALNAAIGGRSDPASGNAANAPGEQKGFAEMMAGAI
FT                   QNQSKNAQGQGVAGRSQVAADSKAAIINQAVGSGAGQSDVQTVDQSSAQQMRLTLQQQI
FT                   TSLQEKIQALSTQNPPLSDKAQAALGKLMQQLASLKSQLEKGVGSTALDASGLSKWMAQ
FT                   LDKVQALLQQGDVNAASWTGQLQAMVQHLAQTIQQTHVAVGRAGQSVEDMRSSHSVGGR
FT                   DGQQAGAIKEPSAANAQAMDSSKKDNHTVNNQGQFQNNPIVSGAGNTAAVISGQMQSLS
FT                   GAIDSALAAQTVNAASTLSSLSKGAPKADLVMQLVDPPGDNAPGAFNLSASGFGAAANT
FT                   NPIVALPGALALNQPRLAADLGQNIQFMVGKNISRATLDVNPAHLGPMKITIDQQNNQT
FT                   NIQIMASHHLAKDMLDQNMPRLREWLQEAGLGNAQITVTSSGQDGSGNQGMNQGGEQNF
FT                   GASNGRHGASTNDSLAHAAQPDVMHSGVSGNQAQTVNGRLRLDTFA"
FT   gene            461578..461901
FT                   /locus_tag="Hneap_0439"
FT   CDS_pept        461578..461901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0439"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; SMART: histone family protein
FT                   nucleoid-structuring protein H-NS; KEGG: pcr:Pcryo_1957
FT                   histone-like nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95296"
FT                   /db_xref="GOA:D0KXX3"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX3"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ACX95296.1"
FT                   /translation="MSTIDLNSLSAEDLRQLMANAERTLRDRHQQRVHSLRKEAEELAA
FT                   SLNMSVAELFGLEKSSKLANKKLPAKYINPANPAQTWTGRGKRPHWLADALARGESLEK
FT                   FAV"
FT   gene            complement(462170..463372)
FT                   /locus_tag="Hneap_0440"
FT   CDS_pept        complement(462170..463372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_0329 TPR repeat-containing
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95297"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95297.1"
FT                   /translation="MTPITPPAELPDSLKASFSLMNTTKPAREQLDSKSIQSVTEWFYS
FT                   ERWHQERADTTELMWLLHWLPAEQSERIAEIADAICISQLEAGDIDSAIALAEDTLAKH
FT                   DDFCLRHTLALAQSAKGDLNQAIGTLEQALGNSELIESNTPAEQRIQAWLDLARLLQNA
FT                   KALFKAMRPARAAIALAAQYHDEELLVEALTLLVRQLIEQGGSDEAWEALKPHLSDTYS
FT                   TGQSALWTLAFSELSNELSEADRNRGALFFLDANEPDALIRLWVKRAETAKEQDDVLIA
FT                   YILCLLFRAPIDAAAPLAAKLLLRDKDRQTERAPLIAASAMALAEIPDDRSIKRAHWYR
FT                   DAMIQLISVARHQGVPEAAVKQWAEDQKLLLEHGVIERASEQLINELATPPAWLQHAIR
FT                   K"
FT   gene            463591..463892
FT                   /gene="rnpB"
FT                   /locus_tag="Hneap_R0010"
FT   ncRNA           463591..463892
FT                   /gene="rnpB"
FT                   /locus_tag="Hneap_R0010"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 270.97"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            464290..464739
FT                   /locus_tag="Hneap_0441"
FT   CDS_pept        464290..464739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0441"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: MraZ domain; KEGG:
FT                   lpc:LPC_2378 cell division protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95298"
FT                   /db_xref="GOA:D0KXX5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX5"
FT                   /inference="protein motif:TFAM:TIGR00242"
FT                   /protein_id="ACX95298.1"
FT                   /translation="MFKGITNLNLDGKGRLAMPTRHRAAFAAEEGQMVMTIDAQERCLL
FT                   IYPLATWLIIEPQIDALPSFNAQANRVKRMLIGHATELTLDSAGRILVPTELRNHAELD
FT                   KEVVLVGQGKKLELWSQPNWAAQTEVFFSESNDKNLPAALEAISL"
FT   gene            464736..465689
FT                   /locus_tag="Hneap_0442"
FT   CDS_pept        464736..465689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0442"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: eta:ETA_07470
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95299"
FT                   /db_xref="GOA:D0KXX6"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX6"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ACX95299.1"
FT                   /translation="MNALAVSTQEKSEALTHETVLLNEAVEALAVRADGVYLDATFGRG
FT                   GHSAAILAKLNNHGRLFATDRDLRALAAGEALASKDARFQIHHAAFSTAAQWLASMGLQ
FT                   GKVDGVLFDLGVSSPQIDEAERGFSFQQNGPLDMRMNQHAGETAAEWLAEAEEEEIANV
FT                   LYRLGDEKFSRRIARRIVETRAAQPLATTFDLVRCIVEATPRRDPRKHPATRSFQAIRL
FT                   HINRELDEISAALSQVVDLLSIGGRLVVISFHSLEDRIVKNFIRDESTTDKDFFGQPVG
FT                   TARLSRVGGSIRASAEEIVRNPRSRSAIMRVAERVA"
FT   gene            465686..465946
FT                   /locus_tag="Hneap_0443"
FT   CDS_pept        465686..465946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0443"
FT                   /product="cell division protein FtsL"
FT                   /note="TIGRFAM: cell division protein FtsL; PFAM: cell
FT                   division protein FtsL; KEGG: tgr:Tgr7_0762 cell division
FT                   protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95300"
FT                   /db_xref="GOA:D0KXX7"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX7"
FT                   /inference="protein motif:TFAM:TIGR02209"
FT                   /protein_id="ACX95300.1"
FT                   /translation="MKFLFGILALAVFASALAVVDTAQQDRDVTRALSTHRQAIEKLNV
FT                   TYAELQLEQGALAAQGRVDQIAQTRLNMHVPSADQITMVFR"
FT   gene            465943..467802
FT                   /locus_tag="Hneap_0444"
FT   CDS_pept        465943..467802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0444"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   psa:PST_1076 penicillin-binding protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95301"
FT                   /db_xref="GOA:D0KXX8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX8"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACX95301.1"
FT                   /translation="MSRIIPAANQRRPAPMEKGALGRFFAWVGGCWRTVMVLGLFGVLA
FT                   LILVGRAVQLQVSEQGFYVQQGGDRQQRAQVIPAHRGMITDRNGDPLAISVPMDAVWVN
FT                   PTELTRFYAARTQGSARKYVDQDPIKTLASLLKIPDANLRSLVANNRSKQFIYVQRQVR
FT                   PSVAAVIRAARLPGVGLQREYQRFYPTGDVTASLVGFTNIDDHGQAGLEASYNNYLAGV
FT                   AGRRLILKDAYGHEVDDLGVQKEAQPGHDLVLSIDKRLQYLTYSELARGVAAHHAEYGS
FT                   AVLMNVTTGEVLAMATVPSFNPNNRATMKPALTRNRALVDQFEPGSSMKPFTITAALES
FT                   GRWQPDSTVNTAPGWVRIGGYTIRDHRNYGVLDLRGILEKSSNVGASHIGEDLGAEVLW
FT                   KNMRAFGFGQDTGVGFPGEVAGRLENWRQWSVSGTAAHSYGYGLSVTTLQLAAAYAALA
FT                   NHGRYIHPSLLKRDAPPSYVQVAPAKDCDEVVSMLQAVVSPEGTAPKAQIAGFQIAGKT
FT                   GTSRMIGPDGTYSKDNYNTVFAGIAPASDPRLVLVVVVTDPQQGSYYAGDVAAPIFHGI
FT                   MSGALRMLNIRPDNLPNEPAEVTAASVPPPSTAVAGKKQAGGA"
FT   gene            467799..469358
FT                   /locus_tag="Hneap_0445"
FT   CDS_pept        467799..469358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0445"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   cbc:CbuK_1928 UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95302"
FT                   /db_xref="GOA:D0KXX9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXX9"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ACX95302.1"
FT                   /translation="MSMLAFSPRPIGEILSALNLLVADNVGSVVARVITDDSREVVPGA
FT                   VFFARSGIQPNIKPFISQALAAGAVLVVTEADYADPRVIRVEAVHSLVLQMVGHVCAVN
FT                   FDDLTIIGITGTNGKTSVAQFIAGALSRSGAPHTASIGMIGTLGAGMWSSGLENLQPTA
FT                   NTTPGLLETLRYAVDFIRQGARYVVMEVSSHALEQNRLQGLPIRLAVFTNLSRDHLDYH
FT                   GTMAEYFAAKTKLFAWPGLRAGIINFDEAQADVLFEALGATADCWAYGLGDPDWRVADC
FT                   QHVRVTSITALPNGIDIQVRTPLGEARLQPSLVGLFNGANIMAALAAVLALGMPLETAI
FT                   KALDQSTPPPGRMQMITLPSGARALVDYAHTPDALDQVLRALRDHRDAAGKIICVFGCG
FT                   GDRDRGKRPLMAATAERLADQIVMTADNPRSEAPQAIIADMRGGLASPDTASVELDRRA
FT                   AIESALMQAKAGDWVLIAGKGHETTQEIQGQRLPFDDAAVVRDWIAQQTDVRAKRSVGG
FT                   AA"
FT   gene            469355..470779
FT                   /locus_tag="Hneap_0446"
FT   CDS_pept        469355..470779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0446"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: tgr:Tgr7_0765
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D -alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95303"
FT                   /db_xref="GOA:D0KXY0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY0"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACX95303.1"
FT                   /translation="MMRASLQQVATWLNQLSVQQPDITIQGVSTDTRTLVPGNLFVALK
FT                   GERFDGHDHLADARLAGAAAAIVSHLNPDIDLPQIEVEDTLTALQTLGQCWRGQVDPFV
FT                   IAITGSAGKTTVKQLLASICAQAGPTLATLGNLNNDIGVPLTLLSLSDIDQFAVIEMGA
FT                   NHLGEIARLTALARPDVGLITMAGTAHVGEFGSVDAIVQGKGELFVGLVPEAQAVINLD
FT                   SYGADRWWAMGSAQRNGFTLNNDPRARWTGEYNATTERLTIFENGQLLIESQPLPLPGA
FT                   HNATNLLAAVAVARTAGFSKEIILAGLNSFTPPAGRMSLVACSEQLTVINDTYNANPES
FT                   MCAALDYLVGRPGLHLAVLGDMGELGDLSAALHEEVIAYARGLAIDGLFTLGAAMDVAM
FT                   KPNAVSSNVSIEYSAKDHADLALALVRALDQLASRSASGTPITILLKGSRFMRMERILN
FT                   QLLPTDGPSPAESEAH"
FT   gene            470781..471863
FT                   /locus_tag="Hneap_0447"
FT   CDS_pept        470781..471863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0447"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: pen:PSEEN4488
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region;
FT                   Phospho-N-acetylmuramoyl-pentapeptide transferase,
FT                   conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95304"
FT                   /db_xref="GOA:D0KXY1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY1"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ACX95304.1"
FT                   /translation="MLLILFDWLAKFYSPFGVFHYLTLRTMLGVLTALIVALWIGPPMI
FT                   RWLQSIKAGQPIRSDGPQSHLSKAGTPTMGGALILVAIGVAVLLWGDLTNRYVWIALLT
FT                   TFGFGLIGGVDDYLKLSKRNSKGLASRYKYFWQSVIALIVAVVLFNMAKTPQETGLIIP
FT                   LFKDVLIPLGFGYILLTYFVIVGSSNAVNLTDGLDGLAIMPTVLVAGGLSVFAYVTGNV
FT                   KFAVYLGIPFVPGAGELAVFCAAIVGAGLGFLWFNSYPAQVFMGDIGALALGAALGVVA
FT                   VMVRQEIVLFIMGGIFVLETVSVMLQVASFKLTGKRIFRMAPIHHHFELKGWPEPKVIV
FT                   RFWIITVILVLIGLATLKVR"
FT   gene            471863..473278
FT                   /locus_tag="Hneap_0448"
FT   CDS_pept        471863..473278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0448"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   tgr:Tgr7_0767 UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95305"
FT                   /db_xref="GOA:D0KXY2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY2"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACX95305.1"
FT                   /translation="MEKHSLILGMGKSGLSVARHLSRLGLPFAAADTRDDAVLRAEWVA
FT                   QYPDISITMGALHESLLDNVAELIVSPGIALDLPLIMSARVKQIPVRGDIDLALHASDV
FT                   PVVLITGSNGKSTVTALVGELLNAAGVSAVVGGNFGTPALDLLTTDADVLVLEVSSFQL
FT                   ESTDFSGLAPAQMPRAATVLNISQDHLDRHGTLAHYAAIKETALHQARRAVLNRDDPMV
FT                   AAMAERASGDVIWFGTAMPTQPSDFGLMTIAGESWLIQAQANATALSILPVQALGLTGR
FT                   HNQMNVLAALALIQAVVPDVALNDDRLLNVLRQFTGLPHRAQSVGVINGVRFIDDSKAT
FT                   NVGAAVAAILGMPAPLVLIAGGQGKGQDFAPLAESLVGRCAGLILMGQDQAVIAEALQN
FT                   EPGATWPVRRVHSMIEAVQAAADIAPPQSTVLLAPACASLDMFVSYVDRGNQFAAAVAS
FT                   LSAKKTNGTEFTS"
FT   gene            473275..474522
FT                   /locus_tag="Hneap_0449"
FT   CDS_pept        473275..474522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0449"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: tgr:Tgr7_0768 cell division protein
FT                   FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95306"
FT                   /db_xref="GOA:D0KXY3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0KXY3"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ACX95306.1"
FT                   /translation="MNRTVQKLLPWLTASAQDVEKVRNESIRLDPILMVAVLALLAWGL
FT                   VMVTSASMELGERFGNPFFFVIRQTIAVVIGASITVWLVLRQPIALWVEYKLWILIASL
FT                   LLLLVVLLPGIGHSVNGANRWIPLGPVNIQVSEFARLGLIIWMAGYIATHTIKLQNRIT
FT                   GMLGPGVVIFAASLLLLLQPDFGTTAVLAATLFAMAWLARAQWQMMVGSTLVMGVLGVF
FT                   VVLSEQYRIERLLSFSNPFADPFGHGYQLANALIAIGTGGVWGRGLGESIQKLSYLPEA
FT                   HTDFIFAVLAEELGLIGVIALIGLYGLIVWRGFVIANMAWKENQIAGAALAWGISVWIG
FT                   MQALINMGVNMGVLPTKGLTLPLMSYGGSAMIVALISLGFLMRVHHEAAMVAELREAQM
FT                   TKRQQDASIRTKEVLS"
FT   gene            474519..475643
FT                   /locus_tag="Hneap_0450"
FT   CDS_pept        474519..475643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0450"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: sdn:Sden_0355
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95307"
FT                   /db_xref="GOA:D0KXY4"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY4"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ACX95307.1"
FT                   /translation="MTSQEKPLVYVMAGGTGGHVIPALAVARGLAEKGYAIRWLGTTAG
FT                   IEARLVPEAGFPIDWLTIGGLRGKNLLTRLLTPLRLIRAVFAARKYFARNKPALVLGLG
FT                   GYASGPGGLAARWLGLPLVIHEQNAIAGLTNRVLARIANQTLAAYLNAFPRVPQAFTVV
FT                   GNPVRADIVGMPGVVQRQIGHRGPVRVLVLGGSLGAKALNDTVPSALSRVSPQLPISVW
FT                   HQTGIKNIESTQTNYKQCKWADGSDYRVVPFIDDMAQAYAWADFVIARAGALTVAEISV
FT                   AGIGALFVPFPHAVDDHQTHNAEPLVQSGAALLMQQRDMTVERLVDSLVPVLSDPDRLR
FT                   EMALAARERALPKATETMVRICIETMKKQHKAAT"
FT   gene            475640..477115
FT                   /locus_tag="Hneap_0451"
FT   CDS_pept        475640..477115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0451"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: aeh:Mlg_2192
FT                   UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95308"
FT                   /db_xref="GOA:D0KXY5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY5"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACX95308.1"
FT                   /translation="MINPAMINSVGGTHRPVADIRMRQVRHLHFVGIGGAGMSGIAEVM
FT                   KTLGFTVTGSDVAESAAVIRLRQLGIPVQIGHAAAHVCDADVIVISTAVKADNPELAAA
FT                   QAKRLPIVRRAEMLAELMRFRIGLAVAGTHGKTTTTSLLAAILAEAGWDPTYVIGGKLL
FT                   SSSSNARLGRGEYLVAEADESDASFLHLQPHVAIVTNIDADHLETYDGNFERLVDHFIE
FT                   FLHNLPFYGLAVLCADDPVAAGITARVGRQVLTYGIDQPADVRATDVYSDGFGSRFVVN
FT                   LPNQTQFDCRLAMPGRHNVLNALAAITVAQDLGVPVAAIQQALTSFQGVGRRLERRGAL
FT                   AIKGKKLPLIDDYGHHPREVEATLQAVRAAWPDVRLVVIFQPHRFSRTRDLFEDFVRVL
FT                   STVDHLILLDVYAAGEAPIAGADGRSLARAIRNRGQVDPVFVVGADEAAAVLPDIIPEN
FT                   ELDQPMLVLTLGAGNVGSLPALLLNRYGEQSHA"
FT   gene            477108..478082
FT                   /locus_tag="Hneap_0452"
FT   CDS_pept        477108..478082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0452"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: pmy:Pmen_0924 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; protein of
FT                   unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95309"
FT                   /db_xref="GOA:D0KXY6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY6"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ACX95309.1"
FT                   /translation="MRDPAVFGRVLLLLGGWSSERVISLKSGETVLGALQRAGIDVTAM
FT                   DVRRDFLPELLAAHQAKPFDRAFIILHGRGGEDGQIQAVLELLGIPYTGTSMGGSAIGM
FT                   DKLACKRIWRGEGLPTPPWAVVATEIEAHRALDSLGLPVMVKPVAEGSSVGVAKVDQPD
FT                   QLAAAFREAARYGQVMMERYIRGGEYTVSLLGGRALPVIRLSTPHDFYDFDAKYLANDT
FT                   EYTIPSGLSAEEESAMQAIALKAFEQIGGSGWGRVDFMRDEHGQNWLIEVNTVPGMTDH
FT                   SLVPMAARAVGIEIEELCLGILAQTLPDESKSTEGSANGREHD"
FT   gene            478085..478900
FT                   /locus_tag="Hneap_0453"
FT   CDS_pept        478085..478900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0453"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: psa:PST_1085 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95310"
FT                   /db_xref="GOA:D0KXY7"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY7"
FT                   /inference="protein motif:PFAM:PF03799"
FT                   /protein_id="ACX95310.1"
FT                   /translation="MAAASRPVQARPKSPSLREQWDAFAQMAIRLLTVLFNWAITFALL
FT                   GMLGLAGWAFWQKLQVPVAHVVVQGATPEASADWVRRDLSAVIGQDIWQVDLNAVQAQL
FT                   LKNTWLTRADVRRVWPDTLVVQIAIHHPIARWQGDQLLDSDGSVFQPNGMSRGLANTEA
FT                   LPNLSGPDGRQWAVWERYLSLKPALAAEGLEMTGLIENSRGSLDVMVQGGTKIRLGTEQ
FT                   IESRLQRLLDVYQKTLVGKLDQIAVIDLRYTNGFAVQWRNPPAAPKKKK"
FT   gene            478931..480181
FT                   /locus_tag="Hneap_0454"
FT   CDS_pept        478931..480181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0454"
FT                   /product="cell division protein FtsA"
FT                   /note="TIGRFAM: cell division protein FtsA; PFAM: cell
FT                   division protein FtsA; KEGG: maq:Maqu_2448 cell division
FT                   protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95311"
FT                   /db_xref="GOA:D0KXY8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY8"
FT                   /inference="protein motif:TFAM:TIGR01174"
FT                   /protein_id="ACX95311.1"
FT                   /translation="MAIAVRKGERDLVVGLDVGTSKVAALVGEYDADGNLSLIGFGQSP
FT                   TNKGLRRGSVVDIESTSFAIQRAIDAAGAMSNCEIGSVWVGVAGDHVISMDSKGMTGTA
FT                   GREITAADIHQVVQSAKAVKIPDGQQILYSEPQEFRIDGQDGIRKPQGMTGHRLEADVH
FT                   IVTTATNNVQNIVKCVERCGLAVTGTVLDPIAAATAVLNDDEKELGVALIDIGGGTTDI
FT                   AIYTRGALRYTTVLPIAGEQITNDLAYGLTTPPAQAEEIKRKFASLHPLDDRAQDEEIE
FT                   VPGVSGRQPRRISRDTMMRICRPRVEEILGYIQEAIRRSGYHEMINAGVVLTGGTAAMP
FT                   GLVELCEDFLQMPTRLGLPQGISGNHDALKNPANATGVGLILHGRRLEAQGGIPAPVGV
FT                   QAEPPLDRLKRWFKEHF"
FT   gene            480248..481393
FT                   /locus_tag="Hneap_0455"
FT   CDS_pept        480248..481393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0455"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ, 2-layer sandwich domain;
FT                   KEGG: hch:HCH_05877 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95312"
FT                   /db_xref="GOA:D0KXY9"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXY9"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACX95312.1"
FT                   /translation="MTWNMVEVQHEGAKIKVIGVGGGGGNAVAHMLTKELEGIDYICAN
FT                   TDSQALRKSQAHSQLQIGSNITKGLGAGADPELGRQAALEDREQIQEAIKDANMLFITT
FT                   GMGGGTGTGAAPVIAQIAKDMNILTVAVVTRPFSFEGKKRTKTALEGIAELEKQVDSLI
FT                   VIPNDKLTAVMGKSASLKDAFASANEVLFTAVSGISELITRPGEINLDFADVRAIMTEK
FT                   GTAMMGTGIGHGDNRAAEAAEAAIHSPLLDDINLTGADGILVNVSSNGDLSIGEFMEIG
FT                   ELVQALAGDEALVKVGTAIDESLEGSLRVTLVATGLVRNTVIAEERKPRVVVHNESPRA
FT                   AVSEQESQSAPMRHAVAQVRGNTAINMDVIDIPSFLRQQAD"
FT   gene            481393..481563
FT                   /locus_tag="Hneap_0456"
FT   CDS_pept        481393..481563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95313"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95313.1"
FT                   /translation="MFRFVMGWAKAANVGRSTQRVRATPHWGTEANPSASFGFELMLKC
FT                   RNRSLDFQLGF"
FT   gene            481747..482256
FT                   /locus_tag="Hneap_0457"
FT   CDS_pept        481747..482256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95314"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ1"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0943"
