(data stored in ACNUC1104 zone)

EMBL: CP001802

ID   CP001802; SV 1; circular; genomic DNA; STD; PRO; 5208602 BP.
XX
AC   CP001802; ABTV01000000-ABTV01000039;
XX
PR   Project:PRJNA29549;
XX
DT   28-OCT-2009 (Rel. 102, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Gordonia bronchialis DSM 43247, complete genome.
XX
KW   .
XX
OS   Gordonia bronchialis DSM 43247
OC   Bacteria; Actinobacteria; Corynebacteriales; Gordoniaceae; Gordonia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5208602
RX   PUBMED; 21304674.
RA   Ivanova N., Sikorski J., Jando M., Lapidus A., Nolan M., Lucas S.,
RA   Del Rio T.G., Tice H., Copeland A., Cheng J.F., Chen F., Bruce D.,
RA   Goodwin L., Pitluck S., Mavromatis K., Ovchinnikova G., Pati A., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D., Chain P.,
RA   Saunders E., Han C., Detter J.C., Brettin T., Rohde M., Goker M.,
RA   Bristow J., Eisen J.A., Markowitz V., Hugenholtz P., Klenk H.P.,
RA   Kyrpides N.C.;
RT   "Complete genome sequence of Gordonia bronchialis type strain (3410)";
RL   Stand Genomic Sci 2(1):19-28(2010).
XX
RN   [2]
RP   1-5208602
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Saunders E., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Jando M., Schneider S., Goeker M., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Gordonia bronchialis DSM 43247";
RL   Unpublished.
XX
RN   [3]
RP   1-5208602
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Saunders E., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Jando M., Schneider S., Goeker M., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (21-OCT-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 5eab57c56b8e891ea9c0c51256960fc8.
DR   BioSample; SAMN00002600.
DR   CABRI; DSM 43247.
DR   EnsemblGenomes-Gn; EBG00001220435.
DR   EnsemblGenomes-Gn; EBG00001220436.
DR   EnsemblGenomes-Gn; EBG00001220437.
DR   EnsemblGenomes-Gn; EBG00001220438.
DR   EnsemblGenomes-Gn; EBG00001220439.
DR   EnsemblGenomes-Gn; EBG00001220440.
DR   EnsemblGenomes-Gn; EBG00001220441.
DR   EnsemblGenomes-Gn; EBG00001220442.
DR   EnsemblGenomes-Gn; EBG00001220443.
DR   EnsemblGenomes-Gn; EBG00001220444.
DR   EnsemblGenomes-Gn; EBG00001220445.
DR   EnsemblGenomes-Gn; EBG00001220446.
DR   EnsemblGenomes-Gn; EBG00001220447.
DR   EnsemblGenomes-Gn; EBG00001220448.
DR   EnsemblGenomes-Gn; EBG00001220449.
DR   EnsemblGenomes-Gn; EBG00001220450.
DR   EnsemblGenomes-Gn; EBG00001220451.
DR   EnsemblGenomes-Gn; EBG00001220452.
DR   EnsemblGenomes-Gn; EBG00001220453.
DR   EnsemblGenomes-Gn; EBG00001220454.
DR   EnsemblGenomes-Gn; EBG00001220455.
DR   EnsemblGenomes-Gn; EBG00001220456.
DR   EnsemblGenomes-Gn; EBG00001220457.
DR   EnsemblGenomes-Gn; EBG00001220458.
DR   EnsemblGenomes-Gn; EBG00001220459.
DR   EnsemblGenomes-Gn; EBG00001220460.
DR   EnsemblGenomes-Gn; EBG00001220461.
DR   EnsemblGenomes-Gn; EBG00001220462.
DR   EnsemblGenomes-Gn; EBG00001220463.
DR   EnsemblGenomes-Gn; EBG00001220464.
DR   EnsemblGenomes-Gn; EBG00001220465.
DR   EnsemblGenomes-Gn; EBG00001220466.
DR   EnsemblGenomes-Gn; EBG00001220467.
DR   EnsemblGenomes-Gn; EBG00001220468.
DR   EnsemblGenomes-Gn; EBG00001220469.
DR   EnsemblGenomes-Gn; EBG00001220470.
DR   EnsemblGenomes-Gn; EBG00001220471.
DR   EnsemblGenomes-Gn; EBG00001220472.
DR   EnsemblGenomes-Gn; EBG00001220473.
DR   EnsemblGenomes-Gn; EBG00001220474.
DR   EnsemblGenomes-Gn; EBG00001220475.
DR   EnsemblGenomes-Gn; EBG00001220476.
DR   EnsemblGenomes-Gn; EBG00001220477.
DR   EnsemblGenomes-Gn; EBG00001220478.
DR   EnsemblGenomes-Gn; EBG00001220479.
DR   EnsemblGenomes-Gn; EBG00001220480.
DR   EnsemblGenomes-Gn; EBG00001220481.
DR   EnsemblGenomes-Gn; EBG00001220482.
DR   EnsemblGenomes-Gn; EBG00001220483.
DR   EnsemblGenomes-Gn; EBG00001220484.
DR   EnsemblGenomes-Gn; EBG00001220485.
DR   EnsemblGenomes-Gn; EBG00001220486.
DR   EnsemblGenomes-Gn; EBG00001220487.
DR   EnsemblGenomes-Gn; EBG00001220488.
DR   EnsemblGenomes-Gn; EBG00001220489.
DR   EnsemblGenomes-Gn; EBG00001220490.
DR   EnsemblGenomes-Gn; EBG00001220491.
DR   EnsemblGenomes-Gn; EBG00001220492.
DR   EnsemblGenomes-Gn; EBG00001220493.
DR   EnsemblGenomes-Gn; EBG00001220494.
DR   EnsemblGenomes-Gn; EBG00001220495.
DR   EnsemblGenomes-Gn; EBG00001220496.
DR   EnsemblGenomes-Gn; EBG00001220497.
DR   EnsemblGenomes-Gn; EBG00001220498.
DR   EnsemblGenomes-Gn; EBG00001220499.
DR   EnsemblGenomes-Gn; EBG00001220500.
DR   EnsemblGenomes-Gn; EBG00001220501.
DR   EnsemblGenomes-Gn; EBG00001220502.
DR   EnsemblGenomes-Gn; EBG00001220503.
DR   EnsemblGenomes-Gn; EBG00001220504.
DR   EnsemblGenomes-Gn; Gbro_R0001.
DR   EnsemblGenomes-Gn; Gbro_R0002.
DR   EnsemblGenomes-Gn; Gbro_R0003.
DR   EnsemblGenomes-Gn; Gbro_R0004.
DR   EnsemblGenomes-Gn; Gbro_R0005.
DR   EnsemblGenomes-Gn; Gbro_R0006.
DR   EnsemblGenomes-Gn; Gbro_R0007.
DR   EnsemblGenomes-Gn; Gbro_R0008.
DR   EnsemblGenomes-Gn; Gbro_R0009.
DR   EnsemblGenomes-Gn; Gbro_R0010.
DR   EnsemblGenomes-Gn; Gbro_R0011.
DR   EnsemblGenomes-Gn; Gbro_R0012.
DR   EnsemblGenomes-Gn; Gbro_R0013.
DR   EnsemblGenomes-Gn; Gbro_R0014.
DR   EnsemblGenomes-Gn; Gbro_R0015.
DR   EnsemblGenomes-Gn; Gbro_R0016.
DR   EnsemblGenomes-Gn; Gbro_R0017.
DR   EnsemblGenomes-Gn; Gbro_R0018.
DR   EnsemblGenomes-Gn; Gbro_R0019.
DR   EnsemblGenomes-Gn; Gbro_R0020.
DR   EnsemblGenomes-Gn; Gbro_R0021.
DR   EnsemblGenomes-Gn; Gbro_R0022.
DR   EnsemblGenomes-Gn; Gbro_R0023.
DR   EnsemblGenomes-Gn; Gbro_R0024.
DR   EnsemblGenomes-Gn; Gbro_R0025.
DR   EnsemblGenomes-Gn; Gbro_R0026.
DR   EnsemblGenomes-Gn; Gbro_R0027.
DR   EnsemblGenomes-Gn; Gbro_R0028.
DR   EnsemblGenomes-Gn; Gbro_R0029.
DR   EnsemblGenomes-Gn; Gbro_R0030.
DR   EnsemblGenomes-Gn; Gbro_R0031.
DR   EnsemblGenomes-Gn; Gbro_R0032.
DR   EnsemblGenomes-Gn; Gbro_R0033.
DR   EnsemblGenomes-Gn; Gbro_R0034.
DR   EnsemblGenomes-Gn; Gbro_R0035.
DR   EnsemblGenomes-Gn; Gbro_R0036.
DR   EnsemblGenomes-Gn; Gbro_R0037.
DR   EnsemblGenomes-Gn; Gbro_R0038.
DR   EnsemblGenomes-Gn; Gbro_R0039.
DR   EnsemblGenomes-Gn; Gbro_R0040.
DR   EnsemblGenomes-Gn; Gbro_R0041.
DR   EnsemblGenomes-Gn; Gbro_R0042.
DR   EnsemblGenomes-Gn; Gbro_R0043.
DR   EnsemblGenomes-Gn; Gbro_R0044.
DR   EnsemblGenomes-Gn; Gbro_R0045.
DR   EnsemblGenomes-Gn; Gbro_R0046.
DR   EnsemblGenomes-Gn; Gbro_R0047.
DR   EnsemblGenomes-Gn; Gbro_R0048.
DR   EnsemblGenomes-Gn; Gbro_R0049.
DR   EnsemblGenomes-Gn; Gbro_R0050.
DR   EnsemblGenomes-Gn; Gbro_R0051.
DR   EnsemblGenomes-Gn; Gbro_R0052.
DR   EnsemblGenomes-Gn; Gbro_R0053.
DR   EnsemblGenomes-Gn; Gbro_R0054.
DR   EnsemblGenomes-Gn; Gbro_R0055.
DR   EnsemblGenomes-Gn; Gbro_R0056.
DR   EnsemblGenomes-Gn; Gbro_R0057.
DR   EnsemblGenomes-Gn; Gbro_R0058.
DR   EnsemblGenomes-Tr; EBT00001789208.
DR   EnsemblGenomes-Tr; EBT00001789209.
DR   EnsemblGenomes-Tr; EBT00001789210.
DR   EnsemblGenomes-Tr; EBT00001789211.
DR   EnsemblGenomes-Tr; EBT00001789212.
DR   EnsemblGenomes-Tr; EBT00001789213.
DR   EnsemblGenomes-Tr; EBT00001789214.
DR   EnsemblGenomes-Tr; EBT00001789215.
DR   EnsemblGenomes-Tr; EBT00001789216.
DR   EnsemblGenomes-Tr; EBT00001789217.
DR   EnsemblGenomes-Tr; EBT00001789218.
DR   EnsemblGenomes-Tr; EBT00001789219.
DR   EnsemblGenomes-Tr; EBT00001789220.
DR   EnsemblGenomes-Tr; EBT00001789221.
DR   EnsemblGenomes-Tr; EBT00001789222.
DR   EnsemblGenomes-Tr; EBT00001789223.
DR   EnsemblGenomes-Tr; EBT00001789224.
DR   EnsemblGenomes-Tr; EBT00001789225.
DR   EnsemblGenomes-Tr; EBT00001789226.
DR   EnsemblGenomes-Tr; EBT00001789227.
DR   EnsemblGenomes-Tr; EBT00001789228.
DR   EnsemblGenomes-Tr; EBT00001789229.
DR   EnsemblGenomes-Tr; EBT00001789230.
DR   EnsemblGenomes-Tr; EBT00001789231.
DR   EnsemblGenomes-Tr; EBT00001789232.
DR   EnsemblGenomes-Tr; EBT00001789233.
DR   EnsemblGenomes-Tr; EBT00001789234.
DR   EnsemblGenomes-Tr; EBT00001789235.
DR   EnsemblGenomes-Tr; EBT00001789236.
DR   EnsemblGenomes-Tr; EBT00001789237.
DR   EnsemblGenomes-Tr; EBT00001789238.
DR   EnsemblGenomes-Tr; EBT00001789239.
DR   EnsemblGenomes-Tr; EBT00001789240.
DR   EnsemblGenomes-Tr; EBT00001789241.
DR   EnsemblGenomes-Tr; EBT00001789242.
DR   EnsemblGenomes-Tr; EBT00001789243.
DR   EnsemblGenomes-Tr; EBT00001789244.
DR   EnsemblGenomes-Tr; EBT00001789245.
DR   EnsemblGenomes-Tr; EBT00001789246.
DR   EnsemblGenomes-Tr; EBT00001789247.
DR   EnsemblGenomes-Tr; EBT00001789248.
DR   EnsemblGenomes-Tr; EBT00001789249.
DR   EnsemblGenomes-Tr; EBT00001789250.
DR   EnsemblGenomes-Tr; EBT00001789251.
DR   EnsemblGenomes-Tr; EBT00001789252.
DR   EnsemblGenomes-Tr; EBT00001789253.
DR   EnsemblGenomes-Tr; EBT00001789254.
DR   EnsemblGenomes-Tr; EBT00001789255.
DR   EnsemblGenomes-Tr; EBT00001789256.
DR   EnsemblGenomes-Tr; EBT00001789257.
DR   EnsemblGenomes-Tr; EBT00001789258.
DR   EnsemblGenomes-Tr; EBT00001789259.
DR   EnsemblGenomes-Tr; EBT00001789260.
DR   EnsemblGenomes-Tr; EBT00001789261.
DR   EnsemblGenomes-Tr; EBT00001789262.
DR   EnsemblGenomes-Tr; EBT00001789263.
DR   EnsemblGenomes-Tr; EBT00001789264.
DR   EnsemblGenomes-Tr; EBT00001789265.
DR   EnsemblGenomes-Tr; EBT00001789266.
DR   EnsemblGenomes-Tr; EBT00001789267.
DR   EnsemblGenomes-Tr; EBT00001789268.
DR   EnsemblGenomes-Tr; EBT00001789269.
DR   EnsemblGenomes-Tr; EBT00001789270.
DR   EnsemblGenomes-Tr; EBT00001789271.
DR   EnsemblGenomes-Tr; EBT00001789272.
DR   EnsemblGenomes-Tr; EBT00001789273.
DR   EnsemblGenomes-Tr; EBT00001789274.
DR   EnsemblGenomes-Tr; EBT00001789275.
DR   EnsemblGenomes-Tr; EBT00001789276.
DR   EnsemblGenomes-Tr; EBT00001789277.
DR   EnsemblGenomes-Tr; Gbro_R0001-1.
DR   EnsemblGenomes-Tr; Gbro_R0002-1.
DR   EnsemblGenomes-Tr; Gbro_R0003-1.
DR   EnsemblGenomes-Tr; Gbro_R0004-1.
DR   EnsemblGenomes-Tr; Gbro_R0005-1.
DR   EnsemblGenomes-Tr; Gbro_R0006-1.
DR   EnsemblGenomes-Tr; Gbro_R0007-1.
DR   EnsemblGenomes-Tr; Gbro_R0008-1.
DR   EnsemblGenomes-Tr; Gbro_R0009-1.
DR   EnsemblGenomes-Tr; Gbro_R0010-1.
DR   EnsemblGenomes-Tr; Gbro_R0011-1.
DR   EnsemblGenomes-Tr; Gbro_R0012-1.
DR   EnsemblGenomes-Tr; Gbro_R0013-1.
DR   EnsemblGenomes-Tr; Gbro_R0014-1.
DR   EnsemblGenomes-Tr; Gbro_R0015-1.
DR   EnsemblGenomes-Tr; Gbro_R0016-1.
DR   EnsemblGenomes-Tr; Gbro_R0017-1.
DR   EnsemblGenomes-Tr; Gbro_R0018-1.
DR   EnsemblGenomes-Tr; Gbro_R0019-1.
DR   EnsemblGenomes-Tr; Gbro_R0020-1.
DR   EnsemblGenomes-Tr; Gbro_R0021-1.
DR   EnsemblGenomes-Tr; Gbro_R0022-1.
DR   EnsemblGenomes-Tr; Gbro_R0023-1.
DR   EnsemblGenomes-Tr; Gbro_R0024-1.
DR   EnsemblGenomes-Tr; Gbro_R0025-1.
DR   EnsemblGenomes-Tr; Gbro_R0026-1.
DR   EnsemblGenomes-Tr; Gbro_R0027-1.
DR   EnsemblGenomes-Tr; Gbro_R0028-1.
DR   EnsemblGenomes-Tr; Gbro_R0029-1.
DR   EnsemblGenomes-Tr; Gbro_R0030-1.
DR   EnsemblGenomes-Tr; Gbro_R0031-1.
DR   EnsemblGenomes-Tr; Gbro_R0032-1.
DR   EnsemblGenomes-Tr; Gbro_R0033-1.
DR   EnsemblGenomes-Tr; Gbro_R0034-1.
DR   EnsemblGenomes-Tr; Gbro_R0035-1.
DR   EnsemblGenomes-Tr; Gbro_R0036-1.
DR   EnsemblGenomes-Tr; Gbro_R0037-1.
DR   EnsemblGenomes-Tr; Gbro_R0038-1.
DR   EnsemblGenomes-Tr; Gbro_R0039-1.
DR   EnsemblGenomes-Tr; Gbro_R0040-1.
DR   EnsemblGenomes-Tr; Gbro_R0041-1.
DR   EnsemblGenomes-Tr; Gbro_R0042-1.
DR   EnsemblGenomes-Tr; Gbro_R0043-1.
DR   EnsemblGenomes-Tr; Gbro_R0044-1.
DR   EnsemblGenomes-Tr; Gbro_R0045-1.
DR   EnsemblGenomes-Tr; Gbro_R0046-1.
DR   EnsemblGenomes-Tr; Gbro_R0047-1.
DR   EnsemblGenomes-Tr; Gbro_R0048-1.
DR   EnsemblGenomes-Tr; Gbro_R0049-1.
DR   EnsemblGenomes-Tr; Gbro_R0050-1.
DR   EnsemblGenomes-Tr; Gbro_R0051-1.
DR   EnsemblGenomes-Tr; Gbro_R0052-1.
DR   EnsemblGenomes-Tr; Gbro_R0053-1.
DR   EnsemblGenomes-Tr; Gbro_R0054-1.
DR   EnsemblGenomes-Tr; Gbro_R0055-1.
DR   EnsemblGenomes-Tr; Gbro_R0056-1.
DR   EnsemblGenomes-Tr; Gbro_R0057-1.
DR   EnsemblGenomes-Tr; Gbro_R0058-1.
DR   EuropePMC; PMC3497385; 22983974.
DR   EuropePMC; PMC4091373; 25024874.
DR   EuropePMC; PMC4222082; 24266988.
DR   EuropePMC; PMC4715301; 26779305.
DR   EuropePMC; PMC5974928; 29854410.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001802.
DR   SILVA-SSU; CP001802.
DR   StrainInfo; 12156; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083028
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Gordonia bronchialis DSM 43247
CC   Culture Collection ID :: DSM 43247, ATCC 25592, JCM 3198, NCTC
CC                            10667, LMG 5355
CC   GOLD Stamp ID         :: Gi02258
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Sputum of woman with cavitary disease of
CC                            both upper lungs
CC   Host Name             :: Homo sapiens
CC   Host Gender           :: Female
CC   Host Health           :: Patient with cavitary disease
CC   Body Sample Site      :: Airways
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Bacteremia, Endocarditis
CC   Habitat               :: Host
CC   Phenotypes            :: Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5208602
FT                   /organism="Gordonia bronchialis DSM 43247"
FT                   /strain="DSM 43247"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:526226"
FT                   /culture_collection="DSM:43247"
FT   gene            333..1862
FT                   /locus_tag="Gbro_0001"
FT   CDS_pept        333..1862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: sat:SYN_02051 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19362"
FT                   /db_xref="GOA:D0LA33"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA33"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACY19362.1"
FT                   /translation="MTSDRDTFGEVWQQVVAELNDDEAARDHEPLTRQQKAWLSLVRPL
FT                   TLAEGFALLTVPTPLVQEQIERNLRDTIRSALSKHLGQPVDLGVRIATPPAEEPVAEPI
FT                   PAVLPADDGLSAALTTGVPTPAPGAPFRGPGPVDPASERPRPDTGDWTAYFAERPTTAP
FT                   AVPSANLNPKYTFDTFVIGASNRFAHASAVAVSEAPARAYNPLFIWGESGLGKTHLLHA
FT                   AGHYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRRVAFKRRYRDVDVLLVDDIQFLMGK
FT                   EGIQEEFFHTFNTLHNASKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPDLETR
FT                   IAILRKKAQMDNIAVPDDVLELIASKIERNIRELEGALIRVTAFASLNNAELDKSLADV
FT                   VLQALLPNSGTLEISAASILAITAEYFDISVEELRGPGKTRSIAQARQISMYLCRELTD
FT                   LSLPKIGETFDRDHTTVMYAERKIRKEMAERRKVYDHVQELTARIKQRAVR"
FT   gene            2449..3615
FT                   /locus_tag="Gbro_0002"
FT   CDS_pept        2449..3615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gsu:GSU0001 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19363"
FT                   /db_xref="GOA:D0LA34"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA34"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACY19363.1"
FT                   /translation="MKFRVARDEFADSVAWVARSLPSRPPVPVLGCVVLGADDGLTISG
FT                   FDYEVSAQESIAAEIAEPGQVLVSGRLLADITKALPNKPVDVTLDGARVAIACGSAKFS
FT                   LPTMPVEDYPQLPDVPAISGTIPTQLFAEAISQVAIAAGRDDTLPMLTGVRVEIEGSTV
FT                   VLAATDRFRLAVRELQWEPTDPDTSGAVLVPAKTLSESAKTAGAEGTGVVSLAFGNGSA
FT                   IGNDGILGILGETKRTTTRLLDAEFPKFRQLLPASHTAIATIDSAPLIEAIKRVALVAE
FT                   RGAQVRLEFGEGSVLLTAGGDEAGKAEEELPVQFAGEALTIAFNPGYLLDGLSAINADT
FT                   VDFGFTTPSRPAVLRPSSGEQPAADESGAFAAPESAFTYLLMPVRLPG"
FT   gene            3643..4836
FT                   /locus_tag="Gbro_0003"
FT   CDS_pept        3643..4836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gme:Gmet_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19364"
FT                   /db_xref="GOA:D0LA35"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA35"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACY19364.1"
FT                   /translation="MFVRELHLRDFRSWRTADLELAAEPTVFTGRNGFGKTNILEALQY
FT                   LATLRSHRVSTDAPLVHSGATSALVTATVENSGRELTAQLRINAEGANKASINNGPPRR
FT                   AREVIGILRTVLFAPEDLSLVRGDPTDRRRFIDELVAQRGPLHVAARSDYDRVLRQRAA
FT                   LLKTAGAAMRRGGGDAASVISTLDVWDAQLAEHGAAVTAARVDVLNELRPHVTEAYASI
FT                   APHSRPTDLAYLPAAGPDVLPPAGARADVAAIGETLLAQLAQVRTKEIERGVCLVGPHR
FT                   DDVGIILGDDIAKGFASHGESWSLALALRLGSVALTRAEGVEPVIMLDDVFAELDATRR
FT                   RKLATFTSDAEQLLVTAAVAEDIPDEIGGRRIGVEVLDDADGRRSVLTPAAADTEGT"
FT   gene            4856..5410
FT                   /locus_tag="Gbro_0004"
FT   CDS_pept        4856..5410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   gbm:Gbem_3436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19365"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA36"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACY19365.1"
FT                   /translation="MSTDPTGTPGTPDELGGYERARRALEEARAAARAAGKSVGHGRAS
FT                   PVRRPASGNKKRRRWSGAGPDSRDPQPLGRLAGGVARERGWQAKIGEGTLFGMWDQIVG
FT                   ADIAAHAQPISLRDKVLHVQAESTAWATQLRYVQAQIIAKIAAALGDGMVTSLRITGPK
FT                   GPSWRKGERHVRGRGPRDTYG"
FT   gene            5755..7812
FT                   /locus_tag="Gbro_0005"
FT   CDS_pept        5755..7812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: DNA topoisomerase, ATP-hydrolyzing, putative /
FT                   DNA topoisomerase II, putative / DNA gyrase, putative ;
FT                   K02470 DNA gyrase subunit B; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; DNA gyrase subunit B domain protein;
FT                   TOPRIM domain protein; ATP-binding region ATPase domain
FT                   protein; SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19366"
FT                   /db_xref="GOA:D0LA37"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA37"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACY19366.1"
FT                   /translation="MADSKDTAGSKSKSKKSGEYSADSISILEGLEAVRKRPGMYIGST
FT                   GERGLHHLIWEVVDNSVDEAMAGYASKVEVTLLEDGGVEVVDDGRGIPTDMHATGSPTV
FT                   EVVMTQLHAGGKFDSDAYAVSGGLHGVGISVVNALSTKVELEINYGGFHWEQTYDHAKP
FT                   QPLEKGDATRKTGTLVRFWPDPEIFETTVFSAETVARRLQEMAFLNKGLTITLTDKRPR
FT                   AVEAPPGDANGDESVADAAETVKTEEEKKADAKPKTRTYHYPDGLVDYIKHLNRTKQPI
FT                   HNSVIGFTAKGTGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRAALTSTVNK
FT                   YALDKKLLKEKDGKLTGDDIREGLAAVISVKVGDPQFEGQTKTKLGNTEVKGFVQKTCN
FT                   EHLAHWFESNPAEAKIIIKKAVDSSQARLAARKARELVRRKTATDIGGLPGKLADCRSN
FT                   DPSKCEVYIVEGDSAGGSAKSGRDSMYQAILPLRGKIINVEKARIDRVLKNAEVQSIIT
FT                   AFGTGIHDEFDIAKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIEHGHVYLAQP
FT                   PLYKLKWQKREPEFAYSDRERDGLLEAGRTAGWKINTDDGIQRYKGLGEMNAKELWETT
FT                   MDPEVRVLRQVTLDDAAAADELFSILMGEDVAARRSFIARNAKDVRFLDV"
FT   gene            7861..10344
FT                   /locus_tag="Gbro_0006"
FT   CDS_pept        7861..10344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: tgr:Tgr7_1535 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19367"
FT                   /db_xref="GOA:D0LA38"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA38"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACY19367.1"
FT                   /translation="MTDTTLPPAGGEGDRVEPVDLGQEMQKSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRLLYASYDAGFRPDRSYVKSAKPVAETMGNYHPHGDTAIYDALVRLAQPW
FT                   SMRYPLIDGQGNFGSRGNDGAAAMRYTEARLTPLAMEMLRDIDEETVDFTPNYDGKTNE
FT                   PTVLPARIPNLLINGSGGIAVGMATNIPPHNLREVADAVIWALEHPDADDETTLAACME
FT                   AIKGPDFPTAALIVGSQGIRDAYTTGRGSIRMRSVVDIEENKGTTTLVVTELPYQVNPD
FT                   NLIQSIAEQVNEGKLKGISRIEDQSSDRVGMRIVVTLRRDAVAKVVLNNLYKHSQLQTS
FT                   FGANMLSIVDGVPRTLRLDQMIRYYVAHQIDVIVRRTRYRLRKAEERAHILRGLVKALD
FT                   ALDEVIALIRASANTEAARTGLMDLLEIDEIQADAILAMQLRRLSALERQKIVDELAEI
FT                   EREIADLQDILAKPERQRAIVRDELKVVVDKYGDDRRTKIIAADGDVTDEDLIAREDVV
FT                   VTITETGYAKRTKTDLYRSQRRGGKGVQGAGLKQDDIVKHFFVSSTHDWILFFTTKGRV
FT                   YRAKAYELPEANRTARGQHVANLLAFQPEERIAQVIQLKSYQDAPYLVLATRNGLVKKS
FT                   KLEDFDSNRSGGIAAINLRGEDELVGAQLCSADDDLLLVSQKGQSIRFHADDEALRPMG
FT                   RQTSGVQGMRFNADDTLLSLNVVREGTYLLVATSGGYAKRTGMDDYPVQGRGGKGVLTI
FT                   AHDRRRGELIGALIVDDDSELYAITSGGGVIRTAAKQVRKAGRQTKGVRLMNIDEGTTV
FT                   IAIARNADEPDDAGE"
FT   gene            10530..11480
FT                   /locus_tag="Gbro_0007"
FT   CDS_pept        10530..11480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG10555 gene product from transcript CG10555-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19368"
FT                   /db_xref="GOA:D0LA39"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19368.1"
FT                   /translation="MSTPKDRDKDQAGSATGGQTGVNTSGTGPGTGTPAGGLVPPWQRG
FT                   QTEQMTTRDQSDPGATAPIEKTGRDTVPGTRPDRGGPPQSDRGGPPQSERGGPPPRGIV
FT                   SSGTAAASISGQQAPVTNLENPLRGRTATATEEPERFVESPTSTIERDQLAGQKLPDLD
FT                   AIHHTEAKRAAAAEATTKPSARSAPTQVRANTPLRAAIQIRRIDPWATFKITAVLAVIG
FT                   FIIWMIAIAVLYLVLDGMGVREQVNTSFATVATADGSSAQSDDIFSATTVFGAAALLGA
FT                   INAILITALATIGSYIYNICADLIGGAEVTLADLD"
FT   gene            11543..11616
FT                   /locus_tag="Gbro_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            11543..11616
FT                   /locus_tag="Gbro_R0001"
FT                   /product="tRNA-Ile"
FT   gene            11682..11757
FT                   /locus_tag="Gbro_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            11682..11757
FT                   /locus_tag="Gbro_R0002"
FT                   /product="tRNA-Ala"
FT   gene            12075..12665
FT                   /locus_tag="Gbro_0008"
FT   CDS_pept        12075..12665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19369"
FT                   /db_xref="GOA:D0LA40"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19369.1"
FT                   /translation="MSDRQHSSWFDDIAPLPAGDRSPGHALADHLKRTRLATEAGSDLT
FT                   AFADSARPARADNRALQEWETLFEPPPRPRGPSGRFHQVRRIWDHHRLGVLGSAAAVVV
FT                   VVVSVLLVAALTGDDSDPAPAVAAASSSTTPGGDQVSAHPLRDCPSRTRGSVTTGNDPG
FT                   DQRSGPGVINVSGHVIPQVGGVVRHVIPHLSVT"
FT   gene            12781..14352
FT                   /locus_tag="Gbro_0009"
FT   CDS_pept        12781..14352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0009"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   sat:SYN_01900 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19370"
FT                   /db_xref="GOA:D0LA41"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA41"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACY19370.1"
FT                   /translation="MTQLLELFRHWYAGRSQVQISQALGLDRKTIRKYLASALAAGMSP
FT                   GTGDKFDESVWRELIGGWFPEVVDPSTRAVTWPPIAKHHKWISGQLDATVTVATIAQRL
FT                   RDDHGVDVSESSVRRYVTAHFADKINEKRATPPRPPVPAGEEAQVDYGKLGMWTNPETG
FT                   KRVSVWAFAIILSCSRWLFVQPVLKMDQTSWCASHVDAFEFFGGVPERIVCDNLKTGVS
FT                   KPDLYDPQINRAYAELASFYEVLIDPARAFTPKDKPRIERPMPYIRDSFFTGREFTSLP
FT                   QMQQAALDWCLNVYGRHAHRGIDGVPPAELFAQIERDVLTPLPPRRFERVTYHVGKVAP
FT                   DCHVKAGTALYSVPWRLIGSHVRVRTCGDMVQVFADDQVVATHVLHLSGRATNLEHYPP
FT                   HKVAYHSRPVAWCRKQAEEIGEHAVAVVAELSEVNAIHRLRAIQSIVGLRTKYPDDRIN
FT                   AACARAIAVGDVGPRTIKGILIAGTEYDDTITTPPVAPTPPAFLALLTDPWVMTGRGGL
FT                   VGGRRG"
FT   gene            complement(14309..15571)
FT                   /locus_tag="Gbro_0010"
FT   CDS_pept        complement(14309..15571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0010"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: tmz:Tmz1t_0333 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19371"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA42"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACY19371.1"
FT                   /translation="MQNATLWRALLGVEKTVVEDIEFDEDEQTLVACVRHTRRAGARCG
FT                   RCQRRSPWYDRGEGRRRWRALDLGTIQVHLEADAPRVNCREHGPTVRAVPWARHGAGHT
FT                   TGFDEQVAWLATQCSKSAVTELMRIAWRTVGAIITRVWADVEKLHDRFADLRRIGIDEI
FT                   SYKRGHRYLTVVVDHDTGRLVWAAPGRDKATLEGFFDALGEERCSQITHVSADGADWIS
FT                   TVVADHCPHAVRCADPFHVVRWATDALDEVRRAAWNQARGAATQRRAGRASGHAKALKH
FT                   ARYALWKNPENLTVRQQAKLAWVAKTDPRLHRAYLLKEGLRLVFQLPHAEAAEALEVWI
FT                   RWARRCRIPAFVELQRRIVKHQASILAAIEHGLSNGRIESVNTKIRLITRVAFGFRSPE
FT                   ALIALAMLNLGGHRPVLPGRS"
FT   gene            15796..16565
FT                   /pseudo
FT                   /locus_tag="Gbro_0011"
FT   gene            16605..16946
FT                   /pseudo
FT                   /locus_tag="Gbro_0012"
FT   gene            17010..18200
FT                   /locus_tag="Gbro_0013"
FT   CDS_pept        17010..18200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19372"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19372.1"
FT                   /translation="MNNDTRRGKHRRNIEARHHLRSSVTAAALAATIATGVGAGVAQGV
FT                   PEQGGTTPNNVPEQGGTMSGDAPQQTVPIVEPGPGSIPGPPREAPYQPYTAPDSTNYED
FT                   AYSPMPQERLTAPRPVRPVRPIAPPPKKIRIGNFVSDIPQGMSIRDVNSINAWSAYGES
FT                   KIAQGLISMGVPEDEASRQAAATIIGVMMGGTAGAVTAGVPAAVVGGVGGAVVGAGVGA
FT                   VIGYSLGGVNVGPGALIGAGVGAVAGAAVLGIPAAVVGAVTGGTIGGLIAYTLGAGDPG
FT                   ADAREPWQQDRPGAPRTAPLPNPQGNQFELRLSPDEARQVGLPAVDYVVTTRGDVRGQV
FT                   AGLRFGWSAEQARAPYRVLGAQAERVARDLTKQGAAQLKSTIPGVDIAWPQEEETR"
FT   sig_peptide     17010..17144
FT                   /locus_tag="Gbro_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.495 at
FT                   residue 45"
FT   gene            18197..18679
FT                   /locus_tag="Gbro_0014"
FT   CDS_pept        18197..18679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19373"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19373.1"
FT                   /translation="MIRRFGIAIVMAVAATMLVGTSAASAEPQLLRVALYGENIATGGD
FT                   HAYCRGAYGVRMVSPVGKRGVVRMTLLSHGFRGDGAAWKRDPHCRFLAIVSYTSSRTLF
FT                   SENVIPVSFSSRPGERVVRDLAIGSGPAKIEVGTYARNSRVRLLQSYPLVFWTVIP"
FT   sig_peptide     18197..18277
FT                   /locus_tag="Gbro_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.904 at
FT                   residue 27"
FT   gene            18750..19400
FT                   /locus_tag="Gbro_0015"
FT   CDS_pept        18750..19400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19374"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19374.1"
FT                   /translation="MVCGTAGGVGTSVIAALLADRRAATTLGESSWWIDAAGNDGDLEL
FT                   RTRASGDPDLLRTEFGTGLYLAREEDTISESVAYAWSRDAVPVVDVGARAMSVLPDLAE
FT                   GPLAELMIPVMVMSPRPDLLNRAKVFLDQWQRAGVLRRTIIVINPQVPDVDDHALREPL
FT                   VTAVSGQVAGVVAFEYDPVLGSGRALDRSAQPVLSPSTVAAVTELIAATSSSN"
FT   gene            19510..19977
FT                   /locus_tag="Gbro_0016"
FT   CDS_pept        19510..19977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19375"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19375.1"
FT                   /translation="MLVLCVVSAVARLSAAPAHADRGVPSVPNTPYGTSFGTFGNHDFC
FT                   RGAVHFGLSAPANKPGFVRVTLTSSGFTGQGAGWKRNSLCGVLLLESYMGSAGFRETPI
FT                   RASFGPRRGERVSRLIYTGSGPLNIGVAPYALNSAVRTPQGQGVGNFAIVP"
FT   sig_peptide     19510..19572
FT                   /locus_tag="Gbro_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            complement(20012..20218)
FT                   /locus_tag="Gbro_0017"
FT   CDS_pept        complement(20012..20218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_0942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19376"
FT                   /db_xref="GOA:D0LA47"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA47"
FT                   /inference="similar to AA sequence:KEGG:Csal_0942"
FT                   /protein_id="ACY19376.1"
FT                   /translation="MAIWALVLSVLGITSIIGIGLAFKARADIARNREEGDPYAVAALV
FT                   VGFFYVFVVVVGLCVFWWIRSGS"
FT   sig_peptide     complement(20135..20218)
FT                   /locus_tag="Gbro_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.813 at
FT                   residue 28"
FT   gene            20659..20835
FT                   /locus_tag="Gbro_0018"
FT   CDS_pept        20659..20835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19377"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19377.1"
FT                   /translation="MVAAGHPAGEHWARAEPAPTVPAGLAGESDRSCADRWDQADRDAT
FT                   AEAPDRRTDLDRQ"
FT   gene            complement(21232..21402)
FT                   /locus_tag="Gbro_0019"
FT   CDS_pept        complement(21232..21402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19378"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19378.1"
FT                   /translation="MPKKYLIAVVGAVVVGLSTGIAALLVQRSRREPPPVSATVPRVEQ
FT                   LSAADPETQSS"
FT   sig_peptide     complement(21334..21402)
FT                   /locus_tag="Gbro_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.503 at
FT                   residue 23"
FT   gene            21497..22018
FT                   /locus_tag="Gbro_0020"
FT   CDS_pept        21497..22018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0020"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mxa:MXAN_1176 peptidylprolyl
FT                   cis-trans isomerase, cyclophilin-type"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19379"
FT                   /db_xref="GOA:D0LA50"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA50"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACY19379.1"
FT                   /translation="MTTQNTTATIHTNRGDIKVDLFPNHAPKTVANFVGLADGSKDYSK
FT                   PNASGGNSGPFFDGSVFHRVIEGFMIQGGDPTGTGTGGPGYQFEDEFHPELQFDRPYLL
FT                   AMANAGPGTNGSQFFITVGPTPHLNRRHTIFGEVTDPASQQVVDAIATTSTDRRDRPLD
FT                   EVVIEKIEIA"
FT   gene            22037..22948
FT                   /locus_tag="Gbro_0021"
FT   CDS_pept        22037..22948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0021"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: rso:RS04802
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19380"
FT                   /db_xref="GOA:D0LA51"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA51"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACY19380.1"
FT                   /translation="MTMPPYTPPQAAVCYRHPDRPTGLSCSRCGRSACPECLRPAAVGQ
FT                   HCVDCLRNDGIQQSTATTPRRRWSSAVAGDTPYVTYALIVINLIVFGLCVAEAGITNPG
FT                   NAALMSDGSLVKGIVGEGEYWRLLTAGFLHFSVMHVAVNMISLYIIGRDLERALGTYRY
FT                   LAVYLISLLGGSAAVMLFEADNVQTAGASGAIYGLIGAMLVIVLKARVPATPVLVIIGF
FT                   NVVLSVSLPGISLMAHLGGLAFGVAATAAIVYLPGLVLPRARLDAASANRVAWAALVTL
FT                   LVVALGLGVGAGMLYDGPTILR"
FT   gene            complement(22961..23455)
FT                   /locus_tag="Gbro_0022"
FT   CDS_pept        complement(22961..23455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19381"
FT                   /db_xref="GOA:D0LA52"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19381.1"
FT                   /translation="MDNSVDRSWATPRAAAFALCAGGLILLGAAVLAAPDAVGLLMMGV
FT                   AGVLLIAFGGYALIIRPRLAIDDATPPRLVIRTIGGTRTYAPEEIDRIRLLSLRRVGRR
FT                   VGQLEFDLLPEAPVAHAGSGPREDTKLVVFSRWDLGADLLGVADELRRAGFDVEDARPL
FT                   A"
FT   sig_peptide     complement(23354..23455)
FT                   /locus_tag="Gbro_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.991 at
FT                   residue 34"
FT   gene            complement(23537..23827)
FT                   /locus_tag="Gbro_0023"
FT   CDS_pept        complement(23537..23827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0023"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19382"
FT                   /db_xref="GOA:D0LA53"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA53"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACY19382.1"
FT                   /translation="MPKSKVRKKTDYTINPASRTPVKVKAGPSSTIYVGVMLGLMLLGL
FT                   AWLVVYYLAATPSTFGDEGQALHWMANLNAWNFLIGFSLMVAGLLMTMKWR"
FT   sig_peptide     complement(23663..23827)
FT                   /locus_tag="Gbro_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.674 at
FT                   residue 55"
FT   gene            23979..24629
FT                   /locus_tag="Gbro_0024"
FT   CDS_pept        23979..24629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0024"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mei:Msip34_2513 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19383"
FT                   /db_xref="GOA:D0LA54"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA54"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACY19383.1"
FT                   /translation="MQRILVIDNYDSFVYNLVQYLGQLGVEAVVWRNDDPHVTGDQLAT
FT                   VIDDFDGVLLSPGPGTPQRAGVTMPMVGIAAEREKPLLGVCLGHQAIGAAFGATVDRAP
FT                   ELLHGKTSQVIHSDVGVLAGLPSPFTATRYHSLTVLPETIPDELVVTGRTDSGIVMAMA
FT                   HRELPIHGVQFHPESVLTQGGHRMLANWLAVCGIDVPEERVAALEAEMASAVG"
FT   gene            complement(24639..26546)
FT                   /locus_tag="Gbro_0025"
FT   CDS_pept        complement(24639..26546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0025"
FT                   /product="Serine/threonine protein kinase-related protein"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG:
FT                   dar:Daro_0438 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19384"
FT                   /db_xref="GOA:D0LA55"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA55"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY19384.1"
FT                   /translation="MMSTPHHLSDRYELGETLGFGGMSEVHYARDLLLHRDVAVKVLRA
FT                   DLARDPSFYLRFRREAQNAAKLNHPTIVQVFDTGEAETDEGPLPFIVMEYVEGETLRDI
FT                   LRANGPVAPRQAMTWMADVAAAMDFSHRNGIVHRDMKPANVMIDKSGAVKVMDFGIARA
FT                   MSDTSATMTQTSAVMGTAQYLSPEQARGIKVDPRSDIYSMGCVLFELLTGEPPFTGDSP
FT                   VAVAHQHVHEDPPWPSHVKPEIPRELDSVVLKAMSKNKDNRYQSAADLRADLIKVLAGG
FT                   KPSAPLLLSDEERTEFIDTGPRKAMRADTGGTHRREDGDAEPPRRRSRKLMFGAVAAVL
FT                   LLLAVLFVFWAPWSSDSARQVAVPDVAGLSAQDAQAALTKAGFQVKILDEPSTTIDAGH
FT                   ATHTAPGGDNVLAAEGSEVTLYISSGPPREKIPDVRGQTQDEAVASLNRLGFTNVKAVR
FT                   VDSTAELKDKVVETAPMIGMEVPVSGVVELRIGNGPKVVTVPNLVGQTQEQARIYLEQI
FT                   QLRMAVVQVDSDLPAGQIVSSSPNAGQEVDEGSVVQVSVSRGNMFVMPNLDGQTPAQAS
FT                   AALSRRGWQGTTLTQSPRNVPLVSPDGGKVVDQDPAPGSKVRKDGAISIVVGQPSLLPN
FT                   "
FT   gene            complement(26543..27880)
FT                   /locus_tag="Gbro_0026"
FT   CDS_pept        complement(26543..27880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0026"
FT                   /product="Serine/threonine protein kinase-related protein"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: azo:azo3774 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19385"
FT                   /db_xref="GOA:D0LA56"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA56"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY19385.1"
FT                   /translation="MTLQNGMTIADRYRLMRLIATGGMGQVWEALDTRLNRRVAVKVLK
FT                   AEYTNDPEFIARFRAEAQTTAKLNNPGIANVFDYGETPDRLGGEPLAYLVMELVDGEPL
FT                   NSVISRLGRLSLTNTLDMLEQTGRALQAAHSQGLVHRDVKPGNILITPAGQVKITDFGI
FT                   AKAVDSAPVTQTGMVMGTAQYISPEQATGDEATAASDVYSLGVVGYESLTGRRPFLGDG
FT                   AITVAMKHIRETPPPLPGNLPSGVRELIEITMAKDPRQRYANGGEFADAVAAVRAGRRP
FT                   PRPGTAAAAGVAAGAAAGAALGRTTSTAAATGRPPTSRASAPVPAQPDNSWTTGQKVLA
FT                   GVAAALLAGAIGLVAFWLLTNGTDDPSTPAPSTPTTVTETQTTTVEPTQENTQDTPTPT
FT                   RTRTTTTTTSEEPTTTTTTPPTSEVPETTDTGATTASPWFTIPSLP"
FT   gene            complement(27877..29364)
FT                   /locus_tag="Gbro_0027"
FT   CDS_pept        complement(27877..29364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0027"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: ppd:Ppro_2545 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19386"
FT                   /db_xref="GOA:D0LA57"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA57"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ACY19386.1"
FT                   /translation="MNKPIRRVSVAVIVMILALLANATYVQVFKADALRTDSRNDRILI
FT                   DEFSRQRGLITAGGTVIARSVPTTGRLKFQREYPRETALAFAPITGYFSFIYGNSQIED
FT                   AENGILNGSDDRLFGQRFMDMLSGRDPRGGNVVTTIDPRIQQLAYNALRNGPCDGPCRG
FT                   SLVALQPNTGKILAMVSTPSYDPNLLASHDSDAQIQSWNRLTGDPRQPTLNHAINQLYP
FT                   PGSTFKVITSASALRDDVTTDVRLTAAPSIVLPGTSQTLENYDGETCPGSSGGTVTLET
FT                   AFKFSCNTAFADLVTTKMKDATTVFTDTARQFGIDQPGPDIPMSVTESTVGSIRSADVL
FT                   AQSAIGQRDVRLTPLQNAVIAATVANGGVRMRPYLVDKLQAADLRTLNTTQPTTVNQPI
FT                   SADQASTLTRMMVLSEQETRGSGGAVSVASKTGTAELDDPNATPVTWYIAFGPSTNAQV
FT                   ALAVVVENGRNGVKSVGADLAPIGREVINAVVGGGGR"
FT   sig_peptide     complement(29293..29364)
FT                   /locus_tag="Gbro_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.666 at
FT                   residue 24"
FT   gene            complement(29361..30791)
FT                   /locus_tag="Gbro_0028"
FT   CDS_pept        complement(29361..30791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0028"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: gbm:Gbem_0490 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19387"
FT                   /db_xref="GOA:D0LA58"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA58"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACY19387.1"
FT                   /translation="MSQPTPASHAPPRQPNEQTGRNTELLLLVFAIGLVTVALLMVQAA
FT                   QDQPITLAILKYVGAYVLLFGAAHFVIRRYAPHADPILLPVVAVLNGLGLVLIHRLDLG
FT                   TASNDSPNPTEQTSNADQQLLWAFLGIIAFSAVLIVVRDHRTLSRYAYTLGLGGLVFLA
FT                   IPAILPASLSTINGSKIWIRTPFFNIQPGEFSKIAIIIFTAAFLVSKRDLFTTAGRHFL
FT                   GMDFPRARDLGPLLAAWVIAIGVLAFESDLGTSLLIFSTMLTMVYVATERVSWLVLGLT
FT                   LFALGAVLAYSLFSHLQVRVAIWQDPFADFYGSGYQIGQSLFGLATGGLLGTGLGSGRP
FT                   NSVPFANTDFIIATIGEELGLAGLTAILLLYLVLVMRGLRTGVAVRDSFGKLLATGLAF
FT                   TIAMQVFVVVGGVTKLIPLTGLTTPFMSYGGSSLLANYILLALLVRISDAAREPDPAKR
FT                   RPAPKPVESLPTQAVSKP"
FT   gene            complement(30788..32305)
FT                   /locus_tag="Gbro_0029"
FT   CDS_pept        complement(30788..32305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0029"
FT                   /product="Phosphoprotein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: sfu:Sfum_2540 protein serine/threonine
FT                   phosphatases; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19388"
FT                   /db_xref="GOA:D0LA59"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA59"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ACY19388.1"
FT                   /translation="MTLVLRYFTRSDRGLVRSNNEDSAYAGARLLALADGMGGHAAGEV
FT                   ASQLVIEALSSLDADEPGGDLLGALERATRAGNEAIAAQVERSPELEGMGTTLTAILFA
FT                   GNRIGLCHIGDSRGYMYRDGQISQITRDDTFVQTLVDEGRITAEQAHTHPQRSLIMRAL
FT                   TGTEVEPTLTVREARAGDRYLLCSDGLSDVVTEETLAETLGSFPDPRECADRLIELALR
FT                   GGGPDNVTVVIGDVIDTEYGESRPIVGGAAGGNEDAYTPNPTTAAGRAAALRPPPSDPQ
FT                   RPSVLDEPAPARKRSHLRRWLSLAVAALVVIALVVGFFVFRAVVYSNYYASADEGNVVI
FT                   NQGSPDEFLFRTMSRPAEKVCITSWQEGKIEFTSSNNVCQRPLRIGDLQQAGVASINGH
FT                   SIKNLSLQEVQNSINRIQLLPPCRATEPTPPQGPSPRTDGIPSTGTTGTLTPRQAPTPG
FT                   PRPGPATPENGDTSTTEYPAPPTSGAPETSGAPETSILPADVDCRQK"
FT   gene            complement(32302..32763)
FT                   /locus_tag="Gbro_0030"
FT   CDS_pept        complement(32302..32763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0030"
FT                   /product="Forkhead-associated protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce2902 GGDEF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19389"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA60"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACY19389.1"
FT                   /translation="MQGLVLQLTRIGFLLLLWLFVFAVIRTLRSDIAAAGGLRIPRYSG
FT                   GEKRRRSPAARGSARYLVVTHGALANTRISLGNQPVLLGRADDSTLVLTDDYASERHAR
FT                   LSRRGDDWYVEDLGSTNGTYLDRTKVTTPVKVPISTPIRIGKTVIELRP"
FT   gene            complement(32959..34260)
FT                   /locus_tag="Gbro_0031"
FT   CDS_pept        complement(32959..34260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0031"
FT                   /product="Forkhead-associated protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: eba:ebA2155 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19390"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA61"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACY19390.1"
FT                   /translation="MGILQRIERKLEGAVDDGFARVFGGQVAPQEIENGLQREAEESLR
FT                   DLGDGTILAANSYSLLFSPTDHDQIAAEYELNRKTFSKHLENFIKDNGWQTYGKVVVEF
FT                   DQSSSLHTGIFRARGTVNPDAEPRPVAAAAPGAPRGPGPRPQENAPLPVGAPDMTQNPG
FT                   YDQRRGADPAYGQQGGYDYQQGDYQQGEYQQGGYDQYGQQGYDQQGYDQQGYGQQQPGY
FT                   DQGYGQQPGYGQQGYDQGQPAGYGQQGYDYQQGGYDQGYGQQPGYGQQGYDQGYGQQGY
FT                   DQGYGQQPGYDQYGQQPGYGQQGYDQGYGQQPAYGQQPGYDYQQQDPAYGRAPAGYAPS
FT                   SITLLLEDGSNRTFQLHEGSNVIGRGQDAQFRLPDTGVSRRHVEIRWDGNTAMLTDLNS
FT                   TNGTTVNDVQVNSWELADGDRIRVGHSDITVRFQ"
FT   gene            34753..34838
FT                   /locus_tag="Gbro_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            34753..34838
FT                   /locus_tag="Gbro_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(35018..35803)
FT                   /locus_tag="Gbro_0032"
FT   CDS_pept        complement(35018..35803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_p0289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19391"
FT                   /db_xref="InterPro:IPR026001"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19391.1"
FT                   /translation="MSSKTNDLPYRVMKLATDMFARETGFSGPEIHEIFAEYTDALGPY
FT                   QGWGGGAMSRWQIFQAGLKSMPLQQQKTFLLELCSYDGGSRYGMPPDEEIEKLRSLLLA
FT                   DGTPGAKAASQGLEKLEDWQAVTKSWTAALGKVTSDPDGAITATRTTLESVCKHICDER
FT                   SVAYENSWDLAKLYKVAASAMEVSPDQHSEQIIKQILSGAATVVSGLAGMRNALSDAHG
FT                   RGKRSVGPAPRHAKLAVNAGFAIAGFLIDTHIEKPDRKA"
FT   gene            35965..39963