FT                   /protein_id="ACX95314.1"
FT                   /translation="MMKMNVRLLTAMACVIALSGCAQVAHLTEGSQTDQEQKSAGVKPQ
FT                   EAAPAISSTAKDKPAAQGSHTEATEAESKRGIYGNPPRHSPFAKLKLGMSSKQVTDLIG
FT                   EPTDQKSYMTGKIWIPFYFGSDRARLEYRYKGQGVLTFVGGGGFVSSNFTLYRVIYNPK
FT                   EEGYEH"
FT   gene            complement(482560..483021)
FT                   /locus_tag="Hneap_0458"
FT   CDS_pept        complement(482560..483021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0458"
FT                   /product="RES domain protein"
FT                   /note="PFAM: RES domain protein; KEGG: yen:YE2116
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95315"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ2"
FT                   /inference="protein motif:PFAM:PF08808"
FT                   /protein_id="ACX95315.1"
FT                   /translation="MKVYRIIKTKYVNDAWLGKGAAIAGGRWNSKDVAMVYASDSLALA
FT                   QLEILVHLQDSPHLTDFSYFVVDIPESDLRRLEPQDLPNDWDSEPSGMETRHIGDEWVQ
FT                   SESSIGLIVPSATSPESYNVLLNPGMDRFKELVLDTQPTSFAFDKRLNR"
FT   gene            complement(483018..483515)
FT                   /locus_tag="Hneap_0459"
FT   CDS_pept        complement(483018..483515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   eca:ECA2804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95316"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ3"
FT                   /inference="protein motif:PFAM:PF09722"
FT                   /protein_id="ACX95316.1"
FT                   /translation="MSTTADITDNGPSKVERFRPSRTRQSGPTRVTDVVELYVPHAHGA
FT                   ELVRFIHQGLDLRIVKDASASINVPQTVFLHWSGIKPHNLKRRAKSGTLSAAEGESALR
FT                   VMRVYEAAVNLFEGDTDAAKSWLETPAPALGGTKPGDLLHSETGAVEVMDLITRIEYGV
FT                   YS"
FT   gene            complement(483774..484835)
FT                   /pseudo
FT                   /locus_tag="Hneap_0460"
FT                   /product="hypothetical protein"
FT   gene            complement(484996..485072)
FT                   /locus_tag="Hneap_R0011"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(484996..485072)
FT                   /locus_tag="Hneap_R0011"
FT                   /product="tRNA-Met"
FT   gene            complement(485265..487091)
FT                   /locus_tag="Hneap_0461"
FT   CDS_pept        complement(485265..487091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0461"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; sigma-70 non-essential domain protein;
FT                   sigma-70 1.1 domain protein; sigma-70 region 4 domain
FT                   protein; KEGG: tgr:Tgr7_3035 RNA polymerase, sigma 70
FT                   subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95317"
FT                   /db_xref="GOA:D0KXZ4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ4"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACX95317.1"
FT                   /translation="MYEDQQASIKSLIARGREQGYLTYAEISDHLPEALVDADQIEDII
FT                   GMIQEMGISVSEVAPDGDDLGLADESRAASDEDATEEAVAVLASQVDAEFGRTTDPVRM
FT                   YMREMGTVDLLNRQGEIEIAKRIEEGLIDVTRALAFYPPTIETLLEHYARIEAGDLRMQ
FT                   DVIVGIIEPEVEIPEDAEEKPLDVAEGKASNTDDEDEDEEDDTEEEAVVDNTLDPELVR
FT                   THLMEIKRLAENLDERSPEYLASLADQLVQLKLNPAFNEKLLEQIRQAIARIRLLEKQI
FT                   MHQAVDKGGLKRETFIEAFRSNESDIGWVKVATKGKPTAKFSQVQPEIERLQKRLNTVA
FT                   RDSKLTVAQTREVHRLITLGEAKARRAKKEMIEANLRLVISIAKKYTNRGLQFLDLIQE
FT                   GNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRI
FT                   SRQMLQEMGREATPEELAERMDLPEDKIRKVLKIAKEPISMETPIGEDDDSNLGDFIED
FT                   QSAISPMDSATNASLSEIVREILASLTPREAKVLMMRFGIGMNTDHTLEEVGKQFDVTR
FT                   ERIRQIEAKALRKLRHPSRSERLRSFIEMNID"
FT   gene            complement(487230..488909)
FT                   /locus_tag="Hneap_0462"
FT   CDS_pept        complement(487230..488909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0462"
FT                   /product="DNA primase"
FT                   /note="KEGG: avn:Avin_46990 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; DNA primase
FT                   catalytic core domain; TOPRIM domain protein; SMART: zinc
FT                   finger CHC2-family protein; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95318"
FT                   /db_xref="GOA:D0KXZ5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ5"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ACX95318.1"
FT                   /translation="MPDMSFIPESFIDDVLARTDLVELIHAQVPLKKKGKEYAACCPFH
FT                   QEKTPSFYVNPDKQFYHCFGCGAHGNAVSFLMDYEHRDFRGAIEELATRAGMTLPVSEV
FT                   DHKALEEQAAMLDSMSFANAHFKRQLRAHQEAIDYLKQRGVNGTTAALFDLGFAPNGNL
FT                   LLGHCESPPKMRDELLELGLIVQKDDGEQYDRFRRRIMFPIRDKRGQIIGFGGRILGPG
FT                   EPKYLNSPESRLFHKGQNLYGLYEARLDDARPARVIIVEGYMDVVMLAQHGVRNVVATM
FT                   GTATTDEQTQSLYRFSPSLVFCFDGDAAGRRAATKALHAALPHLTDGRDLRFLFLPDGE
FT                   DPDSFIQAKGKSAFIEQIEHHSLSFDNFILQLLDQMEPGQDTAAMAKKSKLGNDWIRTL
FT                   PDGALKRITQRRINEHTGVWRAAYKKNTGPTEPTLPRNKPQSYAKQTLILSIVLKHPDL
FT                   LQRVLEPQAWFNSRVPEGFQLLATQPRARWAQSASELWGAEETKTALAIEFQGIERAET
FT                   AQNILEDTLIQLHRSESDSASKQASRQALARFMAEQEKNPKS"
FT   gene            489265..490032
FT                   /locus_tag="Hneap_0463"
FT   CDS_pept        489265..490032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0463"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein; KEGG:
FT                   hiq:CGSHiGG_00130 Sel1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95319"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ6"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACX95319.1"
FT                   /translation="MQWAKWVKWGVVGTMLVTPLWAQASEKPTAKHSAVPIPEAKTEDL
FT                   YAGNSLNRWMPKAERGDIFAQYVLGHMYCVGQGVPKDMVKGLSWYQRAADQGFAPGQLA
FT                   LGTMYYNGEGVKQDYTVAAKWFRLAAERGYDRAQSNLAAMYMNGTGVPQDYTLAIKWFR
FT                   AAANQGYATAQYTLSRMYSDGTGMSKPDMVAAYGLLRPLVEKGNAAAVTAMKELLPKMN
FT                   PDQIKQGQELAERIRGKNRLNKALDAYEKIALR"
FT   gene            complement(490109..491554)
FT                   /locus_tag="Hneap_0464"
FT   CDS_pept        complement(490109..491554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0464"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: mes:Meso_3886
FT                   cardiolipin synthetase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95320"
FT                   /db_xref="GOA:D0KXZ7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ7"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACX95320.1"
FT                   /translation="MLELFDLQNAHWAALYVLVEWLVRLFALIVVPMRRPPVTATAWLL
FT                   LIFFQPLIGGIIYLFVGRPRVSSARQQKIDDLEKALAPNLNHLQKQQSLHHRTTLPDQW
FT                   RPIAQLARHWRIFPEFGGNAVAVIEQLPELVRQLVADIDNANHSVHLLFYIAARDDLTE
FT                   PVFTAMLRAVKRGVEVRLLVDDYGSKKFMAPLLALEAEGIRVARAFPRSKLPRQSARFD
FT                   LRNHRKLVVIDGLIGYAGSMNLIRPDFKPNIIYEDIMLRLRGPIALELQTIFAGDWYIE
FT                   RNAMLTGVQYFPTPEAAGDEICLGLPSGPEYPDPVQQQLLLSLIHVSTESIRLVTPYFV
FT                   PDDAMLLALKTAAQRGVEVELILSERLDQRLVQWAQESYYAELLDEGIIIRRYPRYFLH
FT                   TKFALFDDRISLIGSANLDVRSSLINAELGLLFYAPQTAQTLNRLLARYRDSARILSIE
FT                   AWALRSRREVIIQNLARLTTPLL"
FT   gene            complement(491554..492414)
FT                   /locus_tag="Hneap_0465"
FT   CDS_pept        complement(491554..492414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0465"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tgr:Tgr7_1140 short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95321"
FT                   /db_xref="GOA:D0KXZ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX95321.1"
FT                   /translation="MPNTARIPRSILITGCSSGIGQCVARGLADRGHRVVASVRQKKDL
FT                   DTWPHADIPVVLLDLTDDQSIESGLNAALAHTDGSFDALFNNGAFGLPGAVEDLSREAL
FT                   RAQFETNLFGWQVLTNRVIPLMRAQGFGRIIQNSSVLGIAALPFRGAYVASKFALEGLS
FT                   DTLRMELNGTGIDVSLIEPGPIASRFRANAQAVFLRYIPIESSIHADAYRKQLERLNKP
FT                   GPAAPFTLPPEAVLDRVIHALESRRPKARYPVTVPTYLFSVLRRLLPSRWMDRVLLAAS
FT                   GGGRR"
FT   gene            492545..493210
FT                   /locus_tag="Hneap_0466"
FT   CDS_pept        492545..493210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0466"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   net:Neut_1715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95322"
FT                   /db_xref="GOA:D0KXZ9"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:D0KXZ9"
FT                   /inference="protein motif:PFAM:PF01027"
FT                   /protein_id="ACX95322.1"
FT                   /translation="MSLQNSTVSPRRESLLATNQLIRNTYLMLSMTLVFSAVMAGVSMW
FT                   MNLPPMISLIAMFGSMALIWFVLPRTARSGAGLVTVFAITGLMGLGLGPTINYYLHLEG
FT                   GDQIVMTALGGTGAIFLALSAYALISRRDFSFMGGFLMVGMIVVLLAMLGNLFFHLPAL
FT                   SMALSGAVILLMSGFILFDTSRMVNSGEDNYLMMTVSLYLSIFNIFVSLLNILGASRD"
FT   gene            493301..493495
FT                   /locus_tag="Hneap_0467"
FT   CDS_pept        493301..493495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95323"
FT                   /db_xref="GOA:D0KY00"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95323.1"
FT                   /translation="MDWIKILSAVFIVAMLVFLWPRAGQMIRESRKGTINEWLWVGLLL
FT                   LAVAAFVVFLMQSMHSTVV"
FT   gene            493567..494154
FT                   /locus_tag="Hneap_0468"
FT   CDS_pept        493567..494154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0468"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: dal:Dalk_3566 CBS domain
FT                   containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95324"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY01"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACX95324.1"
FT                   /translation="MTERTPNRLPDEDIQAAMRAMSGYIDITTDDFREIFELAHEHAIR
FT                   RLFCCMDVPHLMRRDFSALKPDQTLTEAAEQMALMHAHTLPVVDENGLVLGDVSEWNFL
FT                   QGYGADTFFSLIFRLMAHDQRFIDYCERTLVREIMTQPAVTLPEQGTFADIARAFHQVE
FT                   EKRLPVVDAQNHLVGVVMRRDFLERFHWEEWL"
FT   gene            494151..494774
FT                   /locus_tag="Hneap_0469"
FT   CDS_pept        494151..494774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0469"
FT                   /product="HPP family protein"
FT                   /note="PFAM: HPP family protein; KEGG: dat:HRM2_48550
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95325"
FT                   /db_xref="GOA:D0KY02"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY02"
FT                   /inference="protein motif:PFAM:PF04982"
FT                   /protein_id="ACX95325.1"
FT                   /translation="MSRETDETAQPVGWVKFWRKWRGRGHGSPPRVSWAEVFWSGLGGV
FT                   LGLMAVGVCALAFTGLDRILIIGSIGASAVLLFGAIRSPLAQPRNLIGGHALSALIGVS
FT                   LHLLLVRETGDPGILSGIQPFIASVLTPALAVGLSIAVMHATRTLHPPGGATALVAVIG
FT                   SQQIHAMGYWFVLFPGILAPLILLFIALVFNNLVPKRVYPEFWW"
FT   gene            494874..496880
FT                   /locus_tag="Hneap_0470"
FT   CDS_pept        494874..496880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0470"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: tgr:Tgr7_0851 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95326"
FT                   /db_xref="GOA:D0KY03"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY03"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX95326.1"
FT                   /translation="MNRWISRFSIAQKNLFSYGLILVLMCSMAILTYFNMNRIQGMTKE
FT                   VIAQRQPAAFAADGIRVQLERAMASVGLYLQSKSPADKKRFDEAISGISQEQAALKQHS
FT                   DESLDGLDAGLKTFVTDANEVMKISADDKLNMPGMDYANQNVNPLSIQISGLMGTLISA
FT                   EADADAGVLPRRALVLELARLRGEWGDVLAGLRGFMAFRSPALEKNFNLYTAEVLKRTQ
FT                   EINTNYGNLLTFEQQDAVDQLLKLLPQFIDQAGKAFAIHKSDKWRMDAYLVRTKLTPAF
FT                   ADVESSVNEIVKHEQSLIHGQSKVMDQTISNIAFGQVGLVLLGILVIVASALLSMVTIS
FT                   SPLRLVAERMRDIAEGDGDLTRRLPVNGKDEIADVSRAFNTFAETAHKLVSQVVMTTRS
FT                   LSDSADRLNDSSARAQQGAARQARDTEALVTGMSQTLEAAEDVARSAETASASVQEAND
FT                   KLSEGLAKVDVSTHSAEQLDSVLLRAEQKIHELSNQSQTIGKVLDVIRAIADQTNLLAL
FT                   NAAIEAARAGEHGRGFAVVAEEVRSLATRTQESTREISGIISQLQSGAQEAVSAMGEGR
FT                   EVSHESLDAITQANQMLINIAQAFGHLSDMSVRIAAAAEEQTAVASGMKQNIESINSTA
FT                   ADAAKQGEEISSSGTDVSQQARTLAELVRQFKI"
FT   gene            496904..497485
FT                   /locus_tag="Hneap_0471"
FT   CDS_pept        496904..497485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afr:AFE_0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95327"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY04"
FT                   /inference="similar to AA sequence:KEGG:AFE_0518"
FT                   /protein_id="ACX95327.1"
FT                   /translation="MSAKPPLIDEVRACRICQDNLPFPPRPILQFSPSARLLIAGQAPG
FT                   KKAHQSGVPFDDASGDRLRGWLGLSRAQFYDEQTVALLPMGFCFPGTGTSGDLPPRPEC
FT                   APAWRSALLDALTHLEFTIVIGRYAQAYHFGTRRQSLTEQVQAWREHWPEKVLLPHPSP
FT                   RNQLWLKRNPWFERDLVPVLQARVADVIGP"
FT   gene            complement(497689..497790)
FT                   /pseudo
FT                   /locus_tag="Hneap_0472"
FT                   /product="hypothetical protein"
FT   gene            497833..498273
FT                   /locus_tag="Hneap_0473"
FT   CDS_pept        497833..498273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_7190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95328"
FT                   /db_xref="GOA:D0KY05"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY05"
FT                   /inference="similar to AA sequence:KEGG:BBta_7190"
FT                   /protein_id="ACX95328.1"
FT                   /translation="MRLLAWVLGLGGVIPFAGLAMAAWWGPLDWHSTVIRVLSVYAAVI
FT                   VSFLGGVHWGAALNQSVAARRHLLWGVSLSLLAWVAALLPWGIMRLSVFILLLLTALRV
FT                   DRVWFGGIGASLNFGVLRTVLTALASLSLLLAIGSYARAGLI"
FT   gene            498270..498947
FT                   /locus_tag="Hneap_0474"
FT   CDS_pept        498270..498947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0474"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   tgr:Tgr7_1143 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95329"
FT                   /db_xref="GOA:D0KY06"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY06"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ACX95329.1"
FT                   /translation="MSEVGSKVSTLRKWLVAGILVWAPLAITYWVINAVIGFMDKTILL
FT                   LPPSYRPEAVFGFNIPGVGAVLAIIVVLLTGALVANFLGRKLIAMGESVLERIPLVRSV
FT                   YSAVKQVIETFVSQDSRSFRKVVMVEYPRKNCWSLAFLAGDPVGEVQDKTAQKVITVFV
FT                   PTAPNPTSGFVIMVPEDEIIALDMSVEEGFRMVISLGVVTPKSQAAKPVLAVPELEKPP
FT                   SSG"
FT   gene            498985..500775
FT                   /locus_tag="Hneap_0475"
FT   CDS_pept        498985..500775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0475"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); GAD domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; KEGG:
FT                   aeh:Mlg_2665 aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95330"
FT                   /db_xref="GOA:D0KY07"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY07"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ACX95330.1"
FT                   /translation="MSMRSHTAGQVDLAVLDQEVTLVGWVNRRRDHGGVIFVDLRDRDG
FT                   MVQIVFDPDDLDVFAKAESLRSEFVIRVRGKVRRRPAGTENPNIVSGQIEVLGLGLEIL
FT                   NRSEPLPFQLDDERVSEEHRLRYRYLDLRRPEMLARLKLRHQVTRALREHLDNAGFMDV
FT                   ETPVLTRATPEGARDYLVPSRTHPGEFFALPQSPQIFKQLLMVAGIERYYQIVKCFRDE
FT                   DLRADRQPEFTQLDIETSFLDEEEVMALIEDMMRHLFAQTIELALPNPLPRLTWAEAMR
FT                   RFGSDKPDLRIPLELVDVGDLLVAVDFKVFSGPANDPRGRIAALRVPNGNSLPRSAIDD
FT                   YTKFVSIYGAKGLAYIKVNDAAAGREGLQSPILKFLTDDAIDGIMTRTGAQTGDVVFFG
FT                   ADKAKIVNESLGALRVRIGQDMGLVEQGFRALWVTEFPMFEYDEKEGRYYALHHPFTAP
FT                   NLDDLHLLETDPEAVRSRAYDFVLNGFELGGGSVRIHDQTMQKRVFELLGISAEQASEK
FT                   FGFLLDALKFGAPPMAGLAFGVDRIVMLMSGATSIREVIAFPKTQSAACLLTNAPGEVD
FT                   EAQLRELSIRVRKPVVEKAE"
FT   gene            500852..501937
FT                   /locus_tag="Hneap_0476"
FT   CDS_pept        500852..501937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0476"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: sfr:Sfri_1938
FT                   quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95331"
FT                   /db_xref="GOA:D0KY08"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY08"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ACX95331.1"
FT                   /translation="MSTTRDAATQIPAVLAARIQALASHSVPAPKLSHVQEHELIERIK
FT                   AELVRQNAVMVVHYYVDAALQKLADETGGRVSDSLDMAAFGAAHSAETLVVCGVRFMGE
FT                   TAKILSPEKRVLMPTLNAECSLDLGCPADEFTAFCDAHPDRTVVVYANTSAAVKARADW
FT                   VVTSSNALQIVGHLKEQGEKIIWAPDRHLGRYIQEKTGADMLLWQADCVVHNEFAGEAL
FT                   IDLKRQHPDAAVLVHPESPKAVVDLADVVGSTSQLIRAAHDLPQSEMIVATDNGIFYKM
FT                   QQAVPSKTLIEAPTGDGSHCVSCAHCPWMAMNGLQAVYDALVSPDGHEIFVPEAVRVNA
FT                   VKSLDRMLAFSKAQGLVTARK"
FT   gene            502064..503914
FT                   /locus_tag="Hneap_0477"
FT   CDS_pept        502064..503914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0477"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   pap:PSPA7_1380 putative sodium/hydrogen antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95332"
FT                   /db_xref="GOA:D0KY09"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY09"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACX95332.1"
FT                   /translation="MDQTILITLTGIIVTGIGAQWLAWRLKVPAILFLLGIGLFLGPVT
FT                   GLLNPNALLGDLLFPFVSLAVAVILFEGALTLQFKELKGVGSAVWLLVTLGAFVTWVIA
FT                   SYAAHYFVGLEPLMAALFGAIVIVTGPTVIVPLLRIVRPNNKVSTILRWEGIIIDPIGA
FT                   VVAVLVFEYILMSATPAHANANLTAVIIPFLELIGVGMVLGLVGGYLLGLILRRHLLPE
FT                   YLVNVVVLATVLAVFTTSNLMADESGLIAVTVMGVLLANMRAVPLAEILHFKESLTILF
FT                   ISGLFILLAARIEPAMFSAIGFSALLVLFTVQFIAQPVKVWLSTIGAGLSWREKLMISW
FT                   IGPRGIVAAAISGLFALKLNQQGIAGSDVLVPLTFIIIFGTVVTASLTARPLANYLGVA
FT                   QPEDKGVLMVGINVFSCMLAHALKKHGYRVILTDSNFADIRTARMEGLETFYGNAVSQA
FT                   AERRLDLVGIGRLFAVSGVPEMNNLAAIRYRHEFGAENVYVLQTPQEKSGSDQQRLSHV
FT                   FTGRKLFGTGVSLGDLMLLIEQKAEIKSTRLTEEFNWEKYQQTYDKRGILLLMISPKGI
FT                   LHVQSDGPMPTPSEGWIIIGLYRAQTEVEAKPDAVEASAA"
FT   gene            503998..504073
FT                   /locus_tag="Hneap_R0012"
FT                   /note="tRNA-Gly2"
FT   tRNA            503998..504073
FT                   /locus_tag="Hneap_R0012"
FT                   /product="tRNA-Gly"
FT   gene            504075..504150
FT                   /locus_tag="Hneap_R0013"
FT                   /note="tRNA-Val1"
FT   tRNA            504075..504150
FT                   /locus_tag="Hneap_R0013"
FT                   /product="tRNA-Val"
FT   gene            504161..504237
FT                   /locus_tag="Hneap_R0014"
FT                   /note="tRNA-Asp1"
FT   tRNA            504161..504237
FT                   /locus_tag="Hneap_R0014"
FT                   /product="tRNA-Asp"
FT   gene            504434..505717
FT                   /locus_tag="Hneap_0478"
FT   CDS_pept        504434..505717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0478"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: tbd:Tbd_0943
FT                   putative integrase prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95333"
FT                   /db_xref="GOA:D0KY10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY10"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACX95333.1"
FT                   /translation="MALTDTAIKALKPESKPYKVTDEKGLYLFVTPAGGKLWRLDYRFE
FT                   GKRKTLALGGYPDVNLKQARVYRDEARQLIANGTDPAELRKAEKTTITESRREEAEAVK
FT                   IEAMIQAGEALPGSFEEIGDEWVNMYLADKSEKYRNKVINRLKAEVYPYLGRAPVADVT
FT                   APMVLKVLQRIEARGIIESAHRVKQNIGQILRYAIATGRRELFDVTMALNKAIAPMPKD
FT                   KNHAAPTEPKDIAPLLRIMAGYRGSPITRAALTIAPCVFVRIGELRHMQWADIDFETFE
FT                   WRYTASKTGQEHIVPLARQVVAALIELQPLTGHSRYVFTGARSDTRPMSENTVNGALKR
FT                   LGIDTQTELTGHGFRAMARTVLEEVHNFRPEVIELQLAHAVRDPLGRAYNRTKHLETRR
FT                   KMMQVWADYLDELRDSKNVIQGNFGMVG"
FT   gene            505838..506875
FT                   /locus_tag="Hneap_0479"
FT   CDS_pept        505838..506875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0479"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3243 IS5 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95334"
FT                   /db_xref="GOA:D0KY11"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY11"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACX95334.1"
FT                   /translation="MKKRSAIKTDLFADTHHRDKLDTLGDPLAEIEACIDFAALAAEVD
FT                   RIAPRPVSVQGGRPPYPTETMVRILVLKRLYNLSDEQMEYQLLDRMSYKRFCGLSQATN
FT                   IPDRTTVWTFENRIGEVGAQVIFDGVTTQLLKKGFIARGGQIIDATLVPAPKQSFSKED
FT                   KEQLKADAMPADWQPGKRRQKDLDATWTKKHGKSQHGYKLSVNVDKKHKFIRKIVTDTA
FT                   STHDSQHFDAVIDPANTSRDVYADRGYPSEEREQWLKANGYRNRIQRKGKRNKPLSEAQ
FT                   QGRNHRIAKTRARVEHVFGAIEQMGGKLLRTIGQARANFAMTMMAACYNLKRLAYFQRV
FT                   GITAF"
FT   gene            507500..507904
FT                   /locus_tag="Hneap_0480"
FT   CDS_pept        507500..507904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpe:KPK_4430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95335"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95335.1"
FT                   /translation="MMTIDQTKTSRRPRRGHVLAESDRRRHKVMTRVNDAELAEIDARR
FT                   GLYDRGEFLRMSLFGMKQARPRPTIIIPALNQTAWLVLSRSASNLNQLSRHLNEAGLQV
FT                   ADLPQIIIMLTQYRDALIGARLPEDQDDES"
FT   gene            507894..510317
FT                   /locus_tag="Hneap_0481"
FT   CDS_pept        507894..510317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0481"
FT                   /product="Relaxase/mobilization nuclease family protein"
FT                   /note="PFAM: Relaxase/mobilization nuclease family protein;
FT                   KEGG: lhk:LHK_00918 relaxase/mobilization nuclease
FT                   topoisomerase/primase fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95336"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY13"
FT                   /inference="protein motif:PFAM:PF03432"
FT                   /protein_id="ACX95336.1"
FT                   /translation="MKAKVTRGTGFRGVLDYALDTGNQKGKNPEIVGGTLTSGSARAMS
FT                   DQFAVTRRLRPDIKSPVWHASLALPEGERLSSERWSSIADDFMQEMGFPSESLYTVIRH
FT                   NDTKHDHIHIIASRVSLSGGLWHGQWEVYRAIRATQVLERIHGLTLTPGLGEPKDEKTL
FT                   TKGEIEQALRTGAEAPRQRLQRLVKEAAQGKPTAVMFAERLELAGVGVRFQIQKTGITG
FT                   VNYELDGLAFKGQSLGDSYKWSKFSKKYGVSYEQARDSESLERYTTAIADRTGRDELGN
FT                   AGRSLEVDAGFVTPSSSRADSRSTGAVGEAEGGGHSSSDRLRQSDRSTAPDTGGIDSAD
FT                   EYQRSGSIRAEGREAGQNNLRPVTESVGAEIEHRHDGEDRTEHRDDPGSTQEISASHDN
FT                   HGERTERGGEIDTTEDLASDTGTDLSQRNRWDSGAHWASRFKQASAAKRRATGGGLGKR
FT                   AIKQSDARRTRVTEQDRQSARELDPTAYLGANGYDVKHEGRHRSVRLHGDEVYRVTQRQ
FT                   DGHWVWCDLYGNNGGDNIDLVREIEPGTGFAEAVFRLAGAPTVGPKRRPPAEPKRPPPR
FT                   LPKQEVASRALGRDYLINDRGISMDTIEHAEQCGMLRYANGGVLFVGYDQASTPQNITR
FT                   RAIESADPMQKRDLRGSDKRYPPILPGDPSTVWIVEGGSDALALHDIAKRQGRPQPTVI
FT                   VSGGANVRSFLEQVEVQAILKQAERVTIAGENERDEATQKRTDEAHQKQVQRVKEITGR
FT                   AVKSWTPKQYLGKDLAEMNYRQQPELMPVQLINLDQRAETKPSQVIEGDLILGQ"
FT   gene            complement(510414..510584)
FT                   /locus_tag="Hneap_0482"
FT   CDS_pept        complement(510414..510584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0482"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   she:Shewmr4_2784 phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95337"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY14"
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /protein_id="ACX95337.1"
FT                   /translation="MDSILRLHDVLRITGASRSSIYLWVSAGIFPQPVKLGVRAVGWRR
FT                   SEVQQWLDDRR"
FT   gene            complement(511145..511303)
FT                   /locus_tag="Hneap_0483"
FT   CDS_pept        complement(511145..511303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95338"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95338.1"
FT                   /translation="MGKGIDSNARKNFSYNNKTGNLKVRETRRLFSATLYLESKKTRIP
FT                   MQGCGFD"
FT   gene            511384..512184
FT                   /locus_tag="Hneap_0484"
FT   CDS_pept        511384..512184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0484"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   NAD-dependent epimerase/dehydratase; KEGG: cli:Clim_2370
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95339"
FT                   /db_xref="GOA:D0KY16"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY16"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACX95339.1"
FT                   /translation="MSQQNTSTQGVSEDSSRFSRVAIVTGATSGIGEATVRKFVQSGYG
FT                   VIGNARSADKLEALAVELGDAFFGVAGDAGDASVIDQLLDAAQAYFARPADIVVVNAGR
FT                   GLGGLMTEVDLAEYEQVLKLNVLGAALLMQKAAQALVEKQAADFPRQAADIVVIGSVVG
FT                   RNISPFSAVYGSTKFAVQSLAEGLRREVGKKGVRVTVIEPGIVVSGFQDAAGYDDHLVD
FT                   KFNTDFGPLLYGADIANAIDFVVAQPSHIHINELMIRPTRQDYP"
FT   gene            512390..515425
FT                   /locus_tag="Hneap_0485"
FT   CDS_pept        512390..515425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0485"
FT                   /product="diguanylate cyclase with PAS/PAC and GAF sensors"
FT                   /note="KEGG: gdj:Gdia_2586 diguanylate
FT                   cyclase/phosphodiesterase with GAF sensor; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; PAS fold domain
FT                   protein; SMART: GGDEF domain containing protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95340"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY17"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX95340.1"
FT                   /translation="MTSPADTFLDLSTSVLRDLVAGQSPKDLAARICLRIEQMRPGRIA
FT                   SVMWAGDGDERLHVFAAPSAPQGLIDQLDGLTPGAHAGSCGSAAHSGVPALVSDIETDS
FT                   RWDDLRPLAQQWHLRSCWSLPLFHNDRLLGTFALSGMVSDVPTDDDILLLQFAATLVSA
FT                   LLHHEYQMMQRQRLTDQKSRLIDFNHMLAKVNQKIVSVESERELLQPLCDLAVRYAHLK
FT                   LVLLARPDETLRFRFLAASGATGYTDGLYISADPDLPEGQGTMGRTWRSEQAYFNTSFE
FT                   HSEFLQPWQSRARQFGLKATATLPVLRGGKMFAVLAVYHAEPDVFDGPLQDVLRELALS
FT                   ISRGLDRLDARKLQNALFNNAFVGVFLVQGRVIKSCNPQAAHMFGYSLDDMVGMPVRDF
FT                   FASDIEYARLDKAFSKMSKSQVVQRQSMVCVRRDRKLLQCDVSGRMFIDNEGEHSVWTV
FT                   LDATERETQAQRLHRIAGFRELLSELNQFSADPANMQQVKDHDLYDFVCQVLSQNNALK
FT                   LVWIGSPLPGGGGFDVLASSGELNWHSDCLPMQSEQPLSSGKLMREHTAQRCWHENQTI
FT                   LLTYEIPSTDGRGGQSVARSTVSLPIHIDGTLTAVLTICGHSEDILDQDAISFFDNLVL
FT                   NIERGLQNIRQRNQIMRLQGLYRALMQQADVVLRAQTVPDMLFGTCEKLVQETPFNAIY
FT                   LRKPNADGVMDVLASTGSGAAALQNVISVVAEDARDQLIVRAWLTQKTAIENDLLGNAR
FT                   LAEYHPFLRAHRWHSALVTPVRRGGELWSVMGFVCEDHDVFDPQTVELCERVAELLGRG
FT                   LDELDNKQRLVSLQSEEAYRARHDRLTDLPNRFALEQYLPQALARSKKNGRMLALGMMD
FT                   LDDFKPVNDQFGHETGDRLLRELAGRLRARLRAQDFLVRLGGDEFVVVIGDIDPDHAIA
FT                   HLQLALSRLHEAVEEGFEEGFEVAPDRFATVGLSGGFALYPKDGEDGDTLLRKADATMY
FT                   QSKTRKNTRAQWWQLFDQEGIV"
FT   gene            515917..516708
FT                   /locus_tag="Hneap_0486"
FT   CDS_pept        515917..516708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0486"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: msm:MSMEG_6369
FT                   O-antigen export system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95341"
FT                   /db_xref="GOA:D0KY18"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY18"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACX95341.1"
FT                   /translation="MNSRSGDTRSDIVRALANMPAALFLSWSDTKARYKRSMLGPFWLT
FT                   LGTAIGVGGLGFVWSTLFKMDKAQFIPLLTVGLILWGFIAGIITESSQVFVQNAQLIRN
FT                   VQLPMFFHPLKLILRHLINLAHNAVVIVIVFLIYPPEWHWSAWLALPAFLLTVLNLSWM
FT                   SLFVGMFAARYRDTETAITNFMPLLFFMSPVLFKAEQLGVGSWIVWLNPFSYFISTVRD
FT                   PLLGHPSPWFVWPVLLGMTVIGWLVTLWLFHTRRTRIPYWI"
FT   gene            516712..517440
FT                   /locus_tag="Hneap_0487"
FT   CDS_pept        516712..517440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0487"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vap:Vapar_0764 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95342"
FT                   /db_xref="GOA:D0KY19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY19"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX95342.1"
FT                   /translation="MAHLIFEHVSIRYPIYNARAQSLRHQFMRIATGGKIAAEAGQTVA
FT                   VTALDDVSFELKSGDSIGLIGHNGAGKSTLLRTMAGIYTPDSGRVIREGRTATVLEIGS
FT                   GMDPELSGYENILRMGMLMGIPLKEMRTKIPDIEEFTELGDFLSLPVRTYSSGMTMRLM
FT                   FAVATSGQPEILLVDEMFGTGDAGFQEKAKARMRDLIANAEIFVFASHDHKLLGELCDR
FT                   VFELSHGKVIVATDFNKKEN"
FT   gene            517445..518881
FT                   /locus_tag="Hneap_0488"
FT   CDS_pept        517445..518881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0488"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.13"
FT                   /note="KEGG: ppw:PputW619_1383 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95343"
FT                   /db_xref="GOA:D0KY20"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY20"
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /protein_id="ACX95343.1"
FT                   /translation="MIYPFILSGGAGTRLWPASRKAFPKPFMPLVDGQTLFDKTIERIK
FT                   QLPSAGPLTVITNESLRFLTADALRGSVAKQPRLLLEPTGKNTAAAIALAALDLQIRAG
FT                   SDALMLILPADHLIAEVGAFSEAVQVAENVANQDWLVTFGITPQSPETGFGYIERDAQP
FT                   LALEEGVAYRVRKFVEKPDRETAQAYIDSGRYSWNGGMFCFKVSTILAEFERHAPELLA
FT                   ACQVAVEHANQIHVAGMDMVEFKADDFERMADISIDYAIMERSERVAVVAADMGWSDIG
FT                   SWTAFADASPSNAEGNVFDGEVIAINTNNCLVRSPHRLVATVGVENLIVVDTPDALLIA
FT                   HKDHAQDVRDVVAELKARGHESHLLHQTVHRPWGTYTVLEEGERFKMKRIEVKPGATLS
FT                   LQMHHHRSEHWIVVNGMARVTNGDKVFLLNTNESTFIPAGHMHRLENPGVINLVMIEVQ
FT                   SGDYLGEDDIVRAQDNYGRS"
FT   gene            518883..520364
FT                   /locus_tag="Hneap_0489"
FT   CDS_pept        518883..520364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0489"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: ppu:PP_1777 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95344"
FT                   /db_xref="GOA:D0KY21"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY21"
FT                   /inference="protein motif:PRIAM:5.4.2.8"
FT                   /protein_id="ACX95344.1"
FT                   /translation="MDLTCFKAYDIRGQVPAQLDAELAYRIGRAFVDEINPGTVVVGYD
FT                   VRLESPMLAEALMRGITEAGADVIDIGLCGTEEVYFQTFHREAQGVGGGIMVTASHNPK
FT                   GYNGMKLVREGARPVSGDTGLFAIRDSIANPPSSLAGEGGLRQLRVGGDEWRHDARADS
FT                   TPSPLVGEGWGEGENTPKPHGKITTDTNKAAYIQHLLGYIDHRALKPLKIVADPGNGGA
FT                   GPVMRLLEKHLPFDIHYIHEQPDGNFPNGVPNPLLPEMRDATSQAVIEQGADLGIAWDG
FT                   DFDRCFLFDAKGRFIEGYYLVGLLAETLLAKHPGGKIIHDPRLTWNTIEQVEQAGGIPI
FT                   QSKTGHAFIKQIMREQDAIYGGEMSAHHYFRDFGYCDSGMIPWLLITELMSKTGKTLAE
FT                   LVDERMAAYPCSGEINYRIDDVQGTIDRVLAHFSPMNPKIDRTDGVSVEFDDWRFNLRG
FT                   SNTEPLLRLNVETRSDSLLLERQISVVENLIGKDF"
FT   gene            520364..521584
FT                   /locus_tag="Hneap_0490"
FT   CDS_pept        520364..521584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: net:Neut_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95345.1"
FT                   /translation="MQESQEPIFIHSLFRSGSTWIFDRFRRAGTNYWCYQEPFNEILSQ
FT                   LKDSPETVLEIHESTSSVLRHTKLDKPYFYEFHAIREHIGDSFQKCISYDSFFDTTICS
FT                   QFDEYTDILICHAKGRPVLQCCRSFGRLPHLKRKFGGVHIYLWRNPWDQWWSYQVNGYF
FT                   DTVNLAIINAINPPPIIALLRSELCLEEVRNSRFDQEFQCFQQVALDAKSRYLIFYVLW
FT                   FYSLIENKQLSDFDINIDRLSVDPDYLQSISDVLLGFGIHGVDLSDCHIPMAVYTEEDR
FT                   AFFEPIEDLAHQLFARVYDSGTLSQALHWQHEYRPKGIVEEGKLIRDASKARMVALRFA
FT                   DTASQVNKRANHQEAGAVYNLTSCREALLRAEQVSSFAVDCNDELYRVYQSNSWKITKP
FT                   LRWINRK"
FT   gene            521678..524281
FT                   /locus_tag="Hneap_0491"
FT   CDS_pept        521678..524281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0491"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mmr:Mmar10_2484 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95346"
FT                   /db_xref="GOA:D0KY23"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY23"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX95346.1"
FT                   /translation="MTTTAIFTVVSNNYLHFARTLLKSVAEQHPEAKRYCVIVDRDLSH
FT                   AHELSDEFETIPMSAINLPDGDSFFYQYTVLELNTAVKPWAMQHLLKAGHDEVIYIDPD
FT                   IRLYRPLNEVTGLLRSGSDIVLTPHLLEPIQDDFRPTELDIRRAGTYNLGFCAVRNSGN
FT                   THRMLEWWQGKLHHDCVVDVDKGIFVDQSWMDLVPGMFDNVAILRHQGYNVAYWNVGER
FT                   ILSGEGDSISANGDPLVFFHFSGLNPENTHSVSKHQNRFTFKNLNTVARFLFENYAKDV
FT                   IANGIGHYKGLPYGFACYDDGTAIEGRERARFRKDPELQAECDGKPFAHPELLSFELLP
FT                   ELNAAGMMGIVDPAYEHRVQTLYESLLGRAADPAGVAYFGPRMGSKFGMARSVLAVGIS
FT                   SEARRMPGWPARLLRFANEVQYTPRRVRTLATEPLSRLFDKLGRHWSFFAYRPPHAVSQ
FT                   RRAKGAASQRNDDDDSGPVVSRRVTDQPLFTIRKLPCPTGMNLVGYVKAESGVGEAVRS
FT                   LARACEASSINFSLFDVGYQNSNRQSDSSVENKAASRHFKIDMLYVNADQTAATARHLK
FT                   SARRERADYTIGFWHWEQPELPIRYMSAFAHVDEVWAPTSFVQDALASVSPVPVYKVPH
FT                   SLQLQVSAGVRRSDFGLPDDRQLALVMYDFHSYQYRKNPQAAVEAFRIAAKQNPNLGLV
FT                   LKTINSEHHKEAYAELKESVADLPHVYFIDEFFSRQKTWDLQSCCDILLSLHRAEGFGL
FT                   APAEMMYLGKPVIATGWSGNMDFMTHENSMPVKYELKPLDVDLGAYPAGPLWAEADVEH
FT                   AAWCLSQLVTQPDLMEQMGRRAAKDIQAQLSPTAVGELVRHRLQVLGHWYPNLLD"
FT   gene            524409..525443
FT                   /locus_tag="Hneap_0492"
FT   CDS_pept        524409..525443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0492"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: rpi:Rpic_1158
FT                   GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95347"
FT                   /db_xref="GOA:D0KY24"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY24"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ACX95347.1"
FT                   /translation="MKTVIITGITGQDGAYLAQLLLEKGNVVYGTYRRTSSVNFWRIEE
FT                   LGIDKHPNLHLVEFDLTDMSSAIRLLQTTEATEVYNLAAQSFVGVSFDQPVTTAEITGI
FT                   GPLNLLEAIRIVNPKIRFYQASTSEMFGKVQAIPQIESTPFYPRSPYGVAKLYAHWMTI
FT                   NYRESYGIFGSSGILFNHESPLRGREFVTRKITDNIAKIKLGKQNVLELGNLDAKRDWG
FT                   YAKDYVEGMWRMLQADKPDTYVLATNRTETVRDFVTMACKAADISIVWEGKNEQERGID
FT                   SATGKTIVAINPKFYRPAEVELLIGNPEKAKRELGWEPKTTLEELCRMMVEADLRRNEI
FT                   GFSF"
FT   gene            525494..526405
FT                   /locus_tag="Hneap_0493"
FT   CDS_pept        525494..526405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0493"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: dda:Dd703_3276 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95348"
FT                   /db_xref="GOA:D0KY25"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY25"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACX95348.1"
FT                   /translation="MNNALVTGASGFTGRYMVSALKTRGYRVVGLGNPDCGADSCIPVD
FT                   LTDAEAVRIAIHQVQPTHVVHLAGIAFVGHGKPDDFYQVNLFGTLNLLSALVELPQPPR
FT                   VLIASSANIYGTPNIEVIDESVCPAPVNHYATSKLAMEHMVHTYFDRCSIVIARPFNYT
FT                   GVGQTEQFLIPKIVGHFKRKAPVIELGNLDVSRDFSDVRDTVDAYVALLESDAHSLAVN
FT                   VCSSRAIALRTVLSEVGRLAGYEIEVRVNPAFVRANEIPVLRGSRARLESLVGHSVPRP
FT                   LEVTLQWMFIESSDSPGSGSAL"
FT   gene            526402..527598
FT                   /locus_tag="Hneap_0494"
FT   CDS_pept        526402..527598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0494"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pol:Bpro_4015 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95349"
FT                   /db_xref="GOA:D0KY26"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY26"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX95349.1"
FT                   /translation="MKILLNLHPLARAGAGIAVYTQRLLMELVHFRDLDEVAGFLGTRV
FT                   LSGDELRLWLSGFDNQTEKRVKEGVKSSPLMIDAVRRAARSIPGMYELRYQLRNIASQF
FT                   ALNKFAQAGFIYHEPNYIPTRYSGKQVIAVHDLSHIRYPDFHPAERVAFLNRHLKRAIG
FT                   LADFVLTDSVFVKDEILDVFPVSGEKIVVTHLGVDEAFHPRPEVETLNTLRQFNLSYRG
FT                   FVLSVGTLEPRKNLERLLNAYGALPEGVRRDYPLVLAGGGGWNDSDLQRQIQQMERRGE
FT                   VIRTGYLPRSQLLDLYASAAVFAYPSIYEGFGLPVLEGFASGTPVLTSNVTSMPEVSGG
FT                   AALEVNPLSVDEIRHGLFSLLDDSSLRSRYMQLGLERVQAFTWAKCAEQTMAVYKQLG"
FT   gene            527608..528759
FT                   /locus_tag="Hneap_0495"
FT   CDS_pept        527608..528759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0495"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pol:Bpro_4016 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95350"
FT                   /db_xref="GOA:D0KY27"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY27"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACX95350.1"
FT                   /translation="MTIRVLHFGKFAFERAGGIERHVEVLARAQAAQGADVIVLAYTLD
FT                   ADANSRRVDGVQIEPVFVRARFSSQPLALGLILRARQLAREKPFDIVHQHWPDPFAHLV
FT                   ASLIPGSPAWVVSWHSDIVKQRFLGPIYRALAPIFFCKPDAVIGATKTHMASAQIDIFA
FT                   DTAHRHVIPYGIDPAPFELAPSVSNSVAALRTRYAGRPIVFALGRHVYYKGFDVLIRAM
FT                   SRVPAVLLLGGGGPLTPELTQLAERLSTESAGQVVFVGSIPDAELPVYYHACDIFCLPS
FT                   VATTEAFGIVQTEAMLCGKPIVNTNLGTGVNEVAPQGVCALTVQPEDDEALAQALNLLI
FT                   ESPEYAQALGDVGRERALDHYNVERMAVDTLALYASLTGNRDH"
FT   gene            528849..530252
FT                   /locus_tag="Hneap_0496"
FT   CDS_pept        528849..530252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0496"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="KEGG: tgr:Tgr7_2083 undecaprenyl-phosphate galactose
FT                   phosphotransferase; TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95351"
FT                   /db_xref="GOA:D0KY28"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY28"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ACX95351.1"