FT                   /locus_tag="Gbro_0033"
FT   CDS_pept        35965..39963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_1308 putative type II DNA
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19392"
FT                   /db_xref="GOA:D0LA63"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19392.1"
FT                   /translation="MRLSADKTVKWTAASAPDGVAPEKVYFGPDPHHLGGFQVAVARAA
FT                   SAPSRQVLRELFNARKGKTQVQLIIAILHDETAYMFGPDPQAQAVELPIEQAQRQLQSV
FT                   LAEPDVLAATERYAAFRKANDTTGVVGFTNSGLFATHHITSNVPKRSDWEALGKNAAPL
FT                   LSKRGRQLVEALGFGTSPGPNGTMLLSTGGHPPRAVAVLLDDSEHFDTKTQRFQLSPVA
FT                   FGLAVASRQEVPWLVVLRKDQIRLYPGRDGVGVGSKGQADTFFEVDLSTIDSEFAALLP
FT                   LVFSADALVADGTADGLLRDSARYATELGARLRERIYDEIVPPLAVEVAHRLAKNAGVK
FT                   LDADGLALAYRVTLHILFRLIFQAYAEDRGLLPSGRNEGFDANSLKTNARRLLDADTSD
FT                   FGDSSTIWFDLVQVWNAIDHGNPQWQIPAYNGGLFSTDPDRSPEGALIKRIELPDNVLG
FT                   PALKSLLIDINEDGVLGAVDFRSLSVREFGTIYEGLLESSLSLAEENLTVDKNGAWVPA
FT                   KRGDEVWARSGEVYFHTASGERKATGSYFTPKIVVDHLIERSIVPALGVHLQKIADHLN
FT                   NGDASAAARDFFDFRAADLAMGSGHFLVAAVDKIEALMRTFLTDHAVPGVVEELLRLAE
FT                   VARNALGTDDVAKSEVDEVGLLRRQVARRCVYGLDINPMAVELARLALWIHTFVPGLPM
FT                   SNLDHGLVNANSLTGIGTIDEALDALQPGRKPGEISLFDEILTDQLASSKTLLIDVASA
FT                   SEANKAEVQEGARMLARARASAATANKIFDAAVAARIGWIQPGLIVDKPSLQSVLERPE
FT                   TAKAAEQLNPAHMPYLFPEVFLRDRPGFDVILGNPPWETVKVEEQKWWGLRMPGLRSLP
FT                   QKQKRAGLVAFQKARPDLVDEYEAERQTVDAYATVLRTGPFVLGSGDIDLYQAFAWRNW
FT                   QLLRHAGRSAVVLPRTALSGSPLEHWRRLVLTKGSFTDVCFISNTGRWAFDMEPRYTIG
FT                   LTVVEKGGDRFVRWSGPFSSEQEFRNGADTVASVPCNEFSSWSDSVSFPLIPDAKSASI
FT                   FRQMKQSPRFDDARPGWEFRLTNELHSTNNRALYDFDLSKGAGKTPVLAGSSFNLWMPD
FT                   AGDPYAYSVTSKLRAHLKKKLAAQLRQRRSAYFGMTFGAKDLPMDHARIVFRKIARPSD
FT                   SRTSIACLIPPRNSITEAGQIVVTVQGDPKAEAYLLGVLSSIPFDWAARRWVELNFNFY
FT                   LMNPMPVPRYSPGTPLTKRMVEVAGKLAAADERYADWAAAVGVRVSSVKSAAEKESLIA
FT                   ELDALVSLLYGLEEDQVEHMFATFHRGWNYEARLDAVITHYREWKGKA"
FT   gene            39960..43421
FT                   /locus_tag="Gbro_0034"
FT   CDS_pept        39960..43421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0034"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   psa:PST_3195 ATP-dependent helicase HEPA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19393"
FT                   /db_xref="GOA:D0LA64"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA64"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACY19393.1"
FT                   /translation="MTQLPDFATNHASTEAGLTVADKVNELFCLLRENKVTAPPIAIAT
FT                   AYVNPAGFALLADELELAPRVRLLLGAEPEEESVRAITSGDSDQDARRDAAIEHHQAWL
FT                   EAERDTMGFARIPTAEAKRMVEWLKSMDVEQNPRVEVRRYSGGFLHGKTYLVEDNATQA
FT                   AIAGSSNMTYAGLARNAELNLGTGGGTGAAGKVREWFEHYWSQSDSYDLAELYGRLWDP
FT                   HTPWAIYLRMLWELYGEHLDSDENPEPHTRLELTRFQADGVVRMERLLDEHGGVLVADE
FT                   VGLGKTYLAGEVIYRTANINRQRVLIVAPAALKSSMWEPFLESYDFSRWVKVYSYEEVR
FT                   NRLDPDRGPVDAFLQEVADYSLVVIDEAHNLRNSGAQRSGAVDRVITAGGSKRVVLLTA
FT                   TPVNNSLTDLETLVKYFIRDDARFAALGIPSIREYIKQAQAMDPANLTPEHLFDLMDQV
FT                   AVRRTRKFVKEHYANELIRGADGKLTTLKFPQPKVRRIDYDLNDDGLALIDAMVYALDD
FT                   PTDPHASRAWEERSRDPQRLMLARYLSSMYTVDHDLQEYQITNAGLLRSGLLKRLESSP
FT                   QALHASLENMIASHESFLEALGKGFVLKGEALSEWVSSDSDDLDAFVAEFDNDEQIESV
FT                   DGYHLTELQGDVESDIALLCELRDLAHLVIEGVEPKVEQLVEELTTIAADAQRVDPRGL
FT                   SHADRRKVIVFSAFTDTIIPIHDAVVEAIQSAPAGSPLADYRARIAPPIMGSYAKTHER
FT                   GATGGVDQGGRASTIAGFAPATAGPRNAKGEPAAKDEFDILFTTDVLSEGVNLQQAGQM
FT                   INYDLPWNPMRIVQRHGRVDRIGSKHDYVHLGLFFPAERLDALLDLEARLEAKLALADA
FT                   AVGAGNVLPGRGPGHEVNLTDDQVTDEFEKLLDAGGSSASLSGEEYRRRLSSAFNMDPL
FT                   LKADILGLPYGSGSGFVNPVVNGNGYVFCIKIGKSPKPWFRYVPVDDDWSLRHNEDGHP
FT                   LISSDTLLSLRVADPQNASADRWLPDEVYDHAFDAWEVARDSVYNVWQELTDPNAFQPD
FT                   LPLSFRDAYALVFKRGGYLGRDAQIALANRLRSVPSAKVSRQVRGAINQGRTDEERIKL
FT                   ITEVLDEAGISAPPPREPLPDVEKHEVRLVTWLAVKGTRALEETAQ"
FT   gene            43418..44542
FT                   /locus_tag="Gbro_0035"
FT   CDS_pept        43418..44542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19394"
FT                   /db_xref="InterPro:IPR021754"
FT                   /db_xref="InterPro:IPR041650"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19394.1"
FT                   /translation="MTFDPRHSVDQSLHHLAQRLDPIIGTKLAPSLGGLPWPTVLSELD
FT                   KMKGKPPKSYSAADLQSQLRMITERLGKLGFPFDDYTRVVTTLGNELRIVRNRWAHHDD
FT                   LTTLDAWRASDFAVRLLEHFGDDQGAADARKLRDEAFDALVEAKVIAEHVAPTLTQPYT
FT                   EAAEPGAEAEPDSDVVRPDPFVLKRSDSANTPTIGSGRSEFEPWTVVVVGDVDVLDALP
FT                   KKVAKEQVRAVATEIAEFEGPIHINRLAQLTAASFGVQRLWPAREKKLVYQIKQTELVI
FT                   DGDKCVWPTDLDPATWTEFRPNDSTVDRPFTEISPAEIANAMRLLRADNPGISDADLDA
FT                   ATLRTFGRKRKTKQFAAQLERARHLVDQYLTFIN"
FT   gene            complement(44539..46048)
FT                   /pseudo
FT                   /locus_tag="Gbro_0036"
FT   gene            46296..46391
FT                   /locus_tag="Gbro_0037"
FT   CDS_pept        46296..46391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19395"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19395.1"
FT                   /translation="MSDRWADMPIFFAAAVGISNANGGVTQGRKN"
FT   gene            complement(46754..48361)
FT                   /locus_tag="Gbro_0038"
FT   CDS_pept        complement(46754..48361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19396"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19396.1"
FT                   /translation="MDIDVAQGDRRRVYQIKYFADGFSGDRKTSRQKQIKKSFDRACKL
FT                   SPLPFEWILVVPTKLTPGERKYVQSLERDDTPRVRIADRLELDDLIAQYPDVHQYLATD
FT                   QLKNDILLYGKETESLAGGTRSLTERIAALGGRGDAMDLHWGVNFARVGGMVELSAYPK
FT                   TPNAWRDSPISLSFATRFGPEHAELRRQFERSIQYGSGGTIVLPPEALSNVSITGPAAF
FT                   ATHDATGELRITTESLPNAEGRAAELRFVDENGALQSAHEGTVTYVNHGTQGWAITIEF
FT                   YDHAVIEIDQPDKAGDTGALHMTYNMRNIQPRQVIQLVDLLVNLHSTSTCEFYLEGQRA
FT                   GILGLDRLEFNNIDELGAIVGIAVDLEAVQPYCSSYFALPAEVSTWDRVNLRVARCMID
FT                   GYLIASPLVATGTVILTGTTSPELERILDAGGPVTYFVKDFHLELGERELPLGTIAVHH
FT                   PKARAINAEEAREALNSGTAEGFKLRLAPGDDPYFYVYIPNKLKNPHHPDIACWSLGGI
FT                   EQPGVNTEDPDWTTVIDR"
FT   gene            49629..50174
FT                   /locus_tag="Gbro_0039"
FT   CDS_pept        49629..50174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19397"
FT                   /db_xref="GOA:D0LA68"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19397.1"
FT                   /translation="MGIKVRQATVGESVREAAARVQASVPFRSEIVDRDAFGAIVHLLV
FT                   AYYHDTGRVDPLRALRRSNVDAYLMSRNRPARRTLRYLLYTAGRVWYPHEYPPAFTLDA
FT                   PRQIRTAPATDEEIDALYRVALTLGEKWEPALTVLVDLMYGVGARPEELKHLRREHIRV
FT                   ERHHGERWVVVTLQTGSS"
FT   gene            50325..51635
FT                   /locus_tag="Gbro_0040"
FT   CDS_pept        50325..51635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0040"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: pmy:Pmen_4491 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19398"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D0L2T0"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACY19398.1"
FT                   /translation="MLQRSAIADTICRTIELGVTITGAALDGEDRTHVFCEVLEPKNTC
FT                   PGCGLPGRLRDHIDREVADLPIVGHPTRLHISVPRYLCDNPDCPTTIFRADISTIVAPR
FT                   AQVTRRTTTWILRAMIVDKMSVTAVAAAIGMSWNTVNNLALDAARSLASAPARLDGVRV
FT                   LGVDEHKWKHVRGKGDSSFVTVLVDLTPIVDGTGPARLLDMVAGRSKAALKDWLTARDP
FT                   AFRDRIKVVTMDGFSGYRTATAETLDKARAVMDPFHVVHLAADKLTVCRQRVQQDTCGH
FT                   RGRSGDPLYGIRRPLLTRIGLLTDKQKTRITNGLQAREEHLAVAVTYAVYQDLIDAYDQ
FT                   PHKRDGKIAMYKLLKRIHTGVPKELAELAQLGRSLWARRTEILAYFDTGASNGPVEAIN
FT                   GRLEHLRGIALGFRNLNHYILRSLIHSGGLAEHLHAL"
FT   gene            51678..52019
FT                   /locus_tag="Gbro_0041"
FT   CDS_pept        51678..52019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19399"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19399.1"
FT                   /translation="MPVLDEQIGRELEYYAANARHDLLLAFGSAPTVERNGINRVNDRL
FT                   AERGQPERLNAQALRHAWIQEIVQLVPVSEFCYLAGVTSLHHMSDLDVVADATGDINEI
FT                   TAHFLEDGQ"
FT   gene            52016..53803
FT                   /locus_tag="Gbro_0042"
FT   CDS_pept        52016..53803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19400"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19400.1"
FT                   /translation="MSIHPSINHSEVHTSDRIFTQAVVVVNRSGAAAMIEAWRAESVAA
FT                   PRGPFRGALSYTVESVLVALACVLLRRAEPTVRTIFRTLLDFTPDQLAQLDIADADLTA
FT                   IRSDADRALKSFRNRLDRTLACLDSARDQPAVRIPVAQHKAIIRARTPEQQEAYAIAAQ
FT                   RLSTVVNRILAGSIPTEYQQSGRGDVVVDETIIDTSDGTYDLGVTDDRNRSAIYFGGYY
FT                   RRDYRNRVDAEGNPLTKKRAWGIGVTAVSSVGPPDALHNRPILFTGIAIHPPTSGSLEG
FT                   LDEAIEHHQRNGFDSRSASRTARWPLITFDMGYLKDGLDRWQFDRKYAGVFRYPDHWRR
FT                   DFESVPAQPGGAKPGPVQLSGAWYCPTAAGISLGKNYVKPLRDVLNKDEWEARERRLRQ
FT                   LLPRLMGVDRRLLERNTRPGRPAEGTQPAKSVKLVLTCPASIGNVRCARWHNAETEDRL
FT                   DLPYIEPEPDMPYFPCCTQRSVTITLTDDQRKRQQLSQWAPGSNDHAIYHEAARALTEQ
FT                   RFNLIKSRTVAGLVHLKYGPRREPLVKLIIAMAFAVVNVREIERFESSNRDLPESIAAK
FT                   WRRLEADLGQPPIRMPNRT"
FT   gene            complement(54227..55018)
FT                   /locus_tag="Gbro_0043"
FT   CDS_pept        complement(54227..55018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0043"
FT                   /product="Protein of unknown function DUF2236"
FT                   /note="PFAM: Protein of unknown function DUF2236; KEGG:
FT                   bbt:BBta_3751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19401"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA72"
FT                   /inference="protein motif:PFAM:PF09995"
FT                   /protein_id="ACY19401.1"
FT                   /translation="MAINNAGVTLDENSLLWRYLGDRRFIMSICRAVTLQMLHPSIAAA
FT                   THEFSLVKRRVFVHKQRTAPCIVRSAYDADFDEVRMIRYSHDEFHGHRPDGRRYHALNP
FT                   DVFFFEHATYVDALFMCVDVFFGGLTEPMREQLYAETCEWYRRFGISSRVMPTTVVEFD
FT                   EYFAHALATELDPDPGLAWYRDQLLRPDYWLFKKLPTAAVRAIQHPVAAEHLGISVSED
FT                   DRRSLHRYAARLSALDTVVPTRNIWPNEVRDRVIAARRSAR"
FT   gene            complement(55123..56097)
FT                   /locus_tag="Gbro_0044"
FT   CDS_pept        complement(55123..56097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0044"
FT                   /product="protein of unknown function DUF808"
FT                   /note="PFAM: protein of unknown function DUF808; KEGG:
FT                   csa:Csal_0752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19402"
FT                   /db_xref="GOA:D0LA73"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA73"
FT                   /inference="protein motif:PFAM:PF05661"
FT                   /protein_id="ACY19402.1"
FT                   /translation="MAGGLVALLDDIAALTKVAAASIDDIGAAAGKASVKAAGVVVDDT
FT                   AVTPRYVHGFTPDRELPIVRKIAVGSIRNKLLIILPVAMILSQFLPQALPYLLIAGGLF
FT                   LCYEGAEKVYEAFGGGHSGDHVDDVPAAEKGPEFEKSMVNGAIRTDLILSAEIMVISLS
FT                   SVESEPFFTRLAVLIVVAVLITVLVYGVVGVIVKMDDVGLSLAQRESTASQRIGRGLVR
FT                   AMPKVMSTLTVVGIAAMLWVGGHILIVNVGEAGFHWPADRLHDVEHWFEELAHGFGGVL
FT                   AWTSGTVVSALVGLVIGAIIVVVMHFIPKRRGHAKEEVADSAS"
FT   gene            complement(56216..56596)
FT                   /pseudo
FT                   /locus_tag="Gbro_0045"
FT   gene            56605..56703
FT                   /locus_tag="Gbro_0046"
FT   CDS_pept        56605..56703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19403"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19403.1"
FT                   /translation="MIGVMRPVVTGSGSAKAPQNVGPVRNVVFANL"
FT   gene            56728..57087
FT                   /pseudo
FT                   /locus_tag="Gbro_0047"
FT   gene            57115..58242
FT                   /locus_tag="Gbro_0048"
FT   CDS_pept        57115..58242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0048"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bja:bll2937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19404"
FT                   /db_xref="GOA:D0LA75"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA75"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACY19404.1"
FT                   /translation="MHTPICDDLGIEFPIFAFTHCRDVVVAVSKAGGFGVLGAVGFTPE
FT                   QLEIELNWIDEHIGDHPYGVDIVIPNKYEGMDADMSAEDLTKMLQSMVPAETLDFGRKL
FT                   LLDHGVPLNEDDDNSLQLLGWTEATATPQVEIALQHPKVSLIANALGTPPADMIEHIHA
FT                   AGRKVAALCGSPKQARKHADAGVDIIIAQGGEGGGHCGEVGSIVLWPQVVKEVAPVPVL
FT                   AAGGIGSGQQIAAALALGAQGAWSGSQWLMVEEAENTPVQQATYIKAGSRDTVRSRSFT
FT                   GKPCRMLRNDWTEAWEDPNNPDPLGMPLQYMVSGMAVAATHKHPDESIDVAFNPVGQVV
FT                   GQFEKVEKTAAVIERWVGEYIEATGTLENLAKESV"
FT   gene            complement(58370..58591)
FT                   /locus_tag="Gbro_0049"
FT   CDS_pept        complement(58370..58591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19405"
FT                   /db_xref="GOA:D0LA76"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19405.1"
FT                   /translation="MFGGTTNLVLLIVMIALGVAASACALTAAYLYLREHPDRDRDTRE
FT                   RLARRWLAVTAVLGFTIIVLRFVWVLLL"
FT   sig_peptide     complement(58514..58591)
FT                   /locus_tag="Gbro_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.596 at
FT                   residue 26"
FT   gene            complement(58593..59744)
FT                   /locus_tag="Gbro_0050"
FT   CDS_pept        complement(58593..59744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0050"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19406"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA77"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACY19406.1"
FT                   /translation="MSDDAVQGEADPRFSAVREVFAEQLASGTELGAAIAVDLDGESVL
FT                   DLWGGHRDAARTLPWERDTIVNVWSTTKEVTALAVLMLVDRGLVDLYAPVATYWPEFAQ
FT                   NGKESIEVRHIMAHTSGVSGWDKPFAPTDLYNWDFAVERLAGQAPWWEPGTASGYHAAS
FT                   QGHLLGEIVRRVTGKHLKQFVAEEIAAPLGVDLQIGATPDDDDRVAEIVPPPPPPEIDR
FT                   SSTSPAPLAVRTFTGPVTDAKAANTIEWRRADMGALNGHTNARALARTLSAISLGGTVG
FT                   GVKLLSEKTIEHIFDEQARGVDLVLGVPLRFGIGFGLPEPQTVPSLPDERICFWGGWGG
FT                   SVTAMFPDKRLTISYVMNRMGSGIIGSDRSDAYIGAILAALTD"
FT   gene            59852..60637
FT                   /locus_tag="Gbro_0051"
FT   CDS_pept        59852..60637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0051"
FT                   /product="peptidase M15D vanX D-ala-D-ala dipeptidase"
FT                   /note="PFAM: peptidase M15D vanX D-ala-D-ala dipeptidase;
FT                   KEGG: mxa:MXAN_6416 D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19407"
FT                   /db_xref="GOA:D0LA78"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA78"
FT                   /inference="protein motif:PFAM:PF01427"
FT                   /protein_id="ACY19407.1"
FT                   /translation="MNRRHLLRSVMTLLVIGLMAVGCGTDTPSSGAPSVSPSVSPKLSP
FT                   PGDVAPSRPTPVSVPPVSAAARAVGFIDVRTVVPDAIVDLRYATPHNFTGVTLYPRGAR
FT                   CLVHSSMGAGLKTAAQVLRRGGEVLVFWDCYRPHSVQQTMYEKVSNPAWVAAPGPYSRS
FT                   HESGRSVDVTIASHRANCRAARRIAEDCLAEMGTGFDSFTPAAMAYATDGVSAAAQRNR
FT                   ARLRNAMSAGGLAVYSGEWWHFDGAGADVRRPIIDVAPY"
FT   sig_peptide     59852..59929
FT                   /locus_tag="Gbro_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.410 at
FT                   residue 26"
FT   gene            complement(60670..61179)
FT                   /locus_tag="Gbro_0052"
FT   CDS_pept        complement(60670..61179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19408"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19408.1"
FT                   /translation="MPWIIAGVTAVVLIAVVAVVAVVLRSGSDSTTTAGASTTETNATE
FT                   SSATDTTQETTAETTTEPVTQLTGTWRGPAAGDQTGFDVVATISSEYPLAATVEYPQIG
FT                   CAGDWSEDSRQGQTLLLTETITSGTCVTSQITLTPVSDDELSFYSSYYSQSQSRTLVIT
FT                   STLRRQ"
FT   sig_peptide     complement(61114..61179)
FT                   /locus_tag="Gbro_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.582 at
FT                   residue 22"
FT   gene            complement(61340..62262)
FT                   /pseudo
FT                   /locus_tag="Gbro_0053"
FT   gene            62265..62366
FT                   /locus_tag="Gbro_0054"
FT   CDS_pept        62265..62366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19409"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19409.1"
FT                   /translation="MLLTFGDRQQRTAGIGHASPLRSEILRSPDAAG"
FT   gene            complement(62467..62820)
FT                   /locus_tag="Gbro_0055"
FT   CDS_pept        complement(62467..62820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19410"
FT                   /db_xref="GOA:D0LA81"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19410.1"
FT                   /translation="MSSLFIRTLQAHQWLYEHSGGLIGHRLLMGNPTLLLRTVGAKTGQ
FT                   PRCSALTYARDGDAYLVVASNRGSPRPPGWLANVKAQPDCEIQVGRTKLQVTARPTYPE
FT                   DADYARDSPSSTR"
FT   gene            62961..64514
FT                   /locus_tag="Gbro_0056"
FT   CDS_pept        62961..64514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0056"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pla:Plav_2083 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19411"
FT                   /db_xref="GOA:D0LA82"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA82"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY19411.1"
FT                   /translation="MLVPFTVTDFLNRAATVYPDRVGAVDEPAQPADSQGELIYAEIAD
FT                   LAQRQAAKLDELGIGVGERVAVVSHNSSRLLTSFYGVAGWGRVLVPINFRLRPDEISFI
FT                   VEHSGARVLHVDPELADALADVACEHKFVLGDDENLYAPPGSAPQPWDPDENALATINY
FT                   TSGTTARPKGVEITHRNIWVNAVTFGLHTTISDRDVYLHTLPLFHANGWGMPFAMTGVG
FT                   GRHILLRKVDGAEILRRVRDHGVTIMCAAPAVAAAVLEAAESWDGEIPGRDRVRIIMAG
FT                   APPPSKTVARVEEELGWEFIQIYGLTETSPLLTINRSRAEWDDLSTHDRATKLVRAGAP
FT                   ALGVQLRTEDADEGAGEVLARSNVVMNGYWQQPEETEAALDGGWFHTGDGGDFTDGYLT
FT                   IADRKKDVIITGGENVSSIEVEDCLFSHPGVAEVAVIAVPSEKWGETIKALVVRTPTDD
FT                   PDNAVTEAELIAWCKTHMAGYKAPTSVEFRDELARTATGKLQKFKLRSPYWENQERGVN
FT                   "
FT   gene            64638..66101
FT                   /locus_tag="Gbro_0057"
FT   CDS_pept        64638..66101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0057"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rfr:Rfer_0321 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19412"
FT                   /db_xref="GOA:D0LA83"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA83"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY19412.1"
FT                   /translation="MTTSYFAWDLAYRADTPCVRDDTMSLDYATFAERVEAVAEQLAAQ
FT                   GISRGDVVATFLPNRVELLLTLMAAWRLGAIATPVNPAFTPAEAAYQLDDARARLVVGD
FT                   PGCPSPDRVVVSPDALAERPSASWRPAAASAMSDDALLIYTSGSTGRPKGVRLAHENLH
FT                   YMGSAMVAHFSLTAADHALLVLPLFHVNAICVSFLAPILAGGRLSITGKFSPARFFDDV
FT                   ARLRPTYFSAVPTIYAMLISQAGLTAEAVASLRFAICGAAPISPDLLDAAERALGIPIV
FT                   EGYGLTEGTCASACNPVDGVRKPGTVGPALPGQHIDIVGPDGRTLPPGESGEVVISGPN
FT                   VMRGYLNRPDATASTVVDGRLHTGDVGRLDDDGYLTIVDRIKDMIIRGGENIYPKEIEN
FT                   ALATHPDVLEVAVVGAPDDLYGEVPVAFVVSYPDRQLAAGQLIAHVADRLAKIKLPSAI
FT                   HIVEQLPRNPVGKIDKPSLRSGLRDPQPV"
FT   gene            66184..66750
FT                   /locus_tag="Gbro_0058"
FT   CDS_pept        66184..66750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19413"
FT                   /db_xref="GOA:D0LA84"
FT                   /db_xref="InterPro:IPR021941"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA84"
FT                   /inference="similar to AA sequence:KEGG:sce5541"
FT                   /protein_id="ACY19413.1"
FT                   /translation="MGFTQPDFPQVDPDTFGDRPFTERLRVLGAHWAEYGFGTPKMVLV
FT                   IYLLKVFVFYAGVGITIATLTSGLNPLHVTEWWNEPIVYQKAVLWTVLVEILGIGGSWG
FT                   PLAGHFKPMTGGILYWLRPDTIRLPPWPGKVPFTAGDSRTPFDIAVYALILVNLVVALA
FT                   LPDGVAVQIQLLGGMEMTLLGGQEH"
FT   gene            complement(66841..68153)
FT                   /pseudo
FT                   /locus_tag="Gbro_0059"
FT   gene            68155..69759
FT                   /locus_tag="Gbro_0060"
FT   CDS_pept        68155..69759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0060"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: bja:blr1604 ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19414"
FT                   /db_xref="GOA:D0LA85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA85"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY19414.1"
FT                   /translation="MKGISFSVEAGECLAIVGESGSGKSVTARTLIGLTGDGARIDAAE
FT                   LGFDGQDLQDLTDRQWRAIRGGQIGFVLQDALVSLDQLRTVGAEIDEALGDYGRGGGGR
FT                   LNRALREERVIELLDLVGVPEPRLRARQRPHQLSGGLRQRALIASAIARNPKLLIADEP
FT                   TTALDATVQARILDVLAQAKARGNGIILISHDLAVVARIADRVAVLRDGEIVEQGTTEE
FT                   VLRRPAHEYTRGLLAAIPSRVSKGTLLVSGDSLAPAPPTPVGDSPPALRVRDVRKTFAT
FT                   GTRRAAVDGVGFDLLPGRTLGIVGESGSGKTTTARIVLGLTEPDEGSVELNGRPWSALR
FT                   PEQRRGSRHLISLIHQDPLSSFDPRWTVERIIRDSLRANGSAAGNLDARISRLLDQVGL
FT                   DDTFRHRRPLRLSGGQRQRVAIARALAPEPSIIVCDEPVSALDVSIQARILDLLATLQD
FT                   ETGVALVFISHDLGVIHHVSDDILVMRGGEVVEYGTADAVFETPQHPYTRQLLAAVPRI
FT                   DSGREQRSADAGLPSPV"
FT   gene            69756..70055
FT                   /locus_tag="Gbro_0061"
FT   CDS_pept        69756..70055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19415"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19415.1"
FT                   /translation="MSVSPTVPVVAAGLIGGFAAARFSGRRELGGAVLAAAGGWCTREW
FT                   ARQNPAVAGGLLATYLTAFGASHPLAKKIGAWPSVFAVTGVTAGATYLATSHNS"
FT   gene            70569..72287
FT                   /locus_tag="Gbro_0062"
FT   CDS_pept        70569..72287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Os01g0726700; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19416"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19416.1"
FT                   /translation="MFTLTDPVADDTGVSSMVSDAVVDAAREMQQLARRAEARTVLLAY
FT                   RIGHAVYQDMIADPSWNRTLGRRVRDMPDKAAIGQVSVRLGISRSTASRWITLGTHLQQ
FT                   LPAVRIAFLDGRHSLARTALMANALLLLDEDTRVGAEQLALTLSARPSADRVLREQLEE
FT                   LVIALDPDAAILARKDFAERHQNVVIGDDAHGHASIDATVPAEHGVYLTRRIADLIARH
FT                   LCADDPRRIGVQRVAALAHLIGLPGGHLACTCGNTTCPATPAPDPTADDDDCADHCDDD
FT                   TPTDTDEADTASSTPADADSDAGLDPTATNTTTDVDTSVDPAEAGVHTDTCSYPGSDAP
FT                   EAPEGPAVEVADTPTACDLGEQTALIVVTDPAGIEVPYLRGHGPIDPDHAEDLISNSIA
FT                   GQLLLPSGYSGLIVTGRDGPAPPIDPTGHGGYDLPPPGAGSQASGPIPPGAGSEASGPI
FT                   PPGAGSEASGPIPPGALTYRPSRAVRERVISHDRTCRYPQCGRPSDECELDHLVKFDPR
FT                   DPLTGGWSIFENLIPLCTPDHHRKHLGLWIPTMHTDRTITWRDPITGEIVITYPR"
FT   gene            complement(72324..72713)
FT                   /locus_tag="Gbro_0063"
FT   CDS_pept        complement(72324..72713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19417.1"
FT                   /translation="MVDTNWRYWQFLHRDTGAREWVGISRPDAWPRIDRIKVWTLLPDK
FT                   AVFVANWFVSQDHQLDVEERHWEHDSITGWDFCDAAIEAPLPSADDLRRITRPEAVLEF
FT                   AQIDRIPLKRIVSLREANRIADGRR"
FT   gene            72750..73499
FT                   /locus_tag="Gbro_0064"
FT   CDS_pept        72750..73499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0064"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mxa:MXAN_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19418"
FT                   /db_xref="GOA:D0LA89"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA89"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY19418.1"
FT                   /translation="MAPTDREIESIFRRVHQGLPREAPGSAETTALLVRMAGELPSDPT
FT                   VFDVGCGTGSATILLAELTGGRVTAVDVHEPYLAEVSRRAAEAGVGDRVSVMRESMDAL
FT                   PVPNGSIDLLWAEGSAYVLGFAAALAAWRPLLSDTGVLVLTEAEFITPDPGEEAAAFWS
FT                   AGYPAMRSTAQNVAAAQKRGWEVRAVYVLPDSDWDNYYAPLRARIAELEREGVDSEVLA
FT                   MAGAEIGVRERCGGDYAYTGYVLRPRS"
FT   gene            73813..74613
FT                   /locus_tag="Gbro_0065"
FT   CDS_pept        73813..74613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0065"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rme:Rmet_3982 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19419"
FT                   /db_xref="GOA:D0LA90"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA90"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY19419.1"
FT                   /translation="MDPAGKVAIVTGGGGGIGGAIARELVARGARVVITDLDATTAAAV
FT                   ADALGDAATWTAGDASDAAHIDDAVALAESTFGPVSMYFANAGVGIGGGLDTPDDVWDL
FT                   AFGVNLMGHVRAARRLVPDWVERGEGYFVSTASAAGLLTQLGNAPYSVTKHAAVGFAEW
FT                   LSITHGDDGVRVSCLCPMGVDTALLRPKGGVAEEGQQMMQRAVETAGAVLTPEQVARDV
FT                   LDAVAAEDFLILPHPEVLEMYRHKGADYPRWLRGMRRFQRSLRT"
FT   gene            75150..75842
FT                   /locus_tag="Gbro_0066"
FT   CDS_pept        75150..75842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19420"
FT                   /db_xref="GOA:D0LA91"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19420.1"
FT                   /translation="MNAPQPPDGQPQYPPPGQGRGGGQPGYGPGPGTPPGYGPGPGTPP
FT                   GYRPQGPGGQPGHGPVPGAPQGYGQPPRPAYQPGPAPQAPQQAAYQQPPQQQGAPGGAQ
FT                   GLSLNTMFFPLAWIFFLIKPKVEIDGHQYPNAVWGVNNIPLPPGQHHVHVHAPYLIPTK
FT                   VGPVDTTINVAPNQVVQLEYKLPVFIFSQGAIGPSPQPYNGVGAAVALFVIPFVLVFLL
FT                   ILLPLLFI"
FT   gene            75992..76465
FT                   /locus_tag="Gbro_0067"
FT   CDS_pept        75992..76465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0067"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: oan:Oant_1327 deaminase-reductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19421"
FT                   /db_xref="GOA:D0LA92"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA92"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACY19421.1"
FT                   /translation="MAYGFPEAQGAVLASFISECTGILLGRRTFEMFAPAWSTRDATYD
FT                   PGAPFFNDTTKHVVTSASSVDGWQNSEVLGPYDADAIRGLKSAENLYVSGSGTLVRAQL
FT                   VDKLVDELHLLVYPVVLGRGARLFENSNEIGLRLVSHDVFDNGVIHLSYGPAE"
FT   gene            76497..79100
FT                   /locus_tag="Gbro_0068"
FT   CDS_pept        76497..79100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0068"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: vap:Vapar_3549 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19422"
FT                   /db_xref="GOA:D0LA93"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA93"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACY19422.1"
FT                   /translation="MGYVSGKWPLVERRVEFDAARGALTTRTPERCGVVLTGSAGVGKT
FT                   TLARQVTQSLPNVRWVVGSESARAIPLGAFAPIVPPSTATDAVGYLSAARESLLDAGAV
FT                   ILGVDDAHLLDPLSATLLHQLAIDGDARIIATVRSGETVPDAVLSLWKDHYLERIELDA
FT                   FTREQSIDLLEQMLGGPVEGLSVDLMWEASGGNALFLHHLVDGAREAGTLRRDAGIWQL
FT                   RGNASITTEFATLLESRITSLPDGVNNALNLLSLCEPIEVDMLVDLAGEDEVEEAERRG
FT                   LLRITEDGRQLVARFAHPLLGEVVRRRIGRLRGRRLRGQLANAIAARGRPRSGPGRIRL
FT                   ADLAIDGDSDADSRIMLDAARSALALSDVAAAERFARAAVEHGAGIDGLDLLSRSLLWQ
FT                   GRPDEVEATMAAIDPETLDEVGVLRWALTRLANFDFAQGDGHGGDDMLALLRARIHTPS
FT                   LVLLVDAVASVRAMMAGELEAAAEQARRVLRDDAVIPAAAYWAAFAAQRSMALTGEFDE
FT                   VAEIARHVDIPPSMDGLVRYSADFGELQALIYAGRLTDARTLAEGCAQFSSPGQYLAWG
FT                   MVQTFVGVLEVAEGRYEHAVRSLRQATAALTSDVMSAWSFPARIALCTILAQLGRCDEA
FT                   KQLAASVRSDLRPHVAVFEPFQRVAEAWIAAGEGQLSEAITIARAAAAVAASSCGRAIA
FT                   AEALHASARLGDPDAADMLAELSTHVDGELIGIYTRHAAAVASKGAAALEDCSREFEEL
FT                   GARASAADAAAQASTALADGGERTAAVRAAGTAHRLAAECGGLVTPAMITMEDPLPLTV
FT                   REREIANLVAAGLSNREIGERLSLSTRTVEGHVYRACMKVDVEDRAGLAARIRAR"
FT   gene            complement(79113..80336)
FT                   /locus_tag="Gbro_0069"
FT   CDS_pept        complement(79113..80336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19423"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19423.1"
FT                   /translation="MSWSRGTLRFSTLAGTAVAAAAVPLIVFGAGVALAEDGSPGGGDS
FT                   TSSDSSSGNSSSGDSAGSDSSTTDSGDGNSGSTGSRGDTSSGGNGSDGNASDSDTSDSN
FT                   ASESDTAESDTADSAGESGTDSDDAGARDGSATETTGDGSTTEAATPSTTRPHGSNGDH
FT                   EVVPTTPGITPPPATTNIDTNTDTDTDSTTDSPATQTPRTETVAPAPDPEVEVPVIGDI
FT                   VDSPTAGVPDPEAVPVMTPLAPAAVVASDIWAPSAFAMDLGSDPLPVSSLAVVQSSTLG
FT                   VGATPRSSTLFGLPVVVIPSTPWNLNDPVWEAEWEAFNSSVVAWVPGVGNTLATISVVI
FT                   DTYQLAAAIGAGDHAEVSDEIGDLAGDIIGIEFGQGIGAQARYLIHLYISDAVATWIVG
FT                   DPTPVATV"
FT   sig_peptide     complement(80229..80336)
FT                   /locus_tag="Gbro_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 36"
FT   gene            80583..80873
FT                   /locus_tag="Gbro_0070"
FT   CDS_pept        80583..80873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19424"
FT                   /db_xref="GOA:D0LA95"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19424.1"
FT                   /translation="MSGPYGVDPNQQDHQPRRYPPLPPAGWAAAAPKPPRDPNRTVGII
FT                   FGALAVVVLLSVGLALLLVNVLGHNESDDKSEIRQQIQGYARDLRGGPRRR"
FT   gene            complement(80875..81267)
FT                   /pseudo
FT                   /locus_tag="Gbro_0071"
FT   gene            81356..82888
FT                   /locus_tag="Gbro_0072"
FT   CDS_pept        81356..82888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0072"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="KEGG: bur:Bcep18194_C6845 flavin-containing
FT                   monooxygenase FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19425"
FT                   /db_xref="GOA:D0LA96"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA96"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_C6845"
FT                   /protein_id="ACY19425.1"
FT                   /translation="MPATGTPTGTPTETVDVLVIGAGISGIGAGHYLTTRLPSKTFAII
FT                   EARSAAGGTWDLFRYPGIRSDSDLHTFGYEFKPWRDKQSIADAPRILSYLQQTIEENGL
FT                   AEHIRYNHRVVSASWSSQESLWTVQIDRADTGEHIAIKANWIFAGSGYYRYDEGYTPYF
FT                   EGRERFSGQIIHPQHWPEDLDHTGKRVVVIGSGATAVTLLPAMAQTAEHVTMLQRTPSY
FT                   IMPIPREDAIANTFRRILGDERGYKWARRKNIAQQRLVYTFCQRFPKTARRAIRAVNQK
FT                   FLPAGFPVDEHFNPPYDPWDQRLCAVPNGDLFKTIREGKTSIVTDRIATFTENGILLES
FT                   GRELEADIIITATGLNLQLLGGMELSVDGEPVNLPDHVIYRGLMLEGVPNAAMAIGYTN
FT                   SSWTLKIGLLCEYLCDLISYMDAHGYSAVRAVADPGMETKPALDFQAGYVKRALADLPR
FT                   QGTDGPWTMSMNYYDDQRNLRKKDFADENLRFSTEPARSALAARAGAVAAGR"
FT   gene            complement(82911..84503)
FT                   /locus_tag="Gbro_0073"
FT   CDS_pept        complement(82911..84503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19426"
FT                   /db_xref="GOA:D0LA97"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19426.1"
FT                   /translation="MSYYPPGPPTAPSGAFTTTGGTPRNRRALTFVLAAIVVVLALVLA
FT                   AGVVLVVKARNGDIKIPGLTLTAADDRGIDPFTDSVALAEPSALENVRLSAQVGYPQQG
FT                   TVLVNGSDPGLYATTGSASCDANRLSRQLTSDPGAASAWASVFGISSASIPYYLNTLTP
FT                   VVLTRDTWVTDHSYTNGKAQPYQAVLQAGTCVMVDAAGVPRVRCAGGSPLTPPAAAPVG
FT                   GYRLEGRQWPGYQTNKVTRVSYQDKHVTTVNNTTTVVPGPSTPVAGDPRNPILQLLNAI
FT                   TGAIAPAPLGGDVNLSGLPPLGEPLPNPVTTNIPFVPRDQQQADANGLARAGSPQVAAE
FT                   VTERAADNNGVPEGAPASETSSAVQSAPQVSGSTEAVPSTEASTVVPPSTEAAPTATSF
FT                   GGSGDRIGSFSFQQGATSVNCSAPATDTGSLLSLRCSDGARTVPASILSRSAVSAATDA
FT                   QGVWRLSLGSGVVAVTSATWLEVATSTTTTTETPTTTETTTEETTTTTTTETTTEETTT
FT                   TTTEEVPTTAPVS"
FT   gene            complement(84708..86162)
FT                   /locus_tag="Gbro_0074"
FT   CDS_pept        complement(84708..86162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0074"
FT                   /product="monooxygenase flavin-binding family protein"
FT                   /note="KEGG: scl:sce3282 monooxygenase flavin-binding
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19427"
FT                   /db_xref="GOA:D0LA98"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA98"
FT                   /inference="similar to AA sequence:KEGG:sce3282"
FT                   /protein_id="ACY19427.1"
FT                   /translation="MDDVIIIGAGLSGIDCAYRLREQNPDLRYTILERRAGMGGTWDLF
FT                   RYPGVRSDSDIYTLSYPFEPWRKPQALAQGDDIRHYIEHTARKFGIEPHIRFVRRVVAA
FT                   DWDSAADTWTLTVEVDDESGGPPSRETYTCRFVVFATGYYDYDHPYTPVFAGADDFTGE
FT                   IVHPQHWPADLDYAGKNVVVIGSGATAVSLIPPLARSADHVTMLQRTPSYIFSSKQKQY
FT                   LAPAVRKVLPAKAAHRVVRARYALQTAAIVHLTHRFPSLGRKMIRSNVAQHLPEDYPID
FT                   VHFNPPYNPWDQRMCMVPDADLFEAINSGSVEMVTDRIDRFDADGIALASGRHLDADVI
FT                   VTATGLQLLGFGGTTIRVDGAEVKPHDRFVFKSHLLEDVPNLAWSVGYTNASWTLRADM
FT                   TARSVAGLVKHMRANGYTHAYPHLGDESMPARPVWDLKAGYVERSPDALPKSGTRGHWQ
FT                   VRHNYYRDAIDHRLGDVTEEMVFGRV"
FT   gene            86296..88567
FT                   /pseudo
FT                   /locus_tag="Gbro_0075"
FT   gene            complement(88505..89761)
FT                   /locus_tag="Gbro_0076"
FT   CDS_pept        complement(88505..89761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0076"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: tgr:Tgr7_3110
FT                   formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19428"
FT                   /db_xref="GOA:D0LA99"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:D0LA99"
FT                   /inference="protein motif:PRIAM:3.5.1.49"
FT                   /protein_id="ACY19428.1"
FT                   /translation="MPELLFPLDSSKSFTDQAIIGHNRWHPDIPPAVTVKPGDTFRAHC
FT                   REWFDGAIHNDDSAEDILNSPLKGVHVLSGPFAIEGAEPGDLLIVDILDVGPIPQEDSG
FT                   PLAGQGWGYTGIFAKANGGGFLTDQFPDAYKAIWDFRGQTATSRHVPHVRYTGIVHPGL
FT                   MGTAPSAELLAKWNAREGALIATDPGRVPPLALPPEPEDAILGSLSGDAFTRAAAEGAR
FT                   TAPPRENGGNQDIKNLTKGTRVFYPVFVPGANLSFGDLHFSQGDGEITFCGAIEMGGFM
FT                   DLHVDLIKGGMETYGVSENAIFMPGNTDPQYSEWIAFSGTSVTLDGEQRYLDSDLSYQR
FT                   ACLHAIDYLTKFGYSPEQAYLLLGSAPIEGRLSGVVDIPNSCATVYIPTAIFDFPVAPS
FT                   ADGPVQIDPGMGAPTASFG"
FT   gene            89876..90160
FT                   /locus_tag="Gbro_0077"
FT   CDS_pept        89876..90160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0077"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; KEGG:
FT                   reh:H16_B0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19429"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA0"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACY19429.1"
FT                   /translation="MPTYVFRCAEGCVDFTERHPMSAIPDAARCPSCAASARRIVGAPA
FT                   LGVGDSAAMRLQDATRATADRPSVVTGLPASSRRTPTSSNPLHRKLPRP"
FT   gene            complement(90168..90812)
FT                   /locus_tag="Gbro_0078"
FT   CDS_pept        complement(90168..90812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0078"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; SMART:
FT                   beta-Ig-H3/fasciclin; KEGG: pol:Bpro_2251
FT                   beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19430"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA1"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ACY19430.1"
FT                   /translation="MATTRIPRLAVALSGLALAVGAVAGCSSDSASDNSSSSTSTMTGM
FT                   SSSAMAAAPVGSGCAAYAAANPTGPGSVEGMAMAPVATAAAANPELSTLTEALSGKLNP
FT                   QVNLVDTLNNGQYTVFAPTNEAFAALPAGTLDKLKTDSALLTKILTYHVVSGQAAPDAV
FT                   VGTHKTLEGQNVTVSGTPEALKVNTAGVVCGGVKTANAQVYMIDAVLMPPA"
FT   sig_peptide     complement(90717..90812)
FT                   /locus_tag="Gbro_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.429 at
FT                   residue 32"
FT   gene            90994..92529
FT                   /locus_tag="Gbro_0079"
FT   CDS_pept        90994..92529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0079"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG:
FT                   rec:RHECIAT_CH0003125 putative sulfite oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19431"
FT                   /db_xref="GOA:D0LAA2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA2"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACY19431.1"
FT                   /translation="MAIRERYVRAAISGPLAVAAGLAAGELSAVRVSAFASPYRAVGAM
FT                   LVDHSPAAAREFAIQRFGTADKTALLAGMAIVILLIAIVAGLLQVRRPPLGALVVVGFT
FT                   GVGVFAAMTRPTATRVYAIPAVIAGIVAVIVLVVLCRTSTAAASDTGADAAPIWSRRQF
FT                   VGAVAVLAAAGAGVTTLARSLAETGGALAERAGLRLPAPVSPSRPIPAGTDLRVAGVTP
FT                   FTTTNSAFYRIDTALAVPQLEVSDWRLRVHGMVDNEFTLTWDDLMAMPAVERIITLTCV
FT                   SNEVGGDLAGNARWLGFPMRDILSRAGIAADADMLLSTSVDGWTSGTPISAITDGRDAL
FT                   LAIGMNGEPLPIEHGYPVRQVVPGLYGFVSACKWVIDWEITRFSEAQAYWTQRGWGERA
FT                   PIKTASRIDRPAPFSTSPAGTVVVAGTCWAQHRGIRSVEVRVDDGPWQQATLATEYSSD
FT                   TWRQWRWDWDATPGQHTLYCRATDRTGATQPEQRVAPIPDGATGWHSRVLRIE"
FT   sig_peptide     90994..91068
FT                   /locus_tag="Gbro_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.479 at
FT                   residue 25"
FT   gene            complement(92574..93842)
FT                   /locus_tag="Gbro_0080"
FT   CDS_pept        complement(92574..93842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0080"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: Glutaminase, core; KEGG: aci:ACIAD1040
FT                   glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19432"
FT                   /db_xref="GOA:D0LAA3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA3"
FT                   /inference="protein motif:PRIAM:3.5.1.2"
FT                   /protein_id="ACY19432.1"
FT                   /translation="MRSPVPDYLQEVLDDLAHNRDGVVADYIPELAAADPDVFGIALTT
FT                   VDGRTHVAGDADLAFSIQSISKPFAYAAAIIDRGLEAVEAKVGVEPSGEAFNELSLEGE
FT                   TRRPKNPMINAGAITAHHLLVGAAARPEERVERARSFFSELAGRDLGIDESVFSSELDT
FT                   ADRNLSIAHMLRNYGIIDAPAHDVVEGYTRQCSIEVTVRDLSLMGATLANGGVHPCSGR
FT                   RVLSRAVARQTMSVMAGCGMYDAAGRWLTTVGIPAKSGVAGGLLGALPGQCGIAVLSPR
FT                   LDDHGNSVRGVEAFRRMSADMGMHLVDAEPYDATVVRDVYVVDDATVFVIQGTIQFGGA
FT                   ESILHAFESDDTATPAAVVDATRIDHLSDVGRRMLLEGLRRLRLDGRRVVLVDPDTVLP
FT                   EPDLDHDGMRPDAVVDDLTMIGG"
FT   gene            complement(93922..94503)
FT                   /locus_tag="Gbro_0081"
FT   CDS_pept        complement(93922..94503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0081"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: protein of unknown function DUF664"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19433"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA4"
FT                   /inference="protein motif:PFAM:PF04978"
FT                   /protein_id="ACY19433.1"
FT                   /translation="MSTYTEVTLPFDVTGEKADLLTLLADQSALFRVALRNITEEQART
FT                   RTTVSELTLGGLLKHLAWGERWGAQILRERDENASLDPASLAHAYELLPEETLDGWLSE
FT                   YDFGADEFDRLIASADDLDELIPQPTAPWAPEREWNSVRTMALNKLRETAHHCGHADII
FT                   REALDGQSTMAAISEGQSWAEDFDSWTPTS"
FT   gene            94622..95254
FT                   /locus_tag="Gbro_0082"
FT   CDS_pept        94622..95254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0082"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: pla:Plav_2299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19434"
FT                   /db_xref="GOA:D0LAA5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA5"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACY19434.1"
FT                   /translation="MVGVSACDDPSILEALTRKPDRAGDRALLDDVLDEARVGVLSTVV
FT                   DGQPWSVPLLFARDGDAILLHGSSGAGMLRHVGAGAPVAFTVFVMDALVIADTLFDHSA
FT                   NYRSAVIRGTTEIVDDALHVLEMLSDKLIPGRVAEVREATRKELAATVALRLPIVDGQW
FT                   IAKARSGGPGADAAGWTGVVPMRTVFDDPITYTGTEPPASVRALSAG"
FT   gene            complement(95261..96838)
FT                   /locus_tag="Gbro_0083"
FT   CDS_pept        complement(95261..96838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0083"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rlt:Rleg2_6131 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19435"
FT                   /db_xref="GOA:D0LAA6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA6"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY19435.1"
FT                   /translation="MTTTGGTQAATTPAETVAGLLETYGAPDANAAHLLVDGHDPAGIA
FT                   FTSIDVDGDGNPVTSTITYGELADQSKRFATALAARGINRGDTVGVLMGKRTELVVALL
FT                   AIARLGAVYIPLFTAFAPPAIEMRLRAAGATLVVTEPSQAAKLDGFDDVATIVAGDEFD
FT                   TLVRDSAPIAESVAVGGDGTLILLFTSGTTGAPKGVPVPVKALASFVAYMRFGLDVAAD
FT                   DVFWNAADPGWAYGLYYGIVGPLAIGRANLLLHAGFSPELTARILDELEVTNFAAAPTV
FT                   YRSLSKDPRIAGFRLRRASSAGEPLTPDVIDWATTALGTEVRDHYGQTEHGMFINNHWN
FT                   DAIREPLIPGSMGKPMPGFAAGIVDGQIAIDVPASPLYWFTGYLDAPEKTASRYTEDGR
FT                   WYLTGDTGRVDDEGRYFFTARDDDVIIMAGYRIGPFDVESVLITHPAVLDVAVVGRPDE
FT                   LRGEVIEAFVVLADGVAGTDELETELQQLVKTQFAAHAYPRAVHFVDALPKTPSGKIQR
FT                   FILRKGEG"
FT   gene            96957..97760
FT                   /locus_tag="Gbro_0084"
FT   CDS_pept        96957..97760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0084"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: lch:Lcho_1634 two component LuxR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19436"
FT                   /db_xref="GOA:D0LAA7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA7"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACY19436.1"
FT                   /translation="MSDTVRGPVTAALRRIRRDSGVPLAFGGVVWGPRSLRLEHFVGRT
FT                   VGALNGVSVDAGHGLGGKVVAVHRPMVVDDYLKTPRITHRYNTVIEREGLRAMAAAPVI
FT                   VDRKPVAVLYGALRTTDPIGGRTLDVLAMEARAVEQEIVAARVRLEARSESAGVDGDRL
FT                   AQAYARLRLFVAHSDDAGLAAELDRLTAEFTSEATSSVDLPALTGREHDVLALAALGHS
FT                   NARIADQLGITVHTTKGYLKSAMRKLGATTRLEAVITARRAGLMP"
FT   gene            complement(97767..98036)
FT                   /locus_tag="Gbro_0085"
FT   CDS_pept        complement(97767..98036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amc:MADE_01038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19437"
FT                   /db_xref="GOA:D0LAA8"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA8"
FT                   /inference="similar to AA sequence:KEGG:MADE_01038"
FT                   /protein_id="ACY19437.1"
FT                   /translation="MPQRDPGPSVKDDELYEKLRDEGNSKEKSARIANAASNTSRSDVG
FT                   SKGGRSGSYEDWTVDELRSRAKDLGLSGYSDLKKEQLIDKLREH"
FT   gene            98221..98808
FT                   /locus_tag="Gbro_0086"
FT   CDS_pept        98221..98808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19438"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19438.1"
FT                   /translation="MGKKRKLIARLEAEIDNLKGELARVEKHARKQLKKAERDAAALRG
FT                   EVLKLIGQNKSERSDAEKNRTENSPAKAVTPPAVKSTVADSATKAPKSVYGEQARADQS
FT                   RTAPPAAPSVTAPVEPPAKKAAAAKKTATKTPADKTPADKTTTAKKTPAKKTPAKKAAA
FT                   TPTVAELRQQAKAKGVKGYSTMTKAKLLDALS"
FT   gene            complement(98832..100598)
FT                   /locus_tag="Gbro_0087"
FT   CDS_pept        complement(98832..100598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0087"
FT                   /product="helix-turn-helix Fis-type"
FT                   /note="PFAM: helix-turn-helix Fis-type; GAF domain protein;
FT                   KEGG: aeh:Mlg_1028 fis family GAF modulated sigma54
FT                   specific transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19439"
FT                   /db_xref="GOA:D0LAB0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB0"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="ACY19439.1"
FT                   /translation="MSQQRDQQLRIAAARADFLEFGPQGAAGVDDVVAASWSRSRSAGV
FT                   DADRYEVAFHSDVDFDSRLARCARPVIDRLADDMSDIPVTIAFTDAAARIVDRRDCSTA
FT                   VGRVLDRVDFALGFSFDEGSIGTNGVGTVFEVGAPVSVVGSEHFNQALTPFACAGTPIW
FT                   DPLTRRMAGVLDVSMLSDSWNPLIEPLIRAAASDIGRNLLLDRSPAKRALFETFLRADT
FT                   RPRQAVMAVGDTVMANEFARDLLTPDEQASIAQFAEFLMSRHDRSTQSLTLPGGRRIRL
FT                   RTNSISCNGDTVGMVILLDEEQAPDPVVADDGPRTLPALPSPDIGVSPAWRSARTEVLT
FT                   ALTAHEAVLVLGESGTGRCTLVGDVFGSLHEDAPVIVVDATADDPEPLPDLGPGPALVV
FT                   LRNLDRMPAESLDAIDGVIRAAIRAGHDVAATMEPVPDSPRDPIPHSRLLFRFDRSVAV
FT                   PPLRLRTADLPAVVDRVVKTISPQRSHRLSPKAMRMITGFHWPGNIVQLREALEFALRR
FT                   RPVGEIQPEDLPGFCRSTAHRALTPLESAERDAIIAALESHGGNRLHAAAALGMSRSTL
FT                   YRKLRVYGILSV"
FT   gene            100784..102385
FT                   /locus_tag="Gbro_0088"
FT   CDS_pept        100784..102385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0088"
FT                   /product="steroid monooxygenase"
FT                   /note="KEGG: steroid monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19440"
FT                   /db_xref="GOA:D0LAB1"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB1"
FT                   /inference="similar to AA sequence:KEGG:CML339C"
FT                   /protein_id="ACY19440.1"
FT                   /translation="MADTTLDAVVIGAGVAGLYELHMLREQGLDVRAYDAATGVGGTWY
FT                   WNRYPGARFDSEAYIYQYLFDEELYKGWSWSQRFPGQAEIEQWLNYVADALDLRRDIQL
FT                   STVIESAVWDPDRQRWLVTTGDGETIDTQFLITCCGMLSAPMTDLFPGQADFAGQLVHT
FT                   SRWPKEGIELTGKRVGVIGNGATGIQVIQTIADEVDELTVFIRTPQYALPMKNPSYGPD
FT                   EVAAYKSRFDELRATLPHTFTGFEYDFTDAWEDLTPDERRAKLEDIYDNGSLKLWLASF
FT                   AEIFSDEQVSEEVSEFVREKMRARLQDPDLCDLLIPSDYGFGTHRVPLETDYLEVYHRD
FT                   NVKAVAVKDNPIAKIVPEGIELTDGTRYELDVIIMATGFDAGTGALTRIDIRGRDGHVL
FT                   KEDWGRDIRTTMGLMVHGYPNMLTTAVPLAPSAALCNMTTCLQQQTEWISEAIRHMRTH
FT                   GKSVIEPTAEGEAAWVAHHDELADANLISKTNSWYVGSNVPGKPRRVLSYVGGVGAYRE
FT                   ATLEAAAAGYKGFALN"
FT   gene            102435..103640
FT                   /locus_tag="Gbro_0089"
FT   CDS_pept        102435..103640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0089"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bja:blr6983
FT                   1,4-butanediol diacrylate esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19441"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB2"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACY19441.1"
FT                   /translation="MTSSVHSLDVAAFRDNADAILTAATQGDARVPGVVAMVTDRDGNV
FT                   YEGAAGVRNIAEPAEMTTDDVFAIFSTTKAITATAVLQLVEEGALDLDAPAADYAPEIG
FT                   TLQVLEGFDGDGQPKLRPPKTQATTRQLLTHTGGFGYDFFDENYNRLAQEHGQPSVTTA
FT                   TKAALTTPLLFDPGERWQYGTNIDWAGQVVEQIRGKRLGEVFADHIFAPLGITDLSFIL
FT                   ADEFRPRLTEIHARGADGSLTPMGLQLPSPPEVDFGGHGLYGTVGEYMKFIRMWLNDGA
FT                   GSNGRVLKPETVEMAVRNHLGDLPVTMLPGVIPALSNDAEFFPGQSKSWSLPFMINNEK
FT                   APTGRPAGAQGWAGLANLFYWIDRENGYGGYWATQILPFGDPTSFTKYMELETAFYDAL
FT                   DA"
FT   gene            103654..104715
FT                   /pseudo
FT                   /locus_tag="Gbro_0090"
FT   gene            104800..106032
FT                   /locus_tag="Gbro_0091"
FT   CDS_pept        104800..106032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0091"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG: aeh:Mlg_1669
FT                   two component LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19442"
FT                   /db_xref="GOA:D0LAB3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB3"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACY19442.1"
FT                   /translation="MHLVLEGPLPEIANRFSRFLAAACPHDALVIYTRECTGRPRKVAG
FT                   PAELVDRVSIDELDAAKESVSPGDVVIGDVVLAGERRPVLMVRDETDTLLVLVAKRGAR
FT                   AIRPTVPTEVIRWWFALVAVSIRQQVSQASPDYLAESRAASSERARTIAQLTEAHEDTL
FT                   ASILSVLRSRDIDDRAARSTAAETASAALISLRGVGDTDRKLATEALAAAFDRLRDELE
FT                   PVVRQWEIDVEYVGPDGGGRTIPGEIAHAARAIVRTVTVAFGVAQQHSRVRVAWECVDG
FT                   DLVIDVRDQGNGDLDGSGLRSQLGGRLGALGGRLEVETLAGWGSRVTVRIQLEEAQRRP
FT                   DEERLSALNPREREVLGHLALGRRNKSIAAELGVSENTIKFHVTSILQKLHVSNRGEAG
FT                   LLAARAGITAG"
FT   gene            106189..107280
FT                   /locus_tag="Gbro_0092"
FT   CDS_pept        106189..107280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0092"
FT                   /product="mycothiol-dependent formaldehyde dehydrogenase"
FT                   /note="TIGRFAM: mycothiol-dependent formaldehyde
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase zinc-binding
FT                   domain protein; Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: bbt:BBta_7131 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19443"
FT                   /db_xref="GOA:D0LAB4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB4"
FT                   /inference="protein motif:TFAM:TIGR03451"
FT                   /protein_id="ACY19443.1"
FT                   /translation="MSEQTVKGVISRSKGAPTEVVDVVIPDPGPRDVIVKIQACGVCHT
FT                   DLAYKQGGINDEYPFLLGHEAAGIVETVGSDVSHVEVGDFVVLNWRAVCGECRACKRGR
FT                   PWYCFNTFNASKAMTLTDGTELTPALGIGAFIDKTLIHELQCTKVNPETDPAVAGLLGC
FT                   GVMAGLGAAMNTGNVGRGDSVAVIGCGGVGDAAIAGARLAGATTIIAIDRDPAKLAWAT
FT                   DLGATHTINGAEVDDVVTAVQELTGGNGADVVIDAVGRPETYKQAFYARDLAGVVVLVG
FT                   VPTPEMTLELPLVDFFSRGGALKSSWYGDCLPERDFPMLVDLYEQGRLPLDKFVTERVG
FT                   LNDVEAAFSAMEAGKVLRSVVEL"
FT   gene            107277..107909
FT                   /locus_tag="Gbro_0093"
FT   CDS_pept        107277..107909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0093"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sat:SYN_02709 hydroxyacylglutathione hydrolase W"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19444"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB5"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY19444.1"
FT                   /translation="MSGALRIDNVVTSGTFSLDGGTWDVDNNIWLIGDDDEVIIIDAAH
FT                   SAQPILAGVGDRTVKAIVLTHGHNDHITVAPELSRETGAPILLHPGDDMLWNDTHPDVE
FT                   HADLEDGQEISVAGTGLKIINTPGHSPGSSVIHVPEAGVLFSGDTLFSGGPGATGRSYS
FT                   SFPTIIASIQEKIFTLDPETKVYTGHGDGTTVGTESPHLEEWIKRGS"
FT   gene            108009..108401
FT                   /locus_tag="Gbro_0094"
FT   CDS_pept        108009..108401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0094"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gme:Gmet_0230 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19445"
FT                   /db_xref="GOA:D0LAB6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB6"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACY19445.1"
FT                   /translation="MVVGFLFFCHGTSTLFAWPVAPYSGQTADFGAWPSWWAGAIQFVG
FT                   GLLIMLGVGTRIAAFIGSGSMAVAYFWKHQGDGLLPIQNDGDSAALFCWALLLLVFIGP
FT                   GRLALDRYLGRERSAETADERVGVGA"
FT   gene            108559..110211
FT                   /locus_tag="Gbro_0095"
FT   CDS_pept        108559..110211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0095"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bph:Bphy_6352 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19446"
FT                   /db_xref="GOA:D0LAB7"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB7"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACY19446.1"
FT                   /translation="MAWLRTDILAGVTLAAVAIPECMGYSSIAHVPLVAGLYTIILPTL
FT                   AFALIGASRQLVVGADSATAALLASGIAGLGVAGLTPDSEQWLAWAGIIAIVTGVLLAL
FT                   ARILRLGFLGDFLSTAVLVGFLAGTGISVLTGQLPGMLGVHGADGRVWYRWYVVLSELG
FT                   TIDWAAVGFAVATLAVLIAGRRWAPRAPAAIVVVVVSIVVVSVFGWSDDVEVVGSVPSG
FT                   LPALGLPDGFAWHDLPKAATVAIGCAIVILAQSAATARSFAQKYGATADVNRDIVGLSA
FT                   ANIVAGLSSAFVVNGSPTKTQLLDDQRGRTQVANLTMVAVTLLVVLFATSALANLPDAV
FT                   LAAIVAVVAVNLIDVHAFRRMWQVRRIEFGIAVVSAVVVVIVGVQNGILTAMAVSLLEI
FT                   VRRQYRPERFVVGVADHGRTRRYQPAHPGQQSLPGLIVFRYDADLFYANASRFADDVMG
FT                   LVRAAPDPLRWLVLDCTVIGDVDYSASSVLSDLITFVHSRGAHFVLAGVDPELQNALLE
FT                   EGILADLDPDHVYPTVGAAVRAYEQQFPGAEPG"
FT   gene            110275..111795
FT                   /locus_tag="Gbro_0096"
FT   CDS_pept        110275..111795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0096"
FT                   /product="DNA ligase I, ATP-dependent Dnl1"
FT                   /note="TIGRFAM: DNA ligase I, ATP-dependent Dnl1; PFAM: ATP
FT                   dependent DNA ligase; DNA ligase domain protein; ATP
FT                   dependent DNA ligase domain protein; KEGG: ade:Adeh_4160
FT                   ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19447"
FT                   /db_xref="GOA:D0LAB8"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB8"
FT                   /inference="protein motif:TFAM:TIGR00574"
FT                   /protein_id="ACY19447.1"
FT                   /translation="MQLNEVVEASASVAGDRSRLRKTAVLAGLLGSASPAELPVVVAWL
FT                   SGEIPQGRLGVGWRSLAKLQAAPADTPSLTVGDVDDALSALAAATGTGSAARRAEIIAT
FT                   MFAAATEPEQRFLVALLTGELRQGALAGVMTDAIAKASGQDLALVRRAHMLTGSLPVTA
FT                   GLAVSGGAEALAGVGLEVGRGVSPMLATPAENLDDALTLLGTDVVVDYKLDGARIQVHR
FT                   RGEDITVYTRTLNDVTTRVPDIVEVVAGLPCETVILDGETLTLTDDGRPRPFQETMSRF
FT                   GSGGAGERGAERVLRPFFFDCLHLDGVDLIDRPLAQRLAAIDRIAPDLRIPSVIRPTPA
FT                   EAAAHFDAAIADGHEGVMVKSLAGTYTAGRRGKAWQKVKPVHTFDLVVLGAEWGSGRRT
FT                   GFLSNLHLGARDSGGGAPIMVGKTFKGLTDDLLRWQTEEFPRHETHRDAHTVYLRPEIV
FT                   VEIELDGVQRSSRYPGGVALRFARVMRYRPDKTPEQADTLDTLRELLK"
FT   gene            complement(111802..112602)
FT                   /locus_tag="Gbro_0097"
FT   CDS_pept        complement(111802..112602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0097"
FT                   /product="Anti-sigma-K factor RskA"
FT                   /note="PFAM: Anti-sigma-K factor RskA; KEGG: csa:Csal_1097
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19448"
FT                   /db_xref="GOA:D0LAB9"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAB9"
FT                   /inference="protein motif:PFAM:PF10099"
FT                   /protein_id="ACY19448.1"
FT                   /translation="MSDDNRPGDDTYAELLEFAPLVGLDALAAAELDELEQRLATAPDD
FT                   IRAEFRRQVLATREAMTTVSAATATPPPAQLRDAILAAARSGDDRQREQPVESPPEPQS
FT                   DENGAAVTQLPDRRRRIVYLAAAAVVTVAVGAIGWAIGHSMTSSDSPTTNTPEQVFSAP
FT                   DLKSTSADVAGGTATVYYSPDVGAGVLVMTSVPPPKPGTVYQMWLVGPDGPRSAGTMTD
FT                   KDVHEVTTALLPGISSAQTLGFSVEPPGGSSTPTSPMVAQIDLR"
FT   gene            complement(112595..113272)
FT                   /locus_tag="Gbro_0098"
FT   CDS_pept        complement(112595..113272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0098"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   bgl:bglu_2g18860 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19449"
FT                   /db_xref="GOA:D0LAC0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY19449.1"
FT                   /translation="MTASALRAPPADINLIADDRSPNLRRPGLRLLGAPMTPSQATDLP
FT                   RLAELLSRIADGDDGAFAEFYDATAARVYGMVLRVLRDPGYSEETTQEVFLQVWRSAGS
FT                   YSADAGSPLSWLITMAHRRAVDRVRSESASSRRDIRYAAQAQESPFDLVSDAVGSSETA
FT                   ETVVGCLGSLTDVQRQSVVLAYYEGLTYREVAERLSVALPTVKSRIRDGMIRLRRCLGG
FT                   ADV"
FT   gene            complement(113272..114075)
FT                   /locus_tag="Gbro_0099"
FT   CDS_pept        complement(113272..114075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0099"
FT                   /product="protein of unknown function DUF1295"
FT                   /note="PFAM: protein of unknown function DUF1295; KEGG:
FT                   pla:Plav_2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19450"
FT                   /db_xref="GOA:D0LAC1"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC1"
FT                   /inference="protein motif:PFAM:PF06966"
FT                   /protein_id="ACY19450.1"
FT                   /translation="MTGWAGFAVLTVAALILLAAIQAVAFAIGHRIGRYNVVDVVWGLG
FT                   FVGVAWLALLLGDGDPFRRWLFAILAAVWGLRLSWHMHVKSRGKGEDPRYTAMLERAGG
FT                   GTGTVIRKVFATQGISQWFVSLPIQVSAILGPGDGVATILLCLGIPLWLTGFAFEAVGD
FT                   AQLRRFKADPANKGAIMDRGLWAWTRHPNYFGDSCVWWGIYLCAAGVWPATLTLLSPIA
FT                   MTYFLVYATGARLLEQSMSKRPGYPEYQQRTSYFLPRPPRRTSEA"
FT   sig_peptide     complement(113998..114075)
FT                   /locus_tag="Gbro_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.699 at
FT                   residue 26"
FT   gene            complement(114075..115361)
FT                   /locus_tag="Gbro_0100"
FT   CDS_pept        complement(114075..115361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0100"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   lch:Lcho_0464 cyclopropane-fatty-acyl- phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19451"
FT                   /db_xref="GOA:D0LAC2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC2"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACY19451.1"
FT                   /translation="MNVPIRHPGSAVGHPVDAQRWPDVASVPAGPTARVRSAAAAALFR
FT                   RATRDLGIRVEYPDGTLGGADTDGVLPRMIVRRPDDFWRRLGSGGLIGFGEAFMAGDWT
FT                   TDDLVGVLTPFATRAARLVPATFQPLRSLVLPKQPAAEENTPTGTRTNIARHYDLSNAM
FT                   FATFLDETMTYSSAVFDDVSAPARWADLADAQRRKIDRLLDLAGVGPGTRLLEIGTGWG
FT                   ELCIRAAARGADVYSVTLSTEQRDLARDRVARAGYADAVRIDLLDYRAIEGTFDAVVSV
FT                   EMIEAVGDKYWPAYFSTIDRLLAPGGRVAIQAITMPHERMVASRNTYTWIHKYIFPGGQ
FT                   LTSVPGLRAAVRRHTSLRMTGGTALGVHYAETLRLWRERFLAADDEVAALGFDHTFARM
FT                   WQFYLAYSEAGFRAGYLDVYQFVFAREES"
FT   gene            complement(115358..116155)
FT                   /locus_tag="Gbro_0101"
FT   CDS_pept        complement(115358..116155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0101"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; KEGG:
FT                   aav:Aave_3572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19452"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC3"
FT                   /inference="protein motif:PFAM:PF07103"
FT                   /protein_id="ACY19452.1"
FT                   /translation="MTGSGPRAGTPSLVPATIGHLRRTPVRHGFTYRSYSWFIDIDDLP
FT                   HPPRPLGPFARFDADDHFPEPATPGASLRDRLESHLRQAGIDPPDGPVTALLSARVAGH
FT                   VFNPLSVFWCHRADGSLRYVVAEVHNTYGERHCYVVTTDAAGRARVGKEFYVSPFNPVE
FT                   GAYELSLPEPGPDGRVALSVTLHRDGHAPFVATLRGHTVAATTRALLAAQIRTPLAPLV
FT                   VSARIRLQGIRLWARRLSVVPRPPHLLTHTVAAPTPDTEEVRR"
FT   gene            complement(116152..117549)
FT                   /locus_tag="Gbro_0102"
FT   CDS_pept        complement(116152..117549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0102"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: tgr:Tgr7_1390 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19453"
FT                   /db_xref="GOA:D0LAC4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC4"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACY19453.1"
FT                   /translation="MTPTDRSSKRRSPQPPSASRHTVPGRSTPPRSVAVIGSGVAGLTA
FT                   AHILSAQAQVTLYESDDRLGGHAHTHRVPMPDGTHLAVDSGFIVHNDRTYPTVSRLFDD
FT                   LGVATQDSDMSMSVSSQINGLEYAGALGISGLFPTPRNLVRRHYLAMLVEIKRFHREAR
FT                   RLLDDASSGSDEPLDDFLIRTGFSGYFRDNFLYPLVAAVWSCSDADAGRYPARYLFTFL
FT                   DHHGMLSVYGSPTWRTVVGGSITYVDAVAAEITARAGSIRTGAAVTRIDDASDGVWLTA
FT                   DDGCGPTLFDAAVIATHPHQALRMLTAPTPATQRTLGAIRYLPKPAVLHSDTSLLPRAR
FT                   RAWASWNQQIRVDAGEAGVGVAVTYDLTRLMRLPTSRPRMLVTLGRTDLVNPRAIHAEM
FT                   TYEHPLYTTESVAAQRLLPTIDTDRIVFAGAYHGWGFHEDGAASGERAAARLGVRWDSR
FT                   PTEVVPA"
FT   sig_peptide     complement(117388..117549)
FT                   /locus_tag="Gbro_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.873 at
FT                   residue 54"
FT   gene            complement(117604..117849)
FT                   /locus_tag="Gbro_0103"
FT   CDS_pept        complement(117604..117849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19454"
FT                   /db_xref="GOA:D0LAC5"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19454.1"
FT                   /translation="MTGRGREAVWAVVTTLILVVRILATIALVLLALGWAVAAIRSSLD
FT                   NVFLWPAVGAGVALFLSTYLYSYLRVRYPRRNGWIP"
FT   gene            117900..118295
FT                   /locus_tag="Gbro_0104"
FT   CDS_pept        117900..118295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0104"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307; KEGG:
FT                   rpa:RPA0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19455"
FT                   /db_xref="GOA:D0LAC6"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC6"
FT                   /inference="protein motif:PFAM:PF03733"
FT                   /protein_id="ACY19455.1"
FT                   /translation="MKTILNVIWLVLCGFWMAVGYVLAGIICVILIITIPFGIASFRMA
FT                   NYALWPFGRTVVRKPTAGSMSMIGNVIWILVAGWWLALGHITTGIALCVTIIGIPLGIA
FT                   SFKMVPISLLPLGVDIVDTDDPAVAYR"
FT   sig_peptide     117900..117974
FT                   /locus_tag="Gbro_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.918 at
FT                   residue 25"
FT   gene            complement(118803..119366)
FT                   /locus_tag="Gbro_0105"
FT   CDS_pept        complement(118803..119366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19456"
FT                   /db_xref="GOA:D0LAC7"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19456.1"
FT                   /translation="MTSSTDTSASLADRYAGLAAGFGAVLDAVGPDDWTAPSPCAGWTA
FT                   RDVVAHVIDTQRDFLAGHDVDAGPAPSLHDPAAAWRSHSHRVAGAVADPDIANRSFDGH
FT                   FGPTSVGETLLRFYGFDMVAHRWDVATAVGAELRFTDDELTMMETAADGFGEALYSDGV
FT                   CERVEIPDDADRQTILLARLGRRS"
FT   gene            119401..120378
FT                   /locus_tag="Gbro_0106"
FT   CDS_pept        119401..120378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0106"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   bac:BamMC406_3383 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19457"
FT                   /db_xref="GOA:D0LAC8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC8"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACY19457.1"
FT                   /translation="MNIRDRSGGDRLDDVERAHLVDPADASYRIGRWGPSPELGDLVRR
FT                   FWVPVWSVPEGAEAPQRVLQYPVCLMVVSDTYARFYGVVTGLSETVLTGDGWGVGVMLT
FT                   PAAGGLLVGGSVDAWTDRHDELSHVFGDRGTALADGIRARMAPNPADESAQHAATRVVE
FT                   DWLAPHLPIDDDGHLINGIVDFVENDSSVIALSQICDRFHLTERSLQRLTRRRLGLTPR
FT                   WLIQRRRLQKAAERLRDNSTTLAAMAADLGYSDEAHLVRDFHKVTGMTPRAFTARFSRG
FT                   DPQKTVTSPATGRRHHHEPPPPPPPPPEKPSPEKLPPPVLNDAD"
FT   gene            complement(120288..122090)
FT                   /pseudo
FT                   /locus_tag="Gbro_0107"
FT   gene            122302..123570
FT                   /locus_tag="Gbro_0108"
FT   CDS_pept        122302..123570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0108"
FT                   /product="GAF domain protein"
FT                   /note="PFAM: GAF domain protein; KEGG: dar:Daro_1017
FT                   helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19458"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAC9"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACY19458.1"
FT                   /translation="MSDAAAVSSRIRQAYEDFLSGVTPPADSVRSVVRESWVRSRNRGI
FT                   DPGDAVPESSVPAMSDAEFADYRATHPITAVRPLVQSLMVDAIADSGVVVALTDQVGRL
FT                   LWVEGESTARDKAGHINFVEGSVWSEDVVGTNAPGLALAVDRGVQVVGPEHFAGPVQEW
FT                   SCAAAPVHDPLTGHVIGVIDVTGGREVAAPFALAAVRSVVAAVERELQSKAIDLGDPHT
FT                   FEAAGPRLTVLTDNGYRWHRHAPESRSLSRRHAEILLLLQAFPEGLNTEQLALKLAEDG
FT                   IDPVTVRAEISRLRRDLGDDVVQSRPYRLTVEMWSDVGDLRQRVASGGDLESVIDELGR
FT                   GGLLVESTAPGIVEIFEELREDVRSRVIAEGQVGALRKWTSSIHGRDDLVAWRRLEHRL
FT                   PVSDPDRAVVGGRIRLLDRRYGV"
FT   gene            123869..125392
FT                   /locus_tag="Gbro_0109"
FT   CDS_pept        123869..125392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0109"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: mxa:MXAN_5040
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19459"
FT                   /db_xref="GOA:D0LAD0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D0LAD0"
FT                   /inference="protein motif:PRIAM:1.2.1.3"
FT                   /protein_id="ACY19459.1"
FT                   /translation="MTVYAKPGTEGSVMSFESRYDNWIGGQWTPPVKGQYFENPSPVDG
FT                   KTFCEVARSTAEDIDLALDAAHKAAPQWGKVPVAERSLVLLRIADRLEENLEKIAVAET
FT                   WDNGKAVRETLAADIPLAIDHFRYFAGALRAQEGSISEVDEDTVAYHFHEPLGVVGQII
FT                   PWNFPILMAVWKLAPALAAGNAVVLKPAEQTPASILYVMSLISDLLPAGVLNVVNGFGV
FT                   EAGKPLASSNRIRKIAFTGETTTGRLIMQYASENLIPVTLELGGKSPNIFFDDVMSKDD
FT                   GFLDRALEGFSMFALNQGEVCTCPSRALIQENIYDDFIAKAVDRVSQIKQGNPLDTETM
FT                   MGAQASNDQFEKISSYLAIGKEEGAKVLIGGEPADLGGDLSGGYYIKPTVFEGHNKMRI
FT                   FQEEIFGPVLAVTTFKDYADAIHIANDTLYGLGAGVWSRDGATAYRAGREIQAGRVWTN
FT                   TYHDYPAHAAFGGYKQSGIGRENHLMMLEHYQQTKNLLVGYAQNAKGFF"
FT   gene            125411..125836
FT                   /locus_tag="Gbro_0110"
FT   CDS_pept        125411..125836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0110"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   mxa:MXAN_5039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19460"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB29"
FT                   /inference="protein motif:PFAM:PF05610"
FT                   /protein_id="ACY19460.1"
FT                   /translation="MTTEQNVPDRVVATDAAVQLLTKLSELHGGLMIHQSGGCCDGSAP
FT                   MCYPVGEYRVGQRDVLVGEIDLPEPIPAVRVWINGDQFELWKHTQLILDVVQGRGAGFS
FT                   LEAPEGVRFLSRARAFSDTENAVLAAYPPLTGAAVGV"
FT   gene            complement(125845..126663)
FT                   /locus_tag="Gbro_0111"
FT   CDS_pept        complement(125845..126663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0111"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: mes:Meso_2689
FT                   LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19461"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB30"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ACY19461.1"
FT                   /translation="MIEAVSTIVFVHAHPDDEGTATAGSMIRASREGHRVVVVYCTDGD
FT                   PGSGGENGAPLDLAPGETIATRRRGEAEASAAITGTARLAWLGYADSGMTGWAQNHTDG
FT                   VFSRVPVDEAARRLADILDEESADVVVGYDWHGGYGHPDHIMLHHTARAATDLATKRPR
FT                   YLEVTMNRDLMRNLFVLATEMGMDGFDPDTAGDDGNPIGTPEAELHWAVELGDDVAAKR
FT                   EALACHASQSDVRQLLALPVEVFPIAFGTEHYLEPGRPPGMVRGWWLDEG"
FT   gene            126841..127554
FT                   /locus_tag="Gbro_0112"
FT   CDS_pept        126841..127554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19462"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19462.1"
FT                   /translation="MNKKLSRTMIVGAMIGATSMAGMVTSGVATAAPLSPTNCAKTATP
FT                   SAPNGWGNSFSDERGQAGKIVATNVVDQDGSLQFTTTPEVPRQASYHSAGKLPLTTLAG
FT                   KPLAFEKSAGNANWQLRVTGANTGQGDGFATLVWSAPDAAGKYDAASSDKWWATRDLGS
FT                   LKRGQTGTLAQLTAAANSGGKNTVVEHYGVSSQPNSGTGKVNVDNVSLNGCTTNFAVKG
FT                   GNGSLGIELPGIGTL"
FT   sig_peptide     126841..126936
FT                   /locus_tag="Gbro_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 32"
FT   gene            complement(127570..128832)
FT                   /locus_tag="Gbro_0113"
FT   CDS_pept        complement(127570..128832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0113"
FT                   /product="Sterol 3-beta-glucosyltransferase"
FT                   /EC_number="2.4.1.173"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   afw:Anae109_0485 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19463"
FT                   /db_xref="GOA:D0LB32"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB32"
FT                   /inference="protein motif:PRIAM:2.4.1.173"
FT                   /protein_id="ACY19463.1"
FT                   /translation="MADILIAAYGSRGDIMPLTGIAGALQRVGHRVSMTCTPDLVDEIT
FT                   PLGIDARPADFRLNADVDTSAADPLKLAAEMVKPRGMRQLGANLLAAMSDTPADIVLLT
FT                   PFAELAGHLFAEARGIPSLGLRLQPMSATGDFPPSLLGAWSAGRVVNRAAGRSAARWFD
FT                   RIYRTPLAGFRAELGLPRRSARSLRNARTAVKWPIPHGFSRSVIRTPGDWRHGLEVTGY
FT                   WWPQDLPDWTPPSELVDFLDAGEAPVYVGLGSLMVPEKESARLSEVIGTALRSAGLRGI
FT                   VSGGGAGLHVEGDDVLTVGTVPHSWLFPRMRAAVHSCGAGTTAASLRAGLPVVGIPSPG
FT                   GDQPFWARRLGRLGVSAATLPRPKLRATQLAEALTAATADDRYRVAAAQLRDAILAEDG
FT                   ADHVVATVDHLLARPGTVTGN"
FT   gene            complement(128837..129172)
FT                   /locus_tag="Gbro_0114"
FT   CDS_pept        complement(128837..129172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19464"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19464.1"
FT                   /translation="MFGPARAHQVPIMEIANNFRGRGGRRLADLQVDPDHLEALRRIDL
FT                   EVILRDGLATGEFVGISADSMALAVRSAIGGAVMRATADPDFDVVAYGEDLVTAFARAT
FT                   EPGSQNG"
FT   gene            complement(129231..129842)
FT                   /locus_tag="Gbro_0115"
FT   CDS_pept        complement(129231..129842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19465.1"
FT                   /translation="MAGVHRSVDMGFIPSIHRSGATRNAPDQAISVVSPERTDHRPTTE
FT                   ETTMKLQTRIAAGVVGIAAAAGIGLGAAGAAHAGTMPITRPGEPTVAMTITNHTDKPEY
FT                   LIGSTAGQSGQWVNAPQRVLYPGASETVTAVAPFSNYLTANAQYRIGHFGPTANYEIED
FT                   MKGNVNTAMSGIWGPHAQQYWMSHSISSRYPNVNVGFDQW"
FT   gene            complement(129876..130475)
FT                   /locus_tag="Gbro_0116"
FT   CDS_pept        complement(129876..130475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0116"
FT                   /product="Protein of unknown function DUF2302"
FT                   /note="PFAM: Protein of unknown function DUF2302; KEGG:
FT                   sml:Smlt1384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19466"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB35"
FT                   /inference="protein motif:PFAM:PF10064"
FT                   /protein_id="ACY19466.1"
FT                   /translation="MSDVDDLLSRLPIGDIAAQLGVDEASAQAAAAQAVPALLTGLQTQ
FT                   TRDENSAQQLAHALQQHDNDLADGEIDLGQVDTADGTKIVSKIFGDKTDQVAGALSDQV
FT                   PAAAVDQGLIARMLPILAPIVLSYLTRKITGGATNSGTTPGGGDLGSILGGMLGGGGGA
FT                   AGGLGSVLGSVLGGAGATPGGGGLGDLLGSILGGRK"
FT   gene            complement(130502..131587)
FT                   /locus_tag="Gbro_0117"
FT   CDS_pept        complement(130502..131587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0117"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bmn:BMA10247_2383 putative acetyl-hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19467"
FT                   /db_xref="GOA:D0LB36"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB36"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACY19467.1"
FT                   /translation="MPQQATTVTRVSAPLPPPAVADLVAPEMPGFPRAERLRTPGDRGS
FT                   ARARAINSYFGRVARPLMTTARAGHPAVRAQMIRALRPSVNQTLVAMSPVPAGTRATGI
FT                   RERFDGGEVRGEWVTGARVAAGPIHPDQPIIYYLHGSGYVICSTRTHRGLVARLSNRTG
FT                   MSAFSLDYRMGPEYRFPAAGDDAIRGYRWLLSQGFRAEQIVVAGDSAGGHLALDLLSAN
FT                   HAAGTPQPGAMVLFSPLYDPTFSLAIEHQRSGRRDPIIEAIAAQRILRLYTRSADPDDP
FT                   RMRIRLTADMDLPDTLIQFGGLEVMGADARAIHRELSNSGARVELQEWPDQGHVFQMFP
FT                   RFTPESRRALAVAAEFMTASD"
FT   gene            131986..136599
FT                   /locus_tag="Gbro_0118"
FT   CDS_pept        131986..136599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0118"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamate
FT                   synthase; glutamine amidotransferase class-II; KEGG:
FT                   ade:Adeh_0817 glutamate synthase (NADH) large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19468"
FT                   /db_xref="GOA:D0LB37"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB37"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ACY19468.1"
FT                   /translation="MKHAPGRVGLYDPRFEHDSCGVAFVVDMYGRRSRDIVDKAIMALI
FT                   NLEHRGAAGAEPNTGDGAGIMIQVPDRFLRESVDFELPAAGRYATGIAFLPQGSEDARQ
FT                   ACAGVEKIVEAEGLSLLGWREVPTDDSSLGALARDAMPTFRQIFIAQPDAGAGEPSANE
FT                   IAELERRAYVVRKRVTYELGNKGAGADGPGRETVYFPSLSGQTFVYKGMLTTPQLREFY
FT                   VDLQDSRVESALGLVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRAREALI
FT                   NTDVFGPDAAEKIFPACTPGASDTARFDEVLELLHLGGRSLPHAVLMMIPEAWERHETM
FT                   KPEHKAFYRYHSSLMEPWDGPASVCFTDGTMVGAVLDRNGLRPSRIWVTKDGLVVMASE
FT                   VGVLDIDHADVVQKMRLQPGRMFLVDTAAGRIVDDEEIKDELAAEHPYAEWLEQGLVQI
FT                   DDIASRPHIHMAHERVALRQQVFGYTTEELNLLVAPMAKTGAEAIGSMGTDTPIAVLSA
FT                   RPRMLFDYFQQMFAQVTNPPLDAIREEVVTSIGGTIGSEADLLNPSAASCRQIVLPEPV
FT                   LDNDSLAKLVDIGDNGSLPDFRSLHVHGLYPVSEGGAGLRRALDEIRAKVSAAIDDGVN
FT                   LIVLSDRESDEKAAPIPSLLLTAAVHHHLVRERKRTRVGLVIESGDCREVHHVAALIGF
FT                   GAAAVNPYMAFESIEDMVERGALGDIDFPTARANYIKAAGKGVLKVMSKMGISTLASYT
FT                   GAQLFQVIGIGQETVDEFFAGLRSQLDGIGLDEIAADVAKRHALAFSERPTERAHRELE
FT                   VGGEYQWRREGEYHLFNPDTVFKLQHSTRTGQYQVFKEYTRLVDDQSAKMASLRGLFDF
FT                   NFGDRDPIPIDKVEPAREIVKRFSTGAMSFGSISAEAHETLAIAMNRLGGRSNSGEGGE
FT                   DPRRFHHDENGDWRRSAIKQVASGRFGVTSHYLSNCTDIQIKMAQGAKPGEGGQLPPHK
FT                   VYPWVAEVRGSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPSARIHVKLVSEVGVG
FT                   TVAAGVSKAHADVVLISGHDGGTGATPLTSMKHAGAPWEIGLAETQQTLLLNGLRDRIV
FT                   VQVDGQLKTGRDVVVAALLGAEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPLLR
FT                   ERFTGKPEFVENFFMFIAEEVRELLARLGFRTLQEAVGHVEALDTGKALAHWGSAKAGK
FT                   LDLSSVLAAPESPFMNQDLYCSGVQDHALDKALDQQLIAQSREAIDHGTRVSFSSKITN
FT                   VNRTVGTMLGHEVTKVYGAQGLPDGTIMIDFTGSAGNSFGAFVPKGITLRLEGDANDFV
FT                   GKGLSGGRLVVRPARNAPEDFVAEDNIIAGNVIGFGATAGKIFLRGVVGERFCVRNSGA
FT                   TAVVEGVGDHGCEYMTGGRVVVLGDTGRNFAAGMSGGIAFVYDPDRTFANNLNTELVDI
FT                   EELETQDVEFLASIITEHRAETESPVAAAILADWENTQGQFAKVMPRDYKRVLLAIETA
FT                   EAQGRDVNEAIMEAARG"
FT   gene            136592..138046
FT                   /locus_tag="Gbro_0119"
FT   CDS_pept        136592..138046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0119"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: scl:sce5061 glutamate synthase
FT                   (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19469"
FT                   /db_xref="GOA:D0LB38"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB38"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ACY19469.1"
FT                   /translation="MADPRGFLKHPERELPDRRPVELRLLDWKEVYTDFGHDQLQTQAS
FT                   RCMDCGIPFCHNGCPLGNLIPEWNDLVYKDRWREGIERLHATNNFPEFTGRLCPAPCEA
FT                   SCVLGINQPPVTIKQVEVELIDNAFDNGWVTPVLPLERTGKSVAVVGSGPAGLAAAQQL
FT                   TRAGHDVTLFERADRIGGLLRYGIPEFKMEKRHIDRRLAQMEAEGTVFRTGVNVGVDVT
FT                   VEQLRADFDAVVLANGSTIGRNLPIPGRELDGIHQAMEFLPQANRIQLGDEVENQITAK
FT                   GKKVVIIGGGDTGADCLGTSLRQGAEIVHQFEIMPRPPMERAESTPWPTYPLMYRVSSA
FT                   HEEGGERVFSVNTEQFIGENGKVTALKAHEVVMRDGRFEKVEGSDFELECDLVLLAMGF
FT                   VGPEREDLLDKLGVDYDQRGNIKRDDNFGAVGLPGVFVAGDAGRGQSLIVWAIAEGRSA
FT                   AAAADAYLAGTTDLPAPIYPTQVAQR"
FT   gene            complement(138219..139117)
FT                   /pseudo
FT                   /locus_tag="Gbro_0120"
FT   gene            139171..139677
FT                   /locus_tag="Gbro_0121"
FT   CDS_pept        139171..139677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19470"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19470.1"
FT                   /translation="MASTAPDRRHCTERLAGSPTCRRDALVPGIGAVRCYVRFRATALI
FT                   DEGERVGAENAILFDVDRARTPAPRLALPGSTGRAATSPLGEGSGSGHGPVYTWLAWAH
FT                   DHMGGSAERNGRRAVEADHRGRGNYTAGRPFGDLRLGRCATGGRRPAVAGADVARRFAA
FT                   ACGPS"
FT   gene            139999..140451
FT                   /locus_tag="Gbro_0122"
FT   CDS_pept        139999..140451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19471"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19471.1"
FT                   /translation="MSSSFVEFEVLDGVDAAFFSYDGPVVEDADLRQAQRQAADAEREE
FT                   QCAWFRENVGATEVSIPVTLDARLDHVHRRDADGGFEATLRLPGHRHASLARRPRSDEP
FT                   WELRWSGEVSRWSTAEFDWAVTLHDLPLDDAALASLQEQLQAPPAG"
FT   gene            complement(140568..141023)
FT                   /locus_tag="Gbro_0123"
FT   CDS_pept        complement(140568..141023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0123"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase;
FT                   cyclase/dehydrase; carbon monoxide dehydrogenase subunit G;
FT                   KEGG: dat:HRM2_48610 CdfA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19472"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB41"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ACY19472.1"
FT                   /translation="MVDVTRSFPVQRPIEEVVAYLRDFANAVEWDPGTQSCEPISTGAI
FT                   GVGSRWHNETKLYGISTTLTYELTRDDPDHLVFTGTNKTATSTEDLSFVSLDSGHTEVT
FT                   YHAHVDFNGAARLADPLAQLGFKRLAPEVAEQMKRAIENAPAAGSVG"
FT   gene            141159..142049
FT                   /locus_tag="Gbro_0124"
FT   CDS_pept        141159..142049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0124"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19473"
FT                   /db_xref="GOA:D0LB42"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB42"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ACY19473.1"
FT                   /translation="MSHRIVAACIAVLSLVAGLLVAATPQARSAPGDCPKIYVLAIPGT
FT                   WANGSSPGIMSQVTSGLGPETQVAFVGYDATAFPWERAIYGKSKAQAVANTEGLALTML
FT                   RRCPGTRIALTGYSQGADAAGDVASEIGTGRARIRPGQVAGVVLISDPRRSRKDNLVGP
FT                   PLRGEGSGGPRLDGMGWVLPRAFTICEPKDIYCNVPRDYYLTRIVGYLAETSNPTPSQI
FT                   LQYQAEASAIVGELLTRGGPGAIVGELSNKRARDQITSFSNFLQSGAHGTYTTFQVKPG
FT                   VTAVQWAHNFLAGLA"
FT   sig_peptide     141159..141227
FT                   /locus_tag="Gbro_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.756 at
FT                   residue 23"
FT   gene            142304..142471
FT                   /locus_tag="Gbro_0125"
FT   CDS_pept        142304..142471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19474"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19474.1"
FT                   /translation="MKLADTLHTSRRGTASTSSMLGSITGRLGRSRTARMFPAEAERLV
FT                   TPAEFKRLHG"
FT   gene            complement(142497..142727)
FT                   /locus_tag="Gbro_0126"
FT   CDS_pept        complement(142497..142727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0126"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: gme:Gmet_0098
FT                   RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19475"
FT                   /db_xref="GOA:D0LB44"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB44"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACY19475.1"
FT                   /translation="MDVDDRYEVPIRDDVIRLGQFLKLANLIESGSEAKEVIGDGLVRV
FT                   NGEVETRRGRQLSVGDVVEIGGVGARVVAEP"
FT   gene            142798..146214
FT                   /locus_tag="Gbro_0127"
FT   CDS_pept        142798..146214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0127"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="KEGG: sml:Smlt2232 lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase; PFAM: tRNA synthetase class II (D K
FT                   and N); protein of unknown function DUF472; protein of
FT                   unknown function DUF471; protein of unknown function
FT                   DUF470; nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19476"
FT                   /db_xref="GOA:D0LB45"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="InterPro:IPR031553"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0LB45"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACY19476.1"
FT                   /translation="MALDTPSSDLPVSTDDTAEHQPTPAHRPPSAADRRSVDLLEKIRR
FT                   PRGFGAGAPKIAGTVVGVLAGIALLSSIFPLFRRLIHYPRDFIDNYIVSLPNTSLAWAF
FT                   VLALVAIALSSRKRIAWWIATIYLVLFMVSNALLLVDPVATDFGVDTDERIQIWIGLGI
FT                   DAAALIFLIVTYRQFYTRVRRGALFRALGVLIVGLTAATLVGWGLVWAWPGSLERTERL
FT                   PYAFNRVVTFGSIDSRTFDGHHTHIVIDSALGLLGALALIAAATVLFRSQRLESLMTSD
FT                   DEKLIRALITRFNDDDSLAYFSTRRDKAVVFSPDGRAAITYRVEIGVGLAGGDPIGDPE
FT                   SWPDAIAEFLTLCDRYGWHPAAMGSSARGAAAYDAAGFGSLSIGDEAILHTREYTISGP
FT                   AMKAVRQAVTRTRRAGVTVRIRRHGEVPDDEMPQVIARADAWRDTDEERGFAMALSRLG
FT                   DRADDDCLLVEAVEHAGTPEEKVIGMLSFVPWGRRGVSLDVMRRDRGSVNGVVETMVTE
FT                   LCRNSEQFGITEISLNFATFRAFFEQGPQIGAGPIMRLGYSVLMFGSRFFQMESLYKSN
FT                   AKYLPDWQPRFLCFEDNRILPRVGLAAIVTEGFVQLPRFGRKQHYIAGQSSIPAGVDAD
FT                   ALIAQLESEEDRTAVEVHRPEQVRVRVAKLDRLIEEGFDPYPPADAPTHTIAEAIAEPE
FT                   GTQVTIAGRVTKMRDFGKVTFADVHDWSGQIQMLVEASRVIPGTPDFGSDVDLGDLVEA
FT                   RGVIGRSRSGELSVLIDAWRFNGKCLRPLPDKWSGLTDPEARVRQRYVDLAINPRSREL
FT                   LATRSVVVKALRDFLADRGFMEVETPILQQIHGGANATPFQTHINAYNLDLYLRIAPEL
FT                   YLKRLCVGGVEKVFEIGRNFRNEGVDFSHNPEFTSLEAYAAHSDYLKMLDLTREMIQHA
FT                   ATAAHGEPVIIRVDDEGNEQRVDISGDWPVRTVHEVVSEGAGVEITSDTEVSELRGICD
FT                   RLEIAYRPDWDAGQIVLELYEHLGEDRTTVPTFYTDFPTSTSPLTRAHRSKPGVAERWD
FT                   LVAWGVELGTAYTELTDPVEQRKRLTAQSILAADGDPEAMELDEDFLTALEYAMPPTGG
FT                   LGVGVDRVVMLITGQSIRESLAFPMVKPTDA"
FT   gene            146211..147086
FT                   /locus_tag="Gbro_0128"
FT   CDS_pept        146211..147086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0128"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bam:Bamb_5411
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19477"
FT                   /db_xref="GOA:D0LB46"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB46"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY19477.1"
FT                   /translation="MNATGIPGRHIDVGGLRLHVLDEGSGPPLLLMAALGSNWFDLDPL
FT                   ATRLVVRGWRVIRYDRPGYGLSAGPRRREVPTLDAEIRRMTGVLDAVGVDGPVTLVGHS
FT                   MASLYVEGFARSEPARTAGLVILDGSYVLLPWRVVPPSFRVANAHRLMGAARGVSVRVG
FT                   LRLRGRGQLRARILPTPPEGFDAAQRVWGDRVFGGGRMLLATLVENAAFPTINASLRRL
FT                   RSARALPAVPTVVVAALSGSVVWRRFWRAKQARYAAGLGARLRTVGSHHFLVLEVPDEV
FT                   ADIIDEVRPG"
FT   gene            147158..147871
FT                   /locus_tag="Gbro_0129"
FT   CDS_pept        147158..147871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19478"
FT                   /db_xref="GOA:D0LB47"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19478.1"