FT                   /translation="MSTALLRSRSALISAVTRTLDVLLVGLGGLFAFWLRFGGEVSHLP
FT                   ATYGTLMVIGGLLVALVFPLLGVYDSWRARGLASPALRVVGVWSLVLMILMISLVLVKE
FT                   AETFSRLWLAQWWLVSGLALAIERVAVYFVLRGLRQRGLNHRKAVVVGCGPQALNLINR
FT                   AEKEGWAGFDVVRVFGERPDDTGIAGHEIHPLNELFDYVSSHQIDEVWIAVPLDQSQQL
FT                   KSVLENLRFSTANVRFVPDLFGLFLINHGVSEIMDVPMIDLSASPMTGANRLVKGVEDR
FT                   VFSLLILLLISPLFLVIALGVKLSSKGPVLYKQKRHGWDGQPFNIYKFRSMKDGADEEG
FT                   DVPQAVKGDGRVTRFGAFLRRTSLDELPQFINVLQGRMSIVGPRPHAVEHNELYKSQIA
FT                   GYMLRHKVKPGITGWAQVNGWRGETDTLDKMQKRIEYDLYYIEHWSLAFDLKIIFLTVF
FT                   RGFVHKNAY"
FT   gene            complement(530296..530994)
FT                   /locus_tag="Hneap_0497"
FT   CDS_pept        complement(530296..530994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0497"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mca:MCA0599
FT                   nucleotidyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95352"
FT                   /db_xref="GOA:D0KY29"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY29"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ACX95352.1"
FT                   /translation="MPAATHPVRAMILAAGRGERLRPLTDHTPKPLIPVQGKPLIVHHI
FT                   ERLVAAGITDIVINLNHLAEQIPAALGDGDRWNVRLHFSWENHLSENLETAGGIRHALP
FT                   LLSDTFILVNGDIFTDFPFEELLNHTLSPEIDFRLLMVTNPEHHPKGDFALNQQRLELC
FT                   EAHTTETGECLTYAGIGLYKKSMFSGLPEGRRALGTLLKEKIAARRGQGLLFTGAWIDV
FT                   GTLERLQQAE"
FT   gene            complement(531017..532501)
FT                   /locus_tag="Hneap_0498"
FT   CDS_pept        complement(531017..532501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0498"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   asa:ASA_0523 outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95353"
FT                   /db_xref="GOA:D0KY30"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY30"
FT                   /inference="protein motif:TFAM:TIGR01844"
FT                   /protein_id="ACX95353.1"
FT                   /translation="MKSHPQSQRLKQTVLAMLMVVGAYGTPALSANLMEIVTLAEQNDQ
FT                   TLLAAQQKRLSIQENTPIARSNLLPQIGASAGLDYKRTEIKSNGIPNAPTVIEGSGRTL
FT                   GLSLNQVIYNRIDNLNLGIADLQAKQADLDFAAAQQDLLLRASTAYFAVLQANASLQLA
FT                   IASQTAFKNQLAQAQKRYEVGLVAVTDVANAQANYDKANADIITARNALENAQSALATI
FT                   TGKEPTELDDVRTNLSTPRPDPANSNDWVTLAAKQNISLQSAQIGGQISQENIAINRAA
FT                   RMPTVDLTGQYGYNSTPSQFNGSESSNVAASIGLQVSVPLYNGGRINAKSRQAAYQYQQ
FT                   AQNEIENLRRTVQQGTANDYRGVITSISEITAYGQSVESARTSLAATEAGYQVGTRTIV
FT                   DVLNAQIQVFSAMANFLNARYSYLTNYLKLKGDTGQLSLDDIKAVNAQLVPGKINALIA
FT                   PLMNSGNESSKSQQQMIERVIQRAAKTVESKAADQH"
FT   gene            complement(532762..533427)
FT                   /locus_tag="Hneap_0499"
FT   CDS_pept        complement(532762..533427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0499"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; Methyltransferase type 12;
FT                   Methyltransferase type 11; methyltransferase small; KEGG:
FT                   tgr:Tgr7_0485 protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95354"
FT                   /db_xref="GOA:D0KY31"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY31"
FT                   /inference="protein motif:PRIAM:2.1.1.77"
FT                   /protein_id="ACX95354.1"
FT                   /translation="MMAFDTERARFNMVEQQIRPWDVLDKRVLDTLFKIPREQFVPAEQ
FT                   RQFAFSDTALPIGHGETMLPPVVEGRILQSLAVAPNERVLEIGTGSGFFTACLAHLGQS
FT                   VHSVDIHPDFTQSAAEKLAELNIDRVVLETGDAVNGWASNERFDVIVLTGAVQRIPESY
FT                   RQQLNVGGRLFAIVGSEQNMSGIMITRQANDQFDTQNLFETHTRYLKGAEPKPQFSFA"
FT   misc_binding    533716..533822
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 60.40"
FT   gene            533871..535760
FT                   /locus_tag="Hneap_0500"
FT   CDS_pept        533871..535760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0500"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: tgr:Tgr7_0487
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95355"
FT                   /db_xref="GOA:D0KY32"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY32"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACX95355.1"
FT                   /translation="MSAVPNDFLAKTAGLSESVIAPFPASAKIYQTGSRPDIRVPMREV
FT                   TLTPTRSDRGVEINPPITIYDTSGPYTDPAVKIDLLKGLEPLRESWIAERADTETLSGP
FT                   SSDYGLARLNDPKTAGLRFGHIRTPIKAKAGKNVSQMHYARQGIITPEMEFVAIRENNR
FT                   LQEMRADPRYKALLRQHKGESFGASIPDVITPEFVRDEIARGRAIIPANINHPEIEPMI
FT                   IGRNFRTKINGNLGNSATTSGIAEEVEKMVWGIRWGADTIMDLSTGKNIHETREWILRN
FT                   APVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVLLRYVPLTA
FT                   ERVTGIVSRGGSIMAKWCLAHHQESFLYTHFEEICEIMKAYDVSFSLGDGLRPGCLADA
FT                   NDAAQFGELQTLGELTKIAWEHDVQVMIEGPGHVPLQMIKENMDKELADCYEAPFYTLG
FT                   PLVTDIAPGYDHITSGIGAANIGWYGTAMLCYVTPKEHLGLPDKDDVREGVITYKIAAH
FT                   ASDLAKGFPGAQVRDNALSKARFEFRWADQFNLGLDPERAREYHDETLPAEAHKVAHFC
FT                   SMCGPHFCSMKITQDVRDYAETLGVDEIEAIKKGMEEKSIEFVKKGAEVYGRI"
FT   gene            535846..536322
FT                   /locus_tag="Hneap_0501"
FT   CDS_pept        535846..536322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0501"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   csa:Csal_1130 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95356"
FT                   /db_xref="GOA:D0KY33"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY33"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACX95356.1"
FT                   /translation="MIEVGQKLPEATLYHRGEQGLNGCSVTEMTAAQRIVLFAVPGAFT
FT                   PTCSDAHVPGFMVLNDAIRAKGIDNIFCVAVNDPFVMKFWGEHLNVGDAIRMISDGNGM
FT                   FTRALGMERDMSNGAMGIRSKRYAMILNNGVVEWLGVDESGLANSSAEAVLGAL"
FT   gene            complement(536333..537109)
FT                   /locus_tag="Hneap_0502"
FT   CDS_pept        complement(536333..537109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA1034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95357"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95357.1"
FT                   /translation="MAQKNLSLRKLSVRDAWGLIEVIESEGEITLHFGNHTAQSGWHPA
FT                   QPAKLAFGYYRALLMGLVLHPDPRRLNLYGLGGGALARYLLEYTDISVHAHDLRPSLAP
FT                   IAQQYFGLDLEHPRLQLQFGDICASDELADVPAADIIWVDIFDEQGMVPIPTRSLAQMA
FT                   RQLGQIGVLCINVWRNDLRSLGDLTRALERFFDPDPLVLRVPERYNSVLCYRAEPWQPH
FT                   DILQAHRRITHFSSPVQETLREAIGWLEALPRKQLG"
FT   gene            537148..538068
FT                   /locus_tag="Hneap_0503"
FT   CDS_pept        537148..538068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95358"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95358.1"
FT                   /translation="MRNSRFIPFVVGICLSLMTVGTSFAASFKVGDRVFIPLYSENLLD
FT                   DGYADGIIQRINADGTVNIKLSDVVNGEDKTMYGTCSPSGASEQIMTAPTARAKEVVND
FT                   VPTDKILPWTIGQFQYVERENLSTTLQRWLGSGMAITPNSLDIADRRARELDLPRLRVV
FT                   VAMAKAQVESTGGNGFPVPASRALHGAAKMLDDVAALVQSHPNAVSDAAAILAKTAPPH
FT                   SKDLLVEAIVHIAELTQKQLAQLAGDNPDPTKVDGYTPAQLIAIYTGYYRMMTANDTQP
FT                   YENAKVAYFSDKVAQAILGGHWPEL"
FT   gene            complement(538079..538684)
FT                   /locus_tag="Hneap_0504"
FT   CDS_pept        complement(538079..538684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0504"
FT                   /product="cation efflux protein"
FT                   /note="PFAM: cation efflux protein; KEGG: mes:Meso_4140
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95359"
FT                   /db_xref="GOA:D0KY36"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY36"
FT                   /inference="protein motif:PFAM:PF01545"
FT                   /protein_id="ACX95359.1"
FT                   /translation="MTELDGHGPLRRAVLWVALLNFGYFWVEFTVAQSIGSVSLFADSI
FT                   DFLEDTAINLLILIGIGLSLVYRARLGMLLAGVLLIPGIATLWMAWNKVMSQAPPDAFD
FT                   LSLTGLGALFVNLACAFLLVRFRHHQGSLTRAAFLFARNDALANVAIIAAGLITLLWHS
FT                   ALPDLIVGLGIFLMNLDAAREVYQAARREHAETRQLQP"
FT   gene            complement(538677..539000)
FT                   /locus_tag="Hneap_0505"
FT   CDS_pept        complement(538677..539000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0505"
FT                   /product="protein of unknown function DUF1244"
FT                   /note="PFAM: protein of unknown function DUF1244; KEGG:
FT                   acr:Acry_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95360"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="InterPro:IPR036810"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY37"
FT                   /inference="protein motif:PFAM:PF06844"
FT                   /protein_id="ACX95360.1"
FT                   /translation="MNEHINPTTDAKDKTEWEAAAFRRLVAHLQERTDVQNIDMMNLTG
FT                   FCRNCLSRWYREAAEERGTKLSDHDARVAIYGMPYDEWKKRHQSEATPTQQEQFKTAIK
FT                   QHD"
FT   gene            complement(539041..539262)
FT                   /locus_tag="Hneap_0506"
FT   CDS_pept        complement(539041..539262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0506"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: tcx:Tcr_0986
FT                   BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95361"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY38"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ACX95361.1"
FT                   /translation="MNSAEIVSMIQNEIPDAEVHPEGEGCNFKITVLSSEFAGKTMLQQ
FT                   HQRVNKILAPSLASGALHAVTLVTRTPA"
FT   gene            complement(539350..540474)
FT                   /locus_tag="Hneap_0507"
FT   CDS_pept        complement(539350..540474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0507"
FT                   /product="ribonuclease D"
FT                   /EC_number="3.1.13.5"
FT                   /note="KEGG: tgr:Tgr7_0509 ribonuclease D; TIGRFAM:
FT                   ribonuclease D; PFAM: 3'-5' exonuclease; SMART: 3'-5'
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95362"
FT                   /db_xref="GOA:D0KY39"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR006292"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY39"
FT                   /inference="protein motif:TFAM:TIGR01388"
FT                   /protein_id="ACX95362.1"
FT                   /translation="MTITDGFGLAQQPRLIQSTSALHDVCDQIAESTWATIDTEFMRES
FT                   TYFPQLCLVQIATPDAIWLIDPLAVPLAPLWHELNRTSSPLVFHAAEQDLELIYLDSGA
FT                   LPQTLRDSQIAAAFLGLGEQIGYANLVNRLLHVELDKSQSRTNWAQRPLTAEQQHYAAD
FT                   DVRFLRSMYPLLREQLATKNRLAWFDEECAALSDPQRFQPQMTGLWRKVRGQQALRAAQ
FT                   RAVLDAITTWREAWARELNLPRRWVLSDEQALELAGSRQFRPNLLNPKNARHHLSVEQV
FT                   DELRATIERAKQLPPEAFPQWQAYQRTDPETNAILNRMQALVQERSKLMEISPSLLATT
FT                   DDMLRLIRAPDALNKLTTGWRCDVIGLPLKSLLD"
FT   gene            complement(540479..541078)
FT                   /locus_tag="Hneap_0508"
FT   CDS_pept        complement(540479..541078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0508"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: neu:NE0042 cyclophilin-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95363"
FT                   /db_xref="GOA:D0KY40"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY40"
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /protein_id="ACX95363.1"
FT                   /translation="MNKARRLFSAIAVACLIGSTSSVFATEAPKAKPVLVKIVTNMGAI
FT                   TVEMDADKAPKTVENFLSYVKSGFYNDTIFHRVIPGFMIQGGGFTPDFRQKPTQAPIAN
FT                   EANNGLSNRRGTIAMARTSDPNSATAQFFINVADNKFLDYSGPSMRGAGYAVFGHVTSG
FT                   MDVVDKIVSTPTGAAGPFPQDVPKKTVLIESIKVLP"
FT   gene            complement(541071..541487)
FT                   /locus_tag="Hneap_0509"
FT   CDS_pept        complement(541071..541487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0509"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; PFAM:
FT                   zinc finger DksA/TraR C4-type; KEGG: tgr:Tgr7_0571
FT                   transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95364"
FT                   /db_xref="GOA:D0KY41"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY41"
FT                   /inference="protein motif:TFAM:TIGR02420"
FT                   /protein_id="ACX95364.1"
FT                   /translation="MAVTLPPGYKPSESEEYMNPMQLEYFKQKLLTWRDELLEESETTV
FT                   NHLREENWQEPDINDRASLESDAALELRTRDRYRKLINKIDKALRQIADGNYGFCEETG
FT                   DEIGIRRLEARPIATLTIEAQERHERLERVQRDE"
FT   gene            complement(541662..542414)
FT                   /locus_tag="Hneap_0510"
FT   CDS_pept        complement(541662..542414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0510"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: hha:Hhal_0937
FT                   TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95365"
FT                   /db_xref="GOA:D0KY42"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY42"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACX95365.1"
FT                   /translation="MDHWALDQNFIDSDKRFGAALLVALVVHALFFAIYFTGDKPSPPP
FT                   PRPIELTLDAPLAAKTNDASPTPSDKINDKVTTQALASAAGEQTNTLQKPKSGKGITTT
FT                   GNNGITDTPTTNAAPDAFNRLNEAVSRSLKTGFLTSKTVNGPAGDYLSRWKRQVEAYGN
FT                   DHYPEDLISQKISGQLILAVTIDKEGHVMDIAIQHSSGNPKIDTAARRLVQLASPYPPF
FT                   PPALAARFDQIVITRTWQFSSGHGLTTR"
FT   gene            complement(542470..543552)
FT                   /locus_tag="Hneap_0511"
FT   CDS_pept        complement(542470..543552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0511"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: tgr:Tgr7_2906
FT                   ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95366"
FT                   /db_xref="GOA:D0KY43"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY43"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACX95366.1"
FT                   /translation="MPTRRQFLTTVAGLTVSPLLLSGCSTHQTQIVEEGFTVFNMPMTL
FT                   RFANESPKAITQTVNAAAGIVEPLYRRIHPWKPSDLTRLNAQLATHGKATTTPEIIDLI
FT                   NISRTLFEGTDGAFDPTIGALIAAWGFHNSHVTESHPLPTEAFLDAWLEHRPTMNDVHV
FT                   DGLEVSVTNRRVQFDFNGCAEGYAGHLVIQAAEKAGITNCLFDTGGDLFMIGQAGDKPW
FT                   HLAIENPLKRGVLASIDLSGHTAPNGHQSLNSSGNYEHRFIYKGEAYSHIINPKTARPV
FT                   RRIAGSTVWANHYAISDGATKGAMMLEPEQVPDMVRKLKLDGVLFMEETGQLWMNQRMQ
FT                   DKLRLVEPVAGLTATHLITE"
FT   gene            complement(543609..544574)
FT                   /locus_tag="Hneap_0512"
FT   CDS_pept        complement(543609..544574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0512"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: ppw:PputW619_0471 glutathione synthetase;
FT                   TIGRFAM: glutathione synthetase; PFAM: glutathione
FT                   synthetase ATP-binding; RimK domain protein ATP-grasp;
FT                   glutathione synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95367"
FT                   /db_xref="GOA:D0KY44"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY44"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ACX95367.1"
FT                   /translation="MKIGILMDPIAGIKPYKDTSFALLLAAQSRGWSVFYLEPDWLYAE
FT                   QGRPRSRMHAITVFDRNTDWFELGPAQTFDLNELDIIIQRQDPPVTLNYHYVTALLALA
FT                   ESEGVLVANRPNALRAANEKLLAQHYPDLCPPTLVTRDPAQLRDFLSLHGHIVLKPLDA
FT                   MGGSSIFQIQAGDLNTAVIIETMLAHGLIMAQKFLPAVREGDRRILLINGEPVDHALLR
FT                   VPQADEFRANLAAGGRGQVVPLRARDREIAARVGPDMAAAGFWFVGLDVIGDYLTEVNV
FT                   TSPTCAREIDAVCHNDPAGQLLDFLASERAAAKKLNNRSM"
FT   gene            complement(544571..545920)
FT                   /locus_tag="Hneap_0513"
FT   CDS_pept        complement(544571..545920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0513"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA; KEGG: tbd:Tbd_2408
FT                   glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95368"
FT                   /db_xref="GOA:D0KY45"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY45"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ACX95368.1"
FT                   /translation="MPSEALRTAHPELDAHYCGPLLRIESHIIRCHRQIEAWFRAQWLK
FT                   HPAPFYASVDLRNAGFKLAPVDTNLFPAGFNNLNHIFDPVMVQAIQAAVEHSCPEAKDI
FT                   LIIPERHTRNLFYLESLAALVAFVEMAGFGVRIGSLEPITEPVNFDLPSGRTLTQHPIC
FT                   RVGKRIEVDGFSPCTILLNNDLSGGRLEILDDLEQTVIPPIELGWWKRSKFEHFSIYQD
FT                   LTRELCATIDLDPWYLSPLMRDCGHIDFLKREGETCLQSQVQELLAEIQAKYDEHQIKE
FT                   KPFVVIKADAGTYGMGVMTAQSADDVTQLNRKQRTRMSASKEGLGIDRVLIQEGVHSFE
FT                   KVSIHQDDDRYVAEPVIYMVDHFVVGGFYRVHTEKGVNESLNSPGAAFVPLPFNEACSL
FT                   PSPDSSPDSERNRLYVYGVVARLALLAAAYEYQMIREADAATEQMAGDVA"
FT   gene            546235..546670
FT                   /pseudo
FT                   /locus_tag="Hneap_0514"
FT                   /product="hypothetical protein"
FT   gene            546745..547107
FT                   /locus_tag="Hneap_0515"
FT   CDS_pept        546745..547107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0515"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: pmy:Pmen_0404 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95369"
FT                   /db_xref="GOA:D0KY46"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY46"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX95369.1"
FT                   /translation="MAHIVVIDDSPTEVYVLQTMLERNGHQVSVAKNAEEGIALVKQAQ
FT                   PNAVLMDVVMPGMNGFQATRELNKNPETSHIPVIIVTTKDQQTDKIWGMRQGAKDYLVK
FT                   PVKEADLMGILGTVLN"
FT   gene            547127..547642
FT                   /locus_tag="Hneap_0516"
FT   CDS_pept        547127..547642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0516"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: ttu:TERTU_0233 CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95370"
FT                   /db_xref="GOA:D0KY47"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY47"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACX95370.1"
FT                   /translation="MNLFEYLCWVETEATAHAVGMPKTDKVESTWQAVLFRAGGRRMLV
FT                   PLVQVRAILPPPRQVHIPGAKPWVVGLANMRGELTGVYDLARLFFDLPSEPGRHSVVLL
FT                   AKTHRFSAAFIVDRSYGIRQIPFSAERAVKEPHLQGVLREVRMDNDWLPILNLETLVES
FT                   DQFMNAVA"
FT   gene            547722..549737
FT                   /locus_tag="Hneap_0517"
FT   CDS_pept        547722..549737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0517"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: tgr:Tgr7_2901 putative
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95371"
FT                   /db_xref="GOA:D0KY48"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY48"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACX95371.1"
FT                   /translation="MSLGVKLGGLSRQVIVLVVVAAITLLVTVAIFILSAKNDQTLLER
FT                   RLVASQLERSSQEMTIETLRAVRGNKASFDTVLALRAQFVSDLSALSGKDPKRPEAGVS
FT                   NERKAELAKVQKSWDEYNVALAKVLEGQKAILGVGDLASQINQLLPDLLSSSDEVVQTL
FT                   IAAQASPQVVYLATRQLMLVERIGLTIGEITSGGQNAANASDRFGRDVALFGGVLNGFL
FT                   NGNRMAPQINDAAARAKLRDVAVLFATINQGGSDLLSEAPTLLAANQAAIKIDKIAGAF
FT                   TGDVSKLSSSLAQDQVNSGRLAYIGYMTGLITLLLLAWLGYALVRDSKRDQKATESQNQ
FT                   RNQQAILRLLDEMMTLADGDLSSHTTVTEEITGAIADSVNYSIDALRDLVGTINDTSVR