FT                   /translation="MALVVVVAIELPMWFRGPPVQAAFGLIVLGAFVILIALALAVSVG
FT                   RRWWARWWAMRHGFAFSHRPHRSEPPHGVESFDNWQMLTFVHYSATGQISDRSARLLFY
FT                   RNWFGARWRYAHRHVFTVTLPTALPGLTIGPNLHTRTRGEHIIFDDDDGSDFARYLPVF
FT                   SPAPDVARRVLTRSVRDRLGDLAARSSVVRITVFVVVGDKLHAVWLNTSQPQDLTDVAE
FT                   GLRILVAALEANSKL"
FT   gene            complement(148399..148611)
FT                   /locus_tag="Gbro_0130"
FT   CDS_pept        complement(148399..148611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19479"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19479.1"
FT                   /translation="MIDEKLRPRGDHGVDVQFVGSTADSRHHIDQGVGDRRRDAQRHLA
FT                   QIDGGDDLRTRQGRIHLVDQPCHRG"
FT   gene            148772..149245
FT                   /pseudo
FT                   /locus_tag="Gbro_0131"
FT   gene            149421..149876
FT                   /locus_tag="Gbro_0132"
FT   CDS_pept        149421..149876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19480"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19480.1"
FT                   /translation="MRVRHRLRLLAVLVALGLGGGLTLVGLGQAVATPGDVKTRVNNYW
FT                   EARVYQAYDIGGAFQLTNKASQRPIYLQYKRTSRYGWPSGWHRLTGDVARGQTKVDGWY
FT                   VAPRGYDGVFLRVCRNDPGDRDYCWSSLMYFGKPGGQGGGSGMITGA"
FT   sig_peptide     149421..149519
FT                   /locus_tag="Gbro_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.754 at
FT                   residue 33"
FT   gene            149919..150410
FT                   /locus_tag="Gbro_0133"
FT   CDS_pept        149919..150410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19481"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19481.1"
FT                   /translation="MKRWASVLIVAAALTLTVGAGSSTAAPRSEQNSATLVALTVEAQP
FT                   VAVPGWPVFPAVYGPRYWPQFKVWFTHNTFLNRAQTRQLYETGWVPGYANTQLPFSSVA
FT                   RTLQGNNLLRTAVQRGGCFAIGTRTDPVWSPVAKKWVTAGAQGYMSPPHLKAQVDAICR
FT                   "
FT   sig_peptide     149919..149996
FT                   /locus_tag="Gbro_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 26"
FT   gene            150492..150626
FT                   /locus_tag="Gbro_0134"
FT   CDS_pept        150492..150626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19482"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19482.1"
FT                   /translation="MTTKLTTTVGAAAVVTALFVGTAPIAEAQPRGYSVRNTTQSVRT"
FT   sig_peptide     150492..150578
FT                   /locus_tag="Gbro_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.900 at
FT                   residue 29"
FT   gene            150839..151363
FT                   /locus_tag="Gbro_0135"
FT   CDS_pept        150839..151363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19483"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19483.1"
FT                   /translation="MKRCLATLAAIVLAVVGLGTATAVAGADVQDRRGLAGKVISPPQA
FT                   RCDYMRNTSSGWLAVSTYPPTVYAAQGKRQSVIYRLLLADANTGKLLQTSNWSGAQSVT
FT                   GNRPARWNGVGTLTGAWQGNYHLAFEVRFFQPGGKWQGTITSLQTRYQIFNQRIGPYGP
FT                   TSSCVKLKNFG"
FT   sig_peptide     150839..150916
FT                   /locus_tag="Gbro_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.446 at
FT                   residue 26"
FT   gene            151490..151990
FT                   /locus_tag="Gbro_0136"
FT   CDS_pept        151490..151990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0136"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: dar:Daro_3096
FT                   ribonuclease activity regulator protein RraA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19484"
FT                   /db_xref="GOA:D0LB53"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB53"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ACY19484.1"
FT                   /translation="MLVGMSELTFTPTADLVDEIGDTVRSCDLQFTQYGGNREFVGRVT
FT                   TVKCFQDNALLKSILGESNPGGVLVVDGAGSVHTALVGDLIAELGRSNGWVGIIINAAI
FT                   RDSKPIGEMEIGVKALGTNPRKSTKTGVGERDIPLTIGGETFNPGDIVYSDDDGIVIVT
FT                   PEN"
FT   gene            152020..153573
FT                   /locus_tag="Gbro_0137"
FT   CDS_pept        152020..153573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0137"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; acyl-CoA reductase;
FT                   KEGG: scl:sce4495 putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19485"
FT                   /db_xref="GOA:D0LB54"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB54"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACY19485.1"
FT                   /translation="MPKPTADYFARLGALVAIDNAAERPTRSVLEAFSGAEMATIPVGT
FT                   ADDLEQAVARARVAQEGWAKRTPAERAKVLDAFSELVYRNAQELMDIAQAETGKARTYA
FT                   QEEVLDVALTARHYANVGPKLLADRKVKGMLPGATSVRVRYQPKGVVGVISPWNYPLTL
FT                   AVSDGVAALLAGNAVVIKPDSQTPYCALAVAELLYQAGLPRELFAVVPGPGSVVGQAIV
FT                   AQTDYVMFTGSSATGATLAEQAGRRLIGFSAELGGKNPMIITKGAKIADAVQGAARACY
FT                   SNSGQLCISIERIYVEKAIADEFADRFAAYVSAMKLSATYDFNADMGSLASAAQVETAE
FT                   AHVADAVAKGAKILAGGKRRADLGPFFYEPTVLTDVTDEMTCYGQETFGPVVSIYPVDS
FT                   VDEAIKLANDTEYGLNASIFAGSSAEANAIADQLRAGTVNINEGYAAAWASTAAPMGGM
FT                   GISGMGRRHGEEGLLKYTEPQTIAEQRFLGIDRMPVVPQNIYRAITPSVVRGLKYLPGR
FT                   "
FT   gene            153672..154865
FT                   /locus_tag="Gbro_0138"
FT   CDS_pept        153672..154865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0138"
FT                   /product="Capsule synthesis protein, CapA"
FT                   /note="PFAM: Capsule synthesis protein, CapA; KEGG:
FT                   mxa:MXAN_4905 putative polyglutamate synthase CapA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19486"
FT                   /db_xref="GOA:D0LB55"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB55"
FT                   /inference="protein motif:PFAM:PF09587"
FT                   /protein_id="ACY19486.1"
FT                   /translation="MDAEVVGRSWGVVGGCAAVMVAVAALAAASSSTPHPVVTSAVHAH
FT                   QPRMHTPVATDLVLSFTGDNILGTDDKFSTASSLPTLWEQSGRRPDYFFRNVRQYFDAD
FT                   DLTVANFEVALTNWREKRYKGEGEVYHFHGDAALAHTLPAGGIDVVTVANNHTFDYGQR
FT                   GFDDTLAALRSARIGYFGTGDASEGSDYDMSLLRTVNGVTVGLVGYQTWTDTPEVERKI
FT                   RTDFDRLRAAGADVLIPFFHWGIESEHTPYEVQTNLAHLAIDAGVDLVVGTHPHVIQSM
FT                   EIYRGKLIAYSFGNFAFGGNSNPTDKRTFILQARLHTVDRDVRSVDFRVIPTRVSRTES
FT                   YNDYVPTPYAGPEKQQVLEFINGISPTLHGRAADCFVPVAPSRTHPPAPTVQARPAG"
FT   sig_peptide     153672..153755
FT                   /locus_tag="Gbro_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.638 at
FT                   residue 28"
FT   gene            154993..156141
FT                   /locus_tag="Gbro_0139"
FT   CDS_pept        154993..156141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_1990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19487"
FT                   /db_xref="GOA:D0LB56"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB56"
FT                   /inference="similar to AA sequence:KEGG:Ppro_1990"
FT                   /protein_id="ACY19487.1"
FT                   /translation="MVGATIAATLTPVPAARATAPLQVTTVASNLSIPWDVEVAPDGTI
FT                   LTAQRSGSLVAIRPDGRLISIAHDTSRIFAAKEAGAMGIALDPGFAQNRRVYICQAEYT
FT                   RPGAPTIPGEVADLPLPWPNTGQVINVVSWRIDGDWIRANRERTVLSGIPITAAGRHAG
FT                   CALTASGRSLWVGTGDAALPGNAQNRNSLGGKVLHINRDGTPAAGNPNPRSPIYTLGHR
FT                   NVQGVAVAPGTGRVYAIEQGTDRDDELNLLRSGGNYGYRPDRAPVIYDESVPMTDPIRV
FT                   PGAIGPVWRSGPATIATTALAFLPAGWGPYSGGLVVSTLKGKRLVFMKLSADGRRVVAK
FT                   TEALTDRYGRLRGLAVAPDGSLLVTTSNGNSADKILRVRWGS"
FT   gene            156143..156937
FT                   /locus_tag="Gbro_0140"
FT   CDS_pept        156143..156937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0140"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: atc:AGR_L_227
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19488"
FT                   /db_xref="GOA:D0LB57"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB57"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ACY19488.1"
FT                   /translation="MCDDALVRSAHEQAAGLSRRDALRLAAGVATGVSAAMVAGTATVS
FT                   AANAAPSSRVVDLTHVLSPSFPVWPGNAPFVSLPTSRVGPGNSGFATNWVSFAEHSGTH
FT                   VDAPAHKIGSGITVDRIAASDLVAPLAVISIDGRGPRSTLGVADVVAFEKRHGRIPRGA
FT                   LVALHTGWQPRTGGPDAAGFSAAAVRMLVGDRAVVAIGTDTLSIDVRGASAAHTAILGS
FT                   GRYAVEALANLTSVPPLGATVMVGAPRFAGGTGGPARVLALL"
FT   gene            complement(156960..157445)
FT                   /locus_tag="Gbro_0141"
FT   CDS_pept        complement(156960..157445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19489"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19489.1"
FT                   /translation="MAANPRSHDVPAGDRVAKFPESAGDPTLAAPGDEAHEITGVVLGL
FT                   SIRGVTEPTRADIDRRNADVERAARTVTIVGPAVAFGTTVPDRGAQITVDLGDPRLEVT
FT                   GALSTLDRPVRGVTGQVSALHRSGTGSVSYLDVDAGIAADSVTSPLYVCLTVDADDL"
FT   gene            complement(157405..157803)
FT                   /locus_tag="Gbro_0142"
FT   CDS_pept        complement(157405..157803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19490"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19490.1"
FT                   /translation="MTSPDVPHVHVRLSSWEWGCCGVTPAVGESVTVALTSGLAGDDEP
FT                   FATEPVVDWRPDLELVGLPSCSAHYAPVDGDPRGRRLRLYGGWHDESRVIPRVEATIVT
FT                   CTWYRRSSGAGRTHPGGSESPVARRTGR"
FT   gene            157987..160023
FT                   /locus_tag="Gbro_0143"
FT   CDS_pept        157987..160023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0143"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   gme:Gmet_0887 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19491"
FT                   /db_xref="GOA:D0LB60"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB60"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACY19491.1"
FT                   /translation="MTAVLDRAGPENDTSPGVTDPPSRSLRKRRSARPVRWNPFALTGL
FT                   LITTAVLYLWNLSASGYANTFYAAAAWAGSESWKAWLFGALDPSNFITVDKPPAALWVT
FT                   GLSVRLFGMNSWAVLVPQALMGVASVALVYCAMRRTFADPRQGTAAGLIAGAVLAFTPA
FT                   AALMFRFNNPDALLVLLMVAAGYCLIRAIGTNSGRWLALVGVALGFAFLTKMLQGLLVL
FT                   PAFGLAYLLFANNGWLKRIGHLILATVALIVSAGWFVVVTMLVPASSRPYIGGSTDNTF
FT                   MDLVWGYNGVGRISGGNGPGGGGPGGGQAGGSFGGSTGLDRLFSSEMGNEISWLLPVAL
FT                   FALTFAIYAMIRSFPGFRFTGRVSRVESGAVVAWGGWLLVTGLIFSFMSGTIHPYYTVA
FT                   LAPAIGALVGIGAVLAWRRRDHWDGRIAMSAMIGLAAWWSIVLLNRNDFGPTWCRWLIG
FT                   VAALLAVVGVLAGSTLKMRKLLATSLIVGSLAGAGGSVGFAIATAATPHSGSIPNAVNT
FT                   SIEGGGMGGFGGGRGGPGGTPPGQAGQQGQTSQGQAHQGQSDDRSGTRGGGTGMGGDIA
FT                   ANTELVNLLKATDTTWAAATNGSQSASGIEIATGTSVMAIGGWSGDPAPTLQQFIAYVQ
FT                   AGKIGYYIGGGQGGPGGNSEIATWVAQNYTATTVGGTTVYKLT"
FT   gene            complement(160081..160518)
FT                   /locus_tag="Gbro_0144"
FT   CDS_pept        complement(160081..160518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_2034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19492"
FT                   /db_xref="InterPro:IPR021607"
FT                   /db_xref="InterPro:IPR023159"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19492.1"
FT                   /translation="MTHTAIGKFTVTSWDEKTVYQADDETIEMGGAHYPARGFTSATVE
FT                   YAYTGDVAGRGVESSLISYNGEHAAPTLGFLAFEGSIDGHEGSVVLRATGEHAGMHVTG
FT                   RMEIVEGLGTGGLANARGYAELEIAGHSDDGYPITFHYTLD"
FT   gene            160648..161478
FT                   /locus_tag="Gbro_0145"
FT   CDS_pept        160648..161478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0145"
FT                   /product="Helix-turn-helix, AraC domain protein"
FT                   /note="SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   bvi:Bcep1808_3951 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19493"
FT                   /db_xref="GOA:D0LB62"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB62"
FT                   /inference="protein motif:SMART:SM00342"
FT                   /protein_id="ACY19493.1"
FT                   /translation="MLGRGERAILHPSRAAVIDVTRQVPAADLRSWIDYFWIVRWQAEE
FT                   PHTQAVIPQPVVHVAAENGRLLAHGVGGSHFTRTLLGDGHVLGMALRPGAFRSFIGRPV
FT                   NTVSRSVIAMGDLTGVDDRPIADALLRPGAADAELVGVAESWVRGLDLDRDPMIDTVAG
FT                   LVTRAESDHTIVRAEQLAAVASMSLRSLQRLFGEYVGIGPKWVIQRFRLLDAAAVANSG
FT                   TRFARDVDWAALAVDLGFSDQAHLTREFSRIVGTPPASYLRSEHDQADDRPRRG"
FT   gene            161483..162328
FT                   /locus_tag="Gbro_0146"
FT   CDS_pept        161483..162328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0146"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bte:BTH_II1459 alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19494"
FT                   /db_xref="GOA:D0LB63"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB63"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY19494.1"
FT                   /translation="MTERITEYRRGPWTFDVIDEGPADGDPVILLHGFPQRASNWDRVA
FT                   RLLHERGLRTIAPDQRGYSPRARPRRRRDYRQSELVADVVALIDELGAPRVDVVGHDWG
FT                   AAVAWTLAANHPGRVRTLTAISVPHPGAFLRAMPRAQILRSWYMLVFQLPWLPEKLLGA
FT                   GMRRPGFAVRMGLPADHDDRLADIVDSGALNGALNWYRGMPIPDPAVRMRKVTVPTTYV
FT                   WSDGDPALGRAGARLCASWVDAPYEFEALTGANHWLPENRPREVAEAILGRVLSVDDAG
FT                   "
FT   gene            complement(162306..162878)
FT                   /locus_tag="Gbro_0147"
FT   CDS_pept        complement(162306..162878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3212 histone H1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19495"
FT                   /db_xref="GOA:D0LB64"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19495.1"
FT                   /translation="MTEPDPPVTPEESSPNGAAAVPPEQVPGEQAPAKKVPAKKAAAKK
FT                   APAKKTPAKKAPAKKAAAKKAPAKKAAGGPAGPASTAPAKKAPAQPPQPAPAPAEPEPA
FT                   SAPTQSEPAASQPATPTPAAPKTPPTAPAKPPVDVVAESDAQRATFAQLRAGAPTELPT
FT                   PNRTVPITIAALLGLLAALIVIRRRRR"
FT   gene            complement(162946..163638)
FT                   /locus_tag="Gbro_0148"
FT   CDS_pept        complement(162946..163638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI21568 gene product from transcript GI21568-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19496"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19496.1"
FT                   /translation="MGLFSSDGKSRAQRKAEAKALKAKAKLEAKLDAKDRRRTEKARRK
FT                   TEHKYFKKELKAQRKNSDHVAKNQAKVAKAEAKKVEAQAKAAADAKALSPASVRRYLTV
FT                   ARLVAPVVIPIVYRAAVAGRGRLTALQAGRVGVSPEVLRQFSGHGATLSARIATTRTAL
FT                   DKVTAQDKSADSDDFVKAMATRLDNLSVAVHASEAMPAGQRRTAHQSIDDELSAIDADI
FT                   LARLGVRA"
FT   gene            163749..165479
FT                   /locus_tag="Gbro_0149"
FT   CDS_pept        163749..165479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0149"
FT                   /product="RecB family nuclease, putative"
FT                   /note="TIGRFAM: RecB family nuclease, putative; KEGG:
FT                   sml:Smlt2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19497"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB66"
FT                   /inference="protein motif:TFAM:TIGR03491"
FT                   /protein_id="ACY19497.1"
FT                   /translation="MVLAPRDLAGCEHRLALDFAHPELVRDRPDTPGVSRRKEAAAAHR
FT                   ARVRELLRGIHSDQPESFVVVDAADSATRARQTMQACADGARWIWNATLPLDAEHGRRG
FT                   HAELLIAHGDGYVPVIVVNHRTTQPAKKLPREADARPTTVVTSPLWAWAPGPDPHRTIR
FT                   PNRRDSLRLAHLTAMLVELGLAVGPDADDLVGGVIGMDADCIVVLAVGPILDDYAQVAE
FT                   RRKQIAAQRIATVPRRVSECRSCLWWARCGPELAERRDVSLVASGNQGQALVAAGITTI
FT                   DQLARHDGPVPDGWPGSARFDDAIVNAVAWLGYIPLVRRVDRPEVSRADVEIDVDMESF
FT                   GEDGAYLWGTLLTDNTDPDRPVIYRPFVTWDPLPTRDEARSFAEFWHWLTAERAAAHAA
FT                   GKTFAAYCYSEQAENRWLLGSADRFAGEPGIPDRAAVEAFIASPEWVDIYAAVGRNFIC
FT                   PNGKGLKKVAPVAGFTWRDDDAGGEASMEWYSAAVGLGGAAVDTSQRTRLLEYNEDDVR
FT                   ATKVLREWITEAAADEVPHERDLLASGGHRGGEPTDRSGAHVAQGVEEGAAAEQRDRAQ
FT                   "
FT   gene            complement(165411..166460)
FT                   /locus_tag="Gbro_0150"
FT   CDS_pept        complement(165411..166460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_2554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19498"
FT                   /db_xref="GOA:D0LB67"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19498.1"
FT                   /translation="MKHRAPAPRRPRVRSRVTAAVVAVLALLAISLTAGIGASTPSGGD
FT                   GGSGSGSGESHQSGDGHDGAGGTDDDTDTGSGTNNSGTNNSDDNDSGTDGSGTNGSGTN
FT                   GSGTNGSGTNDSGTNGSGTNDSGTNGGGHWGGGHGHGNGHGHGNGHGNGHGHGHPTGTT
FT                   DPDESTDPTTQTPTTDPTTESSTTRRPGGGFTYKPRVTPPTTTTTTTQGSSDGSRSTGT
FT                   HRDSASAPVPTVAPPSGGNPGGPAGVAPGPVPGAGTRGPTLPRAGTPRPAATPTTAQVP
FT                   QARGTTAPAHVAADVATPLAPDTHSTSISLAGMRRFLIGIAPGALLLLGAIALLGSGSF
FT                   LDALRNMRS"
FT   sig_peptide     complement(166326..166460)
FT                   /locus_tag="Gbro_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.342 at
FT                   residue 45"
FT   gene            166807..167349
FT                   /locus_tag="Gbro_0151"
FT   CDS_pept        166807..167349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19499"
FT                   /db_xref="GOA:D0LB68"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19499.1"
FT                   /translation="MASGSGASTDTPSGPSSNVDPGLFARRLEELFRTVPGPNGRAYSA
FT                   KAIAQRSTERGFRLGESYLSQLRSGKAKSPSFRTVEGIAAAFGVDVHYFLEDRAAQRTR
FT                   DEIDLMRLQADTDVQLAAFRLAGLSSDSVTVVNELIKVLREQQGLPKDPPDVIAAGLTD
FT                   DSPTDSRLRVVGESRED"
FT   gene            167381..167893
FT                   /locus_tag="Gbro_0152"
FT   CDS_pept        167381..167893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19500"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19500.1"
FT                   /translation="MRRSKGALRALCRTTLKGLDLDLPLDVTQLCDRYGAQRGRPIRLV
FT                   AHPLPVGAPNGIWLAASDADYFFHQANTSRLHRDQIVIHEFGHLIAGHQVLGELSALTA
FT                   GGPTRDESEAALRRTCYSDDREWEAEMLASMILTWATDARTAVGSTAEHEGLRGLQKLL
FT                   GGHRGWL"
FT   gene            167884..169005
FT                   /locus_tag="Gbro_0153"
FT   CDS_pept        167884..169005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19501"
FT                   /db_xref="GOA:D0LB70"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19501.1"
FT                   /translation="MVVGVSVGIGIVNAIALVVFAVALCWRLDQIRRNGWGLQPLAMTV
FT                   AIAALTLAFVMSDSSVTNALDAALFTGASRVVFYALLAVGVAALVVVFFFPGQVSRERR
FT                   AGLEALPLVVALIGLQVTMLVIPVEIRTASITEWTARNWSFALFFLIASGYLAYGFIAC
FT                   VRNVRRFYRTASGYLRMSLGLLVLGLGLLALGSIAQIVFVVGSAGDVLRAPWLLTASRV
FT                   LAVAGVVAFLVGISYPMIYARYQSLTANRRRRRVDEELQPLWKLVTEAVPEVVLPEAGA
FT                   LTPTIRLHRRVVETRDALTQISPCLPVVFEYAEPAVQARLLRVAVDEYTSANRVSGEVR
FT                   DVLPDEGDGLDDDAAPLVALSRALREETLGLAS"
FT   gene            complement(169002..169763)
FT                   /locus_tag="Gbro_0154"
FT   CDS_pept        complement(169002..169763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0154"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   rme:Rmet_0531 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19502"
FT                   /db_xref="GOA:D0LB71"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB71"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY19502.1"
FT                   /translation="MDVSGSSVLVTGGASGLGAATARRFAASGAQVFGLDLQASIDKAA
FT                   PVDGVTLIPADVTSESEVQAAIDTIAESGAPLRVAVNCAGVGWAARILGKKGPHELDLF
FT                   QKVININLVGTFNVMRLAANRMQEESTIDGDGQRGVIINTASVAAFEGQIGQIAYAASK
FT                   GGVHAMTISAARDLARLGIRVCTIAPGTISTPMLAGVTPEFQKTLAEAIPFPQRLGEPD
FT                   EYAQLAEFIVAHNYLNGETIRMDGAIRMAPR"
FT   sig_peptide     complement(169683..169763)
FT                   /locus_tag="Gbro_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.539 at
FT                   residue 27"
FT   gene            complement(169870..170586)
FT                   /locus_tag="Gbro_0155"
FT   CDS_pept        complement(169870..170586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0155"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   sat:SYN_01349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19503"
FT                   /db_xref="GOA:D0LB72"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB72"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ACY19503.1"
FT                   /translation="MIAALLLSFGVIFVAELGDKSQLMAMTYALRYRWWVVLGAITVAT
FT                   TAVHAVSVFFGHFLGLSIPANLMSIFAGLAMLIFGLWTLRGDRLDDDESTKANRVGASV
FT                   FFAVMSAFFLAELGDKTMLATITLSTGHNWLGVWIGSTLGMVAADALAIAIGALLGKHL
FT                   PERTIAIGAAVLFFGFAAWLLAEGLVGSTMPTVVATISAAVLITGLGSVYVWRVHRTAA
FT                   EHAEHTDTDDPRPIAR"
FT   gene            complement(170705..171226)
FT                   /locus_tag="Gbro_0156"
FT   CDS_pept        complement(170705..171226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19504"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19504.1"
FT                   /translation="MQSIPIGLTPFNHEGELGGILISGRWPESTLEWTQTLVASVRIAC
FT                   RPGFLPTTTIFGVVEDRPDDAERDAVGMMVAVGNVVDDSFVEAGRFLTNPPALFMLHPP
FT                   SRTRPSLPECSDVASGCVLLPGLPELGLEHRAGWAEAEADGTVVNLRNQIGIDPNADPD
FT                   TAVLAMLLAA"
FT   gene            171429..173456
FT                   /locus_tag="Gbro_0157"
FT   CDS_pept        171429..173456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0157"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: avn:Avin_18700 ABC transporter, ATP binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19505"
FT                   /db_xref="GOA:D0LB74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB74"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY19505.1"
FT                   /translation="MEIASIAIFGGLTVAAVVVAAVIPLAQAAGLLAPVPLALVAARTR
FT                   PRALVAATVATTLVAFAMAGTGAMATVIGSALVGGIVGDLKRRGRGFGALSLATVVSAP
FT                   LIGGVSVVALLILVPLRTLAIEAMTNSINGVAKWLDRAGPLARVGDWLEAFSRSIESHW
FT                   WVWIWVSGTLGTAVSLVVAWWIVGGVINRLAAVPSEDTLAADVAEHAEEAAAPLPLRLS
FT                   GVGFGYRPDGPQVLHDIDLEIGPGEFVAIVGANGSGKSTLAKILAGRTPGIGSVSRPGP
FT                   AGLGRRGGTAMVLQRPETQMLGSRVADDLVWGLPADVTVDVEALLAEVGLAGLGGRETS
FT                   DLSGGQQQRLAIAAALARNPALLIADEVTSMVDPLGRGQLLELLAGLPERRGMTVVLVT
FT                   HRGTEAAAADRVIHLAGGRVVPHQPDWVPDRSIGAPTVPDAAPSPPPVPAPRPAHAEPL
FT                   LVLDHVGHAHLAGSPWEVVALRDVTLTVHRGEGLLIVGGNGSGKTTLAWIMAGLIDPGS
FT                   GTCTLDGSPVTSQVGMVGLGFQHARLQLQKSTVGDEIMAAGGEKVGTAEVARVLESVGL
FT                   PRAMAATGVDALSGGQMRRVVLAGLIARQPKVLVLDEPLAGLDPYARAEIVELLARLRR
FT                   QGQTIVIISHDFEALETVCDRRVELIDGRLDNGVLAGGAR"
FT   sig_peptide     171429..171515
FT                   /locus_tag="Gbro_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.789 at
FT                   residue 29"
FT   gene            173453..174202
FT                   /locus_tag="Gbro_0158"
FT   CDS_pept        173453..174202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0158"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bpa:BPP3347
FT                   putative cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19506"
FT                   /db_xref="GOA:D0LB75"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB75"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACY19506.1"
FT                   /translation="MTMRMVPLRQVPGDSFVHRLWAGTKLLIVLILGVMTWVLPSWPAL
FT                   GMVAAVVVITALIAGIPLGALPRPPWWFWGLIALGVAVNASFGLAAVVVFLRAVVLGLV
FT                   LVASSILVIWTTPMAEVAPALAKLMRPLRMLRLPVDEWAVAIALCLRGLPMLIDELRML
FT                   RAAHRLRPTAKGRSDHPSAEMGIMDMITAAMSSALRRSAEMAEAITARGGTGRLTAYPS
FT                   GPGRADAVALVVIGLACAVAITLTVVL"
FT   gene            174249..175133
FT                   /locus_tag="Gbro_0159"
FT   CDS_pept        174249..175133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0159"
FT                   /product="low temperature requirement A"
FT                   /note="PFAM: low temperature requirement A; KEGG:
FT                   pfl:PFL_1485 low temperature requirement A protein LtrA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19507"
FT                   /db_xref="GOA:D0LB76"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB76"
FT                   /inference="protein motif:PFAM:PF06772"
FT                   /protein_id="ACY19507.1"
FT                   /translation="MVMQHVRRATGRAPGVTTMELFFDLVYVFAIIQLSSLLAHHLSVE
FT                   GGLQTLVLFGAVWWVWNYTTWATNWIDPDRLPVRVLMVVLMGLGLVMSTAIPEAFTERG
FT                   MQFAIAVAAMQIIRPLFMVITLRGDPIGRNYVNLGMWSTAAGALWIVGAFTEGHVRLAI
FT                   WALALAVDVAGPMANLWVPGLGATPMSTWTLAPEHLVERNRLIFIIALGETVLALGREF
FT                   TEVDPTAYAFISLAIGFALTVAFWWLYFARHSDAAEERLAHADDPAALARGGYAYAHAI
FT                   LVGGVIVAAVGTS"
FT   gene            175133..175429
FT                   /locus_tag="Gbro_0160"
FT   CDS_pept        175133..175429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ara:Arad_2699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19508"
FT                   /db_xref="GOA:D0LB77"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB77"
FT                   /inference="similar to AA sequence:KEGG:Arad_2699"
FT                   /protein_id="ACY19508.1"
FT                   /translation="MVAHPLEQAATGTAVAIAGGPAIFLVGLVVFVHFTTGVDGFEWLV
FT                   AAANLAALILIGVVADLAGLPLWVVSALVLIPMYALVGLAAWHARDARAVSAS"
FT   gene            complement(175529..176158)
FT                   /locus_tag="Gbro_0161"
FT   CDS_pept        complement(175529..176158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0161"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: Manganese/iron superoxide dismutase-like;
FT                   KEGG: sod2; superoxide dismutase 2, mitochondrial; K04564
FT                   superoxide dismutase, Fe-Mn family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19509"
FT                   /db_xref="GOA:D0LB78"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB78"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACY19509.1"
FT                   /translation="MAEYTLPDLPYDYGALEPHISGKIMELHHDKHHATYVKGANDTLE
FT                   KLAAARDDESIAGKVYGLSATLAFHLGGHTNHSIFWKNLSPNGGGEPDGDLASAITEQF
FT                   GGFDKFKAHFTAAATTLQGSGWAILGYDTIGGNLVILQLTDQSGNIPAAIIPVVMLDMW
FT                   EHAFYLDYQNVKPDYVKAWWNVVNWADAAERYATAKSQGSGLIVPA"
FT   gene            complement(176378..176527)
FT                   /locus_tag="Gbro_0162"
FT   CDS_pept        complement(176378..176527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19510"
FT                   /db_xref="GOA:D0LB79"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19510.1"
FT                   /translation="MATHASSDLRSVVRRPTPGRVAYDVGARCRAIGISIAVLLIVFVI
FT                   LALI"
FT   gene            176682..177398
FT                   /locus_tag="Gbro_0163"
FT   CDS_pept        176682..177398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0163"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: bmi:BMEA_B1056 methionine-S-sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19511"
FT                   /db_xref="GOA:D0LB80"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB80"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ACY19511.1"
FT                   /translation="MSWLDQLLSARAHKQELVERHSALPGREVAMPLAAENIELHHPMR
FT                   GEPDPDSDDPLRGGIGHFDGHGAVILGGGCFWGVEEIFWQVPGVYTTAVGYAGGYTPNP
FT                   TYEEVCSARTGHTEAVLVVFDPAVIDLTGILKIFWETHDPTQEMRQGNDVGTQYRSAVY
FT                   TTSDEDARLARDTAEKYATVLQEAGLGPVATEITPLAQAGDGRFYYAEDYHQQYLAKNP
FT                   LGYRCHAATGIAYPVA"
FT   gene            177405..178472
FT                   /locus_tag="Gbro_0164"
FT   CDS_pept        177405..178472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19512"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB81"
FT                   /inference="similar to AA sequence:KEGG:MXAN_6210"
FT                   /protein_id="ACY19512.1"
FT                   /translation="MAEKLTRRQWNRTLLQRQHLLDRVDEDAIEVLDRCVGLQSQDPRA
FT                   AFFGLHSRIEGFDPAELDDLLTEREVVRMALLRSTVFLVDAQDARWIRALAQPAITTEL
FT                   ERYQAPRLLSADPTRVIADAADLLAGRELRGSVLGAELEKRHPGESPSVLTAIARCGLP
FT                   LVQVPPRGLWRGRGSVTYRLFDEWVGPGEPAVEGDEARKDLIRLYLRGFGPATVQGIQT
FT                   WSGLTRLRPLVEAMEADWELARLTGPDGEELFDLEGLDLTDAEAPCAATFLAPYDNVIV
FT                   AQADRRRIADDEAYAATWTPNGRSPGFLLVDGFLAGTWRIDADGVVTVDCLRPLSAAER
FT                   RGVEVERERLQQFCG"
FT   gene            complement(178500..179261)
FT                   /locus_tag="Gbro_0165"
FT   CDS_pept        complement(178500..179261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_1450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19513"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19513.1"
FT                   /translation="MQVRWLSAFLDFPAEQFGAEVTFWRAIAGSTVSPPRGEHREFASL
FT                   QPFAGDPHLRVQRVDDGPGGVHLDLHTDDPRAAAGEAIALGASTVRDAGDYLTLRSPGG
FT                   FVFCLVGWGGESRRSRPIRWPGDTISIIDQVCIDCPPAVFDAEVVFWSRLTGWGTRSTS
FT                   RSELVGLRRDQGLTLGLLLQRLDETPPTVDSHLAQARAHLDIATTSVPEEVARHEGWGA
FT                   RVVETFERWTVMADPVGRRYCITSRNPRTGG"
FT   gene            179327..180220
FT                   /locus_tag="Gbro_0166"
FT   CDS_pept        179327..180220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0166"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: bja:blr2534 proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19514"
FT                   /db_xref="GOA:D0LB83"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB83"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACY19514.1"
FT                   /translation="MTLRPLAELEKKFARSRADHVAVVRLDGPIGASPVGRPGLTTDAV
FT                   EPILKRAFETERLKAVVVVVNSPGGSPAQSEYIAERIRQLASEKGVPVLAFCEDVAASG
FT                   GYWIACAADEIFAAHTSIVGSIGVVSSGFGLADVLSRFGVERRLYTSGDNKARLDTFSP
FT                   AVPEDVEWLKGLQHQLHEAFITWVRQRRGRKLNAPDDQLFSGDVWVGSNAAEVGLVDGI
FT                   GVMRSVIAERYPDAEITVVQAPKPLLARVVGAQMSTAGAGVAGGWLTAVAESLTTGILS
FT                   GVERAQTLRTSYSMRP"
FT   gene            180615..180968
FT                   /locus_tag="Gbro_0167"
FT   CDS_pept        180615..180968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0167"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: tgr:Tgr7_1959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19515"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB84"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACY19515.1"
FT                   /translation="MSMSDIESIAVSELPNDFTGVTDAVMLDVREDDEWSAGHIRGAVH
FT                   IPLAQVPARIDEIDLDADLYVVCHSSGRSMRVLQYLAQRGVDGTCVGGGMLAWVEHGKP
FT                   VETGPAAEGDDNG"
FT   gene            181172..182062
FT                   /locus_tag="Gbro_0168"
FT   CDS_pept        181172..182062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19516"
FT                   /db_xref="GOA:D0LB85"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19516.1"
FT                   /translation="MPYAGSARPGPPPLRYANPQRPAPQRRTYRSPAIRWIARRPPETI
FT                   PPRRPARPSGPRLIPRYVYLPTWGLRDQPITELRAGDPVAVAQSRLHMALLATGGILAV
FT                   SGLVHILRYILLTMNRSRPIPTWLADLSGALVVTAGALAVVAFVVATVLFVRWVIEVRT
FT                   ESYAMADRLDPRRRRWLIPLAAIPLVNIIGGPLLVYEAAMVRTDVDRDVVRRRINRLWV
FT                   AWAIVNGVAIVTVVARLYAWQSGSIQSGANALTMVIISAVVSAAFAIWAASRLPRLFAG
FT                   PETATVPDRRWVAVA"
FT   gene            182059..182868
FT                   /locus_tag="Gbro_0169"
FT   CDS_pept        182059..182868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0169"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: pca:Pcar_2333 glycerophosphodiester
FT                   phosphodiesterase, cytosolic"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19517"
FT                   /db_xref="GOA:D0LB86"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB86"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACY19517.1"
FT                   /translation="MTGDSSPGPAEQVSRSGKPAVVAHRGASGDRAEHTLGAYELALTQ
FT                   GADGLECDVRLTSDHELVCVHDRTVDRTSDGSGAVSELSLAQLRELDFGSWHDPGTPAS
FT                   ILTLRELLTLTLDWRRPVRLFIETKHPVRYGSLVEQRLLELLHEFGVATPPSADHSRAV
FT                   VISFSSAGVWRIRRHAPMLPTILLGDTARVLGGSAATAVGATGIGPSITTLRQYPDIVD
FT                   RAAAAGRVTYCWTVDELVDVQLCADLGVRWLATNHPAQVRDWLVTVD"
FT   gene            182912..183895
FT                   /locus_tag="Gbro_0170"
FT   CDS_pept        182912..183895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19518"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19518.1"
FT                   /translation="MGKKSKRGSGPRPGSNRAERVAARKARQAAALAPPPRPFAGLAAE
FT                   CDLVALRTFVASATAELDLVEPGAPKPALTSVVSTERPAREVPTDARNDVMLATVLPGA
FT                   IPALIRETTYLPTGFVALQTEPDRIEPAADLAAAIAWAAHAEPGAEFDAASAPPTTLAD
FT                   VVNVDVPLEITVYDDFAWWFPPGSDVPPEIAEMLQRANDSVMPTARLAPDSGIGAPWWV
FT                   DAGERAHLRWIRPEAEDELMTALARLHAAGRLTLGEGSRFAGSFRTHGLLVPVFDLDNE
FT                   MHHEEWYPGLNQFDAWLSDALAQIAPLTPDERSSRDGIRGRQVTLR"
FT   gene            complement(183907..184458)
FT                   /locus_tag="Gbro_0171"
FT   CDS_pept        complement(183907..184458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0171"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   pca:Pcar_2555 cytoplasmic ferritin (an iron storage
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19519"
FT                   /db_xref="GOA:D0LB88"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB88"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACY19519.1"
FT                   /translation="MSTETSTERTKFHQLLHDQISNEFFASQQYTAVALYYDNHDMPQL
FT                   ARHFYRQAVEERNHAMMIVQYFLDRDIEVAIPGIDAPRTDFADYKAPIELALNQEQAVT
FT                   QQIVDLAKSARDSGDYLGEQFMQWFLKEQVEEVATMTTLRTIAERAKGNLFDLENFVER
FT                   ELNVADGKDATAPPAAGGNL"
FT   gene            complement(184565..185488)
FT                   /locus_tag="Gbro_0172"
FT   CDS_pept        complement(184565..185488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0172"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19520"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB89"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ACY19520.1"
FT                   /translation="MLLLVIVIGAVAMVFYYDSKLHRVDALVSYAGRPGDTPGTNWLIV
FT                   GTDSRADLSEQQRTDLSTGDAAGARTDTIMLVHNPPSGRPMIVSLPRDLYVPIPGIGDS
FT                   KINAAFNSGGPQLLVRTVQDLTGIRIDHYAEIGFGGFDTLVDAVGGVDVCLDQSINDPK
FT                   AGPPLKKGCHRLNGKQALTLVRSRDFPQADLDRVVNQRKFLAALISRVTSPSILLNPFR
FT                   LFGFINGAIDALTVDQGDHIWNLASLAFALRDDPITTTAPTGDAEFVGGESALPVSDST
FT                   TEFFGYLKAGKEVPKQLLTSTGGVVG"
FT   gene            complement(186036..186842)
FT                   /locus_tag="Gbro_0173"
FT   CDS_pept        complement(186036..186842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0173"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: xcv:XCV4228
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19521"
FT                   /db_xref="GOA:D0LB90"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB90"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACY19521.1"
FT                   /translation="MGFSVRAILDPRGTHGIDVVTDRAGRRALWIELCIVGVLSFGFSA
FT                   IYAILSLIESELAQGLGNTTVALNPSRSELGPIDAIRQVMSALRLFAVAGLGVYLLWRS
FT                   GIGVAQAGLRRLTPRRDVPAALVLAAIIGLPGLGLVAVARALGVNAHLVPATVSSWWQW
FT                   PILILAAVANAVAEEVIVVAYFITRLRQLGVGENGSLAASAVLRGGYHLYQGVGAGLGN
FT                   LVMGLVYGRYFQLTGRVWPLVIAHAVIDMVAFVGYALLRDHLSWVG"
FT   gene            complement(186888..187679)
FT                   /locus_tag="Gbro_0174"
FT   CDS_pept        complement(186888..187679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19522"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19522.1"
FT                   /translation="MTQAVTDRPTDAEMIQTACRRVSDAILAVEPTDPAVAPAEQSPVD
FT                   PVTVDVVHLFESQAFVLVPTAGATLAAVSAAPDGVAAMLEITDCAPIDLRERVRSLIWL
FT                   KGDLHQVPADLERDLAIEIAAEHPDGGLLDIGHGRSMLRLQIDSAVIASSSGAASVSAS
FT                   ELAGASPDPFWEYEHGWISHLDSDHADVVGQLIRRLPRHLRKGRVRPLGLDRFGIRFRI
FT                   ESAEGDSDVRLPFGRPVSDVYELSHALRSLAGCPFMNSLPD"
FT   gene            187861..188847
FT                   /locus_tag="Gbro_0175"
FT   CDS_pept        187861..188847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0175"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ank:AnaeK_2061 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19523"
FT                   /db_xref="GOA:D0LB92"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB92"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACY19523.1"
FT                   /translation="MPVFAYFGPAGTFTEMALEQVLAQAATPGESTAPLFLPAAERIAA
FT                   PSPAAAIAMVRTGEVDYACVPIESSLEGSVPATMDALVPGPGAGRVQVFAETVIDVAFT
FT                   IGAAAPIPPAQVTRLAAYPVAEAQVRGSVARLFPNAHFVTAASNAAAAHDVAAGDADAA
FT                   VTTALAARLSGLTVLADGISDATDAVTRFLIIGRPAPPPAPTGADRTAVILELPNAPGS
FT                   LMAAMNEFASRGVDLTRIESRPRRELERGLSNAGEYRFFLDAVGHIDDDAVAEALAALH
FT                   RRCDRIVYLGSWPAHRVPGAVPPDHSASTAWVQTMRRGGDATTGADR"
FT   gene            188847..189524
FT                   /locus_tag="Gbro_0176"
FT   CDS_pept        188847..189524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0176"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pmr:PMI3716
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19524"
FT                   /db_xref="GOA:D0LB93"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB93"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACY19524.1"
FT                   /translation="MARLHLVRHGETTSNVMRRLDTALPGAALTDFGVRQGVRFALENA
FT                   REQPAVLVSSVARRAEQTAELIASVWDVDTEPLEGIHEVQAGDLEDRVDTDAHQVFREV
FT                   MDRWHAGDLDARIPGGESLAMVYDRYLPVVDDLAGRFLTGDNQQDVYIVSHGAAIRLIA
FT                   ARLSGIDARFAAATHLHNTGSIELEYTNGIWVCHRWGAETAPFGRVDEPLVVAESIGDE
FT                   PMG"
FT   gene            complement(189530..189880)
FT                   /locus_tag="Gbro_0177"
FT   CDS_pept        complement(189530..189880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0177"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   ade:Adeh_2395 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19525"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB94"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACY19525.1"
FT                   /translation="MPVRMSDDDFDGLVSDALDTIPAELTDAIDNVVILVEAHNPEAPD
FT                   ILGLYHGVALTSRDHDYGGFLPDTITIYREPILAMCHSREQVVHEVAVTVIHEIAHHFG
FT                   IDDAWLHANGWG"
FT   gene            complement(189885..190946)
FT                   /locus_tag="Gbro_0178"
FT   CDS_pept        complement(189885..190946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19526"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19526.1"
FT                   /translation="MLANPVRLVLAAVVVGALVMGVIALAVGLFDDSGSVGTSDIGESE
FT                   RIDDNDFARSVAGDCLDWPAGNPGQPVKVGCEQKHRFEVAGALDTSVFPGAEFGEKAPW
FT                   PGDVRFGTIRDEQCPVIVGEYLAGRLDPHGRFSVGMMYPSQYQWDRGARALRCGLQETG
FT                   PDGQPVAFSGRVADQNQSRVWPEGTCIGIDTDTRKATGFPVNCAEPHSFQATGIVDLAV
FT                   RFGDKLSGKPWPNFRTQNDYLDGICPVQAERFVGGKAKLEATTLNVQWSVLEETSWLAG
FT                   SRKVVCYLGLPDRRGGFATLVGDAKGGGDLLLINGKRPVPPPQAPPGRALPTPVPLPPG
FT                   VSENPLEVPAPAG"
FT   sig_peptide     complement(190866..190946)
FT                   /locus_tag="Gbro_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.984 at
FT                   residue 27"
FT   gene            191398..191820
FT                   /locus_tag="Gbro_0179"
FT   CDS_pept        191398..191820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0179"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; SMART: Ankyrin; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19527"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB96"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ACY19527.1"
FT                   /translation="MGTDQDSTAGHEPRAADAADLTELAGRLFDMARTGDRDTLVAYVD
FT                   AGVPVNLRNQSGDTLLMLAAYHGHAGTVEALIQRGADVGLANDKGQTPLAGAVFKGHDD
FT                   VVAALVAAGADPQAGTPSAAQAATMFGRADYTGLWG"
FT   gene            191909..193168
FT                   /locus_tag="Gbro_0180"
FT   CDS_pept        191909..193168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0180"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: serine--tRNA ligase, chloroplast or
FT                   mitochondrial ; K01875 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19528"
FT                   /db_xref="GOA:D0LB97"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB97"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACY19528.1"
FT                   /translation="MIDLRILRENPDLVRASQRTRGEDPGLVDTLLEADGTRRAAIVEA
FT                   DALRSEQKALGKQVGKAHGDEKTALLAKGKELAEQVKAAVARQNAADEAAATAHRAISN
FT                   IVADGAPAGGEDDYVVLEHVGEPREIADPKDHLELGEALGLIDMERGAKVSGSRFYFLT
FT                   GQGALLQLGLLNMAAQKAVANGFTLMIPPVLVRPEVMEGTGFLGAHADEVYHLDKDDDL
FT                   YLVGTSEVPLAGYHMNEIVDLSDGPKRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   GFVYCKPEDADAEHQRLLGWEKEMLAAIDVPYRVIDVAGGDLGSSAARKFDCEAWVPTQ
FT                   NTYRELTSTSNCTTYQARRLSIRYRDDSGKPQIAATLNGTLATTRWLVAILENHQQPDG
FT                   SVRLPAELAKFVGTDVLTPR"
FT   gene            193234..194160
FT                   /locus_tag="Gbro_0181"
FT   CDS_pept        193234..194160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19529"
FT                   /db_xref="GOA:D0LB98"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19529.1"
FT                   /translation="MIAGVIVAVIGAFAFAAAAVLQALGAEQVAQRAATREERKRSAKA
FT                   HPSLRSTVATMLTVPFLIGFVFDIIGFVATLASARMIPLFLSQTIISARLVATALLAMV
FT                   VLHIRLTTRDWIAGAVVVASLVLLAVSAGREGVDDQSWMHWAVLVAGPGLFLLGLLVMR
FT                   TVRRHIASATGLIAGAVFGVMAVASRILEGVDPFEPTRLFTDPALYALLISGMGGFYLF
FT                   TVALQTGSVNGAAAALVVGQTVLPGAVGIAFLGDVTRAGWGPVAFVAFAAAVVGGVMLA
FT                   SSQAVTAVEKADVTNMPTGYGHGSRDG"
FT   sig_peptide     193234..193311
FT                   /locus_tag="Gbro_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.794 at
FT                   residue 26"
FT   gene            194233..195216
FT                   /locus_tag="Gbro_0182"
FT   CDS_pept        194233..195216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19530"
FT                   /db_xref="GOA:D0LB99"
FT                   /db_xref="UniProtKB/TrEMBL:D0LB99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19530.1"
FT                   /translation="MVIGILAAVFAALAYGTASILQARAAQNTPVDPPVAEPHAAPSPA
FT                   STVAAMLSLWYLCGLALDGLGFLGNLVAARELPLFLAQPIVSANLVVTAVLAVVVLHAR
FT                   LSRRDWSAIGVVVVSLVVLGFASGDEGHGHDDPWLHWTVLIAGLVLLGLGAIGLHLLDR
FT                   GVAVLAGLLAGVLFGILAVAVRILDGLDPWDLTALLADPALYTLLVCGVGGFYMFTVAL
FT                   QTGSVAAASASLVAGETVLPGAVGIMVLGDATRAGWGPVAFIAFTTGLPDSTPEDADDR
FT                   TSEDSCRAAGLVIWLRGNSFRCAVSHYGVLKGLMRSRLGRVLVSLV"
FT   sig_peptide     194233..194310
FT                   /locus_tag="Gbro_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.948 at
FT                   residue 26"
FT   gene            complement(195295..196548)
FT                   /locus_tag="Gbro_0183"
FT   CDS_pept        complement(195295..196548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0183"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   rpi:Rpic_3149 RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19531"
FT                   /db_xref="GOA:D0LBA0"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA0"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ACY19531.1"
FT                   /translation="MEIEHLVEQLANHTCDDTTGPEAHTALQMVLRLRNVVEHHAAVLV
FT                   ARLTALGVAKRQGRTMRELLIVMGCAPAVASRLVRVAGNLALLPRLAGHTGDGTVSGEH
FT                   ADAVVRGMTHIATRNGEPLSDEQRQSMVTDLLAHTFSGATPSEITNRARALGNQLADAS
FT                   DVGLPAAEDRAINDFTVTVNEPKTGGDGRTIVRGDLDAVIGEKLHTLIDAFSTPRPEPD
FT                   GTEDTRAPGRRRSDALERILDAAMTAADHGLLGGAPKQSILLTMPADADGRGVLSFTGP
FT                   VSGATTSLLACDSTITDIIVNGDRVPLAVGQDDRLFGPKLRKALIVRDQCCIKCGAPAG
FT                   WTHAHHITFYSHGGTTVLDNGCLLCPSCHTDVHHNGWDIVMGDDRHPWLIPPATVDPRR
FT                   RPLPAYNRRTMRLDDIAA"
FT   gene            complement(196680..198149)
FT                   /locus_tag="Gbro_0184"
FT   CDS_pept        complement(196680..198149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0184"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; histidine kinase dimerisation and phosphoacceptor
FT                   region; sigma-70 region 4 domain protein; SMART: regulatory
FT                   protein LuxR; KEGG: har:HEAR1654 nitrate/nitrite response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19532"
FT                   /db_xref="GOA:D0LBA1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACY19532.1"
FT                   /translation="MWRVPLSRRQLDDAGLTALFLLCGVGLYLAGLNKIGGLSVVGVPT
FT                   WFSLVTLSVAAAFQLTRSTRPALTLTATTVVLVVDVVTVSSIGVWLVFSDTVYAACVYG
FT                   GARLVRTLHVIVVLVCAGGLTLAAIETGTADWRPLFLVSLWLIAFVASPLAYGHAVREH
FT                   RNALAAERERAAALAQLAERERSEAVADERHRLARELHDVIAGRLSAIAMHSAAALEYP
FT                   TNPVLTDKVLRSIRESSVDALREMRGMIDLLAEDATNVSPTHETATLRRLDRLVHPIVE
FT                   SGTTVELRCPPELVDSSCDTDTLAIPPLVDIAAYRIITESVHNAVRHAPGQPIRVEVTE
FT                   HDTQLVLDIRNPLAATPRIPARHVGRGIDNMRTRSRAVGGHLTAAPDDGEFVVRAGDAV
FT                   LAHEVTKTVISALGPREAGHVSTPTTDTLDALTERERDVLRCVSDGLSNAEIAAALVIS
FT                   EATVKTHVSRILMKLGLQSRVQAAIFFRDGT"
FT   gene            198274..198873
FT                   /locus_tag="Gbro_0185"
FT   CDS_pept        198274..198873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19533"
FT                   /db_xref="GOA:D0LBA2"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19533.1"
FT                   /translation="MQAIQFVSSPTVPVASEDLTGSPVLWVILGCEIGFWVLVIVGLGV
FT                   RYLLHRRGLSQVVLWSVPVLDVVLLSAVAVDLQSGAEVTTIHRIAGIYLGVTIAFGHSM
FT                   IRWADVRFAHRFANGPKPSKPPKRGMPALRYETRTFAQWLLAAAIAAAAILLLEATVAD
FT                   DRQRAALDGVFPMLGVVTVIWLVTGPVWALFTASDD"
FT   gene            complement(198899..200344)
FT                   /locus_tag="Gbro_0186"
FT   CDS_pept        complement(198899..200344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0186"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: secretory lipase; KEGG: secretory lipase;
FT                   K01175"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19534"
FT                   /db_xref="GOA:D0LBA3"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA3"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ACY19534.1"
FT                   /translation="MGRKTMPARSGGRAPLVRMIVWLVVAATLISVGGVLEPIPAQAVP
FT                   VRPALPFPVPPAIPEFDRSFYLPPQQVVASKKPGELIAARRVNLAALSVIPINVNAWQI
FT                   SYRSTNTRGEPIPAVATLLKPRGPARPGPSKLVSWQSAEDSTALYCTPSYVLQLASIPG
FT                   QLSGSVDSQYEVLQITSLVGAGYSVVIPDHQGPQSAFAAGPLAGRITLDAIRGAQNFAP
FT                   LGLKRDLRIGMMGYSGGAIATGWAAELAKSYAPELPIVGAAEGGVPANIRALVDLANNN
FT                   AASGLIMAGIIGVSREYPELERFLQRHINPLGRALLTVKNPLCLTYQAALAPFVNIKGL
FT                   INLPGDPLNYPTPRKVLGQLQMGKAVPDFPMFIYQSNPDWIAPVGPVNTLVRTYCADPG
FT                   AQIQYTRDHFSEHITLAVEGFAPAIVWLGDRLDGKPARKGCSVSDQGSMALNPAGWRAF
FT                   VNLVGNNLALLIGEQLGRIPRHP"
FT   gene            complement(200432..201049)
FT                   /locus_tag="Gbro_0187"
FT   CDS_pept        complement(200432..201049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0187"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcj:BCAM0700
FT                   TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19535"
FT                   /db_xref="GOA:D0LBA4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY19535.1"
FT                   /translation="MTAAERTYGGRSVSDRLAERRRRFLDAALAEFTGTGYAASSVTAI
FT                   CREAGLSRRQFYELFDDREDLLIALYDEIQGDARTAVAQALADNNSRDLHQLATTAMAA
FT                   YMASVGNDPRRAEVSFVQIVGVSARVERHRLDGREEWVEFFVAAMAEFADREPSERQRH
FT                   LAIAFVGALTGLVHRWSSADDPVPLAEVVAVLADILLAFTHI"
FT   gene            complement(201066..202712)
FT                   /locus_tag="Gbro_0188"
FT   CDS_pept        complement(201066..202712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0188"
FT                   /product="Rieske (2Fe-2S) iron-sulphur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   mxa:MXAN_3480 Rieske family iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19536"
FT                   /db_xref="GOA:D0LBA5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA5"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACY19536.1"
FT                   /translation="MQITSIGHAGFHIQTAAGSILCDPWVNPTYFASWVPFPDNSELDW
FT                   KALGQCDYLYVSHLHRDHFDERNLRENVSKDATVLLPDYPVPDLKRELEKLGFTKFVET
FT                   VDSEKITVTGDKGSLDVMIIALRAPADGPIGDSGLIVSDGETVCFNMNDARPIDLDVID
FT                   EAFGRVDVHLLQYSGAIWYPMVYDIPRKSKANFAAQKRQRGMDRARSYIEQVGATWVVP
FT                   SAGPPMFLDDDLFGLNDFGSIDAGSEASGSAPRWTADETSIFPDQETFLEQMRIHGTDD
FT                   GEKHRGLMMVSGSVADFTGSTLNEVSHPFAPHDVFGENKRAYLEQMKEKFAPVIAADKA
FT                   TWAQAEGEPLIGQLRELFEPIMAASDLICDGIGYPVGLVMTPHSSGKETTEETEIVVID
FT                   FPNRIVREPKEGEGKYRYGFRIPTELVRTVLRDNEPDWVNTIFLSTRFTTWRIGGYNEY
FT                   LYTFFKCLTDERIAYADGWFSEAHDDSASITKDGWEIQRRCPHLKADLGKFGVIEGEKL
FT                   TCNLHGWQWDLPTGRCLTSKGHELRAERLGS"
FT   gene            complement(202849..203401)
FT                   /pseudo
FT                   /locus_tag="Gbro_0189"
FT   gene            complement(203398..204306)
FT                   /locus_tag="Gbro_0190"
FT   CDS_pept        complement(203398..204306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0190"
FT                   /product="Saccharopine dehydrogenase and related
FT                   protein-like protein"
FT                   /note="KEGG: mxa:MXAN_0831 saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19537"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA6"
FT                   /inference="protein motif:COG:COG1748"
FT                   /protein_id="ACY19537.1"
FT                   /translation="MRTLLLGARGAVGSVVRDQLLRAGHDVTRAGRTAEADAVIDLHGG
FT                   DLDALSTLTEEHDVVVNASGVERVDLARATGRTPLIEISATGSYLDALRSVAPEHAVVL
FT                   GAGLIPGLSTVMVQSLRADTGDDVDVLVMLGSGEHHGPAAVDWTANLVGTDVYAPPEDG
FT                   RVRNLTTSVRATGPDGRTRRYLRADFPDHVLVGGTNGLCIRAYLTLSSAPMTVALGLVG
FT                   RLPALRGAMASSPHLGSADWHLLVHNRRTSEQRHARGTGQSEATGRLTALAAIRAAQNT
FT                   PPGPVTMADLVTLDEALEVLD"
FT   gene            204372..205136
FT                   /locus_tag="Gbro_0191"
FT   CDS_pept        204372..205136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0191"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: mxa:MXAN_5578
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19538"
FT                   /db_xref="GOA:D0LBA7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA7"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACY19538.1"
FT                   /translation="MEPVYSAVITTARLLWLAEGLKFKVSGVENVPKTGPGVVAFNHTG
FT                   YLDFTYAGIPAYLQGRRYVRFMAKKEVFDNKYGGPIMRALKHIPVDREQGGESYRTAVE
FT                   YLKRGELVGVYPEATISRSFELKAFKSGAARMALEANAPIIPTVIWGAQRVWTKGHPKR
FT                   LGRSNYKIMVGVAEPLEPIGDADALTAKLHKVMSEKLLELQDAYGEHPQGEFWVPARLG
FT                   GSAPTLEEANRLDAQEKAERAAKRAAREDEGR"
FT   gene            205160..205966
FT                   /locus_tag="Gbro_0192"
FT   CDS_pept        205160..205966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0192"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: mxa:MXAN_5578
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19539"
FT                   /db_xref="GOA:D0LBA8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA8"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACY19539.1"
FT                   /translation="MQSLTPAKRREPVFRALELIAHGLVRAQGLDLTFTGVQNIPSTGG
FT                   AVLTINHTGYMDFLPAALGVYRAGRRTRFMIKSEVMDIAIMRFLVNHTSTVPVDRSEGA
FT                   QAYTAAVDALRAGEIVAVYPEATISRSFELKAFKTGAVRMAAEARVPIVPAIVWGAHRQ
FT                   WTKTGKRNMGRSKLPVSVRFGLPLAIDSAVDPSAETARLRDAMSTMLHEVQDAYGEHPK
FT                   GEFWVPARLGGSAPTPEEAAVIETEEAQRKAEERARKASSRKDAHR"
FT   gene            205963..206796
FT                   /locus_tag="Gbro_0193"
FT   CDS_pept        205963..206796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0193"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: eic:NT01EI_0005
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19540"
FT                   /db_xref="GOA:D0LBA9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBA9"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACY19540.1"
FT                   /translation="MTFGPPTLIASDVDGTLIDDENRVSPRTLAVLGAARSANVEFVLA
FT                   TGRPPRWIAEITDQFDGTDAYVRYAVCANGAILYDAHNDRILASSTLSSDVLAKLGDLA
FT                   YQLIPGCGIAAERVGQSAHDAATAPFVASSGYQHAWLNPDHVEVGDDEVFAEPAVKLLV
FT                   RSPGMASGEMAARLEPAVADLAQITFSTDNGLIELSVPDTHKASGLEKLAALADLRTDA
FT                   VIAFGDMPNDAEMLTWADHGVAMGHAHAAAISAADEVTIGNNEDGVARVLERWFG"
FT   gene            complement(206993..207601)
FT                   /locus_tag="Gbro_0194"
FT   CDS_pept        complement(206993..207601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0194"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: uncharacterized peroxidase-related enzyme;
FT                   PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   ara:Arad_14218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19541"
FT                   /db_xref="GOA:D0LBB0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB0"
FT                   /inference="protein motif:TFAM:TIGR01926"
FT                   /protein_id="ACY19541.1"
FT                   /translation="MTSTTPLRISRLRVPTDDELSPSVAAVFAQTEKQPGFIPNWLRGF
FT                   ALDEGHFERLNAYLFPLVQGDPAVPSSLTRREREILATVVSVRNGCAYCHALHVHELAE
FT                   FLGDAWLAHRISLDHREVPELSDREQALIELALTVTDEPGGVSDAEIDALRGFGLSDAD
FT                   IFETVQITSVFNATNRISLALGLLPDPEIFDGDHAGAHT"
FT   gene            complement(207611..208147)
FT                   /locus_tag="Gbro_0195"
FT   CDS_pept        complement(207611..208147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0195"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: uncharacterized peroxidase-related enzyme;
FT                   KEGG: ara:Arad_14221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19542"
FT                   /db_xref="GOA:D0LBB1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB1"
FT                   /inference="protein motif:TFAM:TIGR01926"
FT                   /protein_id="ACY19542.1"
FT                   /translation="MCLNWTSCPTNCGRNWSPSATSSATSPTGRAFSLGGAHAARFNDY
FT                   ILGLLDPNGGLLPYVDREILATVTSAENKCSYCRLNHAGHLGAALGDNKLGTRIAIDFR
FT                   EVRELSPRHRILARFASKLSLHPGEVDDADIDELRDLGLSDEEIFEAVHVISAFAAANR
FT                   FSIFLQVTPDDQFFN"
FT   gene            complement(208333..209841)
FT                   /locus_tag="Gbro_0196"
FT   CDS_pept        complement(208333..209841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0196"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   SMART: Animal peptidoglycan recognition protein PGRP;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; KEGG: GI20770
FT                   gene product from transcript GI20770- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19543"
FT                   /db_xref="GOA:D0LBB2"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB2"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ACY19543.1"
FT                   /translation="MRYSRPRLSIAPAIIAIAALAGAVAVSVTDRDPRLVDRSKEIGAT
FT                   GIEQVSLRELPTAVLDVATSGLDAVGIKLPAIDPTHFPLPDITVPVPSGVLPSPTRSAP
FT                   TTPRSTPSASATSPSTTRSTPRTPRSTTRRTAPTTPPTPRMADGRPVGAAVTTLVRDAP
FT                   IKMLAFTWDRPVDVDMMVRAKRSDGRWAPWTALEPATDSAAATPGRPAGTEPIWVGDAR
FT                   EVQIAATDDGLAIPAAEAQDSGLPQLAVGTASEIIGTLVTTALSAVKATLISPESILSL
FT                   GSSLLTPLLGGPQVVARAQWGADEAIRCSQPAYSPALRGAIIHHTAGSNEYTAAQSVEI
FT                   VRGIYAYHARTLNWCDIGYNVLVDKYGQIFEGAFGGLDRNVEGTHTGGFNRSTVGVSMI
FT                   GNLDVAAPTGAMVASVARFLRWRLGKAGLNPGGTATLTAEAFSDSKFPAGAQTTLPMIA
FT                   GHRDYNNTSCPGVQGYPALAQIRALAGGAPAPTPSPTPTPNAPQ"
FT   sig_peptide     complement(209764..209841)
FT                   /locus_tag="Gbro_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.647 at
FT                   residue 26"
FT   gene            210039..211655
FT                   /locus_tag="Gbro_0197"
FT   CDS_pept        210039..211655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0197"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation D domain protein; KEGG: dol:Dole_0035
FT                   SpoIID/LytB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19544"
FT                   /db_xref="GOA:D0LBB3"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB3"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ACY19544.1"
FT                   /translation="MDPTTQGCVPPVQKLRPTTWLSGMAPGVRPRHARRRTLSWTAFGL
FT                   APALLAGGLAVGGFAVVGSTRSENVELSVGSTVTLIGHGHGHGRGLGQWGAYGYARKGW
FT                   SAGQILRHYYGGTTAGKADRPEITVALTGQSSVNVRADAGMRVGDATVGPGQAVSLSGT
FT                   TATIMNGCGGGGVRTVTLRTPFVEPLNMGPNRPAAEFLKFCGSNKAYRGALGFDGGRVV
FT                   NKLHIDDYVKGVIAKESVPAWADSGGLEALKAQAVAARTYALAAIAGGKKIDDTQNSQV
FT                   YGGIAGEDPRTNRAADATAGQILRQNGQYAFTEFSASTGGFTAGGRFPAVPDEGDTASP
FT                   DHNWTATVSTGSVASAFGVGALRSFEVIEANGLGAEDGRALKVRVVGSSRTVEATGEEA
FT                   RTKLQLKSSFFSIKGQTTRPKIVKPPVGPGGGSGSLDLGSLNQLADAIVPGASQLLSTA
FT                   TSLLSGKFDQLGGITGPLGRAIGVPNLTPDAAGVTQLFERGMMFFSNQTGAHALAGNGL
FT                   KRFQARGGIATQGFPKRDVLR"
FT   gene            complement(211674..212201)
FT                   /locus_tag="Gbro_0198"
FT   CDS_pept        complement(211674..212201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19545"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19545.1"
FT                   /translation="MSRQLFGVVVGTLVAIATLALGVGASSAAPTRSPMPHPVCARHPY
FT                   ACLKQRPIPLPRPISISVTYFAESSAGTSAHIASEFTLRRCDSGSPSMPCAHTSPVPIA
FT                   ALNFGEKPEHNLDPACGLPGHWECWGSLFEFVNVPDGPTYEVLRNNTLIDTIPHVAGRE
FT                   AYGIRAGVPILT"
FT   sig_peptide     complement(212115..212201)
FT                   /locus_tag="Gbro_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 29"
FT   gene            complement(212292..212969)
FT                   /locus_tag="Gbro_0199"
FT   CDS_pept        complement(212292..212969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0199"
FT                   /product="ANTAR domain protein"
FT                   /note="PFAM: ANTAR domain protein; GAF domain protein;
FT                   KEGG: aav:Aave_2149 response regulator receiver/ANTAR
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19546"
FT                   /db_xref="GOA:D0LBB5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB5"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ACY19546.1"
FT                   /translation="MLTDSGSEMARIANELRAQSDDTEAVLRKTSKYAVDTLPGAEYAT
FT                   VTLVTGGKIESPVIVGDLGGQADELQRTLGEGPCVRAAVDSETVWIDDMRVETRWPRFA
FT                   PAAADLGIASMACFCLYIDGNDFGALNVHSTTPGAFDRDARLVGELFAAHAATAFGAVR
FT                   EKEQLRAALTSRDLIGQAKGMLMERYQIDATAAFSLLARLSQDSNTKLVEIAARIIEAG
FT                   PGS"
FT   gene            complement(212963..213685)
FT                   /locus_tag="Gbro_0200"
FT   CDS_pept        complement(212963..213685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0200"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; NodS family protein; KEGG: pfs:PFLU3372
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19547"
FT                   /db_xref="GOA:D0LBB6"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB6"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACY19547.1"
FT                   /translation="MSARATSNTGMPTGYFGAMYAKDDDPWGFSSRWYEYRKYALTMAL
FT                   LSSPRYESAFEPGCSIGILSAALAERCDELICTDLSSRAIELASENLAPYGERVRAYVA
FT                   DVVDDWPAGRFDLIVLSELLYYLDDASLTTVVDRLPDSLTADGELVAVHWRWPVGEYPR
FT                   TGDDVHEVLMASDLVHRGGYADRDFRADVFTARPLPSVAESGGLVGPPEDGMSNNRGAT
FT                   INGHTGQGRPWSDRRRLC"
FT   gene            complement(213682..214515)
FT                   /locus_tag="Gbro_0201"
FT   CDS_pept        complement(213682..214515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0201"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: xca:xccb100_2614
FT                   putative N- acetylglucosaminylphosphatidylinositol
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19548"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB7"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ACY19548.1"
FT                   /translation="MTSDALQPVGEQSGSTGTGSFGSVSMTRMAAMSPTDAGTPEPTWL
FT                   NWLSSHGPWTAVEFEVDRLVVLAAHPDDEVLGAGGMMADAARAGVEVVTVCLSDGSGSH
FT                   PGSPTLTPEQLAVRRHAELDAATTILGLDTPRWQGLPDGELAAHQQQMTGIVKSVLDEQ
FT                   PDAVTGLLSVWCHDGHPDHEAVGHCAQALAARRGIPLWMYPIWMWHWAYPGDPGIPWQQ
FT                   MRTHRLDDDVLAVKHAAVRSFESQIGPLSPAPEDQPVLGPHILSHLLREQEFVFV"
FT   gene            complement(214512..215513)
FT                   /locus_tag="Gbro_0202"
FT   CDS_pept        complement(214512..215513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_2543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19549"
FT                   /db_xref="GOA:D0LBB8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB8"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_2543"
FT                   /protein_id="ACY19549.1"
FT                   /translation="MTAPRARSIVTAEGFGLPRPGSGRTRERFAELTRFTTEDISTGRL
FT                   VEAHADADAILGEICGGGTGPGEFWAVWASNPPQTRVDAIREQGGWRLNGTKPWCSGAG
FT                   HCTHALITAHTDDGDRLFAVNLDQPGIEADGSGWHTAGMRDSETATVFLDGASAEPVGA
FT                   PGRYLERPGFWHGGIGVAACWFGGARRVARPLYRTAVRRDDEILRMHLGAVDALLAGGW
FT                   AHLMAAADAIDADPDASATRLAHQVRWSVEQIATAVIDRVGRALGPGPLAGDAEHAQAV
FT                   ADLQVYIRQSHADRDLVTLGSVVAGSLSGTIPGPTASTTTASKTSPSKGERR"
FT   gene            complement(215510..216187)
FT                   /locus_tag="Gbro_0203"
FT   CDS_pept        complement(215510..216187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0203"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ppu:PP_3256 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19550"
FT                   /db_xref="GOA:D0LBB9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBB9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACY19550.1"
FT                   /translation="MVVPVHNERRRLPACLTALDAAAAAVPQRVRVVVVLDACDDGSAE
FT                   LVGDHMSRVRIDAQNVGAARRAGFASLRELPDPAATWFATTDADSAVPSHWLRAHLAAA
FT                   DGGADAYVGTVTPTDFDEWPSGTAERYFAGYDDTPGHRHVHGANLGIRASVYTAVGGFA
FT                   PLPAHEDVDLVSRLTDGSRSRYDGPVEICWDAGAPVRTSTRRTGRVAEGFWTHLRDLSG
FT                   NRR"
FT   gene            216416..217612
FT                   /locus_tag="Gbro_0204"
FT   CDS_pept        216416..217612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0204"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="KEGG: pin:Ping_2040 UDP-galactopyranose mutase;
FT                   TIGRFAM: UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19551"
FT                   /db_xref="GOA:D0LBC0"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC0"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ACY19551.1"
FT                   /translation="MATSGSFDLIVVGSGFFGLTVAERTATQLGKRVLVLDRRDHIGGN
FT                   AYSEPEPTTGIEVHRYGAHLFHTSNQRVWDYVNQFTDFTNYQHRVFAMYKGQSYQFPMG
FT                   LGLISQFFGRYYSPDEARALIAEQAAEFDTKTAANFEEKAISLIGRPLYEAFVKHYTAK
FT                   QWETDPTNLPAGNITRLPVRYTFDNRYFNDTYEGLPVDGYTAWLEKMAADERIEVRLGV
FT                   DWFDVRDELRAANPDAPVVYTGPLDRYFDYSAGRLGWRTLDFETEVLDTGDFQGTPVMN
FT                   YNDADVPYTRIHEFRHFHPERDTYPDDKTVIMREYGRFAKDDDEPYYPINTPEDRKMVA
FT                   EYRDLARTETASSKVLFGGRLGTYQYLDMHMAIASALTMFDNTLAPHLRDGVALDGAE"
FT   gene            217613..219565
FT                   /locus_tag="Gbro_0205"
FT   CDS_pept        217613..219565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0205"
FT                   /product="glycosyltransferase-like protein"
FT                   /note="KEGG: aap:NT05HA_0635 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19552"
FT                   /db_xref="GOA:D0LBC1"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC1"
FT                   /inference="protein motif:COG:COG1216"
FT                   /protein_id="ACY19552.1"
FT                   /translation="MTVTEVSQSDSRTDIPAAGEGPSNAKSLLQRVILPRPGEPLDVRS
FT                   LYLVEDERNARRAHAPSRTAVSLGAESQVSFEAYFNAFAAAYWRRWSILESVVLRVEVI
FT                   GSCRVDLYRSKIDGSRIGIGGDLITTDETGRGVAEFELDLGPFEDGGWIWFDVTTDTDT
FT                   EILSAGWYAPIDPPDGADRVGITVGIPTFNRPTDAVAALSALTSDPLVDEVLDAVLMPD
FT                   QGTKKVVDEPGYTEAAARLADRLRVFDQGNLGGSGGYARIMFEALRLTDSPYVLYMDDD
FT                   IAIEPDSILRALAMSRFAKTPMLVGGQMLNLQDRSHLHCMGEVIDRNKFMWTAAPFVEY
FT                   DHNFAKYPLRDRDNSKNLHRRIDVEGNGWWMCMIPRECAETIGLPMPLFIKWDDWEFAL
FT                   RAAKAGYPTATIPGIAIWHMAWSDKDDAIDWQAYFHLRNRLVVASLHHDGPITGILRSM
FT                   TKATAKHLLCLEYSTVAIQNEAIRDFLAGPHHIRELLPTALPKVAQMRKQFPDAVVLDS
FT                   ATELPRTSGEATALGTNPPEGKVAKAKALAASVRNNLRPADPRHHEVPQANYPPIEARW
FT                   FSLGRVDGVTVTTADGRGVVYRQRDRDKAIELAREHFALVKELRERFGEMKEQYRAAHA
FT                   ELTGKESWARVFGID"
FT   gene            219546..220265
FT                   /locus_tag="Gbro_0206"
FT   CDS_pept        219546..220265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0206"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: ade:Adeh_4001
FT                   phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19553"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC2"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACY19553.1"
FT                   /translation="MSSESTDQVVPADAAATGEVAALIAVQGALAQRPGVLPAARGLSH
FT                   FGEHALGWMAVSALGWVLAVRRGDPVAERRWVEAGVGAVGAHAASIVIKRIVRRKRPHD
FT                   PRIVVGVSTPSRLSFPSSHATSTTAAAILIGRAAGLPRWLLPAALVPPMLTSRLVLGVH
FT                   YPSDVVTGAAIGALTAGAITGVDALAERAATTAGAHPRAARAAGAAARLSALALVPGRT
FT                   ARVALPALRALRKQEKA"
FT   gene            220262..221188
FT                   /locus_tag="Gbro_0207"
FT   CDS_pept        220262..221188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0207"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: sun:SUN_1522
FT                   UbiA prenyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19554"
FT                   /db_xref="GOA:D0LBC3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC3"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ACY19554.1"
FT                   /translation="MSEEPIEHDKVLGPPKNLATGLIKAVRPRQWVKNVLVLAAPLAAG
FT                   TDSLTNGHAMAHVGFAFVAFCLVASSIYLINDALDVEADRAHPTKRFRPIAAGVVPRNF
FT                   AFVLAVVLAAGSIGVALLANWQTAVVIAVYLVIQLGYCFGLKHQAVIDICIVSSGFLLR
FT                   AIAGGVAAEIALSQWFLLVMAFGSLFMAAGKRYAELQLAERTGAKIRKSLQYYTTTYLR
FT                   FIWTLSATAVVIFYGLWAFDKGSDHDTNVAYAVSMVPFTIAILRYAVDIDGGEAGEPEE
FT                   IALGDRVLQLLAIAWIVCVGVAVYAVS"
FT   gene            221175..223469
FT                   /locus_tag="Gbro_0208"
FT   CDS_pept        221175..223469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19555"
FT                   /db_xref="GOA:D0LBC4"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19555.1"
FT                   /translation="MQSPEQPSQQQDFDEKPGRRRRPEVDDEAATTRLDRITDPADSTA
FT                   DSADSTDTPPAVTAKRASTGLRTWGTRQWVPAVSFVVGAVTVATFFAIGAWQRRWIADD
FT                   GLIVLRTLRNLFAGNGPVFNAGERVEANTSTAWTYLLWFWAWVTDGQLEYVALWVALVL
FT                   SVAAIPIAMYGTARLLSSRLGGLTGDGWTLLLPLGSIVYIALPPARDFATSGLENGLCI
FT                   FWVAVLWCQLVAWARRGPTSTRSAAAWTLLLAFTAGLAPLIRPELTVFGGVALALVFLA
FT                   PLGWKMRVGVVVVAAVVPVSYQIFRMGYYALLVPNPAVAKDASGSKWHQGLVYLGNLFG
FT                   PYVLVLPVILAVVAGVAMGVFAHYRVRTETPDAAPVSVRERVARSSRGLQTPKAVVITV
FT                   VVAGLIGGTYWIRQGGDFMHGRVLLVPLFILLLPVMVVPVTVPARIRDAFAGQRADRSS
FT                   STPDETDDLESFLHATTPAAPADRAPEDVDRAPDDADPALDDVDRAPEPDRRRIRAQLA
FT                   GSVLMAALWVTTLVWAIVCHENVLPNAGIDIGRSGIVDERRFYVTNMGNENPVTAQDYL
FT                   DYPRMRAMVEMIDKYHAEGGVILPSSSYDEWYVARMPGVMPKGHPRQVTVYFLNLGMTS
FT                   MNAPLDVRVIDQMGLAYPLAAHTERLEDGRIGHDKILPSEWVVAESGAYPRRPVLPGYL
FT                   DEDTVRQAQEALKCPETEARYASFTDPWTFARFKHNLRESFRFTDYRIERNPEYELQRC
FT                   GLPIPPPLPPQ"
FT   gene            223809..224798
FT                   /locus_tag="Gbro_0209"
FT   CDS_pept        223809..224798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0209"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: bmj:BMULJ_04987
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19556"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC5"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ACY19556.1"
FT                   /translation="MHEAASEPRATRRSSSRFVAAIVALMTVFGMASVVVGAGQADARI
FT                   GGTQFGKQEFWVNGCGMPSVKVRAWKRPGNYKTVILLDGMRAQYDYSGWEINTNVQEMV
FT                   KSGVNVVEPIGGPASFYTDWNAPSNFNGQRYRYTWNCVITNTLIRGLDARGFRVGASKK
FT                   YAIMGVSMGGNAALTIAAQNRRNFDRAGSLSGYNFLSAPGMHTMIRLAMLDVDPKPWNV
FT                   DCMWGPPWDARWYQNDPFLNINRMHGMKIFTGSGNGLFGKYNALPNVFDDLFKGSTLEF
FT                   LALTQRKAFEAAATLQGVPVMTYDAVGTHAWGYWQDMVWNAKARGFFR"
FT   sig_peptide     223809..223922
FT                   /locus_tag="Gbro_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.625 at
FT                   residue 38"
FT   gene            225074..226501
FT                   /locus_tag="Gbro_0210"
FT   CDS_pept        225074..226501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0210"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: mxa:MXAN_4935
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19557"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC6"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ACY19557.1"
FT                   /translation="MRRAVMAGRVPGKRGDRTRMRTAWVTMVAVIAAMTALVFTGGVPV
FT                   GAEPTTTPPTAPPPAPAPAAQPGKVVNTYWYTDRRVALWVYSPSMNTNIQVQILLARDW
FT                   YAKPRDKFPQLTMLDGLRAQDDQSGWIINTKAVDFYKDKNVNVILPIGGESSFYTDWKE
FT                   PDKGKNYKWETFLMRELPPILEGEWRSTDVRGIEGLSMGGSAAMMLAARNPGFYKFAAS
FT                   FSGILQLTSYGMPQAIQFALRDGGGYDSMKMFGQPSDPAWKEHDPYLLADKLQGTSLYI
FT                   SSGNGLIGPHDKPSDIPMLATNYSGVGLEMLSRVTSQQFAIQLNRKGIPGQAVYRPSGT
FT                   HTWPYWEFEMIQAWPQAAGALGLAGDRVACRVAGPFRKVYDRNKTLLGGCLTSDYAVPG
FT                   GRAQDFFGGRIFSGPKGPKIVTGAIGGAYAGTGGPGGRLGKPTSDEMATRDGKGRVNTF
FT                   ERGRITWTAKDGSKVTR"
FT   sig_peptide     225074..225217
FT                   /locus_tag="Gbro_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.769 at
FT                   residue 48"
FT   gene            226614..227249
FT                   /locus_tag="Gbro_0211"
FT   CDS_pept        226614..227249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19558"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19558.1"
FT                   /translation="MTARERCGRDRGRDRKDTTEEVAMTKKATAMRTRRRLVPTLLLIG
FT                   GLALVLGSVAACSDDSTASAPITNTPVTTTSMYSGVDGSVTPSTPPGSASLAPTSGSPE
FT                   SRLPATGPNPNTTVPSNYPGPSGAPLSDKARKYLAALKSQNVTFMGDSDNSVALTMAEY
FT                   VCGARAKNTDPTTIKAFVTASVGPGTRTVEEANTKADKVIAAATDNYC"
FT   gene            227254..228267
FT                   /locus_tag="Gbro_0212"
FT   CDS_pept        227254..228267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19559"
FT                   /db_xref="GOA:D0LBC8"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19559.1"
FT                   /translation="MNARRATPGRPRRKSTRRRIGIVALLLGLLAIVAIILIVILVISL
FT                   FRPGPPGVPPRPTTPSTPSERPQAQPADCPDVLTVVIPGTWESSPDDDPDNPTSHPRSL
FT                   MLRVSKALQNDFDDARTEVYTVPYLAQFRNPTNLTDRQADYNVSRTQGYKRAAGKIIAT
FT                   NKRCPLTTYVIMGFSQGAVIAGDLASNIGNGRGVLAEGDQDLVRGVGLIADGRRQSGEQ
FT                   NDVPPSPDGVGAEVALGGFGGLVPGITMTGPRTGGFGALRDRVQSICAPGDLICDAPTV
FT                   TNPLQAVGQLANAQNNPVHAMYATTRYWNHDGASATQWMYRWAKGEIDDAPHPPHE"
FT   sig_peptide     227254..227358
FT                   /locus_tag="Gbro_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.401 at
FT                   residue 35"
FT   gene            228508..229518
FT                   /locus_tag="Gbro_0213"
FT   CDS_pept        228508..229518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0213"
FT                   /product="putative F420-dependent oxidoreductase"
FT                   /note="TIGRFAM: putative F420-dependent oxidoreductase;
FT                   PFAM: Luciferase-like, subgroup; KEGG: mes:Meso_3765
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19560"
FT                   /db_xref="GOA:D0LBC9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBC9"
FT                   /inference="protein motif:TFAM:TIGR03621"
FT                   /protein_id="ACY19560.1"
FT                   /translation="MTQPETGLDAPVDGLRKFHFGAGGEGNKDEGGARKFVKLAQTAEE
FT                   YGYDTFAVPDHLGNQVGPIAALGALTQATSTIRLATSVLANGWRHPALLAKEANTIDVL
FT                   SKGRLELGIGAGWMKDEFDKAGIEFESPGVRIRRLDEALTVLDGLMRGETVDFDGEFYQ
FT                   IKGLEGSPRPRQGPRPPIAVGGGGPKMLALAAKHADVISVAPGTTPDGKMKLSDMTIEK
FT                   TAERVERIRAAAGDRFADIELNWTIAVIVITDDRQATAEMALKALDQGYPPNIERDTEF
FT                   TVDDVLSSPYIAIGSFEEIADQIREVRRRTTMSYVGVFPTQMDAFAPVLSLLKGE"
FT   gene            229804..231726
FT                   /locus_tag="Gbro_0214"
FT   CDS_pept        229804..231726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0214"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mxa:MXAN_4601 non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19561"
FT                   /db_xref="GOA:D0LBD0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY19561.1"
FT                   /translation="MLNTEFEQFLDENGNLRFTEDATLVDYVERNVRDAADTLAYRFID
FT                   YSRERDGEYQDLTWSQFGKRLRAVAARLQQVTKPGDRVAILAPQSLEYVIGFFSALYAS
FT                   NVAVPLFSPDEPGHTDRLHAVLADCKPTAILTSTKSAEAVRDFFAPLPAKERPRVIAVD
FT                   AVPDSVGSSWVAPVAGKDHNRDTVAYLQYTSGSTRVPAGVEITYEAVAANVLQIYDCIE
FT                   IDRNARGVTWLPMFHDMGLLTVILPALGGRYITIMSPQAFVRRPGRWIKELAAAADGAE
FT                   TYAAAPNFAFEHAAIRGLPKEGESLDLSNVIGLINGSEPVTVSSMKKFNEAFAPYGLPK
FT                   TAIKPCYGMAEATLFVSATQRNNEAKIIYVDRDELNAGRFALVDSDAPNAVAQVSCGQV
FT                   AVSQWATIVDTSQVEDGIATEQPDGHVGEIWLHGLNIGAGYWNKPEETEATFHNTLTHP
FT                   LAEGSHSEGAPQDAKWMRTGDYGVWLDGELYITGRVKDLVIVDGRNHYPQDLEYSAQEA
FT                   SSALRPGFIAAFAVPANELPPVVFEQSTSGLQFDADDSSEQLVIVAERGPGKRTDPQEI
FT                   ADTVRAAIAQRHGVMARDVLLVPAGSIPRTSSGKIARRATKAAYIDGSLRGGYKQTAFP
FT                   DASES"
FT   gene            231835..237114
FT                   /locus_tag="Gbro_0215"
FT   CDS_pept        231835..237114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0215"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase ; Acyl transferase;
FT                   Thioesterase; phosphopantetheine-binding; KEGG: eca:ECA0603
FT                   type I polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19562"
FT                   /db_xref="GOA:D0LBD1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD1"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ACY19562.1"
FT                   /translation="MSELNTDQSENTPDDAATQPADGASTDGETAGDLTVAELRDWLRE
FT                   WVSTATGLPAAQISDDRPMEEFGLSSRDAVALAADVEDKTGVILTATAAYNHPTIAMLA
FT                   KRIIEGDPDEGLDDDDADSYWRRERDPADDIAIVGLSTRFPKAGATPESTWAALIEGRD
FT                   GISDLPEDRWTEFKSDPRMLEVLEKRNLRGGYLDDVKAFDADFFQMSPREVEMVDPQQR
FT                   LALELTWEALEDAHIPASDLKGGQVGVFVGTSTNDYQLMAALGLGEGSDETAAYALTGT
FT                   ATSIIANRVSYFFDFHGPSVAVDTACSSSLVAVHQAVRSLRSGESDVALAGGVNMILTP
FT                   AATVGFDTIGAVAKDGHIKAFSADADGMVRSEGGGMFVLKRLADARRDGDDVLAVIAGS
FT                   AVNSDGRSNGIFAPNPEAQVEVLRSAYVDAATDPRQVDYVEAHGTGTILGDPIEADALG
FT                   RVVGRGRVVGAPALLGSAKTNFGHMESAAGAGALAKVVLSLQHNVIPPSLNYSGPNPYI
FT                   QFGANGLQVTDQVAEWPRYSGHAIAGVSGFGFGGTNAHLVVREVLPTDLVDDAPVLPVV
FT                   DAAAAETPAADLDDDEDFLTEAERAVLAAQAGAGQTETVVAEKDPAAGFAPCAVEGAVV
FT                   PLVISAFLPSRRRKAAADLLEWLESDAGQSTPLADIGRALSRRNHGRSRAVVMARTHDD
FT                   AVKGVRAVAEGKANPIVYSADSPDAASAVWLLSGFGSQHRKMAKQLYQENPVFAKYVDR
FT                   VDEYVQNELGYSITEMFLDDAQTYGIETSQVGIYTIQVALADTLRHFGAEPGVLVPHSM
FT                   GEASAAYISGGLSLADATRVICQRSRLMGEGESMLAGDDIRLMALVEYSAEDINDVLVD
FT                   YPDLEICVYAAPTHTVIGGPEPQVDAIVERAEEEGKLGRKLQTKGASHTSQMDPLLGEL
FT                   AYELTGIEPQRPTVGFYSSVDRETFYRPGHEPVHTIDYFLKGLRHSVWFSQAISKSVEN
FT                   GHRTYLELSPNPAVLISVAAVTFSSGVHDAELIETLRRKEDESYGLVNALMKLYVHGHP
FT                   VNVGSLFGTGDFADIPRTRFERKPYWLTADLSSGGSAGRAPGSHVALPDGRHAWEVNAA
FT                   AVTDPRELVRAAAAEVLSGASVGAAVSHGALPASGTVTTTLAPHPGGASVTVHVKQDKN
FT                   FRLLFEAAVTGDPAEGTTIPADSTASLADGTVNLADSTGAAVFADDKVVVEDEIVDDIG
FT                   NKWSPDSAESVADRLAIIVGESMGYDPEDLPREIPLIELGLDSLMAVRIKNRVEYEFDI
FT                   PQLQLQAMRQANLDDVTKFVEFAVTHRDQLDDLAQNAAGGGELDTAALNAYIDEQNAKQ
FT                   AEAPAPTPADRAPDPVDRAPDPVDRAPDPVDRAPEATDLTDQRAVAEAAGSDVPPRDAA
FT                   ERLTFGVYAMVTKRSAGGIFNKLPVLEEEVAQQLTDRLNERAGGDIDLEDILDSETIEE
FT                   MSDYVRQYLDASADTDGFLRYLRLVPDGKKSYDPTVGDPTPILLFHPAGGNTSAYEALL
FT                   KRLPADRPVIGFDRGVEGSIEDRVRKYIPRLREVQPHGPYVLVGWSFGGALAYGVAQVL
FT                   RDAGEEVAFVGLIDVVRPRQDMIETADTKRERLERWKDFAIRNYDLDPDIPIPMDRLVE
FT                   ADDEGQFAIIMEMMSMSGTKIPGGIIEHQRTSFIENRALTNISPAPYGGKVVLYRADKM
FT                   HAGAIELEPQWAEIDEDGRWREVVDDLEIIHIGGDHLSIVDEPYVAKIGTDLAQRLSEL
FT                   DKK"
FT   gene            237159..238715
FT                   /locus_tag="Gbro_0216"
FT   CDS_pept        237159..238715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0216"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: mxa:MXAN_1113
FT                   propionyl-CoA carboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19563"
FT                   /db_xref="GOA:D0LBD2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD2"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACY19563.1"
FT                   /translation="MTVTDSTAAKLADLRQKLEASREPGGEKALAKRAAKGICSPRERL
FT                   AMLFDPGTFVEIGALAKMPGAAQSGYGDGVVTGHGLVYGRPVAAFSHDQSVFGGTVGEM
FT                   FGRKVSALMEWAGKIGCPMVGINDSAGARIQDAVTSLAWYAEMGRRNDLLSGLAPQISV
FT                   ILGKCAGGAVYTPANTDVLVAVEDKSYMFVTGPDVLKQTTGEDISAEDLGSAHNQARWG
FT                   NIHHIAPDEKAAFEWVREYLQYMPSSAYEQPPVINPGLEPEITESDLSLNDFMPDNDNA
FT                   GYDMHDIIIKLFDDGAFHEVGELFAPNLITGYARVDGRSVGVVANQPSVMSGVLDTDSS
FT                   EKATRFVRICNAYSIPLIFLVDTPGILPGLVEEQKGTIRRSGKFLYAYVEADVPKITVV
FT                   LRKAYGGAYAVMGCKQLGADINFAWPTAKIAVMGAESAAAVLTRRQTEGLSAAEADKVR
FT                   RDFIDFYNSMMATPYMAAERGYIDAVIEPAETRLQLRKALAQLRDKEVLRTPRKHFLMP
FT                   I"
FT   gene            complement(238861..240069)
FT                   /locus_tag="Gbro_0217"
FT   CDS_pept        complement(238861..240069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0217"
FT                   /product="EAL domain protein"
FT                   /note="PFAM: EAL domain protein; KEGG: mei:Msip34_1295
FT                   diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19564"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR019278"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD3"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACY19564.1"
FT                   /translation="MSETRGFTLFDDLELHMQFAPVCRLSDGALATLELQVRGPAGTRL
FT                   STADALRRAARMVEQHTVLDDRKRLLAHSSRAQSVAKILPLLVSLDLDLIDVVDDATAE
FT                   VLERHVMVVAPDAVTRSPQRTLARVARARAAGKIVCVDGLVRNTDAATLLSLVEPDVIV
FT                   TGAELLREPATPDSARLAHALAAHRERSHAVIVAEGVDDEAARVMALTLGADYGLGALF
FT                   PAVEDPAVIASGTVVPLPDMPVWSTPDPDHGTPYAIASSTNTPRRGNKRLLIEMSKALE
FT                   QQAAGGGAAIVLGTFQYAEHFTPTTARRWREMSEHTGLAGVYGVGLPDVRDGNVHRAPL
FT                   APDDDLIEEWNVAVLGPHFAALLSARDQHTGATDLERDFDFVQSYDRVTVTQAVHSILR
FT                   RFA"
FT   gene            complement(240388..240936)
FT                   /locus_tag="Gbro_0218"
FT   CDS_pept        complement(240388..240936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0218"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: ilo:IL0075
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19565"
FT                   /db_xref="GOA:D0LBD4"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD4"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACY19565.1"
FT                   /translation="MTSFTAPGLSTAAADEVTGILQERLSALNDLHLTLKHVHWNVVGA
FT                   NFIGVHEMIDPQVELVRGYADTIAERIATLGSSPSGTAKAIETDRTWNDYSIGRDTAQA
FT                   HLGALDLVYDGFVSSHRDAIAKTGDLDPITEDILIGQTAELEKFQWFVRAHVESYTGEL
FT                   TTAGASSETAAAHAARAEH"
FT   gene            complement(241274..242431)
FT                   /locus_tag="Gbro_0219"
FT   CDS_pept        complement(241274..242431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0219"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   mfa:Mfla_0397 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19566"
FT                   /db_xref="GOA:D0LBD5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACY19566.1"
FT                   /translation="MTERDHSHDCARTGGEQAQSADVVMLRTSGLDTAEGRDEWRNTLG
FT                   SLYCEMDVAWPKGNGLDAEWGGRPFGDLHVSSIRCEEQTVIRSPAMIRSDPTEDFLVCL
FT                   ITDGSVEVTQAGRATLLRPGGFAFLELGEPFVFHSPDTFRQVVVRVPGRMMSGRLPNSY
FT                   AHRFTGREFAPTSRPAGIVGTLLTQIANADAPIPRAASTSFATSVVDMLTTTIMAELPA
FT                   EHRKESFRSQDLARIQQVIADNLHDADFSLSDLAAQAGMSARNVQKLVATTGNSPMAWL
FT                   YAARIERAKHLLMSTGQSVAEVSECVGFRDVSHFSRMFRKQVGVSPGRYRRVGVNRPSA
FT                   DEAVPSAGRSRRRSVPPASISTTRAPADESSDATIDPADPAPTTT"
FT   gene            242608..244191
FT                   /locus_tag="Gbro_0220"
FT   CDS_pept        242608..244191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0220"
FT                   /product="4-hydroxyphenylacetate 3-hydroxylase"
FT                   /note="PFAM: 4-hydroxyphenylacetate 3-hydroxylase; KEGG:
FT                   pay:PAU_00189 4-hydroxyphenylacetate 3- monooxygenase
FT                   oxygenase component"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19567"
FT                   /db_xref="GOA:D0LBD6"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024677"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD6"
FT                   /inference="protein motif:PFAM:PF03241"
FT                   /protein_id="ACY19567.1"
FT                   /translation="MTTAPVADKIAETPTVTAANNVRPMTGAEYLESLRDGREIYIRGE
FT                   RVEDVTEHPAFRNSARSVARMYDALHEPAAQGVLSVPTDTGNGGFTHPFFKTAHNSDDL
FT                   MAARDAIVAWQREVYGWLGRSPDYKASFLGTLGANSDFYGEYKQNALDWYKKSQESVLY
FT                   LNHAIVNPPIDRAKPADETADVCVHVVEETDAGLIVSGAKVVATGSAITNANFIAHYGL
FT                   PLRKKEFGLIFTVPMDSPGLKLLCRTSYEMNAAATGTPFDYPLSSRFDENDSIMVFDRV
FT                   LVPWENVFAYDAETTNNFVMRSGFLNRFMFHGCARLAVKLDFIAGCVMKGVEMTGTAGF
FT                   RGVQMQIGEILNWRDMFWGLSDAMAKSPDEWVNGAVQPNLNYGLAYRTFMGVGYPRIKE
FT                   IIQQVLGSGLIYLNSHADDWKNPDIEPYLNQYVRGSDGIAAIDRVQLLKLLWDAVGTEF