FT                   VASAVQRSQANSRALAETSRAQAEKISSVSDAIAQMSDQIEAVSFNAQQSATIAQSSVD
FT                   VAHRGGDAVRETIAGMVNIREQIQETAKRIKRLGESSQEIGDIVGLITDIADQTNILAL
FT                   NAAIQAAMAGEAGRGFAVVADEVQRLAERVGKATRQIELLVNTIQTDTSEAMLAMEQTT
FT                   TNVVSGATLAENAGKALREIETVSLNLSEQISEIAKVTEQEALVATNLRETVNNIRTET
FT                   QETTDKATRAADEIGALGSLSKELNNSVAGFKMPDR"
FT   gene            549930..556457
FT                   /locus_tag="Hneap_0518"
FT   CDS_pept        549930..556457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0518"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; Hpt domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: response regulator receiver; Hpt
FT                   domain protein; CheW domain protein; ATP-binding region
FT                   ATPase domain protein; KEGG: tgr:Tgr7_2900 putative CheA
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95372"
FT                   /db_xref="GOA:D0KY49"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY49"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACX95372.1"
FT                   /translation="MRTESKVDSIVLDRLKEGLNEKIDQLLRALEDLSSGAGGNELVFE
FT                   SLDAVKAIDAVLAVSDYQLLRVMLKEQMSALTQLETNPEKAAVLVTTVTEAAWMLRALL
FT                   DRLSVGATVNAMSLLPMINRLRQSQGLSEVDTENVLARSTVLWSESRVFVNPYVGQIAA
FT                   KSEEKTKSNQLLASMEQQILLLMRGDVTAIPGLIETFDRIIEREVNRAVVVATRSFEEL
FT                   LGAVHQDQERYLPLAKRMIGRVLRLFRMEIQGRDSLHIRFEAIEFATDMLLELVRVLPD
FT                   DSELCGERVSNWHELLSTDGERVRFLGLETSALTQVAQVLSEELNAAQDVLDLFVRGAK
FT                   SDLEPLVRIQPRLEQIVGVLAALNYEHESGLIQGALEQLIQVTRGSVLFDDDFLMQLAV
FT                   AIMTTEQVVSQIGHLIVDDSKSLTSVDRVVSEALIPLATACYEDVIASKEAVNMALRPT
FT                   GQPVAPDTLTNAARLIAGVRNVLEMAELRAAMPLINGLHRWLFLHVNNLQLVRSETISA
FT                   LAEVSAAVEFYLENLRDHQKEMVQFLDGALQMLPVLNGGTEAHEGEQPRETLEPQNHNL
FT                   DVQTSIDEEPQQPVDESLASMDELIAQLSMPNSDEFVEEAEVATALHGEETAVDAMPLE
FT                   TLDPPEDSDTAPIEAGELQAPELVLDENFVLDVSEETHSGEDADVLSQSAREPETAFLA
FT                   PDTIEAIPAEEPSTEPMVESVEDNAHLGNFDLIEHQHEAASGEEPAGEASQVKADAEFD
FT                   LPAAWAAELSLDLEQDEPVFEQKSAETPVAEDEPLPDFETLDLSLPPSEKEPVESTTEW
FT                   SFLQNASDSDIDLTLPPSDPQSPEHPSFLEEPFNSDLSLDALSLPDIEQAPGRAPESET
FT                   GMVSDAEVGESSAPSATPEFEETLDELAIEMREVFAEEMQEELPALLEAARTWSNQGGR
FT                   DHLVTLRRGFHTIKGSSRMVGLTAIGDWGWSYEHLLNQVLDDRVTSTPALRADVLSAVS
FT                   LMNEALPVLSQGQCPPVSYWQESLGWAEAWSNDQSKDGAASESAITESAPEAETLVAEA
FT                   DVPTVESHEWVQDAPSEVDENILEKFAPSEEILQESEASVTETSYEQEVSSDTDADGEV
FT                   WHVEMSSMDDDTDTEHPDRSPTVVDETTVLPATEPVSEPEEATAQELTPEPAPVIEDPV
FT                   LREIFDQESSGYIHQLRQQVDHALINWVSLPCDKELVRLVHTLLGSARTAGVQPIARIS
FT                   NRLEEWIRLLEEHNHSLEHEDLAVFQRSLLMMDRLRQWAIEPAFDQPDEEPIEVEIAAR
FT                   IDQLLVEILSAEPETEESVDEYAEFALPEVVDSAEEETSETIQAVPEASTPLFERSADI
FT                   GMSVRPDDMPGDQDPDILQIFLEEAEELLEKADGYIAHWRQHPHDLDSIRLLHRNLHTL
FT                   KGGARMAGLLNLADVTHLLEDRLDRARDRGGEQADVLIALVQHTYDALGKMLDLVRRQA
FT                   PIPAQINLLAQIANEGSAHAIEALVSDDEALREPVTAQIEEPFAESVFEQSVEAPADGS
FT                   AVTGSVEMTESAESTAPHAAAVANEVRREQIRVDADRIDDLVNQVGENVLLQARVDRQV
FT                   NGFERQLFELQQTLTRLRGQLRRLEIQTESQMKAELMAETGLSAEEFDPLEFDRFTQVQ
FT                   ELSRGIMESLGDISSIEEAMSDITEQSQLLLLQQSRLGRKLQDGMLALRMVRFNDVVGR
FT                   LRRIVRQVGDEMGRNAELIIHNGETELDRVTIVGLLPSLEHMIRNSLAHGIESPDERRV
FT                   LGKPEVGQIEITIESAGGNVTLEMKDDGRGLDLDAIRRKAVERKLIPADIDLSDDEARA
FT                   LIFLPGFSTAGNVSQVAGRGVGMDVVAGSVREMGGFVDLQSEFGKFTRIQLNLPLTQAM
FT                   TRGILISVGDNQFAIPYKGVVSVTRMTSIQLAEQYASPKPAVTLNGEQYPLFYLGELLR
FT                   HEPFNANAQEVGVRAVFLFKLGERRFAVQVDHQLGGIQLFVKSLGPQLGRIPGLSGATI
FT                   SDEGNVILVLELFELVRQFQRRDDRHLDLTAQVSVRRRPVVLVVDDSLTVRKVTARTLE
FT                   RNNLDVILARDGVEALGFLHEQKPDVVLTDIEMPRMDGFELLGAIRNDEQTRNVPVIMI
FT                   SSRTGQKHRSRAEALGVSAYLGKPYAEADLIGRIESFITDVRDRTRGSGSALEEGRSIQ
FT                   NNEEQG"
FT   gene            556454..557026
FT                   /locus_tag="Hneap_0519"
FT   CDS_pept        556454..557026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abo:ABO_0102 chemotaxis protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95373"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95373.1"
FT                   /translation="MSNSNESTFLAGAAGTHEVGVGPGPAETKKVRIVRLPTQVSDMEV
FT                   IVPYAMVAEITEVMLPEGGTHLSRLDAAMVDWRAQRIPLVSLEAMLNEPLPTIGQRVRC
FT                   AVMYGSNPDIALPYYAVLLSGVPRSEEVNMHSFSEEASSEGGFWRLSAEMGGRRVGVPD
FT                   IRWLESQIDEMRMRFDRDSTTALNETL"
FT   gene            complement(557126..557770)
FT                   /locus_tag="Hneap_0520"
FT   CDS_pept        complement(557126..557770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC3193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95374"
FT                   /db_xref="GOA:D0KY51"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95374.1"
FT                   /translation="MKTIADHSELKTSSHATFLDKPTPSAQLLLFAVLVLSMAATRYHH
FT                   FSAVLHIADTSWAAFFLAGLYLRARWMFVALMGLAVVIDLAAVWTDGLGMTGCFSPAYP
FT                   GLLLAYGALWGAGRLSRHSMREDEPALATILAVIGWLALGVIAAFALSNLSFWAWSGHF
FT                   VDLTLGDYLQRVMGYLGRYMASTNLYVGLGLGVMIVAQTLTIRLSNPKAAH"
FT   gene            complement(557967..559820)
FT                   /locus_tag="Hneap_0521"
FT   CDS_pept        complement(557967..559820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0521"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: neu:NE0636 TonB-dependent receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95375"
FT                   /db_xref="GOA:D0KY52"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY52"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACX95375.1"
FT                   /translation="MYKFPMSGRHRTGRTTLACAYLTACSFPLSALAGSPSTLPDLNIT
FT                   ASHGAPVAFAGVPETVITRAEIERLQATSVLSLLENRAGINMVNQGGPGKITTASIWGM
FT                   SGSQTLVLIDGVRIGSLTAGAAYLENLPVALIDHIDIIKGPRSGQYGADAMGGVIQIFT
FT                   RKGKKGIQPSFSIAGGSNKTFETSANVSGGNGPFDYSIGASHQGTGGFNAYTDTTGSPF
FT                   AVNQPDNDGYRNNSASGRLNYTGDNGARLGVHWLGTNAFTDYDGSSFAGNQQRSRQQNF
FT                   GLDGALMKIGIWQLRASAGRNIERQTQYYDGKYVSEYNSRQDSFSLANDFSIGQGLLTL
FT                   GADRLNDHVSSSVNYDVTSRHNNGVFAQYATQIADLSIQTALRHDSNSQFGSANTGSVD
FT                   LSWQLNPSLALTGGYGTGFHVPSFNFLYYPGGYANPDLRPEHSRTARLGFNWQNNNGWT
FT                   SSLTAFRTRTRDLIASSASTNFVPYNINQAQSIGAEWQLGWHNADWALNSSATWISAVD
FT                   RETGVSIPRQPKWSGRVDVDRKLGAWRMGVTVRGQTATHESTFSQINNGFATADLRLSY
FT                   AYSQNWHIEAKLSNVLDKQYQTAYDYHQAGRTVLFTLRYGL"
FT   misc_binding    complement(559859..560011)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 72.23"
FT   gene            complement(560035..560172)
FT                   /locus_tag="Hneap_0522"
FT   CDS_pept        complement(560035..560172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95376"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95376.1"
FT                   /translation="MPFSIPIAGRNTGRNTEPSGQNALTSFQTRLLFILIMIKIQALAA
FT                   "
FT   gene            complement(560293..560397)
FT                   /locus_tag="Hneap_0523"
FT   CDS_pept        complement(560293..560397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95377"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95377.1"
FT                   /translation="MEQKHSNIFNDEQLEIPVIRRSRESGNDGFFKIP"
FT   gene            560457..561035
FT                   /locus_tag="Hneap_0524"
FT   CDS_pept        560457..561035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0524"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: hha:Hhal_2059
FT                   ADP-ribose diphosphatase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95378"
FT                   /db_xref="GOA:D0KY55"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY55"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACX95378.1"
FT                   /translation="MPVEQPPKMCAVRPLVETRLFAVEAVDLKFANGVEVTFERLAAKG
FT                   RGAVLVVPILDDGRIVLIREYACGTERYELGLPKGRIDGDEPILEAANRELMEEAGFTA
FT                   AQLTLLREVTSSPAYSAQRTHIVLATGLSPRRLPGDEPEPLEVVTWPLDDLDRLAFEGQ
FT                   CSEARSIAAMYLARTYLAHSPANDQKNPA"
FT   gene            561069..561890
FT                   /locus_tag="Hneap_0525"
FT   CDS_pept        561069..561890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0525"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: mei:Msip34_1319
FT                   3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95379"
FT                   /db_xref="GOA:D0KY56"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY56"
FT                   /inference="protein motif:TFAM:TIGR01331"
FT                   /protein_id="ACX95379.1"
FT                   /translation="MNDWLSLRDPVRSIAAQAGEAIMRVYAEDFDIMHKSDDSPVTEAD
FT                   LSAHRVIKAGLQALTPHLPVLTEEGGLPDWSVRQQWSDYWLVDPLDGTREFVKRNGEFS
FT                   VNIALIHQHQPVLGVVYAPATGAEFAGVQGVGSWRFTAQGAQPLKVRPLPNPTITLALS
FT                   RSHGSRREQALIDALTERAGEPQVIRCGSALKTCLVAEGLADLYPRFGPTSEWDTAASQ
FT                   CVLEAAGGQLVDLNGQRLTYNRRAVVLNPSFLAYGERLPLPLAQLARISAD"
FT   gene            561948..562556
FT                   /locus_tag="Hneap_0526"
FT   CDS_pept        561948..562556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0526"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   tgr:Tgr7_2801 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95380"
FT                   /db_xref="GOA:D0KY57"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY57"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACX95380.1"
FT                   /translation="MVLMLDNYDSFTFNLVQYLGELGVEVWVARNDQVTVEEIAARAPS
FT                   HIVISPGPCSPSEAGISIDVIHAFAGKTPIFGVCLGHQAIGQAFGGKVIRAKEVMHGKV
FT                   SPIHHSGEGVFAGLPNPFDATRYHSLVVEQASLPDVLEVTAWTQYPDGSFDEIMGLRHK
FT                   TFVVEGVQFHPESILTEHGHQQLKTFLGYQSAVREPAYA"
FT   gene            562553..563812
FT                   /locus_tag="Hneap_0527"
FT   CDS_pept        562553..563812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0527"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tgr:Tgr7_2800 Bcr/CflA subfamily drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95381"
FT                   /db_xref="GOA:D0KY58"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY58"
FT                   /inference="protein motif:TFAM:TIGR00710"
FT                   /protein_id="ACX95381.1"
FT                   /translation="MSSPAARLAPKAFLIVPLVASLLMIAPFTVDAYLPSFPAIGHEFG
FT                   VDQATMQLTLSLYLWFFGGMMLVHGPLSDTFGRRRMVLISLTVYALASVGAAMAGNINE
FT                   LIAARVIQGIAAGAGVVIGRALVRDLFEGATAQRVMSNITLVFAIAPAIAPIIGGVLDT
FT                   WLGWRSVFWFLALFAALSMAGVFAFMPETVGAHNRQSIAPLFILKSYGRALSHAPFMGL
FT                   TLVFALLFSGMFLYIAAAPMVLVGHLQQTPTDFWKFFVPLVTGLILGSRISNVLASRFA
FT                   PMTTVSIGIGIVTLAVIFNVVQSFWFAHHSFGLGEWRVWLTVSPIMIYAMGMATAMPSL
FT                   NLMGLDYIPAQRGLASALQGFTQMILAGIVSGLAVAHLAQNLLWLAWGMAALWLLAALI
FT                   WIAWYRRAPRLGFASETRHA"
FT   gene            563956..564696
FT                   /locus_tag="Hneap_0528"
FT   CDS_pept        563956..564696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0528"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   tgr:Tgr7_2237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95382"
FT                   /db_xref="GOA:D0KY59"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY59"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ACX95382.1"
FT                   /translation="MAGHSKWANIKHRKARQDNKRGKVWTKIIREITAAVRVGKSADPS
FT                   VNPRLRLAWDKALSSNMSKDTVERAAKRGVGAGDGEHYEEMLYEGYGPGGVAVLVYCMT
FT                   DNHNRTVSDVRHAFTKFGGNLGTDGSVGYLFNKQGVLYYPPGVDEDALMEAALDAGAQD
FT                   VQVGEDGAVEVITTPEDYVSIKDALKVAGFSPEESELAMRAAVTAPVEGDQAVKLVKMI
FT                   DMLEDLDDVQEVFHNADIPEEAYA"
FT   gene            564698..565264
FT                   /locus_tag="Hneap_0529"
FT   CDS_pept        564698..565264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0529"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: tgr:Tgr7_2236 crossover junction
FT                   endodeoxyribonuclease; TIGRFAM: crossover junction
FT                   endodeoxyribonuclease RuvC; PFAM: Crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95383"
FT                   /db_xref="GOA:D0KY60"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY60"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ACX95383.1"
FT                   /translation="MARLRVMGIDPGSVTMGVAVLDFERGSATQIHLQSVSLKPHGSFT
FT                   ARLGAIYAEVDRLIDTHAPDEFAIEQIFMYRSPESSLKLAQARGVAIAAAVGHGLTVHE
FT                   YMPAVVKQAVVGTGRADKLQVQHMIKRLLSLSESPPADGADAAAVALCHCYRRTSLAGI
FT                   SADEVGVEKTAMQLLAQSRYRRRSR"
FT   gene            565261..565881
FT                   /locus_tag="Hneap_0530"
FT   CDS_pept        565261..565881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0530"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: tgr:Tgr7_2235 DNA recombination protein, RuvA;
FT                   TIGRFAM: Holliday junction DNA helicase RuvA; PFAM: DNA
FT                   recombination protein RuvA domain I; RuvA domain protein;
FT                   helix-hairpin-helix motif; SMART: Helix-hairpin-helix
FT                   DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95384"
FT                   /db_xref="GOA:D0KY61"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY61"
FT                   /inference="protein motif:TFAM:TIGR00084"
FT                   /protein_id="ACX95384.1"
FT                   /translation="MIGRLKGILVNKQPPWILLDVQGVGYEVEVPLSTLFDLPANGQEA
FT                   TLLIHTVVREDAFLLYGFSREVERKLFRHLLKVTGVGAKLALGVLSGMNAEEFAGAIAR
FT                   NDIAALIRLPGVGRKTAERLVIEMRDRLAEGFFDGATLATAAGKMGDVVPLAGADQEAM
FT                   SALEALGYKPAESQRMVKAVPGAETLPVEQIIRLALKPFAGKA"
FT   gene            565881..566927
FT                   /locus_tag="Hneap_0531"
FT   CDS_pept        565881..566927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0531"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: aeh:Mlg_2777 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95385"
FT                   /db_xref="GOA:D0KY62"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY62"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ACX95385.1"
FT                   /translation="MTDRVITAESVTEDEAIERALRPKRLVDYVGQPAVVEQMEIFIPA
FT                   ARQRGEALDHVLIFGPPGLGKTTLANIIAHEMGVGLKQTSGPVLERPGDLAALLTNLEP
FT                   NDVLFIDEIHRLSAVVEEILYPAMEDHQIDIMIGEGPAARSIKLDLPPFTLVGATTRAG
FT                   MLTGPLRDRFGIIQRLEFYSVADLTRIVSRSAQLMGVSIDAGGAQEIAARARGTPRIAN
FT                   RLLRRVRDFAEVRGNGTVDQPMANAALDLLQVDARGFDQQDRRLLEALIHKFDGGPVGL
FT                   DNIAAAIGEARDTIEDVLEPFLIQQGFLVRTARGRMATRQTYAHFGFRPPSAFESQQGT
FT                   LLPEEEPQ"
FT   gene            566924..567334
FT                   /locus_tag="Hneap_0532"
FT   CDS_pept        566924..567334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0532"
FT                   /product="tol-pal system-associated acyl-CoA thioesterase"
FT                   /note="TIGRFAM: tol-pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein; KEGG:
FT                   mca:MCA1224 thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95386"
FT                   /db_xref="GOA:D0KY63"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY63"
FT                   /inference="protein motif:TFAM:TIGR02799"
FT                   /protein_id="ACX95386.1"
FT                   /translation="MTTTDIFYWPVRVYYEDTDAAGVVYYANYLKFFERARTEWLRARG
FT                   FEQDMMREEHGVVFVVSRLQVDYQRPAKFNDALRVSCEMRKCGAASMSFHQVAERTSDQ
FT                   IPLSQATVQIVCVDADSFKPTPIPNAMRSYFL"
FT   gene            567331..568008
FT                   /locus_tag="Hneap_0533"
FT   CDS_pept        567331..568008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0533"
FT                   /product="protein TolQ"
FT                   /note="TIGRFAM: protein TolQ; PFAM: MotA/TolQ/ExbB proton
FT                   channel; KEGG: aeh:Mlg_0245 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95387"
FT                   /db_xref="GOA:D0KY64"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY64"
FT                   /inference="protein motif:TFAM:TIGR02796"
FT                   /protein_id="ACX95387.1"
FT                   /translation="MSTEPSVMHLVLGASLPVQLVLLILLLASVASWALIFHKSSLLRR
FT                   ARAQAKRFEESFWSGGSLNDFYDRISRDPRPREGQEAIFEAGFREFKRLRQIEGRSSSE
FT                   LLEGVERAMRVTLHRQIDKFEEGLSVLATIGSVSPYVGLFGTVWGIMSAFMNLGNAQNA
FT                   TLATVAPPIAEALIATAMGLFAAIPAVVAYNRYSTQIDELFGRYDRFTDEFLGLLQRQI
FT                   GGQ"
FT   gene            568012..568467
FT                   /locus_tag="Hneap_0534"
FT   CDS_pept        568012..568467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0534"
FT                   /product="protein TolR"
FT                   /note="TIGRFAM: protein TolR; PFAM: Biopolymer transport
FT                   protein ExbD/TolR; KEGG: ftn:FTN_0353 TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95388"
FT                   /db_xref="GOA:D0KY65"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY65"
FT                   /inference="protein motif:TFAM:TIGR02801"
FT                   /protein_id="ACX95388.1"
FT                   /translation="MDRRGRRTRRVVAEINVVPYIDVMLVLLVIFMVTAPMLQQGVEVT
FT                   PPSAASKALPQSDDVPIVITVDKTGQYAVSGQDAPSGQVPLDTIQAYVLAARKLNPKIP
FT                   VLVKGDKDASYQFVMGAMVAMQKAGVDKVGLVTDQPRSNSNSPSGGK"
FT   gene            568470..569507
FT                   /locus_tag="Hneap_0535"
FT   CDS_pept        568470..569507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0535"
FT                   /product="protein TolA"
FT                   /note="TIGRFAM: protein TolA; PFAM: Tol-Pal system TolA;
FT                   KEGG: mca:MCA1228 TolA protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95389"
FT                   /db_xref="GOA:D0KY66"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY66"
FT                   /inference="protein motif:TFAM:TIGR02794"
FT                   /protein_id="ACX95389.1"
FT                   /translation="MFRWFTRMPLSILLAIALHLLIILSVLIAWKFNAFSAASQSSSTS
FT                   NEPVIQAQSVSQAAIDQQVNRLKQADQQREKSLKQQQTEAQQAAAARRAEQARLQQLEA
FT                   MREAKQKAAAAQEQQLKALQDEQKKAQESVQAQKQALAKMQEEAAKAAAEKQAAQAAAA
FT                   KERATAAAAKQAAAEAAAQAEQAKKQAAAEKAAAEKAAKEQAAKEKAAKAAADKAAKEK
FT                   AANLAAQKAAQARKAALQQQLQDELSASQAQGILAAYAAAIQQKVTAQWFKPPGWQPDW
FT                   TCDVRISQAKDGTVLNVKILQCDGDQLFQRSVQQAVERASPLPLPSDMSLFQSTINFKF
FT                   RANTQ"
FT   gene            569577..570884
FT                   /locus_tag="Hneap_0536"
FT   CDS_pept        569577..570884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0536"
FT                   /product="Tol-Pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="TIGRFAM: Tol-Pal system beta propeller repeat
FT                   protein TolB; PFAM: TolB domain protein; WD40 domain
FT                   protein beta Propeller; KEGG: csa:Csal_1853 translocation
FT                   protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95390"