FT                   GGRHELYERNYGGDHEAVRFQTLFAYQASGQDAALKGFAEQCMSEYDVDGWTRPDLINN
FT                   DDLEIVWNRK"
FT   gene            244322..244729
FT                   /locus_tag="Gbro_0221"
FT   CDS_pept        244322..244729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0221"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: bxe:Bxe_A2513 putative PAH-inducible ring
FT                   hydroxylating monooxygenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19568"
FT                   /db_xref="GOA:D0LBD7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD7"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACY19568.1"
FT                   /translation="MHGMTANAFTSVSLDPPLVLVSIANRARMNEKISQTGRYGVSILA
FT                   SDQEPLSLHFAGGTRQPDLVRFAWRKGVPLLEGALVHLSCRVTDSHLAGDHTLHIGHVE
FT                   ELWYDDGHPLLFYTGSFRALELQGNDDPWGF"
FT   gene            244860..245663
FT                   /locus_tag="Gbro_0222"
FT   CDS_pept        244860..245663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0222"
FT                   /product="Transcriptional regulator IclR"
FT                   /note="PFAM: Transcriptional regulator IclR ; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   ppd:Ppro_2833 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19569"
FT                   /db_xref="GOA:D0LBD8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD8"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACY19569.1"
FT                   /translation="MAALQTVQKIGPVLDLFTVRRPEWGVTEVAAEIGVPRSSAHALLA
FT                   SLVDIGLLQCRSRGRYRIGWRVVELNQTLQGTVDVRSVAAPVLAALSEKYGETTHLAIM
FT                   ERYRVLYVDKVEGNHVINVTGARIGAHLDAHCSAVGKVLLAHCLPSEIERNVTNRPLRR
FT                   FTPTTITNPIALTQELRSVLRTGCAFDAGEAVSEVHCVAAPIRDDMGVVIAALSITAPA
FT                   TRFAAGQQEFKRAVIKAAADVSKSLAAYGDSPANGELDNLTLRAV"
FT   gene            complement(245660..246400)
FT                   /locus_tag="Gbro_0223"
FT   CDS_pept        complement(245660..246400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0223"
FT                   /product="Transcriptional regulator IclR"
FT                   /note="PFAM: Transcriptional regulator IclR ; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   bpt:Bpet0874 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19570"
FT                   /db_xref="GOA:D0LBD9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBD9"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACY19570.1"
FT                   /translation="MQGDGSIGRAVRVLEEFTVSQSTLGVSELARRTGISKSSVYRITG
FT                   DLEQSGLLERQGTGYRLGLRLFELGQRVPRQRDLHDAALPFMNDLREATGHTVHLAVLD
FT                   GTEVVYLEVLQSPTAPPLPTRAGVRWPAHGTGIGKAILAFSPRAVTDRILATGLPRLSE
FT                   RTITTPGMFTAELGRIRERGIAYDLEESRPGVACVASAVLDSTRAPLAGISVSGWHNRI
FT                   NLDHSAAAVRTAALGLSRQLRGDH"
FT   gene            246483..247277
FT                   /locus_tag="Gbro_0224"
FT   CDS_pept        246483..247277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0224"
FT                   /product="2-oxopent-4-enoate hydratase"
FT                   /EC_number="4.2.1.80"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   reu:Reut_B5691 4-oxalocrotonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19571"
FT                   /db_xref="GOA:D0LBE0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE0"
FT                   /inference="protein motif:PRIAM:4.2.1.80"
FT                   /protein_id="ACY19571.1"
FT                   /translation="MADDIQWAADALLEAYRTKTPIDPITPRFADAPLSAAYEIALAQV
FT                   QAWEKDGDTVKGHKVGLASRAIQAQMGVDQPDFGHLTASMFHLEHQPIPAGTYMQPRIE
FT                   PEVAFVLARPLTGPGVTVAEAAAAVDFVLPALEIVDSRIRDWQIGIFDTVADNASSGGV
FT                   ILGSRPSRLSDVDLRLAGCTLHVNGELVATGAGGAVLGSPLNALVWLANTVGPLGVTLE
FT                   PGHVVLPGSMTQAVPIMPGDTVVTTIAGVGSVTALLGEDNNS"
FT   gene            247274..248083
FT                   /locus_tag="Gbro_0225"
FT   CDS_pept        247274..248083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0225"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   azo:azo1854 4-oxalocrotonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19572"
FT                   /db_xref="GOA:D0LBE1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE1"
FT                   /inference="protein motif:PRIAM:4.1.1.77"
FT                   /protein_id="ACY19572.1"
FT                   /translation="MTAPTETTPDAEWNAARVADILLTSERTQTPRTSINAQWPGLTLD
FT                   VAYTAQDIALADRKAHGERVVGVKLGLTSRAKQKQMGVDVPSVAWLTDSMALPAGLPVP
FT                   RSQLIHPRAEPEIAFVLGRDLRGPGVTAAQALAAVDRVLAAVEIIDSRYSGFKFTLADA
FT                   VADNNSSGAYVTGPVALDPGELDLGMEACLLEVDGHVVASATGAAVLGHPAEALAFAAN
FT                   TFGARGHSLEAGWVVLTGGMTDAVAVEPGARVAAHFTSLGSITIAGG"
FT   gene            248086..248292
FT                   /locus_tag="Gbro_0226"
FT   CDS_pept        248086..248292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0226"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: avn:Avin_08790
FT                   4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19573"
FT                   /db_xref="GOA:D0LBE2"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE2"
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /protein_id="ACY19573.1"
FT                   /translation="MPIIDVTLAQGRSDEQVRKLIHELTHAACRAIDAPPASVRVIVHE
FT                   VPATHFAAADVTIAERAAAEPDA"
FT   gene            complement(248382..248714)
FT                   /pseudo
FT                   /locus_tag="Gbro_0227"
FT   gene            complement(248798..249739)
FT                   /locus_tag="Gbro_0228"
FT   CDS_pept        complement(248798..249739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0228"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; SMART:
FT                   Helix-turn-helix, AraC domain; KEGG: bmj:BMULJ_05860 AraC
FT                   subfamily transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19574"
FT                   /db_xref="GOA:D0LBE3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE3"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACY19574.1"
FT                   /translation="MRIGLIAIDGCFGSAIASIIDIVRVADGARGDVDPRIDPIKLAIL
FT                   GPKRRVTTTASMTLSVDHPLSESAEFDVVVVPALGTLTAAATNDALHSRDARSVIASLG
FT                   RLDEATTRIAAACTGVFAVAETGRMHHRRATTSWFLGPEFLKRYPTVALDLDTMVVVDG
FT                   NLVTAGAAFAHIDLALSLVRSISPDLAQHVAKLLIIDERPSQAAFVAYEHLRHEDPIVV
FT                   EFERFVRARLDEPFNVAFVAQSLGTSRRTLERRVRAALNLTPLGFVQRLRIERARHLSA
FT                   TTDLTSAEIALRVGYANAETLRSLLRRERRRS"
FT   gene            249847..250158
FT                   /locus_tag="Gbro_0229"
FT   CDS_pept        249847..250158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_1179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19575"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE4"
FT                   /inference="similar to AA sequence:KEGG:Mfla_1179"
FT                   /protein_id="ACY19575.1"
FT                   /translation="MSTPASLPYAFVAKIVAADGQHDALADLLAGAVALANEEVGTIVW
FT                   FAVRTHADTFWIFDAFPDEAARDAHANGAIVAALMANQHLLGAAPEILAADVLASKLP"
FT   gene            250791..252118
FT                   /pseudo
FT                   /locus_tag="Gbro_0230"
FT   gene            complement(252084..253112)
FT                   /locus_tag="Gbro_0231"
FT   CDS_pept        complement(252084..253112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0231"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   vap:Vapar_2542 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19576"
FT                   /db_xref="GOA:D0LBE5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACY19576.1"
FT                   /translation="MTVDARMVVSDCMTAPTSAVELNTREYRPEKARELWSQTLDSTYC
FT                   EMDVVWPGSPVGAADFGAEIVARQAGELSLSVVRADPHTVVRTPAMIASDPGDDLLLCL
FT                   ITRGRASIVQQGHSGVLSDGSFGFVDASMPFTVAGETPFEQVVVRIPRATLAGRLPAAV
FT                   VDDSLGRSISGTEGIGRVASRLLVDLAMHDDRLDEGSWAGVATAVLEVVSASVQQCSTH
FT                   LSATQQSHTDDLSAIQRVLLRDIADPDRTLADVGAELGMSVRYIHKLFSASGTTPRAWL
FT                   YARRLDRARTLLLQSEITCANLSEQLGFRDVSHFSRAFRKQFGISPGRYRLIPIGGVGV
FT                   GV"
FT   gene            253238..254464
FT                   /locus_tag="Gbro_0232"
FT   CDS_pept        253238..254464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0232"
FT                   /product="cytochrome P450 monooxygenase"
FT                   /note="KEGG: rlt:Rleg2_4431 cytochrome P450 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19577"
FT                   /db_xref="GOA:D0LBE6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE6"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_4431"
FT                   /protein_id="ACY19577.1"
FT                   /translation="MTTAHTLTPDWLTDVTMEQLESDPHQVYERLRREAPVAYVPQLGL
FT                   HIVSTRELCLEIAKDSANWPAVISPAGGRTFGHGAILNTNGPEHRDLRDMVEPHLQPSA
FT                   VDEYIDNLVRPFARERLVSFDQDGAADLVAQYCEPVSVRALGDLLGLDDVPVDKLREWF
FT                   HKLSVSFTNADMTPDGEFANPDGFIPGDEAKAEIIAHVDPKIDRWIEHPDRTAISHWLH
FT                   DGMPDGETRSRDVIYPNLYVFLLGAMQEPGHAMATTLAGLFSRPEQLERVIDDPALIPR
FT                   AVSEGMRWVAPIWSAATKVSTSEVTVGDVTLPEGSLVMLTYGSANNDENAYDAPTEYDL
FT                   DRPVIPNLTFGGGVHACAGTYFATAVVRIALEELFESIPNIELDPDHDVSFWGWGFRGP
FT                   KELFVNWEV"
FT   gene            254507..255529
FT                   /locus_tag="Gbro_0233"
FT   CDS_pept        254507..255529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0233"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; KEGG: ppg:PputGB1_3306 oxidoreductase FAD-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19578"
FT                   /db_xref="GOA:D0LBE7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE7"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACY19578.1"
FT                   /translation="MADTHRVQVKGQDATLDVGKEQSILDAALRANAWIPHSCTQGTCG
FT                   TCKLKVLKGAVDHRESPEYTLTADERAAGLALACLATPREDLVVEPTGAVDDDVPHHRL
FT                   RDFTGRVTELSDVAACTRRLVVELDEDLAFNAGQYCELIVPGAGVGRQYSMANPPSEAR
FT                   RLEFHVKLTPGGLASDKWIFSTLSEGDRIALRGPFGGFHLVREQAEPAILIGGGTGLAP
FT                   LKSIVRHALEHNLVPELHLYHGGRRREDLYDVEFFTELADQFAEFHYHPALSEETWDGA
FT                   MGMVTDVVIDDFRSCKGMSAYLCGPPPMIAAAVKSLKRRRMAPRLIFREEFTPINQGSA
FT                   "
FT   gene            255529..255840
FT                   /locus_tag="Gbro_0234"
FT   CDS_pept        255529..255840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0234"
FT                   /product="Ethyl tert-butyl ether degradation EthD"
FT                   /note="PFAM: Ethyl tert-butyl ether degradation EthD; KEGG:
FT                   bja:blr1249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19579"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE8"
FT                   /inference="protein motif:PFAM:PF07110"
FT                   /protein_id="ACY19579.1"
FT                   /translation="MYHLTVIYGQPDDPKAFDEYYATQHLSLVKKIPGLVRFTAGKCES
FT                   LDDTPPASYLIAQLTFDSKEACGSALGSSEGQAAAADVANFATGGATMLFSAETTTIP"
FT   gene            complement(256023..256439)
FT                   /locus_tag="Gbro_0235"
FT   CDS_pept        complement(256023..256439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0235"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   azo:azo1860 putative tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19580"
FT                   /db_xref="GOA:D0LBE9"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBE9"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ACY19580.1"
FT                   /translation="MPIVHFHLPAGAFTVDQLQGLLVEGSAAYARILDSPIERVRAFIV
FT                   HYEPNLVAVGGRVADSAAPYFTAIVLAGRAVEQRHALLTAFTDLIVDTLGVERSGVRGQ
FT                   IVEVAPENWGIAGVPASGARAAEIAARASAGEGA"
FT   gene            complement(256439..257200)
FT                   /locus_tag="Gbro_0236"
FT   CDS_pept        complement(256439..257200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0236"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: dar:Daro_3809 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19581"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBF0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY19581.1"
FT                   /translation="MTDSSTPETCVIVGATGAMGSVIAQRLAGAGRRVLAVARSADELE
FT                   KLATTSELISTCVADIGSDDAVGAIADGLDGPVRLALFAAGLPVRGSADTIEPSGLAVA
FT                   ANIKVAGPVRLLHAVRDHLTEGSRFVAIAGSLGIEPGPLDAGPGTANAALLNLMRQIGA
FT                   LYGPKGITTHTIAPGPIDTPRLRALVETQAAETGRPVDEIWSAYLGKTTLGRLPTLDEI
FT                   AWLVDMLLAPEAAVLHGAVLTADGGVRHGVL"
FT   gene            complement(257193..258674)
FT                   /locus_tag="Gbro_0237"
FT   CDS_pept        complement(257193..258674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0237"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: avn:Avin_08730
FT                   2-hydroxymuconic semi-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19582"
FT                   /db_xref="GOA:D0LBF1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBF1"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ACY19582.1"
FT                   /translation="MSTTVSEVKHLIGTEWVASSDGDTFESRDPHDGSLLATVARGTAD
FT                   DGRAAIAAARTAFDDGPWPQMSPKERAAILHAVADNVDEHRDELAQLETRDGGKTITQS
FT                   LHAEIPRVAHNFRFFADYVAMAGNEAYPDGDLFSYTLYPPAGVVSAISPWNAPLMLATW
FT                   KIAPALAFGNTVVLKPAPQTPLTAHRFAELALEAGLPPGVLNVVQGFGGDAVAGPLTSD
FT                   SRVDRITFTGSSATGVKILQAAAANHTPVSAEMGGKSANIIFADADLDVAVPKAIRAIF
FT                   GGNGQVCLSGTRLLVQNSIREEFLERFTEEARNLKVGDPKDPASFMGPLIEEQHLEKVH
FT                   GYVELAQEEGGKIITGGERLTGAEHKDGFYYPPTIITGLTNEARAAREEIFGPVETVLG
FT                   FDTEEEALRITNDSPYGLAGMLFTQNLDRAHRMAARWKAGTVWINTFFERDLRLPFGGE
FT                   GISGLGREGGQYSREFFTEPRAVTIRLQRSGADHD"
FT   gene            complement(258684..259739)
FT                   /locus_tag="Gbro_0238"
FT   CDS_pept        complement(258684..259739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0238"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /note="TIGRFAM: 4-hydroxy-2-oxovalerate aldolase; PFAM:
FT                   pyruvate carboxyltransferase; DmpG communication domain
FT                   protein; KEGG: bvi:Bcep1808_5384 4-hydroxy-2-ketovalerate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19583"
FT                   /db_xref="GOA:D0LBF2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBF2"
FT                   /inference="protein motif:TFAM:TIGR03217"
FT                   /protein_id="ACY19583.1"
FT                   /translation="MTTTATTGTKGTVTLVDTTLRDGMSSVSHKFTTQNVADIAAGLDR
FT                   AGVPTIEVAHGIGLGASSIQYGFAAATDPEYVRAAVDAVDNADIAVLYVPGIATLTELQ
FT                   GAIDAGIKTVRVAVHCTEADCGQQPVEWAKAKGLNVMCFLMMSHKLEPDALAEQAAALD
FT                   SYGADVVYVVDSAGAMVPDQAGARVAALRSAIGADIGFHAHNNLGVGVANALAAADNGA
FT                   TFIDGSLRGLGASAGNAQTEVLAAAFERAGWETNVDLYPLIDTAEHVVAPLMTEPQIVD
FT                   ETALILGYAGVYSTFFHPTKRAAKKFGVSTREILLELGRRGVIGGQEDMIIDVATELAG
FT                   RTYSTPAVAAV"
FT   gene            complement(259736..260614)
FT                   /locus_tag="Gbro_0239"
FT   CDS_pept        complement(259736..260614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0239"
FT                   /product="acetaldehyde dehydrogenase (acetylating)"
FT                   /EC_number="1.2.1.10"
FT                   /note="KEGG: dar:Daro_3807 acetaldehyde dehydrogenase;
FT                   TIGRFAM: acetaldehyde dehydrogenase (acetylating); PFAM:
FT                   Acetaldehyde dehydrogenase ; Semialdehyde dehydrogenase NAD
FT                   - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19584"
FT                   /db_xref="GOA:D0LBF3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LBF3"
FT                   /inference="protein motif:TFAM:TIGR03215"
FT                   /protein_id="ACY19584.1"
FT                   /translation="MSRLTAAIVGSGNIGTDLMYKLIRSPDVDPVYMVGIDPNSEGLTR
FT                   ARAAGLETSAGGADWLLTQNDLPDLVFEATSAKIHAATAPRYAEAGITAIDLTPASVGP
FT                   YVVPAVNLQEHLRAPNVNMVSCAGQATIPILYAINEVADASYGEIVAAIAAKSAGPGTR
FT                   QNLSEFSEKTGRALAQVAGADRAKAISVINPAEPPMNMRDTVYAKVRNPDAAAIERAVV
FT                   DMVAEVQKYVPGYSLRLVDVDGDLVTVMLEVEGAGDYLPTYAGNLDIITAAAVRVADVM
FT                   AQQNLVTGATR"
FT   gene            260837..261925
FT                   /locus_tag="Gbro_0240"
FT   CDS_pept        260837..261925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0240"
FT                   /product="Catechol 2,3-dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bja:blr3819 metapyrocatechase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19585"
FT                   /db_xref="GOA:D0LC61"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC61"
FT                   /inference="protein motif:PRIAM:1.13.11.2"
FT                   /protein_id="ACY19585.1"
FT                   /translation="MAENPARFDIAHLARVELFSPKPQETEEFFTKFLGLRVTKREGQS
FT                   VYLRAFEDPYQWSLKVTEAPEAGMGHAALRTQSAEALERRVSSLKDANVEGKLHEDDFG
FT                   YGKTFSYQSPDGHNLSLLWEAEKYVAPPELQSKILTRPSKKPLQGIPVKRIDHLNLMAS
FT                   DVSAIRNSFERHLGFRTTESVVDGDTEIGAWMSSNLLGHEVACMKDMTGGRGKLHHVAF
FT                   FYGNGQHNIDAAEMFRDYDIQIEAGPDVHGITQGQFLYVFEPGGNRIELFGEAGYLHMD
FT                   PDAETKTWQMSDIDTGLAIGGAKLPWETYFTYGTPCVLNLDRHIEAFAHFGPGEPLPEA
FT                   HLAAANMPDEIEQSRAVAGAPA"
FT   gene            complement(262005..265331)
FT                   /locus_tag="Gbro_0241"
FT   CDS_pept        complement(262005..265331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0241"
FT                   /product="cell wall arabinan synthesis protein"
FT                   /note="PFAM: cell wall arabinan synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19586"
FT                   /db_xref="GOA:D0LC62"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC62"
FT                   /inference="protein motif:PFAM:PF04602"
FT                   /protein_id="ACY19586.1"
FT                   /translation="MSDGPENTVVTADDEAPADARRDYRWVKIAAVVTGLLGFLAAVLT
FT                   PLLPVNQTTAELRWPQGDTVSDVAAPLVSYVPIDMDMTVPCVLAARLPANGGVLLSTIP
FT                   EQGQDSAARGLFVRATADTLTVTDRDVVILSTPRAAAQSNPGCRIILHADGHGVQARFE
FT                   NAGASTGLTTFTTGDHEMRPQIVGVYSYLPADAPRDGLSLRATIDTRYVSTPSALKLTV
FT                   IILGILMTILSLVALGILDHRDGRGHKRFLPSQWWTIRGPDVAVFVILAFWWFAGTNTS
FT                   DDGYNFVVGRITGEAGYADNYFRYFGVPQDPFGWHFQVISAMSHVSLAAPWMRLPAFLL
FT                   GLLGWWLISREVIPRLGRAVRNSTPAVWSAAFVFLAIWLPYNNGLRPEPAEAVGALLTW
FT                   CCVERAIATRRLLPYAVAVVAAAFTLALAPGGLMAVAALLAGIRPVVKALVTRRRRDGL
FT                   LPMLAPILAAGTAVLFQIFADQPLAPLIAGNQVATDVGPTLEWWQEPVRYYYLILPTAD
FT                   GTLARRFGILIMILCLVVVLLRLLRREHPSGVARAPIWRLVAVTLGTMFFISFTPTKWT
FT                   HHFGVYAGIAAGLAAAAGAMMAPAILRSRRNRTFFAAAVLAVTGMSFAGTNGWWFVGSY
FT                   GIPWWDRPPSIGPIKLGWAFLILAVVTALVGLWFHFRDDYVDEKTRTIGGGAWYSRLKF
FT                   SPLPVIAGFVVLFMVASFIKGAYEQRDSWSWAKSNARALSGNSCALANDVLVEADPTAG
FT                   LLVPAAIGRRPAPGVAQALSGADSSGFTPDGVPDRLSVDATEDQDSTTSAQNTAQTGAG
FT                   ADEVSDDQNTSAQGGTEGGKGGVRGVNGSTVRLPFGLDPAKTPVLGSYGSPSGTASLTT
FT                   DWYRLPERHNAPLLTIAVAGSVQAVDGIGVVHPGQKVVVQYGHLEPSGRVSTVAIRTPI
FT                   DIGETPTWRNLRFPLADAPREATVVRVIVEDTSGAPSEWVAITPPRVSSLATLNDVVGR
FT                   TDPVFIDWLPGFVFPCQRPMAVRNGVLEVPKWRIMPDAEATRKNSQTWMSGKAGGPLGI
FT                   TEAMLRPTLLPTYLRNNWGRDWGGLQRFTEIAPAPPAELEIGTARRSGMYDPAPMRSSG
FT                   Y"
FT   gene            complement(265324..268641)
FT                   /locus_tag="Gbro_0242"
FT   CDS_pept        complement(265324..268641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0242"
FT                   /product="cell wall arabinan synthesis protein"
FT                   /note="PFAM: cell wall arabinan synthesis protein; KEGG:
FT                   pst:PSPTO_3539 membrane protein PslK"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19587"
FT                   /db_xref="GOA:D0LC63"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC63"
FT                   /inference="protein motif:PFAM:PF04602"
FT                   /protein_id="ACY19587.1"
FT                   /translation="MSGPFSADNARLVAIVAGVLGVVLCALTPLLPVKATDATFDWPQD
FT                   QPLSAQTSSVTAPLIAQTPRSLDIRIPCATLTSTILPALPDGAGVIVGTMPTAAAKSKA
FT                   SALYITATAESVTVTFRNSVAATAARSELGRCSELHVWSAPSGPGAQFVGLRPSTTLAP
FT                   DKRPQVDGVFSAVPTDAVRAAQGLRVHVEIDNRYENSPTVLKLVVMVAAVVAVLVALIA
FT                   LYLLDRLHAPRVRRTRAGPWWRTLRPRVTDLAVTAVLLIWLLLGAGSPDDGYILNMGRT
FT                   ADGFGYLANYYRYYGIPEAPFDWYYSFLAHWSSVSPSLLWMHIPPLIAGLASWFILTRV
FT                   LLPRLGAAVRSSGWALWAAALTFTAFWLPYCSGLRSEGIIVLGSLLTWWAAENAIATRR
FT                   LLPAALAAIAASFTLALAPHGVIGVAILLVAARPLLHILLDRRRTTGGGVAGTLALIAP
FT                   IAAAGSLVAVVVFRDQTLAGVLEAMKLRYQVGPVISWHQEFLRYYFITVPTDDGALTRR
FT                   VPLLLLLAGVIVTVAVMLRRTRIRGVAPGPMWRLIGAIGVTLLLFAFTPTKWTIQFGVF
FT                   AGLGAAIAAAATLAVAQSAARSARNLTVFVSGLFFAMAAATAGYNSWPFVYEYGISWFD
FT                   RAPVLAGYEVSTGFLILAVITAGMAVWQHLRLDYVQNKGLAHADDGPGQSRADRRRLFL
FT                   ASSPIAVIAGLMVIAELLVFAKAAVSRYPAVTVFSENVDTLRGNSCGMADQVLVESDPN
FT                   AGMLVPADGLSATAALTGVGSVGFTPQGIPENLAPEPGSQRPGQMNVSASFAKPFAITG
FT                   GLGAGTTGGVGPTTVNGSNALLPFGLDPKTTPVLGSYGHLGEARLTTGAYELPADRSVS
FT                   PLLVFSTAGAVSTIDQFGVRNFGQKLVVQFGRPGPGGAFTQIGPDVLPIDPGPVITNRP
FT                   WRNLRVPMAAVPRAASLMRLSLLDNNLGQYQFIGITPPRAPRLQTLQQVVGSDAPTLID
FT                   FSAAAHFSCQRPLQVRHGVAEVPQWRILADYPTTNSQSKTWQAAADGGLLSVSESTTSA
FT                   LAVPTYLKDDWTRDWGALERLTPLVPDAPPARLSTGEVTQWGWSRTGSIRVEPQADE"
FT   gene            268799..272143
FT                   /locus_tag="Gbro_0243"
FT   CDS_pept        268799..272143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0243"
FT                   /product="cell wall arabinan synthesis protein"
FT                   /note="PFAM: cell wall arabinan synthesis protein; KEGG:
FT                   GK21299 gene product from transcript GK21299- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19588"
FT                   /db_xref="GOA:D0LC64"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC64"
FT                   /inference="protein motif:PFAM:PF04602"
FT                   /protein_id="ACY19588.1"
FT                   /translation="MTAPSEPSAEPSPDAPTDSAEPAHATASNTRRWALAAVFGGIVAV
FT                   IAAILTPLLPVTEHTARIDWPQATGTAVTASLAAQTPAGLDIAVPCSTLDREVRSGTPG
FT                   AARVVVLSTVPAGGLRAADKGLFITTDRTGASVTVRGKEVLRIPAAELARCERVRITST
FT                   LAGLQARAVGIGTTGSVGPTDLPQVSGVFTDLEPAAVTAAGADGLAVRIDIDNRFDTAP
FT                   TALKLFVMIVGVLAAILALIAIAVLDVRGGYHRRVGRGDLRRLLWPRPADLAVTAVLVI
FT                   WHFLGAGSSDDGYILTMGRNSTDDGFLANYYRFHGIPEAPFDWYYTFLAHWSTVSTAGV
FT                   WMRLPALIAGLVSWFILSRILLPRLGGAVRRSQWAMFTAAAVFVAFWMPLCSGLRSEGI
FT                   IVAGSLLTWWGVEQAIATRRMLPAAGAALAAGITLALAPHGIIAVALLIAGSRPMLRII
FT                   RRRGTENGLLPLIAPIAAAAAIVVILVFRDQTLATVAEALRVRYTVGPTLAWYQELLRY
FT                   YFLSLTTQDGSLVRRVPLLLFLTALFVAIAVMLRRKHIRGVDPGPVWRLVGAVLLTVLL
FT                   LSFTPTKWTVQFGIYAGVAAAMAAVATVAVAESARRSPRNLWMYIAVLMFACAVASAGK
FT                   NAWGWAYDFGIAWFDKAPSVAGIQLSSVLLVATVAALAVAVWFHLRIDVDAERGVVRSA
FT                   QAAPSATQIAIASSPMLIIATLLVLVELALFAKAAAVRSDTYTTFSANMRALTGNTCGM
FT                   ADDVLVESDPNVGALQPIGTTDISRALAGDSTGFTPDGVAPDLLPDPESLGAGTINTSG
FT                   NLARPFVLSGGPPGTTGGVGPVGVNGSRVKLPFGLNPRTTPVLGSFGHDNETAELTSGW
FT                   YRLPDRNASPLLVITAAGPVFSVDQDGVAAPGRSLKVQFGRAGTTPDAFEPMGPGYVPI
FT                   DPGPTKPNRPWRNLRIPMEAVPAGATAMRIVALDNNVSPDQWLAFTPPRAPRLRTLQQV
FT                   VGSDAPVLLDLSVGSQFPCQRPMTTRNGVLEVPQWRIVPDAVTTNSKSKTWQAAVNGGL
FT                   LTTPEALTSADTVATYLDHDWYRDWGGLQRLSPLVPDATPAHVTTGEKTTWGVSRPGPI
FT                   RVVPQDD"
FT   gene            272136..275429
FT                   /locus_tag="Gbro_0244"
FT   CDS_pept        272136..275429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0244"
FT                   /product="cell wall arabinan synthesis protein"
FT                   /note="PFAM: cell wall arabinan synthesis protein; KEGG:
FT                   rpa:RPA4794 cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19589"
FT                   /db_xref="GOA:D0LC65"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC65"
FT                   /inference="protein motif:PFAM:PF04602"
FT                   /protein_id="ACY19589.1"
FT                   /translation="MTEKRYRIAKLVAVIAGAIGVLLALAAPFLPVTYTKAELNWPQQG
FT                   SVQNVAAPNVSYVPVSVDIAVPCTLAADLPAAGGVLLSTVPENGAEAGKVGLFIRATEQ
FT                   RLIVTQRNAVLLSVPRAQAQDNPGCRVVIHADTSGTRGAVEGLAPEAGVTTFDLRDPNA
FT                   RPQIIGVYTDLPPGASTEGLSYRSTIDTRFISSPTTLKGLALIIGVLCTIASMIALAVL
FT                   DSRDGRKLRKLLPHRWWRPRIVDVVVGVVLLIWLFIGGNTADDGYQVTVGRIAPGAGYL
FT                   DNYYRYFGAPQDPFGWHYQYLALWMQVSTATPWLRLLPFLFALAGWFLISRAALPRLGK
FT                   AVASSTPAMWAAGLGFLAVWLPFNNGLRVEPVLSVGILLTWVLVERAVATGRLFPLSLG
FT                   IVSAAFTLTIHPAGAIAVLPLLAALRPILKRLRMRWRRDGFLPVLMPILASGLAVLFEI
FT                   FADQPLASILEGVEVQGIVGPTNKWWTEAMRYYILLNPTPDGSIARRVGIFVTILAVLI
FT                   IVLTLLSKRRVSRVASAPLWRLVTVTAGAVAVLAFVPTKATHQMGAFACLTGVLAAAAT
FT                   ALLRPSVMRRRCNRTFVTAAAAYALAVAFAGRNQWWYVGSYGIPWGDDTPNVRGIGLYV
FT                   PILVVAVALTAYGAWQYYRDDKLAELGEPVPAYRVNDPRPQRFLRRIPTYSLAIICAAM
FT                   LGFTFISFAKAIDTQRDSWSWASSNLDAMRGNTCALADAVLVEEDPNTGLLAPARVAGQ
FT                   NNPSPGAALAGRGMTGFDPNGVSSNLESDSEGEDSDDAGQDRTQTDPNKAPEEPSGGAG
FT                   SADTGGGTTATRGVNDSMVRLPFGLDPQRVPVLGTYGNPSGSGHLQSDWYQLPARSDDR
FT                   PIVTMSVAGKIEYIDELAVRHPGQKLRLEFGRVEPDGRVTTVASMLPLDLDAAPEWRNL
FT                   RFPLDQAPQRASVVRIVADDTSADPDQWLAVTPPRVTKLVTLNSLVGSEDPVLLDWEVA
FT                   FAFPCQRPASAANGVLETPMWRITPDAEGERVNSRRWMAGDYGGPLGIVENELRPTVLP
FT                   AYLRNDWAKDWGSLQRLTPLKPQVTAEIDLTDDVHWGWWTPGPMRAVKN"
FT   sig_peptide     272136..272216
FT                   /locus_tag="Gbro_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            complement(275549..278953)
FT                   /locus_tag="Gbro_0245"
FT   CDS_pept        complement(275549..278953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0245"
FT                   /product="cell wall arabinan synthesis protein"
FT                   /note="PFAM: cell wall arabinan synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19590"
FT                   /db_xref="GOA:D0LC66"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC66"
FT                   /inference="protein motif:PFAM:PF04602"
FT                   /protein_id="ACY19590.1"
FT                   /translation="MVPAGPTGAVPERDGETPGLTSLIVSAAQNVRRAKLVAIIAGLAG
FT                   LFLALATPLMPVKQTTAEITWPQQNAISSVAAPLISYVPIDLDISIPCTAVDRLGDNGS
FT                   VLLSTLPKQAEKSGERGLFIRVTGSPSDPDDHRSVEVVNRNVPLVSATLAQVRSQPCRD
FT                   IVVHADADAVTAEFVGMRGNDGSPLMGSTDTRDQYKYWPDQRPQLTGLFTDLSGPAADV
FT                   PGLDAHVTIDSRYNTAPTVFKWIVVIVGVIATLLSLVALAALDSTDGRRHRRFLPARWW
FT                   HLNARDYVVIGALIVWHFIGPNTSDDGYLLTMSRVAQDTDYTANYFRWFGAPEAPFGWY
FT                   YQVFGMLSHVSVASPWMRIPALICGILAWLIVSHEVIPRLGRAALTRPPVAWTAAFVFL
FT                   AFWFPFNNGLRPEPIICLGALLTWCSVERAIATGRLLPAAVACLVGAFSLAAGPTGLLA
FT                   VAALIAGARPMIMALIKRARVIGGGAWSYVALIAPIVAAGTFVVFVVFSNLTLRSFTEA
FT                   STMKTDVGPSRHWFSEIDRYSSLFAFSADGSIARRFAVLAMILAMVVSAAVLIRKSRIP
FT                   GTALGPSRRIVGITFASLVFLMFTPTKWTHHFGVFAGLAAALAAIATIAAGHQAMHSRR
FT                   NRTLFAALVLFVTGFAFTAPNSYYYYSSWGMPWGISQVTIGGLMLGQLLLYLSLLLLAL
FT                   ALWFHFREPFTGTDPAENAPPPRHPRAYRRVGTSIASAPFAYVAAAVVVFEIVTAAFSA
FT                   INQSSSFSTPRSNLEALAGNECGMADWVWVEEDPNRDMLRPVDRTLPNPLGGPTTPPGS
FT                   DAQPGTVGFSPNGVEDDLSSTASEGSLGVLAGNVWAAPDILNSNPGGTGGGVLPTPGIN
FT                   GSRAKLPFFLDPATTPVMGSYSKTDQIPAKLTSGWYALPAGWRDRPLLTMSVAGEYDNP
FT                   NLMLQYTSDPIGPNTRDGDLTPADETELIDPGPRPSWRNLRYDTKDLPADTTAVRIVAT
FT                   DDNLSEDRFIVVTPPRVPKMRTLEDVVGREAPVHVDWTSGLAFPCQRPFDHHVGVAEIP
FT                   DWRIKPGADLAAAVTAWQDQFGGGPVGWLQVSQEATALATYLRGDIGRDWGALERYTPY
FT                   GGVTTLADIQTGTATRSGLWSPAPIRK"
FT   gene            278966..279436
FT                   /locus_tag="Gbro_0246"
FT   CDS_pept        278966..279436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0246"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: pfs:PFLU5364 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19591"
FT                   /db_xref="GOA:D0LC67"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC67"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACY19591.1"
FT                   /translation="MSDDAGARETTEPLPILLLNGPNLNTLGTRQPEVYGSDTLADVVD
FT                   LAERTAAELGFGLRAAQTNHEGQMIDWIHESVRQISGIVINPAGWTHTSVALADALVIP
FT                   GAPIMEVHISNVAAREPFRHHSYVSPHASGVIAGYGIRGYEFAIRRLVDIIG"
FT   gene            279546..279998
FT                   /locus_tag="Gbro_0247"
FT   CDS_pept        279546..279998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_04877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19592"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC68"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_04877"
FT                   /protein_id="ACY19592.1"
FT                   /translation="MTTADHDRIEREITIDAPVDRVWTLVSEPGWYINDKQITEHRIET
FT                   RGEVTIVHDPTHGAFAMLVLELDEPRYAAFRWLIDADDPQSTSTLVEFWLTETDSGVVL
FT                   KVAESGFASLDDSDANRRSRFEDHSDGWRIELELARDHLTRQDARA"
FT   gene            279991..280320
FT                   /locus_tag="Gbro_0248"
FT   CDS_pept        279991..280320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0248"
FT                   /product="regulatory protein ArsR"
FT                   /note="SMART: regulatory protein ArsR; KEGG: scl:sce1129
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19593"
FT                   /db_xref="GOA:D0LC69"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC69"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACY19593.1"
FT                   /translation="MPENDAATVELFAALADDTRWQILVRLGREPASASALAGEFPISR
FT                   QAIAKHIQLLTDVGLVTPVRVGREIRYETVGARLSGVARRLDDIARGWDRRLARIKTLA
FT                   EDATT"
FT   gene            complement(280330..281076)
FT                   /locus_tag="Gbro_0249"
FT   CDS_pept        complement(280330..281076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0249"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19594"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC70"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY19594.1"
FT                   /translation="MSAFRLETVESDSGTAHLVTTGAVNWVILREGSDLTLIDGGYPGQ
FT                   ASTVVSSIRAIGAQPEDIRGALLTHAHVDHLGGLAKLQRRYGFDVYMDPVEVAHARRDH
FT                   LQQADVRDIAPIAYRPRVLKWLAMVTPLGVLSRAGLPDAQPFPDPLDLPGRPTPVAAHG
FT                   HTDGHSAYLAAGGAVLVSGDALVSGHPISTITGPQCISDAFQHDVDEARRTVDAFTRLD
FT                   ATVLFPGHGPIHRGPVALAAQHALDN"
FT   gene            complement(281073..283022)
FT                   /locus_tag="Gbro_0250"
FT   CDS_pept        complement(281073..283022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19595"
FT                   /db_xref="GOA:D0LC71"
FT                   /db_xref="InterPro:IPR020959"
FT                   /db_xref="InterPro:IPR020963"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19595.1"
FT                   /translation="MTKSLGRDLGTLVIAVVVGAVVALAGLKVIDAVDWPAYNSSNVTR
FT                   ALTTAGQAIAIAVVVAVALLYRYGRARVAIPFLSAAAMSGFVTVTLGMPLGATRLYLFG
FT                   LSVDQEFRTEYLTRMTSSPRLADMTYVDLPPYYPAGWFWWGGRFAQLSGQPGWEAYKPW
FT                   AIISIAIAAAVAVVALNRMFGADRGGALALAVTTVTLMYASPEPYAAVLVLLAVPMVIV
FT                   LTYALRGRSRAADGPVPGVREGTSWPAVIAAGLFVGLCATMYTLFIGLFAIVAILLALY
FT                   FAVQGWRGLANKALPTDEVRTERRRVIGAIAVRLVAVGAVTGLVALTVWAPYLWARVTN
FT                   RPASGGTAEHYLPEGGAVFPVPMFQLNLVGVITLIGLVWILLRFRQRTVALAFGATVVA
FT                   VYLFCLLSMLMTAAGSTLLSFRLDPILIAVLTAAGVFGVIELAHAAVGRFGDVRFVVGA
FT                   VATIAAIAVAQGIPGHLSAEITTAYTDTDGYGERGDHRPAGAESYYPKIDRLIREQTQR
FT                   VPTDNIVLTADYGFLSIYPYWGFQGLTSHYANPLAEFDKRAAAIARWSESTSPQDLIDR
FT                   LNRSPWPAPDVFLFRYSADGFTLRLAQDVYPNDPNVKRYTVTFDPTLFADPRFRVTTDG
FT                   IGPFVLVVREGPRR"
FT   sig_peptide     complement(282945..283022)
FT                   /locus_tag="Gbro_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.910 at
FT                   residue 26"
FT   gene            complement(283025..283786)
FT                   /locus_tag="Gbro_0251"
FT   CDS_pept        complement(283025..283786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0251"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mxa:MXAN_6631 short chain dehydrogenase/reductase family
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19596"
FT                   /db_xref="GOA:D0LC72"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC72"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY19596.1"
FT                   /translation="MMNAVGAPQSILVLGGSSEIGLAITAEYLKKGPARVILATVPGDP
FT                   TAEAAATKAKAAGATDVELIDFDARATDTHREVIDKAFAGGDVDVAIVAFGIQGDDEQA
FT                   WQDHKLAVAEAEINYTAAVSVGVLLGEKMRAQGHGQIIAMSSVAGERVRRSNFVYGSTK
FT                   AGLDGFYLGLGEALRPFGPRVLVIRPGQVRTRLSAHVKEAPMTVEKEDVGRLAVAAATK
FT                   GKEIVWVPGQFRFVMMVLRHIPRAVFRKLPI"
FT   gene            complement(283817..285241)
FT                   /locus_tag="Gbro_0252"
FT   CDS_pept        complement(283817..285241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0252"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   noc:Noc_1951 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19597"
FT                   /db_xref="GOA:D0LC73"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC73"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACY19597.1"
FT                   /translation="MSTEELLPITTRTLVGWSRTTPIEGHVLSTPYPEVIAEAVARVAD
FT                   DNSDKPDYLKRGVIARGLGRSYNESGQNSGGLTVDMTQLTRVYSIDDETGIVDVDAGIS
FT                   LDTLMQVALPHGLWVPVLPGTRQVTVGGAIAHDIHGKNHHSQGSFGNHVREMQLLVADG
FT                   RILTLTPDGSPDDPDAELFWATVAGIGLTGIVLRAKIAMKRTESAYFIADTAQTSTLQE
FT                   TIDLHLQDGFEDGYEYASGWFDTISAPPKLGRGTFSRGNLAKLDELPEKYRENPLSFNN
FT                   KPLITFPNIFPRGLANKLSFSVVGEGYYRMGPPSQGKVKNLAQFYHMLDVFGNWNNAYG
FT                   RGGGFAQYQFIVPTGNEGEFTRLIEDIQASGHVSFLNVIKLFGEGNKAPLSFPFKGWNV
FT                   CLDFPVKAGLAEFLNELDARVMAMGGRLYTAKDSRTSAESFHKMYPRIDEWLAVRRRID
FT                   PHGVFMSDMGRRYELG"
FT   gene            complement(285417..285818)
FT                   /locus_tag="Gbro_0253"
FT   CDS_pept        complement(285417..285818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100032459"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19598"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19598.1"
FT                   /translation="MSPSARRSRKVSAILGVVAGVALLAACGNDSADDAAASTSSATST
FT                   STTSTFVHPTTRSTMPGSPQIPAEWPQDIPVVSGGTYRMAHGQTGADTLEVRGLGPSAF
FT                   DAAVSQLEAAGFAPMTTVDPPGRPSGRRR"
FT   sig_peptide     complement(285720..285818)
FT                   /locus_tag="Gbro_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.779 at
FT                   residue 33"
FT   gene            complement(285833..286297)
FT                   /locus_tag="Gbro_0254"
FT   CDS_pept        complement(285833..286297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF20893 gene product from transcript GF20893-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19599"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19599.1"
FT                   /translation="MKRRRARATALICAAAAMSMVTACGDDSSGTPTSSGSSQAVTVTT
FT                   AGTADQGSPQVPADWPQDVPIISGGRYKSSTAQSVGGAVAVEVYGLEPSAFDRAVDELK
FT                   NAGFTPLGAIDPGTESLRTTSLNRGGTVVVLVATGQGDQYVLTYTVRKAA"
FT   sig_peptide     complement(286226..286297)
FT                   /locus_tag="Gbro_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.545 at
FT                   residue 24"
FT   gene            complement(286412..286837)
FT                   /locus_tag="Gbro_0255"
FT   CDS_pept        complement(286412..286837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19600"
FT                   /db_xref="InterPro:IPR021975"
FT                   /db_xref="InterPro:IPR038611"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC76"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3870"
FT                   /protein_id="ACY19600.1"
FT                   /translation="MDAPKPFEVYETGQLLHGTKADLGVGDLLVPGRESNFETGRIINH
FT                   VYVTRTLDAATWGAEMAKGEGRGRIYIVEPLGEIEDDPNVTDKKFPGNPTRSYRTREPV
FT                   RVVGEVTDWVGHAPEQIAAMRDGLADLTRRGEAVIYD"
FT   gene            287152..288498
FT                   /locus_tag="Gbro_0256"
FT   CDS_pept        287152..288498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0256"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: mxa:MXAN_6633
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19601"
FT                   /db_xref="GOA:D0LC77"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC77"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACY19601.1"
FT                   /translation="MTTETEVGADEHVTSPGATEADTAPHRWNSVHLIAFRFCCVYVTG
FT                   FCLLFAQILFALLGVVGDLVPPSAIMWQLTTLAPVLEWVARTVFGVDATLHTDSGSGDQ
FT                   TVIWVLVFCLLVFAALVTVVWSVLDRGRGDYRRLAAWFLLFVRICLAGQMLFYGFAKLI
FT                   PSQMGEPSLTALLQPHGDFSPASVLWLQVGSSPVYEMLLGSVEVLGGLLLFWNRTATLG
FT                   ALVSLVAMIQVFLLNMTFDVPVKILSFHLVVLSLVLLAPQIRNLLGLFVLNRPAATVSP
FT                   PELFTSARRNRWATMSVVALGVWVTVGTAVGGYDDYQKYGGGAEKPALYGIWEVQEFRV
FT                   DGKPLPPLTTDETRWQRLVFDTPEAATVQLMDGTLTVVPATVDAERQRIDLPPLAASFG
FT                   FDRPAHDRLLLTGTLDGRPAAVRLVRADENAFTLRSRGFHWIQEEPYFR"
FT   gene            complement(288513..289163)
FT                   /locus_tag="Gbro_0257"
FT   CDS_pept        complement(288513..289163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0257"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   bcs:BCAN_B1035 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19602"
FT                   /db_xref="GOA:D0LC78"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC78"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACY19602.1"
FT                   /translation="MTDDSETGALLTQSVLRRLRDEIFEGILPPGTALSVPGLAARLEV
FT                   SRSPVREAVQQLVTDGLAVYTPRAGAKVAVLDDEMLRHVFEVREVLDGLAARQATAQVT
FT                   LAELAELWEHVREQERLLDAEPDHRRDADIDLAFHTAVRSLSGNKPLCDALLKLDTQSH
FT                   LYRSHMWSHDVTRRLAVTEHRRIVAALEAGDADEAERAAKAHAAGVLVRLMRT"
FT   gene            complement(289208..290239)
FT                   /locus_tag="Gbro_0258"
FT   CDS_pept        complement(289208..290239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0258"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: psa:PST_3584
FT                   2OG-Fe(II) oxygenase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19603"
FT                   /db_xref="GOA:D0LC79"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC79"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACY19603.1"
FT                   /translation="MFTVPTVDIAPYVDPNGSPEDRQRVAEELDNACSGVGFIQIVGHG
FT                   IDTAVVERLTAALDEFYALPLEVKKQYARPGENRGYSPPKSESLSMSLGVAAANQMNDF
FT                   YEAFTVGSERSWFPGHDLPETSYPDNTWPGAAPGFRPAVQEWFTAARGLSRVLLTAFTD
FT                   DLGLAPGYFDAMTDHSIDALKLNNYTLPEGDIELAGELTGMGAHTDFGILTELWADQVP
FT                   GLQVLDHDGCWHDVAPADGALLVNLGDAMARWTNDRWRSTIHRVDPPVVDGRILRRRSA
FT                   AFFFDGNSDAVIETLPGCARTDHPGYPPITVAENIDAKLAGMKGGIAPVAADREARRVM
FT                   AAS"
FT   gene            complement(290267..291628)
FT                   /locus_tag="Gbro_0259"
FT   CDS_pept        complement(290267..291628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0259"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SMART: AAA ATPase; KEGG:
FT                   mxa:MXAN_2832 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19604"
FT                   /db_xref="GOA:D0LC80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC80"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY19604.1"
FT                   /translation="MSLYDTMNDVDARHLTKGVALSMSGVTKRFASGTVALSDVDLDIA
FT                   EGEFVAVVGPSGCGKSTLLRMAAGLERPTEGSVALATDAVGFIFQDPTLLPWRSVRANV
FT                   ELCAEIAGLPTAQRRARAQAAIDAVGLSGFESPPPPSGSAIRRPLHRVRRADLRHPARR
FT                   MMTTATETSAITTRRAETPAARRDSAPLPTARHRRVKAVLRYGLPPILSFTVGIAAWYA
FT                   VTYLILAEHRRFLLPPPHEVLTDSLLDPAHVGPMLEALAVTAKVCLVGFVFAAAIGVTI
FT                   GVVMSRGSFLERAIYPWAVVLQVIPVLAIVPLIGLWFGYGMVARTIVCVIIAIFPIIAN
FT                   THFGLVSVDKASHELFTLAKASPLQRLMKLEFPSALPSMMTGFRTASGLVVVGAIIGDM
FT                   FFAKGQPGIGTLLDIYRARLQSDDLIAAIVLASIFGIAVFGIFSVLNALVNRRR"
FT   gene            291931..293109
FT                   /locus_tag="Gbro_0260"
FT   CDS_pept        291931..293109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_4758 NMT1/THI5 like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19605"
FT                   /db_xref="GOA:D0LC81"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19605.1"
FT                   /translation="MNLRPVITRRSRAVLAGVSAALCAATLAGCSGSDSDVASTASLAP
FT                   ASAANNLAQVCPKDVVVQLQWQPQSDMAGVIGLLGPGYTVDTDNKSVTGPLAFDGQDTG
FT                   VDITLRAGGPAIGFQSVPSAMYADDSINLGLVHGDQLISAATDQRVVGVTPLLQYNPSI
FT                   IMWDPASHPDVKTIADIGRSDASVVVSKDQIFPQWLVAKGLLKKSQLDTSYDGAPARFV
FT                   GDPSITQQGFAKSEPYTYEHETPAWNKPVAYAMVKDAGYDVYASNVSVRADKLAELSPC
FT                   LRKLVPMIQQTGKNYVNAPDAINATIVDWVSQDMAVTPYSAGEAAFSAKLLKDKGVIAP
FT                   GSDGVYGSYDMVKAQKIIDDLRPILNADGANLPAQLPATTIFTTEFISDQVR"
FT   sig_peptide     291931..292038