FT                   /db_xref="GOA:D0KY67"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY67"
FT                   /inference="protein motif:TFAM:TIGR02800"
FT                   /protein_id="ACX95390.1"
FT                   /translation="MKARIQRWGLWILSGLLFLAPAVSQAELNIVISGGQESGVPIAVV
FT                   PFSTTTNTDFASIIDADLARSGQFAPLTTDQMPSQPSAPEQVQFDQWRTGKAQYLVVGK
FT                   VVQQGGNYQATFYLLNVTNGQQMTGRVISAPVSAARSIAHRIADIIFKQITGVRGAFDT
FT                   KIAYVTETDGPGKKRRYTLEVADSDGANPQTVLSSNFPLMSPTWSPDGSKLAYVSFEGR
FT                   RSGIWVQDLRTGQRYQLTKFPGINGAPSWSPKGNKIAITLSKYHSPNIYVVDLDTRNLT
FT                   QVTNDGSINTEACWLPDNQTLVFTSDRSGSPQLFEKTVGTSSAQRLTFGLSYAAGGAIS
FT                   PDGKTLALLAGGNGGFRVAVQSLSGGGSDLRYISNGGSEERPSFAPNGSMLIYASQVGG
FT                   SSVLKVSPVSGGESQTLRFARGKVRDPAWGPFQGDE"
FT   gene            570959..571924
FT                   /locus_tag="Hneap_0537"
FT   CDS_pept        570959..571924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0537"
FT                   /product="tol-pal system protein YbgF"
FT                   /note="KEGG: xcv:XCV3270 putative secreted protein;
FT                   TIGRFAM: tol-pal system protein YbgF; PFAM: TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95391"
FT                   /db_xref="GOA:D0KY68"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY68"
FT                   /inference="protein motif:TFAM:TIGR02795"
FT                   /protein_id="ACX95391.1"
FT                   /translation="MNRLKIKRNAKKITVLAVFGMVMTQPTWAQTPPGWLNWSDKSDAA
FT                   PAATTQAPETDAQSATPQPLSSQPLGTGETGVNTASGQTVIIQNLLDSVSRLQEQVRDL
FT                   RGQNEVQENQIQRLQKAQQSAFSSFDDRLSKLEQTGGSTLAPSAPVPPSVPATKEPAAS
FT                   VPTAPAPASSASAAPAASPAPATSQDAAATAKQQALYNAAFAQLKDGQYDQAITGFQAA
FT                   IDADPQGQWTPSALFWQGETYYVEQKRDKSEAAYQKILTQFPNSDRVPDALLKTGYIAY
FT                   DANKNKQARDIFQQVISKYPQSQAANLAKQRLARMDAEKR"
FT   gene            571921..572604
FT                   /locus_tag="Hneap_0538"
FT   CDS_pept        571921..572604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0538"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   pmy:Pmen_1280 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95392"
FT                   /db_xref="GOA:D0KY69"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR027621"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY69"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACX95392.1"
FT                   /translation="MISALDDIAIQEKAPLQLRITEIFRSLQGESESAGWPTVFVRLTG
FT                   CPLRCVYCDTAYAFTGGERLSLLSILDQVAAYHTQDVCVTGGEPLAQPACLPLLTSLCD
FT                   AGHLVSLETSGALSIEGVDPRVRVVMDLKTPSSGEAEKNRFENIDLLKTSDEIKFVIGS
FT                   AEDFKWAVQHVRQFQMDKRFNVLISPVFGQVTPLALADWILESGLRLRFQQQLHKLIWG
FT                   NEPGH"
FT   gene            572588..573295
FT                   /locus_tag="Hneap_0539"
FT   CDS_pept        572588..573295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0539"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: Queuosine
FT                   synthesis-like; KEGG: pmy:Pmen_1281 ExsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95393"
FT                   /db_xref="GOA:D0KY70"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY70"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ACX95393.1"
FT                   /translation="MSLDTENTQPKAVVLLSGGLDSATVAAIAKSDGYQVHAVSFDYGQ
FT                   RHKVELKAAYRVALQLGIQHHKMISINLNDVGGSALTDSALAVPDYDAQSAEHIPITYV
FT                   PARNLTFLSLALGWAEILGARRIYIGVNAVDYSGYPDCRPEFIKQFEVTANLATAAGLT
FT                   GEPFKIIAPLQTLTKAEIIQWGTRFGVDYAQTISCYNPDEQGRACGRCDACHYRKQGFM
FT                   DAGIPDVTIYAPE"
FT   gene            573351..573426
FT                   /locus_tag="Hneap_R0015"
FT                   /note="tRNA-Lys1"
FT   tRNA            573351..573426
FT                   /locus_tag="Hneap_R0015"
FT                   /product="tRNA-Lys"
FT   gene            573791..575315
FT                   /locus_tag="Hneap_R0016"
FT   rRNA            573791..575315
FT                   /locus_tag="Hneap_R0016"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            575391..575467
FT                   /locus_tag="Hneap_R0017"
FT                   /note="tRNA-Ile1"
FT   tRNA            575391..575467
FT                   /locus_tag="Hneap_R0017"
FT                   /product="tRNA-Ile"
FT   gene            575749..575824
FT                   /locus_tag="Hneap_R0018"
FT                   /note="tRNA-Ala1"
FT   tRNA            575749..575824
FT                   /locus_tag="Hneap_R0018"
FT                   /product="tRNA-Ala"
FT   gene            576047..578921
FT                   /locus_tag="Hneap_R0019"
FT   rRNA            576047..578921
FT                   /locus_tag="Hneap_R0019"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            579030..579144
FT                   /locus_tag="Hneap_R0020"
FT   rRNA            579030..579144
FT                   /locus_tag="Hneap_R0020"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            579270..579479
FT                   /locus_tag="Hneap_0540"
FT   CDS_pept        579270..579479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95394"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95394.1"
FT                   /translation="MSRKARRETGLRQLRVNGYSIRERRNTAGLRQFNAKQAQARVKSP
FT                   SKARPMRVAAQKTQHFVIGLGIVA"
FT   gene            579578..580069
FT                   /locus_tag="Hneap_0541"
FT   CDS_pept        579578..580069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mei:Msip34_0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95395"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95395.1"
FT                   /translation="MSMNQARWLVATFVALAVLSFIWGHNPAEVRPKDTASGPVIPVVI
FT                   PNDCTMKGTGCDLALGHIGHVLVRAPIVIKPLEKFSLVVEPQGEASKSMGAVSVDFQMV
FT                   GMDMGINRYPLTRTNNGNYAQNIILPVCTTTRTDWVADLSFTTTAGTFVAKIPFVVDHR
FT                   "
FT   gene            complement(580090..580716)
FT                   /locus_tag="Hneap_0542"
FT   CDS_pept        complement(580090..580716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0542"
FT                   /product="putative cytochrome c"
FT                   /note="KEGG: pfs:PFLU2980 putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95396"
FT                   /db_xref="GOA:D0KY73"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY73"
FT                   /inference="similar to AA sequence:KEGG:PFLU2980"
FT                   /protein_id="ACX95396.1"
FT                   /translation="MNNRKWVIAALFMLSAAPLAIAGTSTNTIGEKIARKGTGDVPACA
FT                   ICHGDHGEGNLKAGYPRLAGMNAEYLDQQMTLYAQEERTNRIMQEYAQKLSIAQRRAVS
FT                   EYYANQTAHSPHIDLQSLPPQAAKLLQVGAPNRGIPSCFSCHGDNGQGDADGIAPIAGQ
FT                   PAIYFIHQMNAWRFNARPVTEGNPMGVIAKSLTVQEISLLAHALQ"
FT   gene            complement(580753..581355)
FT                   /locus_tag="Hneap_0543"
FT   CDS_pept        complement(580753..581355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0543"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   bba:Bd0846 putative MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95397"
FT                   /db_xref="GOA:D0KY74"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY74"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ACX95397.1"
FT                   /translation="MKKNILLVMALPQENVGNRLDQFGLPILYTGVGKINAAIKLGEIL
FT                   STTNEHTIVINLGSAGSHQYPAGETVCITRFFQHDMNATALGFDLGQTPFEKETHLTGS
FT                   LAIPGMKQATCFTGDSFVSERHPELSFEVIDMEAYSLAKTCLHHNTEFIALKFITDGAD
FT                   GQAARDWPEALNMATDHLSVALGETLKHLERLQLASK"
FT   gene            complement(581371..581889)
FT                   /locus_tag="Hneap_0544"
FT   CDS_pept        complement(581371..581889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0544"
FT                   /product="Adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: tcx:Tcr_0108
FT                   adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95398"
FT                   /db_xref="GOA:D0KY75"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY75"
FT                   /inference="protein motif:PRIAM:2.4.2.7"
FT                   /protein_id="ACX95398.1"
FT                   /translation="MPITNSLAQAVRAIPDFPKPGVIFRDISPLLNHHFRETIDMLSAQ
FT                   FSPEEWAEIDAIVGIESRGFILASGMSYAQNKGLMIVRKPGKLPPPRHSVRYTLEYGED
FT                   ELQMATNLNPQRVLIIDDVLATGGTLLGTCELCTQCGHEIKGIGTLINLPGLNQFAWPN
FT                   TPVRSLFTY"
FT   gene            complement(582064..582624)
FT                   /locus_tag="Hneap_0545"
FT   CDS_pept        complement(582064..582624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0545"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; SMART: Smr protein/MutS2;
FT                   KEGG: noc:Noc_1906 Smr protein/MutS2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95399"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY76"
FT                   /inference="protein motif:PFAM:PF01713"
FT                   /protein_id="ACX95399.1"
FT                   /translation="MAKSSKKTAPLAPEDIALFHEAVGSVEPVSNACVVVDDAPPKPSR
FT                   RKAIPERLSDYIDQHLSDGFALEEPIEHGETLSYLRPDSPPPLLRKLRRGQFSVAASLD
FT                   LHGMSIDEARNSIARFFLEQRRDVRCCVRIVHGKGNRSIGQVPVLKRMVNHWLPQRDDV
FT                   IAFCSAPPHDGGTGAIYVLLRKS"
FT   gene            582732..583496
FT                   /locus_tag="Hneap_0546"
FT   CDS_pept        582732..583496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0546"
FT                   /product="stationary-phase survival protein SurE"
FT                   /EC_number="3.6.1.11"
FT                   /note="KEGG: mca:MCA2418 stationary phase survival protein
FT                   SurE; TIGRFAM: stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95400"
FT                   /db_xref="GOA:D0KY77"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY77"
FT                   /inference="protein motif:TFAM:TIGR00087"
FT                   /protein_id="ACX95400.1"
FT                   /translation="MNILVSNDDGYLSPGIRVLAERLKALGHVTIVAPDRDRSGASNSL
FT                   TLSRPLRPRLVEPDVWAVDGTPTDCVHLAIQGLLSVVPDIVVSGINHGSNLGDDVLYSG
FT                   TVAAATEGRSLGLPAIAVSNAAHHPEHLGVAADAVVDLVCRLVNHPLPAFTLLNVNVPD
FT                   LPADRIKPMLATRLGRRHPSSGIVRDRDPRDREIFWIGAAGEGADASEGTDFAAVAAGH
FT                   ISVTPVQFDMTRHSAIHNVADWLAEPVCALPK"
FT   gene            583493..584272
FT                   /locus_tag="Hneap_0547"
FT   CDS_pept        583493..584272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0547"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: hha:Hhal_1430 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95401"
FT                   /db_xref="GOA:D0KY78"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY78"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ACX95401.1"
FT                   /translation="MTSSDFPRLKKILSSSDKPELRVPEKTLKKTARRVEDELPSFSKQ
FT                   GPDYTWARGAMVERLRQQGVSNAKVLAAMNTLAREAFVDEALRMRVYDDCSLPIGQGQT
FT                   LSQPYIVGRMSELLLGASIPVKRVLEIGTGSGYQAAVLAQCGCAVFTIERIGTFLEVAK
FT                   ARHRRLGLLNIRYLHRDGFKGWPSQAPFDGIIVTAAPSNIPDELKAQLVDGGRLIVPVG
FT                   SQGEAQRLTVITRTENDFRSQFFDAVSFVPMLPGEQS"
FT   gene            584269..584856
FT                   /locus_tag="Hneap_0548"
FT   CDS_pept        584269..584856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0548"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="KEGG: tgr:Tgr7_1434 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95402"
FT                   /db_xref="GOA:D0KY79"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY79"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1434"
FT                   /protein_id="ACX95402.1"
FT                   /translation="MRLFGALYDRVLSWSAHRHAPVALGGLSFAEASFFPIPPDVMLLP
FT                   MAMARPRCWWQFATIATVFSALGGLFGYLIGWLAIDWLMPYIQQWGYGSVFEKAKLWFQ
FT                   EWGFWAIIVAGFSPIPYKAFTITAGALTMNPALFFVASLVGRGGRLYLVAGLIAWAGPK
FT                   IAPKLRHYIEWLGWLTVALLVIAVILWRWMKH"
FT   gene            584881..585666
FT                   /locus_tag="Hneap_0549"
FT   CDS_pept        584881..585666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0549"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; Peptidoglycan-binding lysin
FT                   domain; SMART: Peptidoglycan-binding LysM; KEGG:
FT                   aeh:Mlg_1826 peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95403"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY80"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACX95403.1"
FT                   /translation="MNQLSCLAAHVRPLYRLAWVGLLLGVMTLSGCATGSHFDRWAGHD
FT                   ASAIRVRPGDTLYSIAVANDLDWRDVARWNGIRNPRDLRAGQILRLTPPGQTARAATRV
FT                   TTRAVPRKPPAAKPASRSASTQSNTTVSAQGVIWKWPVNGRVLSHFIDQSNQQKGLILG
FT                   GAIGEPVRASAAGEVVYAGNGLPGYGNLLIIKHNSTWLSAYGYNRSLLVKEGQTVRAGQ
FT                   VVATMGRRDGRAKDKTGSLLFQIRRDGKPVDPMAYLPSR"
FT   gene            complement(585700..586578)
FT                   /locus_tag="Hneap_0550"
FT   CDS_pept        complement(585700..586578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0550"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: psa:PST_0849 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95404"
FT                   /db_xref="InterPro:IPR016634"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY81"
FT                   /inference="similar to AA sequence:KEGG:PST_0849"
FT                   /protein_id="ACX95404.1"
FT                   /translation="MVNHAEIAALKWDVRQRLTLLESTLLLTGWVRTQALVETFSISRA
FT                   QASKDFAVYMSLRPDNLKYNKSLKYYEAGDAFTPLLLTGSATDVLNALQVVNPQQTPVV
FT                   TLSAALPAIQVVQPLDRQLDWSVLRVVSQAIYQKRKLKAAYQSMNRNEPTELTLSPHHL
FT                   VFSGFRWHVRAFSDTHQAYRDFVLARFRGEPPQLLNETAISGDHDEAWHQTIDVIIEPH
FT                   PGLPESQRKILAEDYGMIDGTRCEPVRQALLPYFLRLMQIEPERQHPDPKIQQIILKNP
FT                   EQVQPFLWRNN"
FT   gene            586732..587064
FT                   /locus_tag="Hneap_0551"
FT   CDS_pept        586732..587064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmr:PMI2482 plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95405"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95405.1"
FT                   /translation="MNHVLDTTARTTSIDWAAVYEACRLHLVGIPYVHFIEAPEETLNR
FT                   LGMHDALEIMAAGFLPLLPAQAKVRQEIDAPKPVPKVSMARFDNKKITLRAPGVRGFSK
FT                   WVPRAS"
FT   gene            complement(587087..588052)
FT                   /locus_tag="Hneap_0552"
FT   CDS_pept        complement(587087..588052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0552"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: saz:Sama_0644 magnesium transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95406"
FT                   /db_xref="GOA:D0KY83"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY83"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACX95406.1"
FT                   /translation="MTTDFYTWHLQGDGTARLLTLSDETPCAGPVWIHLNYTRPETQEW
FT                   IRSRIDLDSTVQDTLLAEVTRPRALILDQGLLLTLRSINHNPGQEPDDMIGIRLWITPK
FT                   LIISTHLRSLRAVNTLQRDMETNNAPKDAGQFVTRLVELLNEDMLDTIEEIDELTDNYE
FT                   KIMLISEDVEPVSDRDLADLRTMILTLRRYLGPQRDALLSVIGSHLIWMKKGPIQRLRE
FT                   AENRLTRYLEVLDASRDQMRIIQEQLQTRSNNELNKQLTFLTALSAIFLPLTFITGLFG
FT                   VNIDGIPGNDGHPWAFSIFTLFLVSLAAVLIYLFKRARLF"
FT   gene            complement(588122..588712)
FT                   /locus_tag="Hneap_0553"
FT   CDS_pept        complement(588122..588712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0553"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: vok:COSY_0362
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95407"
FT                   /db_xref="GOA:D0KY84"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY84"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACX95407.1"
FT                   /translation="MLTSQEIAQLRADLVQTTTLMDKSLTLHSTWGLFSPREIDEGTRL
FT                   LMGFLDAPEPGQTIVDLGCGYGPIGLALAKAQPKADVILLDKDFVACEFAASNAKRNQL
FT                   NNVVVKPSNGLDALRGQHVDRIVSNVPAKVGKEMWSIMLWDAAEALNPGGDIWFVSING
FT                   LRDYFKRTFKEQFGNYEKIKQGQNYTIHRAVKS"
FT   gene            complement(588783..589244)
FT                   /locus_tag="Hneap_0554"
FT   CDS_pept        complement(588783..589244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0554"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="KEGG: tgr:Tgr7_3054 ferric uptake regulator, Fur
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95408"
FT                   /db_xref="GOA:D0KY85"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY85"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_3054"
FT                   /protein_id="ACX95408.1"
FT                   /translation="MICQNHHVCATSALAHAEAVCLARGARLTPIRRAVLMEIWANHEA
FT                   TKAYDLIARLSSEGSLIKPPTVYRALDFLLAHGLIHRIESLNAFIGCHHPDTQHQAILM
FT                   ICDRCGTINEAASEALNGILSALTHAEKFTVTHQSIELHGLCASCQKLA"
FT   gene            589563..590513
FT                   /locus_tag="Hneap_0555"
FT   CDS_pept        589563..590513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0555"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dar:Daro_4039 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95409"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY86"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACX95409.1"
FT                   /translation="MLPAAFSARVFAEENLVIAGPKVPDIKPTPLSENVFCIVSPWGFP
FT                   SVENQGMMSNVTFVNTKKGVVIIDSGASRQIGEMALRQIRQLTEAPVVAVINTHYHGDH
FT                   WLGNHAFVADNPDVSLYAHEKTISAIKTGQGEFWRNLMERSTDNATIGTAVTPPTLALS
FT                   HGDVLDFGDTKIKVHFYGTAHTPSDISLEIVGQNLVHVGDVAMDNRIAFMDDGSFRGTF
FT                   KNYDALEAAVPDALWIPAHGHPGKQVLEHNRELFEGIYQSAEKAVEQMGGQELAKSLAL
FT                   EDPRVKKYAPVTKGFDENIGKYTSLAYLEAESASF"
FT   gene            590651..591175
FT                   /locus_tag="Hneap_0556"
FT   CDS_pept        590651..591175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0556"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: pnu:Pnuc_0788 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95410"
FT                   /db_xref="GOA:D0KY87"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY87"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACX95410.1"
FT                   /translation="MSDGTLVRPLWPPLVAGLVLGLVLILTFVLVGNGVGASGTFASIA
FT                   AWLGMQIAPAATESNGYLGGMVANGANPFASWIVVEVVGVAIGALLAAVSAGRFKLKVD
FT                   TGAGKIGVWPRLALALIGGALAGFGSRLAAGCTSGVGLSGTTMLGIGGFIFLVVFFFVG
FT                   LGLSALLRRVW"
FT   gene            591175..591831
FT                   /locus_tag="Hneap_0557"
FT   CDS_pept        591175..591831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0557"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: pnu:Pnuc_0789 rhodanese domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95411"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY88"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACX95411.1"
FT                   /translation="MDYGVAGTALASGILFGYVLEQAGFGSPCKLTAQFRLTDWSVFKV
FT                   MFTAIIVASLGILLLQTGNYFGSKGFFVPTTFLWATASGAALIGAGFAIGGYCPGTSVV
FT                   GFMSGRIDGLVFMAGMVLGIFGFAYVYDSALIQFILHSAQFTAKTLPQYLGVSPWLIWV
FT                   VMVLVAVGGFALGRVLERRAHGVITAEDIVDGTDPTLSSDEQGSAVQGNLGSRAA"
FT   gene            complement(592036..592467)
FT                   /locus_tag="Hneap_0558"