FT                   /locus_tag="Gbro_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.274 at
FT                   residue 36"
FT   gene            293146..294147
FT                   /locus_tag="Gbro_0261"
FT   CDS_pept        293146..294147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0261"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: rme:Rmet_4741
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19606"
FT                   /db_xref="GOA:D0LC82"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC82"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACY19606.1"
FT                   /translation="MSHTTATTPTEMAELDRERRMGGQGTETTDREVRRISLADFENRR
FT                   AEITDQLWSAATDIGFFQVVDHGIDLATVDHAFDMSARFFDLPRAVKEQYPLKKGQNAG
FT                   WEYMTQVRPSVGTPDQKESYQYTRPRMDALWPSEEELAGFRSTIEDFEHRCWRLAMNLL
FT                   GCFADRLGLDREFFTRAHDPSSTTYQSTLRLLHYYAFPDELLDDESIWRAGAHTDFDAL
FT                   TLLFQRSGQGGLQVLPGAEAHGQAWTPVEPSDDAITCNIGDMLMRWSDDRLPSNFHRVR
FT                   APRRGEYRGPRYTIAYFAQANTDVLIESAGGTYPPITAAAYIAQRIAANFRK"
FT   gene            294153..295467
FT                   /pseudo
FT                   /locus_tag="Gbro_0262"
FT   gene            complement(295478..297019)
FT                   /locus_tag="Gbro_0263"
FT   CDS_pept        complement(295478..297019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0263"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19607"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC83"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACY19607.1"
FT                   /translation="MRFDDIIIGAGHNGLTAAAYLARAGRSVLVLERSDHVGGAAISAM
FT                   PFPGMPARLSRYSYLVSLMPRQIMADLDLDLRLIRRRISSYTPLPDDPTRGVLVDNDDP
FT                   DATAESFRRATGDESDFTAWQSFYTRMSGIAERVFPTMLEPLRRGDDIRDVAVGTDSSD
FT                   AELWERLTTRPLGELLEQYFDDDVLRGIAATDGLIGTFADLDDASLRQNICFLYHLVGG
FT                   DWDVPAGGMGAVSGALYETAVSAGARIETGITLGGIDVGDGTVEYGTTEHGGVTIAGGQ
FT                   LYAACAPAVINTYLDDPISTELDPRGSQLKINLLLERLPRLRSGVPPETAFAGTFHINE
FT                   TASQLHTAYRQACRGEVPDVPPCEVYCHTLSDRSILGPELDGKHTLTLFGLHMPPEVFD
FT                   EPGAVEHAVGATLSSLNSVLAEPIQNVLAHDRAGNPCIEFKTPQDLEDTLSLPGGNIFH
FT                   RSLQWPWAETDSEVGTWGVETRHPRLLLCGAGARRGGGVSGIPGRNAAVKVLDAG"
FT   gene            complement(297061..298248)
FT                   /locus_tag="Gbro_0264"
FT   CDS_pept        complement(297061..298248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0264"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: smt:Smal_3161
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19608"
FT                   /db_xref="GOA:D0LC84"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC84"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ACY19608.1"
FT                   /translation="MVPVLVTGLLVVVPLLMTPAAHAEDMPPLRTPALSGLDARTYSGP
FT                   IGAPGTLIRQVPLDRSVTLSDAGRAYRVLYATRDIRGRSAVSTGAVLLPRSPAPRGGYP
FT                   VLAWAHGTVGLGDDCAPSVQPRIPRDVRYLGHWLRQGYAIVATDYAGLGTPGLMNYLSG
FT                   KVEATSIVDSVISAHRMGVPLARRWAIVGQSQGAGAALAAARDANRLSAGHHLDYRGVV
FT                   ATGTPANIEQVVALAGPQLPPVALPPALNTYATYIWAGFADARPDLRPLSILTAEGRRL
FT                   VRLARTTCYQDMKPLVRGKTLRDMFAAPVATIPGVRAALVDYMGTPYSGFDRPIFLGQG
FT                   LRDVDVPAPSALSLYAQMRAAGQPVELHIYPDQDHSGTVIASMRDSTPFLARIMR"
FT   sig_peptide     complement(298177..298248)
FT                   /locus_tag="Gbro_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            298333..299181
FT                   /locus_tag="Gbro_0265"
FT   CDS_pept        298333..299181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0265"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bpt:Bpet2625
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19609"
FT                   /db_xref="GOA:D0LC85"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC85"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACY19609.1"
FT                   /translation="MDIPAALSDHTVALSDGHTIPLVGLGTFGMLGQACADAVSVALRS
FT                   GYRLLDTASRYSNELSVGMGLRESGVPRDEVVVQTKLGGGDQGFDEAINAAKESARRLG
FT                   VAHIDVYLIHWPCPTLGRTVESWRALLTLADEGFIRVPGVSNFKQHHLQMLYDETGRWP
FT                   ALNQIQCSPALARTELRAFMAEHDIFAQAWHPTGRKEHMLGEPAVLRLARKYGKSPTQI
FT                   ALRWSVQQGIGVVPKSSHAGRQRENADLFDFELDADDMAALAALDRGERAARDSDVEEE
FT                   F"
FT   gene            299355..301163
FT                   /locus_tag="Gbro_0266"
FT   CDS_pept        299355..301163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19610"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19610.1"
FT                   /translation="MFTLTDPVADDTGVSSMVSDAVVDAAREMQQLARRAEARTVLLAY
FT                   RIGHAVYQDMIADPSWNRTLGRRVRDMPDKAAIGQVSVRLGISRSTASRWITLGTHLQQ
FT                   LPAVRIAFLDGRHSLARTALMANALLLLGEDTRVGAEQLALTLSARPSADRVLREQLEE
FT                   LVIALDPDAAILARKDFAERHQNVVIGDDAHGHASIDATVPAEHGVYLTRRIADLIARH
FT                   LCADDPRRIGVQRVAALAHLIGLPGGHLACTCGTTTCPATPAPDPTADDDDCADDTPTG
FT                   TDEGNTAEGDTAEGDTASSTQADTDSDAGLDPTATTTSTDVDTATDVDTATDVDTSVDP
FT                   AEAGVHTDSCSDPGSDAPEAPEGPAVEVADTPTACDLGEQTALIVVTDPAGIEVPYLRG
FT                   HGPIDPDHAEDLISNSIAGQLLLPSGYSGLIVTGRDGPAPPIDPTGHGGYDLPPPGAGS
FT                   EASGPIPPGAGSEASGPIPPGAGSEASGPIPPGAGSEASGPIPPGALTYRPSRAVRERV
FT                   ISHDRTCRYPQCGRPSDECQLDHLVKFDPRDPLTGGWSIFENLIPLCTPDHHRKHLGLW
FT                   IPTMHTDRTITWRDPITGEIIITYPR"
FT   gene            301233..301745
FT                   /locus_tag="Gbro_0267"
FT   CDS_pept        301233..301745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0267"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: oan:Oant_2747 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19611"
FT                   /db_xref="GOA:D0LC87"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC87"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACY19611.1"
FT                   /translation="MSRPDPDQSRDPAVEPRHEDFATRHAPTPIELPLDDGEASTNVDL
FT                   KTQMIRFIITGAGSGVLDFGLTILLQYVVGADFWIAKSFGFILGTTTAYLLNRRWTFEA
FT                   PPSTVRFLAVVALYAVTFFVNVGLYTVLSHAWPVTLIYSFIAYVIAQGTATVINFVVQR
FT                   LVIFRIR"
FT   gene            301756..303156
FT                   /locus_tag="Gbro_0268"
FT   CDS_pept        301756..303156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0268"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   acp:A2cp1_0251 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19612"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC88"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACY19612.1"
FT                   /translation="MTSAVVVGSGPNGLTAAVTLARAGLSVEVIEMADVIGGGTRSSEL
FT                   LRPGIIHDHCAAFHPLGAGSPAWRGLDLRWRWPEIDCAHPLDDGRAALLFRSVSATAAG
FT                   LGRDGDVWRDVIGSVATDFDDLADDILGPLLHLPRHPMRLAEFAHHALYPATMLARVFG
FT                   SEDTRALFAGVAAHAFTRLDKPGSSSAGLMLLAAGHRHGWPVAEGGSASIATALATALI
FT                   DAGGSISTGRRVTDLAELDSPDVVALDVMPGAAAAILGDRLSASRFRRLTRYRHGPAAF
FT                   KVDYLIDGEVGWLNPDCARAGTVHLGGTSSEIAVAERDVVAGRMPERPFVLVGQQWVAD
FT                   PTRTPGSLKPLWAYAHVPHGYPHDATDVVTAQIERFAPGFRDRIVDSVSTGPADLQHAN
FT                   PNYVGGDIGGGRNDLRHLIARPRLSANPYATGVPGVYLCSSATPPGGGVHGMCGYRAAQ
FT                   AALRDLDR"
FT   gene            complement(303172..305775)
FT                   /locus_tag="Gbro_0269"
FT   CDS_pept        complement(303172..305775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0269"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; binding-protein-
FT                   dependent transport systems inner membrane component;
FT                   SMART: AAA ATPase; KEGG: oan:Oant_2473 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19613"
FT                   /db_xref="GOA:D0LC89"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC89"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY19613.1"
FT                   /translation="MTTSAPQPAAGAGSPDTDSAWRLLLRNRASVFGMVVIAIVIICAV
FT                   AGPLIAPFGANEIDVPNALRSPSWGHLFGTDDLGRDVFSRVVLAASVSMRVAVVAVAIS
FT                   LLVGVILGMVAGFAGGVLDTVLMRIVDVVFSFPVMLLALAIVAILGPGVTSAMIAIGIV
FT                   YIPIFARVARADTLRVRQTQYVLAARTMGVPTWRTLVSHVLPNISGPVIVQTSISLAFA
FT                   ILSEAALSFLGLGVQPPDPSWGRMLYDAQGFITTAWWMGVFPGLAILFTVFAFNLIGDG
FT                   VRDVLDPRQRTLLRNRGKVRRPVVKAPGAGVRDGDERPVDGTPVLTVRDLTVGVGPREI
FT                   VHGISFSVTAGQTLGIVGESGSGKSLSVLSATGLFNAPSAYVEGSARIGATEVIGASAS
FT                   TLRALHGARVGFVFQDPSSSLNPLLTIEDQLTEGPRRHLGLSRAAARERALTLLRDVHL
FT                   PDPEARLRAYPHQLSGGQRQRVMIAVALACDPDILVADEATTALDVTTQAQIIALVAEL
FT                   QRERGMAVVWISHDLGVIGRIADDVMVMREGRVVETGSVTDIFGNPQDEYTRRLLDARL
FT                   LLSEVSERAPEAPDARAKQAPLVKVRGLGVDYTVRGATGRDTVHAITDVDLDVLRGTTL
FT                   GIVGESGSGKSTVAGVLTGLIESGHGTAVRGSAEVTVDGRTIDAVGVRGADAAVLRRRL
FT                   AMVFQDPAASLDPRMTAGRSVAEPLRTHRLASGRDEMRSRAEQLMDDVSLDRSFLDRYP
FT                   HEMSGGQRQRVCLARALASDPEVLILDESTASLDVSVQANVLDLLAELQREKGLTYLFI
FT                   AHDLAVVEQISDTVAVMQNGRVVESGPAVDILHNPETDYTRMLLDAIPPETPSRA"
FT   gene            complement(305772..306737)
FT                   /locus_tag="Gbro_0270"
FT   CDS_pept        complement(305772..306737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0270"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: noc:Noc_2185 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19614"
FT                   /db_xref="GOA:D0LC90"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC90"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY19614.1"
FT                   /translation="MTLLRSPLLRFIAIRLLYTVAVLLGVMVAVFFLIQIVPGDPVRIA
FT                   LGTRYTPESYAALRSASGLDQPLFTQLVNYIGHAFTGDLGVSFRNGESVTTMLLDRLPA
FT                   TISLALTSIVVALVIAVPLGSWAALREGRPADNVIRVVSQFGISVPDFWMGILLIGLFS
FT                   TALGWLPSAGYSPLLDGLGGWLEHIVLPAITVGIVTGAIMTRYVRSSVLEVVNAPYVTT
FT                   AESKGLSRSRILLSHVGRNALVPVLTISGIQFATLLGGVIVVEVVFAWPGLGLLVYDSV
FT                   AARDYPVLQGAILLIAIIFLIVNLVVDICYAVIDPRIRLS"
FT   gene            complement(306744..308294)
FT                   /locus_tag="Gbro_0271"
FT   CDS_pept        complement(306744..308294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0271"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: oan:Oant_2957 4-phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19615"
FT                   /db_xref="GOA:D0LC91"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC91"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACY19615.1"
FT                   /translation="MTGSPLSRRSFLSLAGAGGIALAGGGLLSACGSGSSAGNTIRAAI
FT                   AGEPDQLDPHKSSSYFTFQVLENVFDTLVEPDEQLTMRPALAESWTVSPDDLVWTFTLR
FT                   PGLAFHNGDPCTAADVVYSYRRIIDEELSNAWKLESIDQITALDDRRVRLTVKHPTPNL
FT                   LTNIGGFKGLAIVNRRNVESGEIATRPVGTGPFSFVSRSPGASIVITSNPRYWGGAPAV
FT                   DGVTFSFISQGTTAVSALRSGEIDWTDAMPAQQLSILKGDDSLRVGTVVANDYWYMTMN
FT                   FKRKPFADNRIRQAVAYAIDRDSVAQVVGYGTAKPNQLAIPSTSPWFIGYDRYTAGLDR
FT                   AAATERSKTLLREAGTTSLDMGLMVTTEYPETVTAAQVIASNLDDVGISVTIETLDFGA
FT                   WLDRQSQGDFDALMLGWLGNLDPDDYYYAQHYSSGESNAQKYSNPEVDRLLDAGRTELD
FT                   MARRKQIYGDAATRIADDVSYLYLYNPSANQAYTTALVGYTVRSDKAVRFRTARLDRG"
FT   sig_peptide     complement(308181..308294)
FT                   /locus_tag="Gbro_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.514 at
FT                   residue 38"
FT   gene            complement(308411..309289)
FT                   /locus_tag="Gbro_0272"
FT   CDS_pept        complement(308411..309289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0272"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: mlo:mlr5218 sulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19616"
FT                   /db_xref="GOA:D0LC92"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC92"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ACY19616.1"
FT                   /translation="MRFTFAEAMTDPSYYAPLAQAAEKAGYAGFTIPDSLAYPYESDAT
FT                   YPYTPDGNREFLDGKAFIETFIQAAALGAVTSTIRFTPFVLKLPVRPPALVAKQASSVA
FT                   YLTNNRLALGVGTSPWPEDYDFMGVDFRRRGKRMDECMDIIRGLTTGEYFEFHGEFYDI
FT                   PKIKMTPAPTEPIPLLVGGHADAALRRAVVRGDGWMHGGGPAEELDVLLEKIADIRKAE
FT                   GTTNDPFEIHVISLDAYSVDGCKRLEDKGITDVIVGFRMPYIKGVDTEPLQKKFDHLNW
FT                   YADNVIAKVNT"
FT   gene            309471..309908
FT                   /locus_tag="Gbro_0273"
FT   CDS_pept        309471..309908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19617"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19617.1"
FT                   /translation="MLGSSGRRVTLGAAVVAAALSIAGVAGLGTAHAAVGAPRIVDRSG
FT                   FGSVGNGYGAGCTYVISVPISAKSAKTTVVAGRPGTRAAILYDQTPPAEAAKVTVWWTP
FT                   PAAGRYRIIAGQVAQGGAKISRSILVDVKFGLNTGSSCLAV"
FT   sig_peptide     309471..309572
FT                   /locus_tag="Gbro_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 34"
FT   gene            complement(309914..310387)
FT                   /locus_tag="Gbro_0274"
FT   CDS_pept        complement(309914..310387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0274"
FT                   /product="helix-turn-helix HxlR type"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   bur:Bcep18194_A4724 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19618"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC94"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACY19618.1"
FT                   /translation="MRRASFSDMNCSVAQSLEIVGEWWTLLIIRDAFIGVTRFDAFSER
FT                   LGIARNVLTQRLETLVEHGVFTKEPYQDKPVRYDYRLTEKGRDLWLVLTALRQWGDKWA
FT                   APGGAPVVATHRDCGQVTTLQPVCSECGEPVTRASLALHRGPGARDHGPLPAD"
FT   gene            310442..312037
FT                   /locus_tag="Gbro_0275"
FT   CDS_pept        310442..312037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0275"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_4007 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19619"
FT                   /db_xref="GOA:D0LC95"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC95"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACY19619.1"
FT                   /translation="MTKLMERLDTSAPRRPGVVLVVLSLAAFMASLDVFIVNVAFDQIG
FT                   RDFHGVGLPELSWVLNAYTIVYAALLVPAGRIADRYGRKGAFLAGLALFTVASAACALA
FT                   QGIWWLVAFRVIQAVGAAILTPASLGLVVSTMPVAVRARSVRIWAATGALAAALGPAVG
FT                   GLLVEASWRWVFLVNVPVGIAALIAGALVLTTSADESGTPLPDLLGAGLLAVAIGALTL
FT                   GLVEGPDWGWSDGRVVGAWILAVVAFAGFVVSSGRHRVPVIDPALHRVRSFAFANVTAV
FT                   LFGVPFAGALLANILWLQQVWGYSAIKTGFAVSVGPLMVPIFAAVAHRLSARIPVGAIV
FT                   AGGCALFGLGGVLIAASVGAEPDYAAEILPGWLIGGVGVGLALPSILSAATADLPAHQS
FT                   ATGSAIVNMSRQVGLVLGVSVLVAILGTPVGFENAHSAFQHAWWVLGAVAAAAAVAALG
FT                   MTPPSRESGVGYPPATAAARTAPDAPVRAAASTPENLSGHVAAQGNTTRIGHTPGAAAS
FT                   ADRADSSDIRGCGR"
FT   sig_peptide     310442..310540
FT                   /locus_tag="Gbro_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.539 at
FT                   residue 33"
FT   gene            complement(311859..312764)
FT                   /locus_tag="Gbro_0276"
FT   CDS_pept        complement(311859..312764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0276"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   apl:APL_1469 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19620"
FT                   /db_xref="GOA:D0LC96"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC96"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACY19620.1"
FT                   /translation="MSADRVIAVVVTHRRVELLAESLTVVSGQHRPVDHLIVVDNADEP
FT                   EVAELVAAQPVPTTYLGSQRNLGGAGGFALGMLHALTLGADWVWCADDDGRPDGPEVLG
FT                   TLLDCARRHDLDEVSPVVANIDDPDTLAFPLRRGLVWRRKRSELFSDSETDDLLPGIAS
FT                   LFNGALFSASCLEQVGVPDLRLFFRGDEVDVHRRLVRSGVRFGTCLRAGYLHPDGSAEF
FT                   RPILGGRMHTQYPDNETKRFFTYRNRGYLMSQPGLRRLLPQEYARFGWYFLVQQRDPKG
FT                   FREWMQLRGLGRRERFSRPQ"
FT   gene            complement(312761..313594)
FT                   /locus_tag="Gbro_0277"
FT   CDS_pept        complement(312761..313594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0277"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcm:Bcenmc03_0848 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19621"
FT                   /db_xref="GOA:D0LC97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC97"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY19621.1"
FT                   /translation="MAFTKKDTTRGAPDTRVRVDTWDACVDFPIFDAKTRSLKKAVVGA
FT                   AGGVIGATDSNVIVVEALRDINMHLKHGDRVGLVGHNGAGKSTLLRLLAGIYEPTRGAC
FT                   RVQGRVAPVFDLGVGMDPEISGYENILIRGMFLGMSRKEMLRKIDDIAEFTELGDHLEM
FT                   PLRTYSHGMRVRVALGVVTSIDPEILILDEGIGAVDADFMRKARARLQALVERSGILVF
FT                   ASHSNEFLAQLCDRAMWIDKGQVKMEGGIEEVVGAYEGPAAAAHVRKVLANLDKS"
FT   gene            complement(313601..314467)
FT                   /locus_tag="Gbro_0278"
FT   CDS_pept        complement(313601..314467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0278"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: dda:Dd703_2684
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19622"
FT                   /db_xref="GOA:D0LC98"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC98"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACY19622.1"
FT                   /translation="MSAVVDDDAIPARPQSSDSRTLKRAVKDLRDGLDNRELWLHLGWQ
FT                   DIKQRYRRSVLGPLWITIATGVTAIAMGLLYGELFDQDLHKFLPYVALGFIFWGFIESS
FT                   ILEGSEIFAKNEGLIKQLPAPVSVHVYRVVWRQLIIFAHNVVIIVIIFIVFPPPFGFSQ
FT                   LLVIPALLLFVLNAVWVSIVFGILSTRFRDIGQLLTTVVRLVFFMTPIIWSAQSLSSTK
FT                   AGESSSRLRIVEINPMFHYLEISRGELLGDHVELYHWLIVLGCTAVGWLMAMFVMRNYR
FT                   ARVAYWV"
FT   gene            complement(314519..315067)
FT                   /locus_tag="Gbro_0279"
FT   CDS_pept        complement(314519..315067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0279"
FT                   /product="Protein of unknown function DUF2587"
FT                   /note="PFAM: Protein of unknown function DUF2587"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19623"
FT                   /db_xref="GOA:D0LC99"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D0LC99"
FT                   /inference="protein motif:PFAM:PF10759"
FT                   /protein_id="ACY19623.1"
FT                   /translation="MSDGMTPGPFGGSPTSDDGDKVIIVGGGGDPSAESPDGAEGHGNI
FT                   AEMVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRVRLKEIHESSIRELEDGLAPELREE
FT                   LERLALPFTDEGTPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRQGA
FT                   LPPGMTAGGAHGPSTGQYL"
FT   gene            315145..316341
FT                   /locus_tag="Gbro_0280"
FT   CDS_pept        315145..316341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0280"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="TIGRFAM: cysteine desulfurase family protein; PFAM:
FT                   aminotransferase class V; KEGG: mlo:mlr0102
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19624"
FT                   /db_xref="GOA:D0LCA0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA0"
FT                   /inference="protein motif:TFAM:TIGR01976"
FT                   /protein_id="ACY19624.1"
FT                   /translation="MSFDVASVRGLFPSLGDGWIHFDPQAGMQIPDSVATAVSRGFRQL
FT                   VSTPGDSYPAARDSAEALDGARRAIADLVAADAAGVVLGPSRSSLIHSLAEAVTPNTWL
FT                   RGQVVVSRQDDEPNIVPWLRVVERYGARVRWAEVDVETGELPAWQYPELITGDTEIVAV
FT                   TLASASTGAITDVSEIAPLTRQVGALLVVDATNAAPYLPLDIHELGADVLVVSAERWGG
FT                   PRMAAMAFREPHTIDRLRMVSMNPRAVGPERLELEPHQGALLAGLVASVEHLAGLDADA
FT                   IGKRRRRLVTAMDGVYDYLQRLNFYLTTTLEQLGQVHLVGTGENRIPVLSFTVDGVSAD
FT                   KVVRRLADNGICALGDLPNRALSRMGADDFGGAVTIGLAPYSTPYEVDHLVRTLGSLG"
FT   gene            316366..316929
FT                   /locus_tag="Gbro_0281"
FT   CDS_pept        316366..316929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0281"
FT                   /product="regulatory protein MarR"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: rle:pRL120219 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19625"
FT                   /db_xref="GOA:D0LCA1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACY19625.1"
FT                   /translation="MSVVCRRTDSRLAIVAAKLTTMNVDTEWQRPLTPQEVETWCAFVH
FT                   GGWALYARVTDELTARGLSVSDMRLLESLERTDYRGISELADDVHMRISTVSRQIARLI
FT                   DDGDVEKIRSDGDGRHRLVRLTEKGRETLREHVKVRDTVIRRHVVNVLSEEEFAALGIA
FT                   FRKIGEGVIGNLDGCDGGLSGDGQ"
FT   gene            complement(316912..317865)
FT                   /locus_tag="Gbro_0282"
FT   CDS_pept        complement(316912..317865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0282"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   Os02g0805600; hypothetical protein ; K00344 NADPH2:quinone
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19626"
FT                   /db_xref="GOA:D0LCA2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA2"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACY19626.1"
FT                   /translation="MDSGNLSVQNIDDPVAGVGEVIVDVVAAGVNRADLLQRKGMYPPP
FT                   PGAPDTMGLEVSGRISALGPQVSGWAVGDEVCALLAGGGYAEQVAVPATQLLPVPLGVD
FT                   LVSAAGLPEVACTVVSNLFGTADLRPGELLLIHGGSSGIGTHAIQVAHALEVQVAVTAR
FT                   TQAKLARCAALGADILIDYSTQDFTEVITNSGGADVILDIIGAKYLRPNIDSLRTGGRL
FT                   VIIGMQGGAKAELPIGLLLAKRASVHGTTLRSRPTTGPGGKADIVAQTRRITWPLIDAG
FT                   KVVPIIDTTFSLDDAEAAHAHLDSGDAIGKVLLTVA"
FT   gene            317966..318051
FT                   /locus_tag="Gbro_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            317966..318051
FT                   /locus_tag="Gbro_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(318223..318621)
FT                   /locus_tag="Gbro_0283"
FT   CDS_pept        complement(318223..318621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0283"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: scl:sce5431 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19627"
FT                   /db_xref="GOA:D0LCA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY19627.1"
FT                   /translation="MSVRVLIVDDQALVRAGFRTILDSEPGIEVVGEAADGAAAVAVVE
FT                   TLRPDVVCMDVQMPGMDGLEATRRIVSAHAGEGRPSVLVLTTFNREDYLFQALDAGASG
FT                   FLLKNSTPEQLIEAVQVLARGDALLSPT"
FT   gene            complement(318618..319949)
FT                   /locus_tag="Gbro_0284"
FT   CDS_pept        complement(318618..319949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0284"
FT                   /product="histidine kinase dimerization and phosphoacceptor
FT                   region"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   KEGG: scl:sce5432 putative two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19628"
FT                   /db_xref="GOA:D0LCA4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA4"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACY19628.1"
FT                   /translation="MVTATPPPVIDGVEWVRPAPTAADRRYDAVLAVVLFAGTLASSAL
FT                   YRTTGYGEDAPFWLTVLWSLAMTAPLAFRRRWPEVVAVVLSAAFIAGGIAQIGEALFSN
FT                   ITLFIAIYSVGAWGRSRRRATAVRAVIVAAMFVWLFWGLVIASNAPDLPPSLARETDGP
FT                   LSPYVAFALINVLTNLLYFGGAWYFGDAAAASARSTAALRQRTDELAAERERSREQAVA
FT                   LERLRIARELHDVVAHHVSVIGVQAGAARRVLARDPEQAATSLSAIEESAREAVAELHG
FT                   LLGTLRHGTGDEDAAAGALAVDPAPRGLEDLPGLVEDSIASGVPASLTVIGEPRDASPV
FT                   VQVTAYRLVQEALTNMRKHAGPGASAEVRLRWEPGALEVEVTDTGVAAARAEANGVPGS
FT                   GGLGLIGMRDRVSAVGGALEVGPRRRGGFLVRAGLPLRRTGEAS"
FT   gene            complement(320009..320575)
FT                   /locus_tag="Gbro_0285"
FT   CDS_pept        complement(320009..320575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0285"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rhi:NGR_c26600 bifunctional deaminase-
FT                   reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19629"
FT                   /db_xref="GOA:D0LCA5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA5"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACY19629.1"
FT                   /translation="MGRLIVEQIVSVDGFATDADGGISFFEAIEDFNATDADQLEMLEG
FT                   VEAMLLGRITYEMFAAYWPTADPAIEPVATPIARLAKHVVSNTLTDAPWGDDAPARIHR
FT                   GDGVAAARALSDSLDGGVIVWGSLTLADGLLRAGAVDELRLRIVPVLIGAGRTFTPPDL
FT                   GVRRLALDHAVTHPSGHVGLHYRLR"
FT   gene            complement(320575..321036)
FT                   /locus_tag="Gbro_0286"
FT   CDS_pept        complement(320575..321036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0286"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: sme:SM_b20607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19630"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA6"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACY19630.1"
FT                   /translation="MTERTATAQFTITRIFDAPRELVWRAWTETADAAEWWHPRDVWIK
FT                   AGTVSVDARAGGRYAYTMVGPDGREYPTSGVYREVTPPERLVFTWGSPGDADDEAPLIT
FT                   VTLRELDGHRTEMLFHLVGIDAAPGDEDVYDGWNSAFDLLGEHLDAAER"
FT   gene            complement(321033..321371)
FT                   /locus_tag="Gbro_0287"
FT   CDS_pept        complement(321033..321371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0287"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: mes:Meso_2191 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19631"
FT                   /db_xref="GOA:D0LCA7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACY19631.1"
FT                   /translation="MGGATDGLSLVFQALADPTRRAMLSRLAAGPATVGELAEPFAMSR
FT                   PAISQHLNVLERAGLIERTAHAQWRTCTLRTEPLDDASEWVERHRGEWNERFDLLDEHL
FT                   RRLKGESS"
FT   gene            321481..322023
FT                   /locus_tag="Gbro_0288"
FT   CDS_pept        321481..322023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0288"
FT                   /product="MGC79660 protein-like protein"
FT                   /note="KEGG: similar to MGC79660 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19632"
FT                   /db_xref="GOA:D0LCA8"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA8"
FT                   /inference="similar to AA sequence:KEGG:100230032"
FT                   /protein_id="ACY19632.1"
FT                   /translation="MTATAAPASTPGPDASAPNLRLRERPFDWFFIVVFSLFTVTSMIS
FT                   DMLPTLGVDFSEPSPNFLVNANWWYAHDTDPLFMHPPVWMRIVTGLSAFVYPVFYVLLV
FT                   ISLVRGWNWIQLPSVIYATMIASITGVIVFGVEFFGEPEWVTPNPAKFLAFNLPYVLIP
FT                   ILLLIRMRGPMPFTRRF"
FT   gene            complement(322161..322843)
FT                   /pseudo
FT                   /locus_tag="Gbro_0289"
FT   gene            complement(322833..323093)
FT                   /pseudo
FT                   /locus_tag="Gbro_0290"
FT   gene            323250..324464
FT                   /locus_tag="Gbro_0291"
FT   CDS_pept        323250..324464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0291"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1;
FT                   General substrate transporter; KEGG: psb:Psyr_0657 Bcr/CflA
FT                   subfamily drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19633"
FT                   /db_xref="GOA:D0LCA9"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCA9"
FT                   /inference="protein motif:TFAM:TIGR00710"
FT                   /protein_id="ACY19633.1"
FT                   /translation="MTTREGLGPRLLFALALLSATAPIATDLYLPSFLEVKDALHTDAT
FT                   QVQLTLTAFLVGVAVGQVVWGPVSDRFGRRSPLLVGSVAAVLAGIVVVAAPTIEVLIAA
FT                   RFVQAFAAAAGMVIARAIIADLLRGFAGARSMTLMMTIQSLAPVIAPIIGGVLAGHVSW
FT                   RGVLGVILGATVLQLVFAVTSVPDTLPVERRTRRVGFGDLLGRFGRPAFLAYVLTQAFA
FT                   FGALMAYVSSSSFVYQRVLGASTVIYGLAFAVNALGMTAAGLVAARLSRRHVHPATTIG
FT                   VALPVLVVASAGVLVAAVSSTKILLVVPLFIATTSVGFVMGNSAALAMEHTRDAAGAGS
FT                   AVLGGLMFLIGGALSPLGGLAGDDTAVPMGIVMCSSAVLALACFVVARRSVARNPESEA
FT                   AFRRP"
FT   sig_peptide     323250..323327
FT                   /locus_tag="Gbro_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.908 at
FT                   residue 26"
FT   gene            324511..325083
FT                   /locus_tag="Gbro_0292"
FT   CDS_pept        324511..325083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0292"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: ade:Adeh_0932 YceI"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19634"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB0"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACY19634.1"
FT                   /translation="MSVETFTADDGELLIHTGVTGPAARTGHRLTIAVRAWTATVTVDD
FT                   GTPTAVAATIVVDSLDVTAGTGGLTPMTGPERAMARSNALKSLKAKKFPEITFAASDVA
FT                   ESAGGYRLTGMLTIAGTTREQIVDIATDESHLTFDVALTQSDFGVKPYSLAMGTLKVAD
FT                   EVRLTLDVTRTHPRPPAAGQATERSLS"
FT   gene            325080..325817
FT                   /locus_tag="Gbro_0293"
FT   CDS_pept        325080..325817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0293"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: abo:ABO_1618
FT                   dienelactone hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19635"
FT                   /db_xref="GOA:D0LCB1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB1"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ACY19635.1"
FT                   /translation="MTSSVTVERITIDAEPDSFDALIARPAEPSGPRPSVLLVHDATGD
FT                   EVDTERNLRIVAGQGYLALAPLLFTTGPNKLGCIVSAMRSLAVGHGPAFAILERARVTL
FT                   ADDAQSTGDVAIVGFCMGGGFALLEGDARYVAAAPFYGSLTSYRRVRADTCPVVASFGQ
FT                   RDPLLPFGERRLRRVLDKHGITSDIKTYPGVGHSFANQIDAVPDRVLRIAGMHYDADVS
FT                   ADAWGRVFAFFAARFAEHDEHRA"
FT   gene            complement(325814..326122)
FT                   /locus_tag="Gbro_0294"
FT   CDS_pept        complement(325814..326122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19636"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19636.1"
FT                   /translation="MDSALEVTVTANFVNAWFLLVATTPAVVVDEAVHRLAWSQPTRVA
FT                   VEPGSHEVAVGIRYRGFSAILGKAPETVTVQPGETLRLSARNGPLNRDPFLITILDD"
FT   gene            complement(326205..326816)
FT                   /locus_tag="Gbro_0295"
FT   CDS_pept        complement(326205..326816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19637"
FT                   /db_xref="GOA:D0LCB3"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19637.1"
FT                   /translation="MPPYGPPPRRRSTALIVGVICAIITVVCVTATLLVAFWPDDEPTG
FT                   ETLRLAENVTITVDVPSGWKTVRSDSSEYPDRYLLVPRAEQRSYTKIDSDSADLTDDGV
FT                   TIEPISVVEFFALECSDIKSSELKNTEDVGAWTVSTESTSRTSVSAERTLAFRRLDDGI
FT                   CFVAHGLSAAQQKSQLSDKPDSFVRRITNGGIVSDVRQKQ"
FT   sig_peptide     complement(326706..326816)
FT                   /locus_tag="Gbro_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.370 at
FT                   residue 37"
FT   gene            complement(327135..328607)
FT                   /locus_tag="Gbro_0296"
FT   CDS_pept        complement(327135..328607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19638"
FT                   /db_xref="GOA:D0LCB4"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19638.1"
FT                   /translation="MLSSSRIRVIGAIAAVVAVLIALQIYASTQATLGPLESLWNDYAG
FT                   TPKSMTLPWAGLLLTMVGLPWRRRFLALGAALTIDALYAAPRFLLTGTIAVGNGPIIVL
FT                   TGIVVLACMRWTGVERRNALYAAALGALLILATKVGDIWLGVTIHTQPMVLDEYVMLAD
FT                   HALGQPSWHVGRLLEVLGPQAVWVLHWVYIELPAAAAVVAVWQLRRVVTSGRWPDHFLV
FT                   RTFLVLGLVGPLFYVLFPVVGPMFAFGPDGGGAQLGNFWPTLLPPTDLIPGPMFFDGGP
FT                   PRNCMPSMHTAWALAVFLHTRRDVDGGPAPRWLRIVGSFWLICTLAATLGFGYHYGADL
FT                   VAGAVLCLTVDSALRDPARGWGWFRIRLVAGGGVLFGALLVAYRYLAVPMAEYPVYAGL
FT                   LVLGSLAALSLTFYTTWFAPQRVLAPMATTRVTPAGAVRGQLAVRRTNLLACLDIPWIA
FT                   RIRARLDAPGRTEVNPLTTRVSPGVDTRPEDN"
FT   sig_peptide     complement(328524..328607)
FT                   /locus_tag="Gbro_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.984 at
FT                   residue 28"
FT   gene            complement(328783..329847)
FT                   /locus_tag="Gbro_0297"
FT   CDS_pept        complement(328783..329847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0297"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: mms:mma_0084 Mg2+/Co2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19639"
FT                   /db_xref="GOA:D0LCB5"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB5"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACY19639.1"
FT                   /translation="MGDEQSNDEHIRGQIWRDGERVDGFDIAKISDCLDEKNTLIWADL
FT                   ECPSHDTLAQLAAELDLDPFAVEDTTAAVERVKTVTYTGHTFMMVYAITMNDDEPQDDS
FT                   DSPPPAPRRSSETVRQRSDRFDLHRISIFVKANALITVRRNAGFDIDEVVHRWNDIGGE
FT                   KHGIGALLHGLLDVVVDGHFDAVQRLDDDIEDLEGLLFDEKVAGRTLQRRTYELRKDLV
FT                   SLRRIVLPMREVIAGIQRRRFENHAPPELDPHFSDLYDHALRAAEWTESLRDMITTVFE
FT                   TNLSLADARLNTVMKKLTGWAAIIAVPTAITGFYGQNVPFPGFSHTLGFVTSSVLIVVA
FT                   VTALYATFRRKDWL"
FT   gene            329948..331078
FT                   /locus_tag="Gbro_0298"
FT   CDS_pept        329948..331078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0298"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: pfs:PFLU5899
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19640"
FT                   /db_xref="GOA:D0LCB6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB6"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACY19640.1"
FT                   /translation="MAAGEGSRRIAPLTGIRTIAALAVCLTHAAFWTGNYTDDAVGRLF
FT                   ARFEIGVAIFFVLSGYLLFRPWVRATEGSPTPGIGRYFWHRARRILPAYWITVTAVYLL
FT                   YAIAPPGGASTTGTGAVGYLRNMTLTQVYGLGHLHSGLTQMWSLAAEVVFYLVLPLIGW
FT                   VLVVLVCRRRRRPDLLIVGLVTVMLISPVWSVVVAGSDGVDPTARLWAPAFIGWFAGGM
FT                   LLAVCVPYLRRWPAMWSLGVALVAFGASVADIAGEPTITPTTASATVVKHLLYLIVAVA
FT                   LIGPLTIPGADDVWARLCGSRPMVFLGEISYEFFLVHVVVLEVMMVALGYQVFTGSWVV
FT                   AFLVTTAVSTPIAWLLHRGTASLWRARTPGHVAARG"
FT   gene            331113..332345
FT                   /locus_tag="Gbro_0299"
FT   CDS_pept        331113..332345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19641"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19641.1"
FT                   /translation="MVENRYPGRPARARTTKEIREWCDAAQMPGERPDLSDIAALLIAS
FT                   GFLTPGGRAILVRRISTGLPVPTLPAGYGDLRRLQRGITQLENQLASPVLPGVVGAVVR
FT                   NRLNGLVRRREDAHKTVVTAKGVFAGGTRAIRRERRENVYLEIEERERLFSGLLCTPSP
FT                   NVNASSYMRRAGSAAIDRIAGMVSQVAAKSGNPQAEQWAGQVLGGGREQPPATAPRMAG
FT                   FVDGYETILYIAGHYYDRIVRNPAWRSDHFEVQRTQVNLHAELAEIAADVIALRAVRID
FT                   LDRAKRNGGFDKSFAEQIDRRETVLRPVWTELIERVQALAEVAHVVESAAVELRILAEY
FT                   NKALTIDDRIDDLIARSGDREMSVDNSKRLTEQVRSGEEQLRIYRDVLQGNIARISPAA
FT                   TRELPARYEPS"
FT   gene            complement(332330..332767)
FT                   /locus_tag="Gbro_0300"
FT   CDS_pept        complement(332330..332767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0300"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pfs:PFLU3197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19642"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACY19642.1"
FT                   /translation="MGDDGFAYTAQVEVRWSDMDAFGHINHARVVTLMEEARIQWLLSA
FT                   GEEYAPLIKSAMIVHVEIRYQSQLRHEDSPLRIAMWIKGFRSVDFTIGYEIRGADAEPG
FT                   SRPACVASTQMAVVDVEAHKLRRLTATEKVYLRSWGRQDGS"
FT   gene            332978..333955
FT                   /locus_tag="Gbro_0301"
FT   CDS_pept        332978..333955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0301"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: mxa:MXAN_4935
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19643"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCB9"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ACY19643.1"
FT                   /translation="MARRWIAVVAVLVATLVAAPALAHAAPLSARISKTVKLSPLRTDI
FT                   WVYSPAMNERIKLSVLTPAGASGPRPTVYMLDGAGAEGDVSDWITKGRAGRFFAGKNVN
FT                   VVLPTGGKGSFYTDWQKRDPTLGKPMWETFLTKELPTLIDRRFDGSGRNAVIGLSMGGQ
FT                   AAFALAIRHPSLYSGLASLSGCPPVSGPANEAYVRTTVGRDGGDATNMWGPFGSAGWRA
FT                   HDPSLHLDALRGKSIFISAGSGAVGPLDLQRKVDPDEGPREAVTASSSALELGAYRCSL
FT                   EFAVTMRAHGVHYTDGFRLIGTHTWAYWEQDLPVAWQTVSRGLY"
FT   sig_peptide     332978..333055
FT                   /locus_tag="Gbro_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.743 at
FT                   residue 26"
FT   gene            complement(333966..335033)
FT                   /locus_tag="Gbro_0302"
FT   CDS_pept        complement(333966..335033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0302"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG:
FT                   afw:Anae109_2310 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19644"
FT                   /db_xref="GOA:D0LCC0"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC0"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACY19644.1"
FT                   /translation="MTFRIRPDLDDLPVYVPGKTFPGAVKLASNEVTQGPLPSVLDAIG
FT                   AAAASVNRYPDNGMVDLTAALAKQLGVTEDEVQVGCGSVILCQNLILITSGPGDEVVFG
FT                   WRSFETYPLATRVAGATPVQVPLTGEATYDLRAMAAAVTDRTRLIFVCNPNNPTGTVVE
FT                   AEELRTFLRSVPSDIIVALDEAYFEYMRLPSSQHYDALELRREFPNLVVLRTFSKAYGL
FT                   AGLRVGYAVGAPEVITALGKVHVPFSVNSVAQQAALASLAAGDELLTRTDAVVGERSRV
FT                   ADRLRAAGYRVPDSQANFVWLELGADSVEFATAAVEAGVVVRPFAGDGVRVTITESGEN
FT                   DVFLAFAENWAGKSQ"
FT   gene            335164..335252
FT                   /locus_tag="Gbro_R0005"
FT                   /note="tRNA-Ser2"
FT   tRNA            335164..335252
FT                   /locus_tag="Gbro_R0005"
FT                   /product="tRNA-Ser"
FT   gene            335295..335367
FT                   /locus_tag="Gbro_R0006"
FT                   /note="tRNA-Arg1"
FT   tRNA            335295..335367
FT                   /locus_tag="Gbro_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(335458..336042)
FT                   /locus_tag="Gbro_0303"
FT   CDS_pept        complement(335458..336042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19645"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19645.1"
FT                   /translation="MTPTFDNLAILIPPPTDGVTVAVDWASTADRLGFTPPEDYRQIVS
FT                   AYGPGLFCGDISVWIPDADATEHEDLFNCIPDAHDTLEEWREHFTRDATQWVDPDGVRQ
FT                   PVVLGDPRIPFTAWGGSSSGAYCYWYRVDDDPNKWPVVSADLRDDVYLFHRGGMAAFII
FT                   AYVTGQYEAVAEIVAEADLSFDRWDAVGHGG"
FT   gene            336203..336973
FT                   /locus_tag="Gbro_0304"
FT   CDS_pept        336203..336973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0304"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: asu:Asuc_0408 aquaporin Z"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19646"
FT                   /db_xref="GOA:D0LCC2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC2"
FT                   /inference="protein motif:TFAM:TIGR00861"
FT                   /protein_id="ACY19646.1"
FT                   /translation="MVPAPVAKVAAELFGTFWLVFGGCGSAIFAAKQVAELKGEDDAMF
FT                   GINVGIGYLGVALAFGLTVVTMAYAVGHISGGHFNPAVSLGAAIGGRLPWKDVPGYWIA
FT                   QVVGGLIAGLALWAIASGQPDFERTGSMVANGYGDHSPNHYTLAAVLVAEILLTGFFII
FT                   IILGATDSRAPVGLAPLAIGLSLTLIHLISIPISNTSVNPARSTGVAFFNGDGAPAQLW
FT                   AFWVAPLVGAAIGALIYRAFLAAEGTAETESELA"
FT   gene            337314..339008
FT                   /locus_tag="Gbro_0305"
FT   CDS_pept        337314..339008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0305"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: rpb:RPB_0519
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19647"
FT                   /db_xref="GOA:D0LCC3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC3"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACY19647.1"
FT                   /translation="MELLILVLVGAIIVTAVADRRGMQPALIIVVIALGVSFIPGLPQV
FT                   ELDSEVLLTVVLPPLLYSAALGFSFPNFLRNIKPILGLGVAMVVITAFAVGLIASLLIP
FT                   EFTFLLALLLGAIVAPPDAVTAVAIGRKLGLPKRLMAILTGESLVNDAAALSLFAIAIS
FT                   QIANTHAFIENPLLLFGYNAVLGPIVGLVLGLLTLWIRGHLRNPALETVQGFVVPFAAF
FT                   LAAEHLHASGVLAVVIAGFVVGSGSVHAGYQTRLQERYVWNSVDVLLEAFVFAYIGLQL
FT                   RFIIEDLREARESLVQIGIASILVLAVVLAIRPVCVFAMFGRGVVGRRIENTMSLQIQA
FT                   NPRRAAAAQSRTPRPKRLAGLRERIDNRPLTWQESVVVAWTGMRGVVTLAAASGIPPTL
FT                   STGEPFPERSAIQAIAFVVAVGTILIQGPTLPWLISRLHLRNEDEERYDVEQTERAERI
FT                   VQIAAQIVIADFVAKPPPGLDDATVAHIKDTVARQSRDADEMPDPDAHTARADAFAALY
FT                   RDVLSAQRESLVENRDAGAVEDEAVRAMLERLDLQEAGLSARLESRF"
FT   gene            339090..339884
FT                   /locus_tag="Gbro_0306"
FT   CDS_pept        339090..339884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to trefoil factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19648"
FT                   /db_xref="GOA:D0LCC4"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19648.1"
FT                   /translation="MGQPGQPRPPEPAGGARPGGSRSGPEEYRGTLRQLYPPLGFAPDG
FT                   TPLFWPGQQTPHPGARRPDDSGRQAPDQDRTTASADDDSPPAPQSRPRRTTDTVPTVRS
FT                   MAITAAALAAAVILVVLVAIAFMRAGPDQDSTTAADLPTFTTETFTRIPTTGPRLTPSR
FT                   PDRSTPRSPAGIDPAGKQITYQVTIEGTATILYVDAAGLRTEFAPPATWKYTFTGSYNP
FT                   LRLIVVVGSGSTATCTITVDGQAVVNDEVGPASAKRSASCIA"
FT   gene            340023..340577
FT                   /locus_tag="Gbro_0307"
FT   CDS_pept        340023..340577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0307"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   pap:PSPA7_3300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19649"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC5"