FT   CDS_pept        complement(592036..592467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95412"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95412.1"
FT                   /translation="MYRSSTHMSRSDSIRIIGHRGRKDSRHGLPAHRDCHHDSQGRRGC
FT                   RLGSLVHRDSHRDWLVHKGCHHGSLVRTDSHRDWLVHKGCHHGSLVRTDSHPDWLAHKG
FT                   CHHGLPVRRDSHRDWQAHKGCHHGWLVRTDFHLGPELRE"
FT   gene            592488..593195
FT                   /locus_tag="Hneap_0559"
FT   CDS_pept        592488..593195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rce:RC1_1434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95413"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY90"
FT                   /inference="similar to AA sequence:KEGG:RC1_1434"
FT                   /protein_id="ACX95413.1"
FT                   /translation="MNSTLSSLDDYQAWMTQLSEPDFDELVSVAQEFFDINRSLSNDHQ
FT                   TILDELLKYEDDSPVIRWQHYPADDVQDPDTGAMYYYHAHAADERPQDEHGHFHLFIRP
FT                   EPSAQFSHVVGVSIDARGAVRSLFTTNRWVTDEYIRPAVDLVSMLPDAFVVNRARPSWL
FT                   VSRWLMMLVRLCEPQIRRLLNARDESLGWTGDGELPVDVAEDRSKNVLSEEFIDIYAVL
FT                   TLVQQVGLQRYSA"
FT   gene            593331..594320
FT                   /locus_tag="Hneap_0560"
FT   CDS_pept        593331..594320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0560"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: pnu:Pnuc_0792 rhodanese
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95414"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY91"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACX95414.1"
FT                   /translation="MNFKKFVFVPAVIAASFAAQAAYAVTVPGPLVDPAWLNAHLKDVK
FT                   VLQVSGTMKSFTTAPEMKEIKGKNVAVTVSGHVPGASFVDFKTVRVSRDIDGKMVKGVI
FT                   PDKAAFEKLVQSWGVNKGQPIVIVPKGLSTPDVDEATRLYWQLKYYGQDNMAILNGGMA
FT                   QWLADGMPAATDAPAVSAGNWVASAERKNILATYQEVKKAVEHPGAVEFADARPTNQYM
FT                   GVFTKPKELPGHLPGAKNVPPDLLTTADGASARFLPKASYESMFKTVGLNSGKEIIDYC
FT                   NTGHLASGLWFVTHEIVGDKKARLYDGSIVEYSMYDGAKMNDPAMLGK"
FT   gene            complement(594473..595366)
FT                   /locus_tag="Hneap_0561"
FT   CDS_pept        complement(594473..595366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0561"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   tbd:Tbd_2447 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95415"
FT                   /db_xref="GOA:D0KY92"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY92"
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /protein_id="ACX95415.1"
FT                   /translation="MSVKHPVVAVTGSSGAGTTTVKRAFEHVFRRESLSPVVIEGDSFH
FT                   SLSRMEFREAVKKAEAAGNFSFSHFGPEANHFDKLGELFKTYGESGTGKKRYYIHSDQE
FT                   AAEHNARLNTNLKPGEFTPWEDIPAGSDLLFYEGLHGLVKTDSIDASAHVDLGVGVVPI
FT                   INLEWIQKIFRDNAERGYSAEATVDTILRRMPDYVNHITPQFSRTDINFQRVPTVDTSN
FT                   PFITRDIPTPDESLVIIHFSNPKKAGADFPYLLSMIPNSFMSRYNTIVVPGGKMSYAMD
FT                   LILTPIIHNMIERRNA"
FT   gene            596032..596107
FT                   /locus_tag="Hneap_R0021"
FT                   /note="tRNA-Ala2"
FT   tRNA            596032..596107
FT                   /locus_tag="Hneap_R0021"
FT                   /product="tRNA-Ala"
FT   gene            complement(596413..596502)
FT                   /locus_tag="Hneap_R0022"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(596413..596502)
FT                   /locus_tag="Hneap_R0022"
FT                   /product="tRNA-Ser"
FT   gene            596841..597224
FT                   /locus_tag="Hneap_0562"
FT   CDS_pept        596841..597224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0562"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="TIGRFAM: peptidoglycan-associated lipoprotein; PFAM:
FT                   OmpA/MotB domain protein; KEGG: bmj:BMULJ_00650
FT                   peptidoglycan-associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95416"
FT                   /db_xref="GOA:D0KY93"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY93"
FT                   /inference="protein motif:TFAM:TIGR02802"
FT                   /protein_id="ACX95416.1"
FT                   /translation="MNGSGTDESVLYASAPKGDAATVYFGFDKYNVDPSYRPMLQQNAA
FT                   FLKENTQRHVLVEGNTDNRGSREYNIALGEKRAVAVRDTLLADGVAPSQVDVVSYGEER
FT                   PAVEGNNEAAWAKNRRADLAYGK"
FT   gene            complement(597323..600874)
FT                   /locus_tag="Hneap_0563"
FT   CDS_pept        complement(597323..600874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0563"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: pag:PLES_46651 exodeoxyribonuclease V gamma
FT                   chain; TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V RecC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95417"
FT                   /db_xref="GOA:D0KY94"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY94"
FT                   /inference="protein motif:TFAM:TIGR01450"
FT                   /protein_id="ACX95417.1"
FT                   /translation="MPPTTPITDEITPGFLLIQGNRLELLQQVLIDWLKRHPLAPLENE
FT                   TFLVQSNGMAQWLRLGLARPRSAQDGGLGIATGIEMILPARLQWQCYRAVLGTDFVPAE
FT                   APLDKDKLVWRLMRLLPNLIHTPSFLPLRHYIVTDQRPDDRRLYQLALRVADQFDQYQV
FT                   YRADWLRHWQEGHDDLPAHETRLPDEQRWQPPLWRALLADIRERQDDRDGIEFAAGRAD
FT                   LHTAFRKAASEQKARPEGLPRRIVVFGLSSIAPQVLDVLAVASRWSQVIVCFLNPCEYY
FT                   WGDIIDGHQLFAQRYQGRRPYKSAPNETAHAHPLLAAWGRQGRDLMRLLDQFEENAQLA
FT                   ANPLTLTPFESTVVDSAKSSLLTLIQDDILKLRTPDELRALNRRLEPDQDHSLHFHIAH
FT                   SPLREVEILHDQLLAAFEADTSLKPTDIIVMVPDMSLYAPAISAIFGRFGRDDPQHIPF
FT                   SISDQAASGQVALINALEQILNLPTSRLLRSELLDLLGSPLLLARFGISETDLTTLHDW
FT                   IDSAGIRWGLNAQHREAFGVPPGMEQNTWAFGLNRLLLGYLSGDENAIWDEIEPHPVMD
FT                   GISAELVGKLAQLVQQLDKYTQRLSEKCTPTEWVARLRRLMTDFFSLSDTQNHLDSPEI
FT                   QIEMDTLARLHNELERWLADCSVAGFENEIDIETVRHAWLNRLEPHRLHQRFIVGGVNF
FT                   ATLMPMRAIPYRHIYLLGMDDANYPRRQTPNDFDLMNGRYRPGDRARREDDRYLFLEAL
FT                   LAARERLSISWVGRNINNNKIRPASVLVSQLRDYLDQFWAVPEPHSCSEIQTTEHPLHP
FT                   FSRRYFSADNTDLFTFANDWRAVHDSTQGTSKTELPIWLPKEPLTLNTLSDFLRTPAHT
FT                   LLTKRFGVYLRPTATELEDHEPFELDGLQRWQLKKEINDRVRHQLAIQAHATSQMTTPT
FT                   IEHISALISTQYGQARLGGRLPIVSPAFEYSELLPLIDQWQRWLELNLRFHQTAAKSPV
FT                   LSIRSDRGIMLEASVPDVYSTESSIPNDTLARLIFIEGKLHRGQDIEWHKCVAQWPAHL
FT                   LAQLTHGSVETYLIGETGTLCFTPIEKEMAKQHLLTLLDAWFDAVQAPYPLACKTAFCL
FT                   LAQEMTPENTDSALKKARECFEGNMKVPGEVTNSPALARLWPDFSTLINGQSFAKKQFT
FT                   ELSQIIYAPIKDAIEAR"
FT   gene            complement(600968..601996)
FT                   /locus_tag="Hneap_0564"
FT   CDS_pept        complement(600968..601996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0564"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="KEGG: tgr:Tgr7_3175 sensory box protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   GAF domain protein; SMART: GGDEF domain containing protein;
FT                   GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95418"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY95"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACX95418.1"
FT                   /translation="MQEPLDLRDSDIVLLSILARETNLPRFFHIAANAAAKIVGADGAG
FT                   LILPEGEKLKYRFFEGLPPQFVALSQHAFDRSTGVAGAALAQNHPLFIEDYPNSDLALP
FT                   HFVESGLKASLSIPIRISDQIEAVLALSWFKPVGQSMSMRQLSLATLFGDFIGTALYRD
FT                   KIEQHLNRLAHSDPLTGLPNRAGFYPLLDQAILRAQDGDRHVALAIIDIDHFKTVNDTL
FT                   GHEFGDRLLMEISSRLAEALHREDKIARLGGDEIAILIESARHLKDLQDIVRRLSQALY
FT                   LRIGRDGEYVRISGSIGVCEIHPKETRNQNTLMCAADSAMYQAKRAGGNCAVFSAPPQP
FT                   DF"
FT   gene            complement(602125..602694)
FT                   /locus_tag="Hneap_0565"
FT   CDS_pept        complement(602125..602694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0565"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P ; Elongation factor P/YeiP protein;
FT                   Elongation factor KOW domain protein; KEGG: lhk:LHK_00710
FT                   Efp"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95419"
FT                   /db_xref="GOA:D0KY96"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY96"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ACX95419.1"
FT                   /translation="MKTAQEFRAGNVIMVGKDPMVILKAEFNKSGRNSAVVKMKMKNLL
FT                   TGSSTESVFKADDKFDQVILDKKECTYSYFADPLYVFMDSEFNSYEIEAENMGDTINYI
FT                   VDGMTDPCEVVFYNDKPISVELPTIIVREIAYTEPAARGDTSGKVMKDAKLTNGHEIQV
FT                   ASFIEIGENVEIDTRTGEFRRRASAA"
FT   gene            complement(602767..603915)
FT                   /locus_tag="Hneap_0566"
FT   CDS_pept        complement(602767..603915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0566"
FT                   /product="Uncharacterized conserved protein UCP015557"
FT                   /note="PFAM: Uncharacterised conserved protein UCP015557;
FT                   KEGG: ppf:Pput_3857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95420"
FT                   /db_xref="InterPro:IPR016633"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY97"
FT                   /inference="protein motif:PFAM:PF10093"
FT                   /protein_id="ACX95420.1"
FT                   /translation="MLTTERIDWDIFCRVIDNYGDIAVSWRLARILTEDHRQVVRLWVD
FT                   DLSALVHLIPEIDATEEQQSHHGITIIHWTDASATPRPARFVIEAFGCTLPEGYQQRMH
FT                   EQTVAWFNLEYFSAESWISDYHGRFSPQPNGLQKQFVFPSTRPDSGGLLREAHLFLARD
FT                   RFLHLEQTKWAHDWQIPLPNGLSLLLFGYENRAIGELIDDLAQTTTEAVTIYLPEGRLL
FT                   SSAREHLRYPELMAGDQFQRGAVTLHVLPFLPQAQFDRLLWMCDILFVRGEDSLVRALW
FT                   AGKPFIWQIYPTDDQAHWEKLDALLDTCRGDLPAPAFDAWRTLTHDWNRQQLAPESWQN
FT                   FIEHHALLASAAEKNRLTLASQTELSNWLVKTAYERLQCRTI"
FT   gene            complement(603916..605412)
FT                   /locus_tag="Hneap_0567"
FT   CDS_pept        complement(603916..605412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0567"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; NHL repeat containing
FT                   protein; KEGG: ava:Ava_3670 NHL repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95421"
FT                   /db_xref="GOA:D0KY98"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY98"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACX95421.1"
FT                   /translation="MPRIRPLFLPLLALPVIALMLWFMPPAANASGYPPFPAQTQWFNV
FT                   SKPLTGAQLQGRVVLLDFFTPGCINCIHMIPIQQQLKQKFGDDLLVVGVTSPKFTASQQ
FT                   ADNMTPFLRRYHVDEPVFIDSGMTWWQHYGVFAWPTMLLLNPEGKVIHSFVGERSYTDM
FT                   AAVIQSAVESARAANTLTHPKLPLKPLSADNHFMVLPTKIAVNDNRVAISDTGHDQVRI
FT                   FDHEGKLLATIGDGKAGFADGSFATAEFNRPQGIAWLGNDLYVADTDNQRIRRIDFASQ
FT                   TVSTVVGNGQRVFLNEVTAAAKDTPLNSPWGLEAVDGDLFIAMAGDHAVWRYDPKTRKL
FT                   DVYAGTGDEGLHDGERLLAQFAQSSGLAYHDHNLYVADPESSSIRQINMQTSLTITLVG
FT                   KGLFSFGDRDGAADQALLQHPQGLAYLNGALYIADTFNNAIRKLNLDTLQVSTVAKNLA
FT                   QPNGLAVLNDHTLLIADTYRDRIVALNIINGETTAWPPKK"
FT   gene            605669..607567
FT                   /locus_tag="Hneap_0568"
FT   CDS_pept        605669..607567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0568"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tbd:Tbd_2810 ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95422"
FT                   /db_xref="GOA:D0KY99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D0KY99"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACX95422.1"
FT                   /translation="MPLLTVDRLHFALGTRVLLDHVGLTVEPGERIALIGRNGMGKSTF
FT                   MKILAGLTRADEGEVRLEPGARIAYLQQDPQMDSTASVYATVAEALGGIEATLTAYHAC
FT                   IEKLGAGDDSVMDEMARLQQQIEAVDGWSVAQRIDEVITRLDLDPDASVKSLSGGAKRR
FT                   VLLAQALVVQPDVLLLDEPTNHLDIASIEWLEGLIRGFSGAVIFITHDRSFLQNLANRI
FT                   LELDRGQLTSWPGDYQNYLRRVEEREHAEQIQNAEFDKFLAEEEVWIRQGVKARRTRNE
FT                   GRVRRLEALREERAARVNKQGKVEVAVASSRTSGKIVFDGEHIDKTYNGKTILKDFALR
FT                   ILRGDRIGLVGPNGVGKSTLIKLILGEIQPDSGTARQGSQLQVAYFDQHRAQLRPDWTA
FT                   LQNICDGGDRIDVHGQNMHGIGYLQKFLFTPERARTKVESLSGGERNRLLLARLFAQSA
FT                   NLLVLDEPTNDLDLETLEVLEQVLLDFDGTLLVVSHDRAFLDNVVTSLLVFEGEGRVRE
FT                   VVGTYEDWLAIRDRENAQQSTSTPKPVAKTAPVANSPAKKDSLSFKERHELAALPEKIA
FT                   ELEDEQAQLTVQMSDPAFYAQPDDKTAPVLSRMAAIDEELLELMARWGDLEARATQ"
FT   gene            607592..607960
FT                   /locus_tag="Hneap_0569"
FT   CDS_pept        607592..607960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0569"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   ttu:TERTU_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95423"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA0"
FT                   /inference="protein motif:PFAM:PF02594"
FT                   /protein_id="ACX95423.1"
FT                   /translation="MNDSVESDFFHWQDDRLILKLKVQPRASRTAWGEVIGGRIKLYLT
FT                   TPPIDGKANQAVIDFIAKTFSVAKNRVEIRRGETSRSKDIALAWLTVPKASSSEAERLL
FT                   LQALSSKAIADSSEARLR"
FT   gene            608062..608937
FT                   /locus_tag="Hneap_0570"
FT   CDS_pept        608062..608937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0570"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 1.2; sigma-70
FT                   region 4 domain protein; KEGG: sml:Smlt4258 RNA polymerase
FT                   factor sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95424"
FT                   /db_xref="GOA:D0KYA1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA1"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ACX95424.1"
FT                   /translation="MNTAQHPVMPRTLPVVGDSLQQYLAEVRRIPLLTADEEQKLAEQL
FT                   KSTGDIDAAQKLIMSHLRFVVHIARGYRGYGLPLADLIQEGNIGLMKAVKRFEPEQKVR
FT                   LVTFAVHWIRAEIHEYILKNWRIVKIATTKAQRKLFFKMRQMKSGLGWLTADETRAIAA
FT                   ELNVPEREVVTMESRLYSHDIAIDAPVYDSEQEGSGPSYEQILVDQHQVSVEDMTAQRD
FT                   EDDRVTAMTHALHDLDARSRDILERRWLQEPKATLQTLADEYQVSAERVRQIENAALKK
FT                   LRLALPAPSH"
FT   gene            complement(608986..609630)
FT                   /locus_tag="Hneap_0571"
FT   CDS_pept        complement(608986..609630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0571"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: cps:CPS_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95425"
FT                   /db_xref="GOA:D0KYA2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA2"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACX95425.1"
FT                   /translation="MPDLMHHALTAFMAFLAMMNPVANAVIFLGLTADMGLATTRHVAW
FT                   RAVRTAFFIVLTFALFGPLVFSLFGITLPALRVAGGVLIALVGFRMLHGENSRVSHPKQ
FT                   IPSESGSEVDSSQNDIAITPLAIPVLAGPGTIATAMSYSPSGHWMQTGATILMFTLICA
FT                   LTFYAFVFSERILARIGRGGVAVITRLMGLILAVIGVQMLLDGLHQSGVFG"
FT   gene            609765..610328
FT                   /locus_tag="Hneap_0572"
FT   CDS_pept        609765..610328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0572"
FT                   /product="phosphatidylethanolamine N-methyltransferase,
FT                   putative"
FT                   /note="KEGG: afr:AFE_0594 phosphatidylethanolamine
FT                   N-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95426"
FT                   /db_xref="GOA:D0KYA3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA3"
FT                   /inference="similar to AA sequence:KEGG:AFE_0594"
FT                   /protein_id="ACX95426.1"
FT                   /translation="MIRTREWLNFAREFVKNPRHTGALCPSSVYLARQMAALVPDGEGK
FT                   VIELGPGSGPMTRALLKRGIKPDDLILVERTDSFAQLLRQRFPGLNIIHGDACGLSQLL
FT                   SGIEAPIRAIVSSLPLRSMPSSVVQQISQEINQISQPGTRYIQFTYHLHDNKLPFTGPF
FT                   SGSECHIVWRNFPPARVDAFDWKS"
FT   gene            complement(610397..610816)
FT                   /locus_tag="Hneap_0573"
FT   CDS_pept        complement(610397..610816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0573"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   bxe:Bxe_B2477 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95427"
FT                   /db_xref="GOA:D0KYA4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA4"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACX95427.1"
FT                   /translation="MGFQTAKENSDEMSEINMTPLVDVMLVLLILFMVTMPVLTQEIRV
FT                   TLPKTTSQTPVTAPKDPIDLAIRADGSLQWNQENLSDEAVTKRLVIAAKEQPQPVIRLY
FT                   GDAAVPYGKVMNVLASAKEAGITNIGFVTEPMPQK"
FT   gene            complement(610822..611535)
FT                   /locus_tag="Hneap_0574"
FT   CDS_pept        complement(610822..611535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0574"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   cja:CJA_1300 ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95428"
FT                   /db_xref="GOA:D0KYA5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA5"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACX95428.1"
FT                   /translation="MPHSFDLASLWQQSDLIIRSVALLLLAMSVLTWFYVLQRLSFMLR
FT                   LRGVSRRFEQFWHTQGYSEGLALLGKPGHINPFRTLADSAVEAVEHYYSHSTDLHSQLP
FT                   LSEWLSLSLTSKIDDIQEFFRQGMSALASIGAVAPFIGLFGTVWGIYHALENIGQTGSA
FT                   NLATIAGPVGEALVMTAFGLAVAIPAVLAYNAINRQNRQLIARVQRFAQQLHTYHVSGI
FT                   APTARAKANVQQWQE"
FT   gene            complement(611555..612367)
FT                   /locus_tag="Hneap_0575"
FT   CDS_pept        complement(611555..612367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0575"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: cja:CJA_1301 Uvs044"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95429"
FT                   /db_xref="GOA:D0KYA6"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA6"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACX95429.1"
FT                   /translation="MKAHLHQHTDPSRLPGLSRGNSILLLGLVIGLHGVVLYALLRSES
FT                   ISQPAQVSAPEAVMLGTLLTQPSPVIEPEPTPEPTPEPTPEPTPEPAPAPAPEPEPKPA
FT                   PKPAITEPKAKPEAKPLPRPTVKKSPPQTKARPTNKAVESLATVQHSLSDSSQAEKAPT
FT                   IATNPVPVQTPPPVVQPRLDARAGNNPPPDYPRAARKRGQEGTVVLSLVIGADGSVQDV
FT                   SVKRSSGYPLLDQSAVKAIRRWHFHPATQGGKAISWNYLQPIKFSLTD"
FT   gene            612638..614902
FT                   /locus_tag="Hneap_0576"
FT   CDS_pept        612638..614902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0576"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: mms:mma_3621 catecholate siderophore receptor Fiu"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95430"
FT                   /db_xref="GOA:D0KYA7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA7"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACX95430.1"
FT                   /translation="MIRSKKHEAAVVFLALGSAPLGVAHADNVALPTVNVSGKSERNDI
FT                   KVDQLSSPKFSQPLVDTPQTITIIDQALIKQQGATTLTEALRNTPGVSTFYLGENGNTT
FT                   TGDSVYMRGYDASSSIYVDGVQDLGAISRDMFNIEQVEVIKGASGTDYGVSSPSGSINL
FT                   VTKQANMRDSTAGSLELGQSYARATADVNRALDGVKGGAVRINVMGQKADVAGRDSIEN
FT                   NRGGVAASVALGLGTANRLWFDAMYLKQNNVPDGGVPTIGLPGYTSPDSKRPFLANAPA
FT                   VDPSNFYGTDSDYQKVTSSRYTLTLEHDFNPNTTLRNVTRWAQTQNDYLLTAFMGSAAN
FT                   WLTPDPSNPSTWTIARSLPTFLNQQNTILTNQTSLKTNLQTGSIQHDALVGVEFTRSKQ
FT                   NNLSYATQGAWPAANLYAPDPDVTGLTWDLNGGHAEGLSNTAAIYAFDTAHLTDRWLVT
FT                   GGVRLDHYRTSYNSVQACGVGRGAPACTGGAATGTLVNAADLSTSGNAVSWKLGTVYKI
FT                   TPDSSVYVNYANAQLPPGSANFQLSSNANSANNPDYAPQKTKTIEAGAKWDALDGRLGL
FT                   AAAVYQTEVLNGIVQDPVSLQYYQTGKQRVQGVELSAVGNITPDWQINAGWTLMDTKVT
FT                   SGSAVGNDPDDYQLNYTPRTAFTSWTSYRVTPKLTIGGGPRYTSMLQRGKDGAVGTPQY
FT                   ADSYWVVDAMASYQLTKAMSLQLNVYNLFNKEYVAAINKSGYRYTPGAPRTVRLTAAVK
FT                   F"
FT   gene            614994..615671
FT                   /locus_tag="Hneap_0577"
FT   CDS_pept        614994..615671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0577"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: mms:mma_3620 PiuC
FT                   iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95431"
FT                   /db_xref="GOA:D0KYA8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA8"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACX95431.1"
FT                   /translation="MMMHLAEVLDKATVADFRAQLEAADWVDGRQTVGAQGARVKQNQQ
FT                   LDVRSPIAMALGQRVLSALAQHPLYFSAALPKRVVPPLFNRYEGGEQYGFHVDGSVRHE
FT                   ADGALLRTDLSCTLFLAEPNEYEGGELVVHDTYGQHEVKLPAGDLILYPSSSVHAVMPV
FT                   TRGARVASFFWLQSMIRDDARRVQLFELDQTIQRLRTRIGDDAEVLHLTNLYHNLLRQW
FT                   AEV"
FT   gene            615671..618205
FT                   /locus_tag="Hneap_0578"
FT   CDS_pept        615671..618205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0578"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   PepSY-associated TM helix domain protein; KEGG:
FT                   pap:PSPA7_5127 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95432"
FT                   /db_xref="GOA:D0KYA9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYA9"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ACX95432.1"
FT                   /translation="MVSRTRLNPSLFMSPRTLFRWLHRWLGLFAGLILAIVGGTGAIMS
FT                   FQDDLLRWMNAGIMQVTVPEGATVLPLPDLLARIQAQKASPPIATLRVSTEPGESAWVG
FT                   FRARGKPAGEFVNPYTGDLLGKARGEAFFHTVENVHRRLLAGNTGKAITGASALVFLAI
FT                   MISGVIIRLRRAGLKYWFKPIGHGALAARTQSWHSVVGVWLLVPFLLVTSTGLFWSYDW
FT                   SRNLWLAATSTPKGKPAPYKMAEVSHSAPDLQAIADRLATLSANRVQIFWPNKPDEAMR
FT                   VLWQNSATPHQRAFNTLQLQPTTAEILADQPFVSLPFGTQIIRSMFALHSGEYFGLVGM
FT                   WMMFLVSLSLPLFFISGLWLYLRRRVRPRSKLVKFSGITPDTAPVLVVYASQTGTAQTL
FT                   AQMTAQRLEAAAQPVLFRSLDELTHAELSAASMALFIVSTYGDGEAPDQAQGVIKSLLG
FT                   KQQALPTLSFAILALGDRQYRQFCGFGIELRQSLLAAQATEWFPMLMADQADPVVLDEW
FT                   VSQLASVWGDETLTAAAPSPAWILSKRQHLNPAGMGFPTFEIELTATHTMRDEWQAGAL
FT                   IDIVPLQPTERVAQWLHAAGLEGSQRVLLDGVEQPLAEALRHHELPAISAGKPGHDIPT
FT                   WINTLRRLGARSYSIASLPTDGVVRLLVRQVQTPAGELGIASGWLTAHAPLGEKLTAQL
FT                   RQNPSFLPMVDPTVPCLFIANGTGMAGIRAQLEARIAVGAKRNWVILGERSPQDAYWLA
FT                   QWHLWESEVFIERLDWVFSQLPTSGAIRYVQHRLGEAHDSLKEYLDENAVVYVCGSATG
FT                   MAPAVESVLSNLLGTEVWQAFRRSGRYRRDVY"
FT   gene            complement(618276..620030)
FT                   /locus_tag="Hneap_0579"
FT   CDS_pept        complement(618276..620030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0579"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: mca:MCA1110 glucan biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95433"
FT                   /db_xref="GOA:D0KYB0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB0"
FT                   /inference="protein motif:PFAM:PF04349"
FT                   /protein_id="ACX95433.1"
FT                   /translation="MSKPTKKQTEQQPSEQAPSILTTQEYTRRSFLFTLANISGLVALG
FT                   FGNAQAAQESTATPVNEPTTPKTPAPAAVAPENGLKFAAAKPFSYKSLIARAQEMAKNP
FT                   YQAPPSPAADAIKTINYDASGKIKFNPKDALWGKSGSVYPITFRPLGEYFPKSVAMNVV
FT                   EGDQARMIEYRPDYFTMPEDSPLRQVPAGQSGISGFWVQRSRRIGDWTKSEPWATFQGA
FT                   SYFRAISRQGQVGMSARGIAINTGLPQGEEFPDFRAFWFEPAANEGDPVVVYALLDGPS
FT                   ITGAYRFELRFDGDTEMVIEKHLFIRKTIDQLGIAPLTSMFWYSETPNSHLRGWRPEVH
FT                   DSDTLVGWRSDNEHFCRPLTNPPSLAYSAFVDEHPRGYGLLQRDRDPSHYLDGVGYEKR
FT                   PSVWVEPIVDSKGNNNWGKGSVTLIEIPTNDETFDNMVAFWQIKGPALAGTALQFKYRL
FT                   YWTEHEPFFPRDQLARAVALRAGPGGNFGGSRPANTVKLVIEWDSQLFQGHQPKDAVFT
FT                   ITSSAGKTDNVQIDWVAGTPRWLTQFDLFVDSDTPVELNGVLTLNGEVISETWLYQFHR
FT                   QSFVQMMA"
FT   gene            complement(620062..622176)
FT                   /locus_tag="Hneap_0580"
FT   CDS_pept        complement(620062..622176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0580"
FT                   /product="glucosyltransferase MdoH"
FT                   /note="KEGG: maq:Maqu_1668 glucosyltransferase MdoH"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95434"
FT                   /db_xref="GOA:D0KYB1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB1"
FT                   /inference="similar to AA sequence:KEGG:Maqu_1668"
FT                   /protein_id="ACX95434.1"
FT                   /translation="MTDSAMPSTKDAFRGIALLRRWIFTAFVLLQTALGIWGMILVLPY
FT                   HGSTAIEKTILITFIPLYAFVAAGSWMALFGFYLRRRYKNRGDAHSLMSRFADRLPTTK
FT                   LVKTAVALPIYHEDVERVFRGLRASIQSVLATGQGEMFEFFILSDSRDPEIWLEERAAW
FT                   LALCNDLDLHGRVHYRRRRVNLKAKTGNVSDFLRRWGRNFKYFIVFDADSVMSGEALVT
FT                   LVRLMECEPKAGMIQTVPRLFNARSAFARMQQFVTHLYGPLFSEGLAALQLNEAVFWGH
FT                   NAIIRTEAFMAHCGLKSMRGFGLWRGTVLSHDFVEAAFIRRAGYEVWLETAIEGSFEES
FT                   PPSLDDELIRDKRWSKGNLQHLRFFGYERGIATAHRMAFMNGIFAYMASPVWFLFLLFS
FT                   TIEVAQFAAGDINYFPDTRSLYPNWPQWHPQWAIILVTSTLVTLFLPKVLALFDLLVFD
FT                   TGRRQGFGSTAKLLQGFFLENLFSILLAPIRMLAHSAYVVQAILNVTVRWAGQNRSSEI
FT                   GWLQALIRHAPGMILAITWSGIALYLDANFFYWTIPISLSLLLAAPITVWLSRFSLGDH
FT                   WRTQGIWRTPPEQNLGDQVLVDFAELDMPPLKPQNAPNWLNWTILHPNQARIAAALAPH
FT                   RSGAAKQASTELKEKLMVEGLHALPSRKAARILDDADAVMQLHQHAWMAPPDDPWGRQV
FT                   DHLTRLICIK"
FT   gene            complement(622173..622466)
FT                   /locus_tag="Hneap_0581"
FT   CDS_pept        complement(622173..622466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95435"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95435.1"
FT                   /translation="MNDTSPEVNPAPGNTQCEYPVAICGQLRWLQRRVFYQFLQTGCPT
FT                   IDLQANLDISDNQADLQQRLAIPIPQLCAMPPILRGSVKHAQPHAKHNRKPS"
FT   gene            complement(622463..624070)
FT                   /locus_tag="Hneap_0582"
FT   CDS_pept        complement(622463..624070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0582"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: tgr:Tgr7_2580 glucan biosynthesis protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95436"
FT                   /db_xref="GOA:D0KYB3"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB3"
FT                   /inference="protein motif:PFAM:PF04349"
FT                   /protein_id="ACX95436.1"
FT                   /translation="MFRRNTVPPVSPFSVRPAPSSTWPLRWKMVLGLFIASLTIATHEA
FT                   LAFGFQDAVIQAKQLASQSYSPDPQIPEALSQIDQNTFERIAIKPSASLWQTARFGIDP
FT                   ISAGYIYDQPVDLYEVTPDSVAPIVFDKTKFDWPSQAFAQTVPANLGFAGFSVHYPLSG
FT                   QDARDVMLTFLGGAQFSVVAANQVPGAHARGVAIDTGLPQGEQFPRFTKFWLVRPNPSD
FT                   LQLTIYALLDGKSLTGAYEFVIRPNGSRVDVHVTASLFPRTGISRLGLAPLSTMYFYGQ
FT                   TGQRPAGQWRPAAYESDGLLMHTGEGDWVFRSLQNPATLRVSEFAADGIRGFGFMQRQT
FT                   RFCQFEDAISRFERRPSLWVTTEAGFGKGKIVLVQIPTNSDLHENQIAFFQPAEVVDSA
FT                   HPVSFAYTLTAGNSDVAQEPLAQVRRPLIGTVKLAADDKTEKAYRVNLDFSGGRLSTLA
FT                   DNEPVIANIETKGTATVQEQAVIPLPEAGHWRLSMLLVPTGKSVVTIDASLALKKKVIS
FT                   ETWRYDLPSDLTRFGQMK"
FT   gene            624563..628069
FT                   /locus_tag="Hneap_0583"
FT   CDS_pept        624563..628069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0583"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /note="KEGG: tgr:Tgr7_1176 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   DNA polymerase III alpha subunit; PHP domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SMART:
FT                   phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95437"
FT                   /db_xref="GOA:D0KYB4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB4"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ACX95437.1"
FT                   /translation="MSFVHLHLHTEFSLIDGTLRIKPMLAAAKERGLPALALTDQANLF
FT                   AMVKFYEAARKSGIKPILGADCLVVDEPGSTPYRVVLLAQNNLGFRHLTELLSRGYCEG
FT                   QIQDRPMLRREWLTQEQCAGLIALSGGHLGEIGQLLLHGKARERKAAIKFWTERFPDRF
FT                   YLELTRCGRPDEEKYLHAAVELAEQAQLPVVATNDVRFLDQENFEAHEVRVCIQQGRVL
FT                   DDPRRPHDYTALQYLRPADEMQALFADIPEAIENSLAVAERCNVTLQLGKNFLPNFPTP
FT                   NGETEADYLRTLSEQGLAHRFERVPAEQHEAYRERLNIELDVIIQMGFSGYFLIVADFI
FT                   QWAKRQGIPVGPGRGSGAGSLVAWALLITDIDPIPYDLLFERFLNPERVSMPDFDIDFC
FT                   MEGRDRVIDYVAERYGRAAVSQIATHGTMAAKAVVRDVGRVMSYPYGFVDRIAKLIPMK
FT                   PGLDVTLEDALGRTERSQKEQERFSQEFRDLYERDEEVRAIVDMGMALEGLSRNVGKHA
FT                   GGVVIAPSKLTDFTPMYCESNGASAASQLDKDDVEAVGLVKFDFLGLRNLTIIDWALGS
FT                   INATRQKVGKEPVDITVIPLDDKPSFNLLKRCETTAVFQLESRGMKDLIRRLQPDTFED
FT                   IIALVALFRPGPLQSGMVDDFILRKKGEQKIEYLHPWLTDVLKPTYGVIVYQEQVMQIA
FT                   QILAGYTLGGADLLRRAMGKKKPEEMAKQREIFLEGAKSKQVDPTQAGYIFDLMEKFAG
FT                   YGFNKSHSAAYALVAYQTAWLKAHYPAHFMAAVLSADMDNTDKIVGLIGECQRMGLNVI
FT                   PPDVNHCAYKFQALDEHTVVYGLGAIKGVGEGVIQKIVEERQAGAPFVDMNDFCHRVGS
FT                   QALNKRVLEAMVLAGALDTLGPNRASLFAHIPDAMKAASQIQAAEAAGMGDLFGGFDAP
FT                   ETAIRVPIPALEPWPDAEQLRKEKDTLGLYLTGHPIHAFRDELKSLVSDTLSGLLDKLD
FT                   IPAPGTFPKGVPVTVAGLAIAERIVRQQNGDRQLFLTLDDGEGRCEVRITGDEIDRISA
FT                   QVERDQLVIVEGDAVFDNFSGGIRVRCKRLLVLEQARLEKARGIFLEFAADCNAAKAQA
FT                   LIERMRPMRCDGVPLSCRVYSDMAKAVVRLGPEWQIAPTDDNMQAIRSAPGVQSARVLY
FT                   QR"
FT   gene            628185..628421
FT                   /locus_tag="Hneap_0584"
FT   CDS_pept        628185..628421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rce:RC1_0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95438"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB5"
FT                   /inference="similar to AA sequence:KEGG:RC1_0855"
FT                   /protein_id="ACX95438.1"
FT                   /translation="MQIDHHDLAHEFPEHKDRIHTLKMENKHFANLFNKYHTINNEIEQ
FT                   AEKNDLPISDEHAETLKKQRLELKDQLYAMLIS"
FT   gene            complement(628681..628767)
FT                   /pseudo
FT                   /locus_tag="Hneap_0585"
FT                   /product="hypothetical protein"
FT   gene            complement(628854..629573)
FT                   /locus_tag="Hneap_0586"
FT   CDS_pept        complement(628854..629573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_3042 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95439"
FT                   /db_xref="GOA:D0KYB6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACX95439.1"
FT                   /translation="MSKSKTFNWSLGLATTAVALTLSANAFAYDASALKGAPKVEGVGM
FT                   NITNAAIKPWDISYFYDGTNLPDGKGTVTAGEKIYTEQCAMCHGDFGEGAHGYPKMVGD
FT                   PVDQFEASAKAGVDAVSNRGINNNWGNAPTLMDMIHRHMPFYAPGTLSVDEAYSVTCYV
FT                   MNLASIPGVGDDFVCDKTSLPKIKMPGEPLYVTNSGPDTANQRCMKDCYKGTPFVVEKA
FT                   ASIGNVSVGKVKAKDTQ"
FT   gene            complement(629551..630921)
FT                   /locus_tag="Hneap_0587"
FT   CDS_pept        complement(629551..630921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0587"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: tcx:Tcr_0156
FT                   Mo-Co oxidoreductase dimerisation subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95440"
FT                   /db_xref="GOA:D0KYB7"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030835"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB7"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACX95440.1"
FT                   /translation="MSENMINTVPEGTKKAGEASSDRRKFLRKSVALAAGGAAIAATSA
FT                   ANAGDGLKTWTTPLKNEPTRHMLGRGVVSVPYGLPSKYESGVVRRNVGWLTADTIASIS
FT                   FTPWQDLHGIITPNGLHFERYHAGAVDVDPSKHHLVVHGMVKQPMIFTVDDLKRLPSHT
FT                   AIHFLECPANGAMEWRGVQMDSMQFTHGMMSCSEWTGVKLTTLMEMVGVDPKATWFYGE
FT                   GTDGSALQRSVPMEGAVDQHGRPIPPEYTNHYRDAMVCYAQNGEALRPENGYPIRLFIP
FT                   GFEANISTKYLRRLMFVDKPLVTYQETKHYIEVLPNGMVRQYDLVNEANSVINYPCPDF
FT                   KMNGKGTYEIRGIAWSGYGKIAHVDVSVDGGKNWKQANLVEPVLNKCVTKFTLPFEWDG
FT                   QEALIMSRATDETGYVQPTLKQLREVRGFNSIYHKNSIQVWKIEKTGEVKNVQIENV"
FT   gene            631283..631774
FT                   /locus_tag="Hneap_0588"
FT   CDS_pept        631283..631774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0588"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   har:HEAR2146 molybdopterin converting factor, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95441"
FT                   /db_xref="GOA:D0KYB8"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB8"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ACX95441.1"
FT                   /translation="MKISVQTEDFDVNSVLAELRGRCAHVGAVACFLGTVRDMNDARDV
FT                   AVLTLEHYPGMTERALERVATEAKSRWPVAGVTIVHRYGALFPSDQIVLVAVASAHRHD
FT                   ALDACAFMMDYLKTHAPFWKKETDSSGATCWVDARESDAVARARWFADFDPPAVEPLVE
FT                   "
FT   gene            631833..633038
FT                   /locus_tag="Hneap_0589"
FT   CDS_pept        631833..633038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0589"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: pfl:PFL_4221 molybdopterin biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95442"
FT                   /db_xref="GOA:D0KYB9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYB9"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACX95442.1"
FT                   /translation="MQAIDRTQRQLIEQLAPITESELIPLETALGRFLAEDVYAEQDVP
FT                   ASDISLFDGYALSAPSACGSSRQVAGVTYAGDAPAVLPEGDFVWRIFTGAPLPDGANAV
FT                   IAQESVTSSDGRAVILHESMSVGAGVRPKGADSRRGQRVLCAGTRLDAAELGLLASIGC
FT                   AQILVVRKPRVAIFTTGNELVAPGEPLEPGKIYNSNHIILVSALTRLGVEIVDLGVLPD
FT                   EASAIRTALLAAAKHVDLVLTSGGVSVGDADLVRQVVSEIGTIESWRVFLKPGKPLAFG
FT                   RIGSVPFIGLPGNPVSTFVTFFLFVRPALRALAGGDPQIDRPPLNLPLAQDWVAGDRPE
FT                   FIRVRRERAASGETRLQPFGDQNSGLLSSIAWADGVALIPADRTLMCGDMVDYFPFEGW
FT                   YL"
FT   gene            633035..633514
FT                   /locus_tag="Hneap_0590"
FT   CDS_pept        633035..633514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0590"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: tcx:Tcr_0162 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95443"
FT                   /db_xref="GOA:D0KYC0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYC0"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACX95443.1"
FT                   /translation="MSNQQLTHIDETGAARMVDVGEKPHTERVALAESFIRMQPATLAL
FT                   ILSGGHKKGDVLAVARVAGIMAAKKTWDLIPMCHPLLLTKVAVTLTPDEQNHGIHILAE
FT                   CRLSGQTGVEMEALTAASVAALTLYDMCKAVDRGMVIEYTRLLEKHGGKTGSWVR"
FT   gene            634043..635029
FT                   /locus_tag="Hneap_0591"
FT   CDS_pept        634043..635029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0591"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: tgr:Tgr7_0336 GTP cyclohydrolase subunit MoaA;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   molybdenum cofactor synthesis domain protein; Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95444"
FT                   /db_xref="GOA:D0KYC1"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYC1"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ACX95444.1"
FT                   /translation="MSNLVDPFGRTIDYLRLSVTDRCDLRCFYCMPEGFNDFEVPEHWL
FT                   TADEIERLLGVMAEMGLRRVRITGGEPLVRRGIEDIVRRIDALPGIRDIALSTNATRLG
FT                   KMAAPLKAAGVDRINVSLDTLDADRFKQITQGKLSKVIDGLMAAKDAGLSPIKLNMVVM
FT                   KGVNEDDVESVLEFCIEHGFVLRMIETMPMGDTGRDALDHYISLQTIKQRLSERYPLIP
FT                   VINPVDGAGPARYLQIAGTDTQVGFITPMSEHFCGTCNRVRLSVDGTMYMCLGQEHNFS
FT                   FRPLLRNGIPDDELKEAIISAIGLKPERHEFQDKPEKVIRFMSMTGG"
FT   gene            complement(635192..636610)
FT                   /locus_tag="Hneap_0592"
FT   CDS_pept        complement(635192..636610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0592"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: csa:Csal_0796 protoporphyrinogen oxidase;
FT                   TIGRFAM: protoporphyrinogen oxidase; PFAM: amine oxidase;
FT                   FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95445"
FT                   /db_xref="GOA:D0KYC2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYC2"
FT                   /inference="protein motif:TFAM:TIGR00562"
FT                   /protein_id="ACX95445.1"
FT                   /translation="MNTHSNASEPINCPYLVIGGGISGLATAYHLSRMGKTVTVLEATS
FT                   RVGGAVGSIEEDGWLRELGPNSLVQTPEMAALMSALDLVSEIIEANTVAKKRFVAKNGH
FT                   PVALPGSPLELLTSPLFSMGDLWHLAREAWIKPVNKEETIAEFVRRRLGQGFLDWAVDP
FT                   FVSGVYAGDPNRLSVQAAIPKIYAFEQESGSLIRGGIAKMKAAKANPAPVTLPAKGKLF
FT                   SFKRGLQTLTDALATAITSSGRGNIQLDSAITNIQRLPEGGWSVKTVQGKTFHTRQLIL
FT                   STPAHVSAQLLGEVDGPLAETLAAIEYPPVTSVVMGFDRSEVAHPLDGFGLLLPSKEKK
FT                   RTLGVLFSSTLFPDRTPAGKVLLSAFIGGRKHPEAAQGDDQELLDRVLGDLSPLLGIKG
FT                   KPEFLRVKRWQQAIPQYEIGYLELQEKISQRLTALPGLSLNGNWRGGIAVGDCLNNGNK
FT                   LAERLIENTRTEES"
FT   gene            636735..637685
FT                   /locus_tag="Hneap_0593"
FT   CDS_pept        636735..637685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0593"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: tgr:Tgr7_0332 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95446"
FT                   /db_xref="GOA:D0KYC3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYC3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACX95446.1"
FT                   /translation="MTTIANRDQSKEVVILGGTGFVGRVLASLLSQQGYSVTIPTRHAA
FT                   RHRDMALMRGVRLIGGTPAAADMANDRREENWQEVLSEGSILINLIGILNEPRHNGEGF
FT                   EQAHVHTTQVALKAAAKAGVKRYLHMSALGADANNGGSFYLRSKGKAEDWAHEFGEQQG
FT                   IAVTSFRPSVIFGPQDSFLNRFAQLARLIPGVFPLACADSRFAPVYVGDVADQFMAAMT
FT                   DTSTIGKRIDLCGPTEYRLRELVAYAAKTSGHPRLVIGLPDWAARLQARVLEWVPGQPF
FT                   TRDNYDSLQTPSVCAEGCPHQTTRLERIAPGYLGK"
FT   gene            637943..638485
FT                   /locus_tag="Hneap_0594"
FT   CDS_pept        637943..638485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hneap_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   azo:azo1912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hneap_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACX95447"
FT                   /db_xref="GOA:D0KYC4"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:D0KYC4"
FT                   /inference="protein motif:PFAM:PF03350"
FT                   /protein_id="ACX95447.1"
FT                   /translation="MSNDSVAKPRGAVKHFESGFEHFLFASRWLMAPIYLGLVVAMGVL
FT                   LMKFGKEIWHLVTHVTSMDEGQVIVGVLTLVDVSLLMNLLIIIMFSGYENFVSKMEDLH
FT                   AHADRPDWMGSIGFSDLKIKLIGSMVAISGIELLKAFMNVDILTDRHLAWLVGIHVTFL
FT