FT                   /inference="protein motif:PFAM:PF06475"
FT                   /protein_id="ACY19649.1"
FT                   /translation="MLTWRGEGTDRLEQVRLHVNGTRIKAYGRIIAAATDDHEAFSASY
FT                   ELVTNDSGVTKRLSIHLVRASGETQFAINRDEEQHWLVHAPGGESIRSDFNGAMDVDLA
FT                   LSPMFNALPIRRLGLAAGSGEATEVPVVYVYLPQGVVEPGTLTYTPKPDGLGVVSPVAN
FT                   STLTIDDNGFVVDYPGLATRV"
FT   gene            complement(340591..341568)
FT                   /locus_tag="Gbro_0308"
FT   CDS_pept        complement(340591..341568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0308"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: bph:Bphy_0743
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19650"
FT                   /db_xref="GOA:D0LCC6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC6"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACY19650.1"
FT                   /translation="MWESVEVTDPTSALPPVCVLGLGLIGGSLLRVLHDAGHDAFGYNR
FT                   STQTAQDAVGDGYSASSDLDETLRRAADVDALVVLATPVTTIEPLVARVAELAPTVLLT
FT                   DVISVKQEVTEIVRRVHPGGRYVGGHPMAGTSRSGWAATDPTLFGGAMWMVTTEDTTPA
FT                   DDWLTVATMARAAGASVVPAAPDAHDRAVAAISHLPHLTAAATAAVGAAESGLALRLAA
FT                   GSFRDGTRVAGSAPALQRAMVEANRIAVLNVLSETIDRLIAARDDLRDKGNVEILIDDG
FT                   HRARRAYEAMAESDVQPITGVTVGAEGWQSELRRQAHAGRVWVG"
FT   gene            341628..342167
FT                   /locus_tag="Gbro_0309"
FT   CDS_pept        341628..342167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19651"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19651.1"
FT                   /translation="MAGAGAQKTGSNTQDDDDIDGFAVAVVREDGAWKVTAMKPGALSD
FT                   LSDAERQLRDLRSAGAVFGLLDVDDEFFIVIRPAPSGAHLLLSDATAAVDYDIAADALD
FT                   ALNIDVPDLDPDELDDIDPWEEGDLAVLADLGLPDAVMSIIVNDTDLYADEQIGMIAAR
FT                   LGFADELSKVLDSLGH"
FT   gene            342196..342627
FT                   /locus_tag="Gbro_0310"
FT   CDS_pept        342196..342627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0310"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   scl:sce2586 putative zinc-binding hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19652"
FT                   /db_xref="GOA:D0LCC8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC8"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACY19652.1"
FT                   /translation="MASALDAAADAGDDDVPIGAVVFDPGGIELARAANRREADADPTA
FT                   HAEILALRAAAAAFGDGWRLPGCTIAVTVEPCTMCAGAITLARIDTLLFGAWEPKTGAV
FT                   GSLWDVVRDPRLTHRPQVRGGIFEDRCRELMIDFFQQQR"
FT   gene            342731..343000
FT                   /locus_tag="Gbro_0311"
FT   CDS_pept        342731..343000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0311"
FT                   /product="protein O-D-mannosyltransferase-like protein"
FT                   /note="KEGG: similar to protein O-D-mannosyltransferase;
FT                   K00728 dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19653"
FT                   /db_xref="GOA:D0LCC9"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCC9"
FT                   /inference="similar to AA sequence:KEGG:NCU01912"
FT                   /protein_id="ACY19653.1"
FT                   /translation="MNQPADKISAAVDTAVEKITEFAESGKVQEALGTVRDKVNELAEN
FT                   EKVQEAISTAKDKIGEVASNEKVQEVITVAKEKVGEVTDKLGGK"
FT   gene            343174..343383
FT                   /locus_tag="Gbro_0312"
FT   CDS_pept        343174..343383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0312"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: mpt:Mpe_A3663
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19654"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD0"
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /protein_id="ACY19654.1"
FT                   /translation="MAISDDAKNKAEELKGRGKEAAGSLTDDQDLKNEGKADKGAAQGK
FT                   QKVADAAEKVKDKVDDVKNKLTGN"
FT   gene            343450..343540
FT                   /locus_tag="Gbro_R0007"
FT                   /note="tRNA-Ser3"
FT   tRNA            343450..343540
FT                   /locus_tag="Gbro_R0007"
FT                   /product="tRNA-Ser"
FT   gene            complement(343606..344670)
FT                   /locus_tag="Gbro_0313"
FT   CDS_pept        complement(343606..344670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0313"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   pna:Pnap_4871 HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19655"
FT                   /db_xref="GOA:D0LCD1"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD1"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ACY19655.1"
FT                   /translation="MSPSDPLTLGQQLVAVLEGGRRTATYKLAVMVALLDLAVESVPDD
FT                   PDAAVAIDLDDLAHRVMDLYWRQLRPLDGQVLRQSTDGRGVIFAAVSRLRDAVASSTLR
FT                   ETPIETAAARAPETYAAELLVVKRNLVRYPLDLLQRVGGEHHPFLYDDSWLGTDSVSRI
FT                   LAHGNRIELFGGVCFTLARLAPLVKPAFQLAWVDDVRRMNATLLDDGPDLAHHLFGADR
FT                   ISLERPGSALAEAFGRECFYCAKHLTAHQVDHVLPWSRVGLDGLTNLVLACASCNSNKS
FT                   DLLPDPAHITRALGRGRSTLDALAETISWPSQYERVVSAAHGLYATQPTTTPIWRAARH
FT                   VEALSRVDITWPLR"
FT   gene            344894..345208
FT                   /locus_tag="Gbro_0314"
FT   CDS_pept        344894..345208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19656"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19656.1"
FT                   /translation="MIGAVALATSAIGTAALGTGEAHATTPVIGKSCSYAEKSNLRYTA
FT                   SGTPTVCANVGNRYARVRSGRVDPKVRVPGSHCTGGYPVARTPQGKAVLCADGRWVSQG
FT                   "
FT   sig_peptide     344894..344968
FT                   /locus_tag="Gbro_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.914 at
FT                   residue 25"
FT   gene            complement(345199..346335)
FT                   /locus_tag="Gbro_0315"
FT   CDS_pept        complement(345199..346335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0315"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG:
FT                   dda:Dd703_2395 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19657"
FT                   /db_xref="GOA:D0LCD3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD3"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACY19657.1"
FT                   /translation="MVISRVRLLIVSLLAVVAVVAPLGGTATAAPVAAPSRFSTAELVG
FT                   PYPSDIPPGGTYIPLLDGFADLRAHRPDIIAQNLRIVQRTNNSATPALREDAIDINYDD
FT                   RLESLSMALGARLGATFRRLLAGGQLPKVAALLKGETGRVSLPLGTTLLEKEYFNNPRP
FT                   FVVAPNSIRRYDRPGGRLYDQLRNNGSYPSGHSAQGYWKGALLAYWLPELGPQLIARAG
FT                   EIGRSRMVLGVHYPLDVMSGRLMAMDMVAARLTDPGFARLIGQAGAQLRSQLERAVGMP
FT                   LARFIAGDRAYLSRSEAVSEHRGMMTFGFGRIAPGQRNAIPASAAALLKSRFPSLSDAQ
FT                   RLAILTRTAIPAGYPLDQTGADGGWLRIDLAAALAAQP"
FT   sig_peptide     complement(346246..346335)
FT                   /locus_tag="Gbro_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 30"
FT   gene            complement(346406..347134)
FT                   /locus_tag="Gbro_0316"
FT   CDS_pept        complement(346406..347134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19658"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19658.1"
FT                   /translation="MPSWLHVHRDAPRIELFAPLARRNPSLAYTNQIIAEQRGTHPFIT
FT                   LETRGIHVNARLVLESAVFHARNLESALANWRVFLTDEAPGIIALLEGPAEEPTEPREM
FT                   PDELATIVALDPEADSLSDAEVARICGFDAGKILELHDFCMMQCLSWRRHSATSDGPED
FT                   VELSREQLGRWEATSRQIYAALRFLALDEDFDEDDDLDDYDALDEELDEDVEDDPDFGD
FT                   GGLFGRLARREGPDGISAAS"
FT   gene            347353..347736
FT                   /locus_tag="Gbro_0317"
FT   CDS_pept        347353..347736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0317"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bja:blr0519 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19659"
FT                   /db_xref="GOA:D0LCD5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACY19659.1"
FT                   /translation="MIDHLGLQCADPEAAIAFYTRVFTALGVREAMRVVRPEGALLAVG
FT                   GSDGFPKLWFGPLVDHGVRPVHLALTAPSREAVDDVHRAAVEAGAEILHEPRVWPEYHP
FT                   GYYAVFLRDPDGNNVEAVHHTFD"
FT   gene            347747..348358
FT                   /locus_tag="Gbro_0318"
FT   CDS_pept        347747..348358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19660"
FT                   /db_xref="GOA:D0LCD6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19660.1"
FT                   /translation="MNDDEIFAAIADERRTLADQVSTLTDEQWATPSLCVEWTCRDVLA
FT                   HLVVPLVVSIPAFGWAMIKARGNFDRANLITTADVAKRHDDLPKILRDKANKRFTPPGY
FT                   GPAAPLTDIVIHGLDIRRPLGLSAGFAPDIARVVLDFVTDKGGAPIVKRARVRWSATDL
FT                   DWSHGDGPTVEGPAESLMLVLSGRDAGLPELRGDGVAHLG"
FT   gene            348515..348934
FT                   /locus_tag="Gbro_0319"
FT   CDS_pept        348515..348934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19661"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19661.1"
FT                   /translation="MATTRFSIRLGLTTAVAAAVVAGGLVGAGPSAAVVKDLAVSPAMG
FT                   GKYGTGCTYKVTVTAIWGNPTAVIFEDFTENRVLGTSSIVDSKASASWKPQRTGKHLIV
FT                   ARLAAPADGVVGNVASTVVTVAGKGVDLQSVCPVF"
FT   sig_peptide     348515..348616
FT                   /locus_tag="Gbro_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.720 at
FT                   residue 34"
FT   gene            complement(348959..350005)
FT                   /locus_tag="Gbro_0320"
FT   CDS_pept        complement(348959..350005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0320"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: bcj:BCAM1644 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19662"
FT                   /db_xref="GOA:D0LCD8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD8"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACY19662.1"
FT                   /translation="MTVTSADTGRRTLGVDAIIVGVRDETPDARTIMLSWPGDEHYLPG
FT                   QFVTLRIPSDLTGSVARSYSLSTSLGLDAVPAITVKRTVAGYGSNWLCDNAEAGMTIHL
FT                   LPPSGLFTPHDWNRDLHLFAAGSGITPIMSIAKSALAQHDSTVTLFYANRDRTSIIFDD
FT                   QLAALAERYGRRLRIEHWLETERGLPSAQDLLQHCDIAAPDEAFVCGPAPFMDLVENTV
FT                   RDTGIDRHNLHVERYVSLTGDPFTLEALPDTASSTETATVTVELDGVTHRVECSTATRL
FT                   LDAMLAGGVDAPYSCREGDCGSCVARLTSGSVAGGDGIALEPEDAADGYILTCQATPDS
FT                   DEITVDFE"
FT   gene            complement(350002..350420)
FT                   /pseudo
FT                   /locus_tag="Gbro_0321"
FT   gene            complement(350447..351373)
FT                   /pseudo
FT                   /locus_tag="Gbro_0322"
FT   gene            complement(351328..352650)
FT                   /pseudo
FT                   /locus_tag="Gbro_0323"
FT   gene            complement(352668..353720)
FT                   /locus_tag="Gbro_0324"
FT   CDS_pept        complement(352668..353720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0324"
FT                   /product="Molecular chaperone-like protein"
FT                   /note="KEGG: pfl:PFL_5232 chaperone protein HscC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19663"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCD9"
FT                   /inference="protein motif:COG:COG0443"
FT                   /protein_id="ACY19663.1"
FT                   /translation="MSIVVGLHLQSDRVHATICRDHPNTGSAPRVEPFRTFPAALRWRS
FT                   QASPALADHRVDGVYRRFVDRLGDPRAMSVPGGPDRLADQLTAALLTEIVRTIERSLGQ
FT                   HVDRVLIAHPAYWTVPQVHLMYYSLVDTGIDRHRALLLVPDTDAALEWIDHTAGLADAH
FT                   EVTICDLREDSAVIGYARRPHSGHLTTTTAHRFPGLGLHHFDDLLQHRVLAKAQRAGHP
FT                   VPHHPALLAQVRAHCAEVRTTLRGTATRMIVDTPSAGGLEHHGIVLTLDDLYALARPQA
FT                   AGTVRAMARHADPDHVVLIGAAPTFPLLPDTVAARFGCPVVMPDDPELVCARGAALIAA
FT                   MSLRSGVLSQ"
FT   gene            complement(353878..355155)
FT                   /locus_tag="Gbro_0325"
FT   CDS_pept        complement(353878..355155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19664"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19664.1"
FT                   /translation="MTINNFDDAIDESWREFVNDLAMRLGDLTYGGFNFLELGASLPDK
FT                   GFRVFVRFEASKSRGVRCSIPSDLVRTLRTVGTPAELAQEITDRHRRFSEMGWRYLTRK
FT                   HEWVIDAGRKRHRLVVAQVVELLRDLWNIPHPTFLTLRDPRGSVTPFEIPPQPDVEQRR
FT                   HLSAVPDLSIPPAGPQAEPDPTTLAIRVSDCCHLAELVLSWLSATTQRELTMADHGMID
FT                   LPLTDALPTSVFVPQAERRVVFTATVCHRLSDSSALATVVKTYSHLFRGITYIVSSDHV
FT                   YAQLSVDCLVFHPDNMEAALARWRYFVNEIGEAVVRVLNPGGPGAHECAHSTMPVGMQT
FT                   LLDIFARGELSPERAAHLANRKADRLRGYRTFCETMVLDWAGKHRQALAQHAPAEEIDL
FT                   CAEMTADLRRFADLLDNAISLVTRPQ"
FT   gene            complement(355198..355902)
FT                   /locus_tag="Gbro_0326"
FT   CDS_pept        complement(355198..355902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0326"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bgl:bglu_2g05200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19665"
FT                   /db_xref="GOA:D0LCE1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE1"
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /protein_id="ACY19665.1"
FT                   /translation="MLSRFHAAPAERLHAVLMIALTFTTGINDAVGYLGLDKVFTGNMT
FT                   GNVVILGMGVAGGDGLPVLGPALALAGFMAGAGVAGLVLRPATRGWSARTTVLLACVAA
FT                   VMVASAAILFTVGDSPTRGWMITVTTSAATAMGVQAATARVVAVKDVSTVVVTSTITGL
FT                   AADVFGPGPGLGRDAARRFAAIAAILVGAAVGVLLMNVHLGVGLLVAGVIIAVVTVVGA
FT                   LHRPSCQTPSLQ"
FT   gene            complement(355925..356044)
FT                   /locus_tag="Gbro_0327"
FT   CDS_pept        complement(355925..356044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0327"
FT                   /product="acetamidase/formamidase"
FT                   /note="KEGG: abc:ACICU_03577 acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19666"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE2"
FT                   /inference="similar to AA sequence:KEGG:ACICU_03577"
FT                   /protein_id="ACY19666.1"
FT                   /translation="MAPAQAHAYLSAATDFDISQVVDVVKGVHARIWRADFAR"
FT   gene            complement(356086..357708)
FT                   /locus_tag="Gbro_0328"
FT   CDS_pept        complement(356086..357708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0328"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   scl:sce5736 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19667"
FT                   /db_xref="GOA:D0LCE3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE3"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY19667.1"
FT                   /translation="MLSTMQDLPLSVAQILRHGSTFHGTAEVVTWVGGGSRRRSYAEVG
FT                   RRSAQLAHALRGLGIDGDQRVGTFMWNNAEHMEAYLAVPAMGAVLHTLNIRLFPEQLVF
FT                   VANHGEDQIIIVDPTLLPLLNPQLPQLRTVKHVIVNGDSTDGVEAPDGVTVHAYETLLA
FT                   DQPTTFDWPEVDERSAAAMCYTSGTTGDPKGVAYSHRSIYLHSMQICSTEGPALRQGDR
FT                   ALAVVPQFHAMSWGLPYAAFMIGASLIMPDRFLQPEPLAELISAEQPTFAAAVPTIWQG
FT                   LHQYLEAHPQDISCMHDVLIGGSAVPPSLMHAFQDDHDIQVLQGWGMTETSPLGSVSRA
FT                   PADTEGEERWRYRYTQGRFPASVQARLVDDLGDVVPNDGTSIGELEVSGPWITGAYYGV
FT                   DAPEKFHDGWLRTGDVGSITPDGYLTLTDRTKDIIKSGGEWISSVDLENAVMGHPDVIE
FT                   AAVIGIPDAKWDERPLVAVVLREGSDTTPETLREFLSDKVAHWQLPENWTVINEVPKTS
FT                   VGKFDKKRLRSQYHDGGLSVTQF"
FT   gene            357859..358329
FT                   /locus_tag="Gbro_0329"
FT   CDS_pept        357859..358329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19668"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19668.1"
FT                   /translation="MNLRYTTVVVASGVALASGVAAADAGAAPRTVNAADYATPGSPGS
FT                   YRWAYASSPLRECAIYPAQGGRGVTCSVAFPAGTPEVSTLPFFGRPNAVQIVGGQVRNI
FT                   ITEGGPPGARVLPVGHQIVVGSITCTALAGRGIDCQSGKRGFRFERGVLTKR"
FT   sig_peptide     357859..357930
FT                   /locus_tag="Gbro_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.592 at
FT                   residue 24"
FT   gene            complement(358330..360109)
FT                   /pseudo
FT                   /locus_tag="Gbro_0330"
FT   gene            complement(360221..361747)
FT                   /locus_tag="Gbro_0331"
FT   CDS_pept        complement(360221..361747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19669"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19669.1"
FT                   /translation="MRRWVCALATVATAMLVVSGCTVDGQPTASRSEGGPTASVTDSGL
FT                   SYSSDDVAITAAAGVAPSGTTVSVDRTSAAVPGEWARFAAPAAPGVTIVLGTGQQPASP
FT                   ITIDFKQIQRTANTFVITESAGKVELLPYGEGSTLSAQTDHLSSFWPVIFDVERYRQYA
FT                   TEYVANALGITSPAPGCFQRDGLYPDAGGRVSSIAGDVAWPCLSREGSDVKLSLQANSG
FT                   PTWQVSTQPRWQAQYPTTLSIASAIADSVWRQTSNSNALLLPDSTLNLTTDELTDTRVR
FT                   MTVDPVMSQVRTAALAVDIFIPDEIASRLDSAKCIQGLISAGTLDEEASGSGMAAAARC
FT                   IGAVAGGVVASIIGIVTDGGAALWTQLEGAIRTVLSADDVSFEVAEIPADAIGDGSPIP
FT                   VDQVRGMLGTWKGPINQTGSRKYSVLLSLRHDGRTVVGSVEYPELQCNGYLHEAKLISG
FT                   TLHIVETITKNGSCVEVVPLELTLQGDQLHYHFDRGRRHGEGTGILTRQQ"
FT   sig_peptide     complement(361685..361747)
FT                   /locus_tag="Gbro_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.727 at
FT                   residue 21"
FT   gene            complement(361807..362466)
FT                   /locus_tag="Gbro_0332"
FT   CDS_pept        complement(361807..362466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2094 uracil-DNA glycosylase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19670"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19670.1"
FT                   /translation="MIDPIQLATNMGNINGRNADPRVVADKMSRIRSPHVQPINDLADR
FT                   IALTEGFGKGEVPYVDPDTGGIDARMLVLLDNPSTKAESGSGSGLLSLDNDDRTARNCR
FT                   EAYQRHGVQISDVVHWNVVPFPVAGVKNGGSTPAERVRGVRWTREIVAMLPRLEIVLLL
FT                   GAAARDGWQRGDITRDGLYVPAGNIPHCSMRGLNTAGGRDRFENAIADVAARLRSQ"
FT   gene            complement(362664..362984)
FT                   /locus_tag="Gbro_0333"
FT   CDS_pept        complement(362664..362984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19671"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19671.1"
FT                   /translation="MKSITGATVIAAAALTFGLAGVADAAPASVQREGGPCYVHEFGQT
FT                   SRDGKLFCSALNSAWESKAVHRAPKVRIGEQCRRLGAQAIVAGTDGKATCRETAQGLRW
FT                   QW"
FT   sig_peptide     complement(362907..362984)
FT                   /locus_tag="Gbro_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 26"
FT   gene            complement(363120..364257)
FT                   /pseudo
FT                   /locus_tag="Gbro_0334"
FT   gene            364596..365003
FT                   /locus_tag="Gbro_0335"
FT   CDS_pept        364596..365003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19672"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19672.1"
FT                   /translation="MPDLDWGHVMGDDSMDVGDLGYKALTLDVPLHSGDRGGVVRFSTV
FT                   DWEGRARAAEDAAAKLAGAIETLSVVLPNNYFGDCVEGREMYVRAKAAVDSWRESLKGH
FT                   RAELDALATQCRTAASELDSADVDGAHGIET"
FT   gene            365316..365411
FT                   /locus_tag="Gbro_0336"
FT   CDS_pept        365316..365411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19673"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19673.1"
FT                   /translation="MPLWRMDKQREGVVGAIKVKGILGLPNTLET"
FT   gene            365408..365665
FT                   /locus_tag="Gbro_0337"
FT   CDS_pept        365408..365665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19674"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19674.1"
FT                   /translation="MNGGVTGISDYKLRNDDFTWFPDLNIGGRRVGLFSLGGDACDTIV
FT                   ESGRAFVFTDVALGRLDDDVTENCNRAIAFTRATIDLMPR"
FT   gene            complement(365689..366581)
FT                   /pseudo
FT                   /locus_tag="Gbro_0338"
FT   gene            complement(366611..367414)
FT                   /locus_tag="Gbro_0339"
FT   CDS_pept        complement(366611..367414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0339"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: azo:azo1163 putative hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19675"
FT                   /db_xref="GOA:D0LCF1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF1"
FT                   /inference="protein motif:PRIAM:5.3.1.22"
FT                   /protein_id="ACY19675.1"
FT                   /translation="MDRARLTVNCSIFFPDLPLLDRPRAAADAGFRGVEFWWPFDTAVP
FT                   SDHDVERFITAIDDAEVRLTHLNLAAGDLTAGHRGLLSHPDTSAEFRDSVEVAMGIGRR
FT                   LGTVGFNALYGNRLYGLDPDSQDDLATENLAISAAAASTIGADILIEPLSGIPAYPLTL
FT                   AADAIAVCNRVTQEHGVDNVKMLADLYHLAVNGDDLDAVINRHADRIGHVQIADAPGRG
FT                   EPGTGSLDIARYVSALRVRGYDRWISLEYVPTRPDTFDWVTDFPA"
FT   gene            complement(367425..367859)
FT                   /locus_tag="Gbro_0340"
FT   CDS_pept        complement(367425..367859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19676"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19676.1"
FT                   /translation="MTDFGVKRLAYAYTAARAARHYERDYWHDYAAALHGRLLAQLEPA
FT                   QSVAHDDPTVAAIQTLTATIPDKRHPWSDFLAAPPWIHDQFSRLHPPIAAARALVEYAT
FT                   SDCVEDLLLARWPELRTVAVSADDLADVIPLEPPRDPGWS"
FT   gene            complement(367856..368329)
FT                   /locus_tag="Gbro_0341"
FT   CDS_pept        complement(367856..368329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19677"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19677.1"
FT                   /translation="MVTINTRRLTVHDAARALVHTRTEPPVDRQYWLDYYRRLRSSLIE
FT                   RIDPRDRSQRPDELDSLRHFAERLLTNGLNCLPRYDDPCHPAGATGPVDEALQHSLQTL
FT                   RVARESLSYAVADYIVEILTTHDPGIERVAIDTIKLELRDFVIQPPSWEWPTR"
FT   gene            complement(368391..370043)
FT                   /locus_tag="Gbro_0342"
FT   CDS_pept        complement(368391..370043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0342"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: mca:MCA0729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19678"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF4"
FT                   /inference="protein motif:PFAM:PF08378"
FT                   /protein_id="ACY19678.1"
FT                   /translation="MPHLIPDPPRFASPAEQQVWARLRDQLLDDDLLIAGQRVTDHDKE
FT                   HEVDLVVAIDGAGIACLEVKGGEVWHDGDSWLQARAGQPPKRIDPVEQARAACYALREY
FT                   VESDPAWTQGRLRWDHLVVLPHSAVPADFALPDCPRWKIIDRTQLDALMPLIRNVLLQQ
FT                   TNSLPMLDPTGIDQLQTALSGRGLPQRDVVARALENDATAEIITEQQAVILSAISKLSR
FT                   VEIRGGAGSGKTFLALEQARRLSRAGQRVALICYSHGLASYFTRITSHWSRREQPAYIG
FT                   EFHDLGITWGASAGPDESVRTQEAAEFWEHTLPHQMVELAEALPPGHRFDAIVIDEAQD
FT                   FADDWWLPLLACLRDPGTSGIYLFSDEYQRVFDRQGSPPVPLVPLILDHNLRNTRQIAT
FT                   TFSPLVGQRMQLRGGDGPDVQFVACNADDALDAADDQIDPLLDEGWRPEDIALLTTGSR
FT                   HPEQVDRQALGTAAYWDTFWDAEQVFYGHVLGFKGLERRVVVLALNESKPRERSRERLY
FT                   VGLSRARDQLVVCGDPEFVREVGGPDVARRLGI"
FT   gene            complement(370056..371702)
FT                   /locus_tag="Gbro_0343"
FT   CDS_pept        complement(370056..371702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0343"
FT                   /product="AAA-4 family protein"
FT                   /note="PFAM: AAA-4 family protein; KEGG: maq:Maqu_0558
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19679"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF5"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ACY19679.1"
FT                   /translation="MDTAALIAGGETFTTEFKRSDIGDKDLTKAVACLANGDGGVLLIG
FT                   VDDDGTVVGAKPRHGTVTSPERVAAYIQASTEPALAVDVSTEIVAGHEVIRIDIPRANP
FT                   GPVGTKLGVFTKRVIKSTGEPECAPMTAHEIVSMGMVTRGQDFAAATARGATFDDLDSN
FT                   EFERFRQLCRAAGDDLGELSDHDIISALGLLPIHDPVSIGAVLLFGTKSAMQHWVPNAE
FT                   FIFQDLRESGPSANVTIVAPLLAAAEQLRTLIDTRNTVTELMAGIHRVEVPLIPSLTRR
FT                   EAVANTLVHRDYTAVGPTRVQITESEFVVSNPGGFPPGVTIANLLDQSRPRSPVLAAAF
FT                   KRAGLVERKGKGVNDMFEQQLRAGRAVPDYSHSTTDSVVVTVPLGNADLDLVRFLLTWE
FT                   NESQNPLRLNELRVVHEVKSSGSATSSEVAEELHLIPATAKTILGRLVEYGILEARGVG
FT                   RSRKYHLTARFYDLAQDRNAYVRVKGADPLQQQRMIMDYVHAYGSITRSQAAQLCQTDP
FT                   HQARAILKRLVEDGRLRLVGERRAAKYMSPE"
FT   gene            complement(371804..372217)
FT                   /locus_tag="Gbro_0344"
FT   CDS_pept        complement(371804..372217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19680"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19680.1"
FT                   /translation="MHSHARHSVRFWLIAFALAAATIVPVTGTAQAAPAPTVIRDCTGK
FT                   PLIKPRTIDSIFCADLGIIVTNISWSRWTPRLAEGSGVEHRRTCVPNCAEGPVQVQPIS
FT                   LRLFDVKRGDFRRITLIDEYGKTETHQLTGLHR"
FT   sig_peptide     complement(372119..372217)
FT                   /locus_tag="Gbro_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 33"
FT   gene            372313..373737
FT                   /locus_tag="Gbro_0345"
FT   CDS_pept        372313..373737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19681"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19681.1"
FT                   /translation="MADTARAPGHLFVVHGRLESVRYDAVIVPTDRHFDVSSQWDRLLS
FT                   GQVPSRPRGWSRGFGRSDGTEGVWFISVYDETAVTGAELAERLDALVRDIVGEIGADVG
FT                   RLVVAMPVLGIRGGAQGARRGAVVRDLVDALTTISHRRGVDIAQVTPDRAVHGAIQHFR
FT                   KAGTSSLWELTAEELQLAGELGSFAQQGHLALFLGAGVSMSAGLPSWGSLLTELANKAQ
FT                   IAAADFESLNGSPLDQAELVSLHLQDRLGSEVAALEREATQVSLAHALLAGLNCMQVVT
FT                   TNYDELYEAAVDATGHKRPALLPREHAEPGRPWLLKMHGDVGDENDIVLTRRSFVRYDA
FT                   NSRPAGSLLQSLMMTKHLLVVGTSMSDDNVVRLAIEVDDFLRSDATFGTFIDVSQPSAR
FT                   AELWRKRFRWLNCAGDETADRVRRMEIVLDAIGMYAAQDASWLLDPRFAGLLTPGRSGG
FT                   DRRGQGTDSASAASIH"
FT   gene            373850..374182
FT                   /pseudo
FT                   /locus_tag="Gbro_0346"
FT   gene            complement(374279..375139)
FT                   /locus_tag="Gbro_0347"
FT   CDS_pept        complement(374279..375139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19682"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19682.1"
FT                   /translation="MVPNTRAISEVRPQFAMISSGRRCVTEVAHSSIVAWRNCSRSPAQ
FT                   LAAAIRSTVSTSVPPEIITSGYWSSIISICAWRCHTLANAYMLRGFRYPTRQLAQSPGA
FT                   YLSIQKFCRMQPSGYDAGPEYARSRRSYLEGCRRLAADYHHSSEPSWQAPSALDHLIFY
FT                   PDLTRIDWTRCPIIVQDDTGTLANLNIGVSSFSKVTNLRETQRFQRSLRKLDGTVRSSW
FT                   AKRKALLERTTAFKSLDFKQWDKRGKDWYSVRVVDGFRAHLRYEGASTEWWAEEIGDHK
FT                   SLGHG"
FT   gene            375181..375666
FT                   /locus_tag="Gbro_0348"
FT   CDS_pept        375181..375666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0348"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /note="TIGRFAM: DNA mismatch endonuclease Vsr; PFAM: DNA
FT                   mismatch endonuclease vsr; KEGG: ajs:Ajs_2197 putative very
FT                   short patch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19683"
FT                   /db_xref="GOA:D0LCF9"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCF9"
FT                   /inference="protein motif:TFAM:TIGR00632"
FT                   /protein_id="ACY19683.1"
FT                   /translation="MVSAGVPHRPSDRPAASSETVRSRMSRQRNKDTAPEVQVRKILHA
FT                   RGARFRTDVKLESDLRTRADLAWRGLRLAVFIDGCFWHGCPEHATRPASNAEWWAEKLD
FT                   ANVARDRRTDALLADRGWTVRRYWEHEDPERVADDILATLRRLRRCTGRADRSHTPR"
FT   gene            375838..377637
FT                   /locus_tag="Gbro_0349"
FT   CDS_pept        375838..377637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0349"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /note="KEGG: pat:Patl_4102 superfamily I DNA/RNA helicase-
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19684"
FT                   /db_xref="GOA:D0LCG0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG0"
FT                   /inference="protein motif:COG:COG0210"
FT                   /protein_id="ACY19684.1"
FT                   /translation="MESEVELDDAQRRVAEAPVDKRLLVVAGAGQGKTEVVSARLGHLI
FT                   EEEGLSASSELLVLSFSRAAVHAVRTRLSERDIAELNVRTFDSFASQVLIDADEEPQAG
FT                   FEARIRQATGVLAEHAAGTEWIDDLCHVVIDEVQDVVGDRAALVLALLERLDEHAGFTV
FT                   LGDPLQGIYDFARTESADQTTSAEFLARVAGDFGATEVALSKNHRAQGQDCVRIAQLGQ
FT                   ELRRTDDATEALSVLRAVRESLPQISRVDRWEFLGDYSGRSAVLCRTNAEVLRISRQLV
FT                   DAGVRHAVRRPAQAFGASKWIGRALGPLVGPAAARSEVETRLAQILGAEAYEAWYLLKA
FT                   VDVRSRSTEQIDLGRVRRAVAAANVPLALTQDDVVGVVVSTIHRAKGLEFDNVFLADWR
FT                   DSFAGERDDWEQVRLEYVALTRASQSIVRIETPRSRSVISESGWLPGRHQERAGTKGRL
FT                   RARAMEIGYDDGYVSRPVAVGEQSASSIQENLDRAIPGTAVNAVLDITRSDQLRPIYAL
FT                   TVGGSPIGVTTEDFGREFAALFRVRPGQWPSELTDMVLVSVETTAGDPRIAEEAGVGPG
FT                   GFWLVPRVAGLARPLWDVMEKVG"
FT   gene            377634..380822
FT                   /locus_tag="Gbro_0350"
FT   CDS_pept        377634..380822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0350"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: sfu:Sfum_3850
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19685"
FT                   /db_xref="GOA:D0LCG1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG1"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACY19685.1"
FT                   /translation="MSVDDVLAEKYRFREAMVDALRGDLVGPGEGDDEVIGEAPLSRYI
FT                   IGALWPQPADEEDAEATEQAAEAEPTGAEADGESDEGSPVAESRMRFPSSVGLTFSVRA
FT                   SAESVVIAPSAGRYEELTDDDEAALGWRRHEVPAKTFAQQLQRPGVYRDDVADGLQLYR
FT                   YVRPERDGVVTVTVALKNTHTAIKGDLRDGISWFQVGIAVQTQHADIVDRSAAHNIGVD
FT                   PDLDTAALMYRNAHTFAIGHGCAAEWDLDEVHDGAVSKVATTFIPSHEVHRAKPGVVTG
FT                   IDLHMKTLAERPIGEISTNLRGLTSQYRSWIDTLEGEVSTGTARVGGDLQPVAERHLRE
FT                   MRKAADRIDAGIRLLEDDADALRAFRLANRAMQLQRARQDWVRGGAQGTVGDGADARWR
FT                   PFQIAYVLLNLPGIADPAHDDRGIADLLWFPTGGGKTEAYLGLVAFVILLRRIRNSAAY
FT                   GVAVIMRYTLRLLTIQQFERASMLMCSLETVRKSNPELGSRPFSIGLWVGAGATPNSLR
FT                   EARTSLKKLARGEELQEKNPVQLTQCPWCGTFLDHENYKVARMPSEHLNIACGTSSCDF
FT                   RSGLPVHVIDEDVYRERPELILGTVDKFAMMAWNENVGKLFARDGKGTPPELIIQDELH
FT                   LISGPLGSMVGLYETAVDAACSVPSIHDEYNRARPKVIASTATIRRADEQIEAVFARSA
FT                   TLFPPPGIDPDESFFAEPSGKDQLGTRRYVGVMASGTSHATLLVRVYAALLQAAKDIEG
FT                   DDATRDPYWTLLGYFNSLRVLGSANLQVEGDVRERLGVVSKRNGTAQRELKTVNELTSR
FT                   VPSSEIPGRLKALERKLGGGNAPDDVVLATNMISVGVDIDRLGLMTVMGQPQASAEYIQ
FT                   ATSRVGRQHPGLVVTIFNSARSRDRSHYESFRPFHQSLYRAVEATSATPFAARARDRGL
FT                   HGVLIAMTRLLVGELAGNDSAHLAADYWDDLTKVGDLISERVGRVAPDEQAATEDEIAA
FT                   LLKVWADEGEARENMKYQNSRNPQAALMVRPEDALTSEEIEYSQREVPWPTLQSMRDVD
FT                   AESSLHQIPMRRKK"
FT   gene            380819..382561
FT                   /locus_tag="Gbro_0351"
FT   CDS_pept        380819..382561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0351"
FT                   /product="Protein of unknown function DUF1998"
FT                   /note="PFAM: Protein of unknown function DUF1998; KEGG:
FT                   pat:Patl_4100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19686"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG2"
FT                   /inference="protein motif:PFAM:PF09369"
FT                   /protein_id="ACY19686.1"
FT                   /translation="MSIAEAKARRSQLLSTYGIGGLFPSETSSFMIVGLHEWNEERSPV
FT                   ISEPRLARSLRVQELKSPPAGGRKDVPVVRFPETQICPGCRRIGTTAALGGDWNASNCK
FT                   CKEGRAGAALSPFRLIIACPRGHIDEFPFYQWLHRDAGDRAAVKHEMRMVSLGRTSSLD
FT                   DLVLECSCGVKEQTLEKASQASAMKGITRCRGRRPWLGEDHSEECGETPRVLQRGASNV
FT                   WFPAVLSAISIPPYSEALAKFVDKHWAALEDPEAVNDALLRNIAKQSRGRFTVEQIVAE
FT                   VERRRGEETAEDIDEEQLRRQEFQALMDGREEDKDESDFVCEKTVIKRQFSGDVPGLFT
FT                   DLRKVTRLREVRALRGFSRLSGSTDEGSFCSLSPEPLYWLPAIEVIGEGIFLALDRDEL
FT                   TDWAATPFAQGRRRKLQDAADRQGIAFKRPPTQVDIAKVALHTLAHILIDQLSLDAGYP
FT                   ASSLRERLFVDDEMAGILIYTASSDSAGSLGGVASQADPEKFAAAINEGLDRLSWCSSD
FT                   PVCIESPASGTDALNMAACHACVLAPETSCELNNTLLDRALLFGTHEPGEESAGLFSVH
FT                   LGRT"
FT   gene            382597..385410
FT                   /locus_tag="Gbro_0352"
FT   CDS_pept        382597..385410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0352"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicase ; helicase domain protein; KEGG: eba:ebA251
FT                   ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19687"
FT                   /db_xref="GOA:D0LCG3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG3"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACY19687.1"
FT                   /translation="MADIAAGERVIVRDEEWLVRAARATDLDGTRVEVTGVSELVRDQD
FT                   AVFFDHPELDTVHRLDPRAGTLVADTSPGFRRTRLWLESVRRGSPIPASDTRITVGHEA
FT                   LLDRMDYQLRPAAQALKNLRPRILIGDAVGLGKTLEIGILLSELIRRGRGERILVVTPR
FT                   AVLEQFQQELWTRFAIPLVRLDSAGIQKVKQTLPSSRNPFSYYKRVIVSIDTLKNPARY
FT                   KHHLKSQHWDAVVIDECHNLINRGTQNNELARLLASQSDAFILASATPHNGKQESFAEL
FT                   INMLDPTAIVDPNDYKAKDIEHLYVRRHRNSADVKLDVSHKWRERRKPDIVGVSPTIAE
FT                   RAVLRELEDVWLHPTGDPVIEGKGRQLFPWTLYKAFLSSPRALRASIARRLRTIDNDRD
FT                   RESVALQRLDDLAERAEATTPAKLEELVAYLGRIGVAASSDERVVIFSERIDTLDWLQA
FT                   ELRRRLKFPTKAINGLLAVEVLHAGLSDEKIQAVVEGFGQKASPIRILIASDMASEGLN
FT                   LHKECHQLVHYDLPWSFIRIQQRNGRIDRYGQLHSPQIAALALAAEDDVTDDLNVVTKL
FT                   LQKEHEANRALGDAEVLLDLHDSKIEEETVMEAIRTGRDLDDLVPEPTPERLNPFARLM
FT                   VQGGTHESEPAPETAARLSLFDDDDNYLTDELADISADGGTDLDIHREDEQDLVAFKPP
FT                   QDLLTRFRDLPPDYLREQEIEKRLRLTGSPDLARDRLTRAQRAQDSSWPDVHFLAPIHP
FT                   VLDWAGDRAIGRFGRNEIPVVTGAVDHPHFLTQAVWSNDAGRPAIAHWGAVTGLPDAPE
FT                   VVDFEFVVEVAGLSEAAGNPGVPDDALEPLQHLVPAAVDAARNHIRARRDDFEHNLIDR
FT                   VDRYRADLTRWEQTALTIAAEPGKRTDARLEIEHTADSWASIIDSMAASGEPFVRVVGV
FT                   IIPKPRG"
FT   gene            385415..390136
FT                   /locus_tag="Gbro_0353"
FT   CDS_pept        385415..390136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0353"
FT                   /product="type II restriction enzyme, methylase subunit"
FT                   /note="KEGG: psa:PST_3447 type II restriction enzyme,
FT                   methylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19688"
FT                   /db_xref="GOA:D0LCG4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG4"
FT                   /inference="similar to AA sequence:KEGG:PST_3447"
FT                   /protein_id="ACY19688.1"
FT                   /translation="MFDSIHNVNDFLSEHWLAEVFPTNLKNLARQWKEWAEQDKPTPVK
FT                   GLATIASTYIRDLGDLPAPATDTIDARVTELHSTLLAAVGFTAEAVTIETAQADTTIDV
FT                   PVLARYPSTGSTDSLHILQAYPVDNADALFGGDAELVEPLRRHVTSEKIEKIEAVGEAV
FT                   TQLFVSDAAPRYLLVVAGGVALLTDVGRWSEGRYLAFDVATALDRRDEKASGELTWHAG
FT                   LWSANALLPDEEDGKAEIDHYTESSEKHAVGVSEDLREGLRTSIEKIANEVLTRRREAG
FT                   LPVEGIPELPRDLTTQSLRFLYRILFLLFAEARPELGVLPVGTPEYESGYGLDRLRELV
FT                   QVPLTGRSADGHHLHESLDLLFRLVNTGHKAGARDVDGMVFEPLRSDLFDPAKTPYIDG
FT                   EGMRISNRVLQEVLNLLLLSKPSKRKGAQRGYISYAQLGINQLGAVYEGLMSYSGLIAD
FT                   DDMVEVAKDGNADKGSWLVPSTRSGDYDADDIVWREDRLTGRKDIVRHPKGSFVFRLSG
FT                   RDRQRSASYYTPEVLTKCVVKHALAELITDDTKAQDILEYRICEPALGSGAFLNEAINQ
FT                   LAAEYLRRRQDELQTPIKPEDYTTQLQKVKAYLALHRAYGVDLNSTAVELAEVSLWLNV
FT                   MHSGLQAPWFGLHLRRGNSLIGARRATYDLTSLGRAKKSWLKTPPTDRPLSEGSIGDGE
FT                   IHHFLLPAEGWAAVADAKQAKELAPDAAAALREWRKRVTKKPNQKQTDRLKALATRVER
FT                   LWALALRRLEISEQQISRQIDVWGADLPVVEDAVDRERVERELHDPEGPYERLRLAMDA
FT                   WCALWFWPVTGSVADNDQGHPGPPGLDEWIVTLEELLGAAGIKKVEAGQSSFQDLADGF
FT                   KELAQIDDQDRRFSGMRTIPDLLLRHQWLGTAREIAQDQGFFHWELDFAQIFQRGGFDV
FT                   QVGNPPWVRPKWRDDETLSESDPVFALREKIPVAEFNSRRSRLLADEWTRALYLDDLAW
FT                   WAGTAEHLGSPEIHPALTGVQTNLYTNFMEQVWRNAAPQRSATGLIHPEGHFSDPKAGS
FT                   LRAKTYPRLRRHWQFFNEHMYFEGIGDTVVFGVHVYGPPKEVGFLQITSLFDPQTIDDS
FT                   FAKAESKDVPGIQYPWGGWDLRGHASRIETISERILADWAMLFDPVGTPAVQARLLRPV
FT                   TREHVEVLSTVARYPFRTASLGYKWTRCFDEDKGKKDGYIEWRTEFPGSWDEVVLQGPH
FT                   FTVATPFAKEPNENCRSKGDYTTWDLESLPESVIPRTNYQRACDRDTYDAGIPKWGDRP
FT                   ATDYWRVAWRNMTQPGLERSLHAALVPPGAAHVNTVNSLTVCTCASTCKQLSSPDGLSD
FT                   LRMTGLVAGLWASLPFDYLVKVSGRPHVQTEVVDRFPAPVDHPAAAQLLFRTLRLNCLT
FT                   RDYQPLWDALYEQGFATDMWTAPFAGQLKPLGVSVPEWSMTTPLRTDFERRAALVEIDA
FT                   LSALMLGLTAEHLALMFRTQFPVLRKYEYEMYFDANGRKIAKDHHAQGVHQQKEDFKLL
FT                   QEWMIGGDHGDLLDRYTPFEPDAEHAEPWFYKPDREAEMRAAYAEFEQRLADG"
FT   gene            390133..396396
FT                   /locus_tag="Gbro_0354"
FT   CDS_pept        390133..396396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0354"
FT                   /product="Protein of unknown function DUF1998"
FT                   /note="PFAM: Protein of unknown function DUF1998; DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   maq:Maqu_1319 DEAD/DEAH box helicase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19689"
FT                   /db_xref="GOA:D0LCG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG5"
FT                   /inference="protein motif:PFAM:PF09369"
FT                   /protein_id="ACY19689.1"
FT                   /translation="MTLAQPSLPSLLAAETQESIVEYLTTTFALSDPATQTALRDFLGD
FT                   TDTGIFRGPYLKIRTPYQPVGDGWVSPLEWMPSGFRPFQHQAEAFARLSTNGKAAQPTI
FT                   VTTGTGSGKTESFLVPLLDHCKRAAARGERGIKAIILYPMNALVTDQARRLADYLHGDE
FT                   RLAGVSAGVYIGGEGKRRHAGPHALIDHRDTLRDNPPDILLTNYRMLDLLLLRQADTRL
FT                   WDNATTTLQYLVLDEFHTYDGAQGTDVAMLIRRLGSRLGLEGAAGPLGRVTPVATSATL
FT                   GGGSQSVELRRFASTVFGSDFGSDSVVGETSLAPIDVVREVDFTLDIPSVAEILAVPEP
FT                   VADDPASWEPLARTVLAGGQSGAEDFSDPVTIGGALRRHFLTRVVIDVLGAQPRTVADA
FT                   VLDVAQAGILPWGVHNSTAPREAQTALLRFLALLSIARVRDVSGSLRPLVNVQVQMWVR
FT                   ELSRMLRLVSDTPDFRWWHSGPAEGQRHLPATYCRVCGRSGWMAATTELGDSLSGESPA
FT                   IWRNSARSGSRAKNRVMLAANPAEDGVRHLDPETLEVHAAPREGTVAVHISIDDEEAAG
FT                   EVCPSCGARNAIRYMGSSVATLLSVGLTTEFGSRLLPDAEKKTLVFTDSVQDAAHRAAF
FT                   IEGRAFAFNFRSALYACVEDGNRTLAEVGQALATRATTDELYAITPPDFARRLTTDADW
FT                   LDHDDGTLRRILATRLVFQSQLEVGLGTRTGRTLELTSSLAVDVDVDLAYFGAAARDVH
FT                   QNLPQLSVTDLPDDASYRIWLLGLLDHLRTGGGILHPWLTTYITQEGKRWSIWGGSADG
FT                   MPKFPRGRPAPSFYTTGTAGETDFQSLSPRGESWLTDWTKRCLGVTAGEARAMLMSVVA
FT                   LLAGDNGPLHDRAGEKGARIFGLDPQSVTLHTDELGRLVCPTCHHLQPCSASRIEIWEK
FT                   APCPRMRCTGRLEPAEIPAANFYRTMYRGGRIRRIVSAEHTGLLGRDEREEVETRFKVG
FT                   GSASDPNILACTPTLELGIDIGDLSTVSLASLPRSTAGYLQRVGRAGRSTGNAFVFAAV
FT                   PTSPRDLYYFAQPEHLLAGEVLPPGAYLEATELLQRQYLAFCLDRIAGGALRIGPPMPA
FT                   RLADCLDNGMDEGRWLRGVVDTCTAGAAKLSADFLGLFGEHLSDLAREQLGDFASDGLR
FT                   LQVAAVAARWVEETDEIRDRMSALSEAIAVLDGHGHLDDAQREDRKRCAGEFKALSDQL
FT                   YDRATIETLTGLSGVGLLPNYNLLDDSTTLDVHLWWTVGREGNTSQGDKPQTEALDLTY
FT                   ERGSSTALTELAPGAYFYAGGKRVEIDAMDIGPATKPHWRRTRLCPDCGWGTTDSATVP
FT                   SCPRCHSGAVSDSGAVHKVLELRKVSAVHRLDDVLIDEEVEDRTRTFFGTITGVDIEPK
FT                   DINRAWRLKNTAFGAEYARSATIRTVNTGYGDAPGEQITIAGEARTAPGFTTCEHCGVV
FT                   APGPNSTDKVRHRGYCVTRRGGTEKWTRLLLSHELRTQAVRLLLPVSLLNFETTLASFK
FT                   GALLLGLRKDFGGDPQHLAVVASSMSDTQGATRRFLVLHDTVPGGTGYLDRFGDPQRMH
FT                   QILSLARDALAQCPCRTEEQQACHRCLYGVLPARDMEHASREAALRLIEEFLSEWDVES
FT                   IGTVTGIDIGKVQLSELEIRFRELLKSRLDAREGASYEVALGGKGEELDIRIPAPDGRT
FT                   RRWRMRPLVQMSHSGVATEPDFLFTRVDAQTADVAIYLDGKQFHASVEHNRTDDDARKR
FT                   DALRRSDIRVWSISWDDVIADETGSAKQRSADIVHQHIKNLVAENVSDNRVRHIWANPI
FT                   EFLLEYIADPDATVWGEGAEATVFELVTGPAEHGTAQHFRVAPSELATALIDAAAGAAM
FT                   TDDETGSVMVVPRHGLSGLPLIICAVPDSFRTTLGVFTLLDDRANVVGGPEHDARWRAW
FT                   LRWSNILQFLTLPRYGDLMPQRMAAIWTTRSVDDFLAVPVPLAITAGGRADMITPLSGE
FT                   WEIVREYADPVVDDLVTGLAQAGLDAPEVGLELGPDESIWQVELGWEEPKVAVVTDVDE
FT                   AREAWLDDNGWKVFRVDTTTGAGVDDVATCLTEGTR"
FT   gene            396393..398537
FT                   /locus_tag="Gbro_0355"
FT   CDS_pept        396393..398537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0355"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: ecf:ECH74115_5811
FT                   ATP-dependent DNA helicase, UvrD/REP family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19690"
FT                   /db_xref="GOA:D0LCG6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG6"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACY19690.1"
FT                   /translation="MTRYVQMHEMFQGSYNKLDGSIKSRVLNFMVKLQQDPDGSGLDFK
FT                   QPKGAADKHIRTARVTDNYRAVLMDPGGQSALYLIAVMKHDDAYEFAEKVTVQVNEKTG
FT                   AAELFDKVALKTAVDTAPVAQPSEQPFMPSTVRTSDLERFGVEPGIAERLTEVTGEEAF
FT                   LAIAGALPSTQGGAVLDLAFGKSPDDVWKDYALQEPGPIDTDDLEKALERPISRLAFTA
FT                   AAGDNEAELRAVLEGDFAKWRVWLHPLQRDLATHDGWNGPFRVTGGAGTGKTVTALHRA
FT                   RHLARRIEDSGSGEKVLLTTYTRNLVRDIEAQLIMLAGKEITGLVDVLNVDALARKVLT
FT                   AGDNGRVLVNSSSIVQDSDTRVAQLWATAAQTATGKWEPGFLSDEWALVVLGNSIEDEA
FT                   GYLRVPRTGRSQRLSRPQRADVWKVVEHFQRLMRAEGLITFTELAARAASALAADPGLR
FT                   DRFGYRNAVIDEAQDLHPAHWKMLRALVAPDTDDLFIVGDAHQRIYGRPTPLSRYGIET
FT                   RGRSRRLTINYRTSREILRWTLLMADPDVDDLDVDSDTLQGARSVFGGPEPEMLGFESH
FT                   GEENSGIGTLIKTWRAEGLELRDIAVFTYEKRHVDEICDALESEGVPSAAVGPNTAEEK
FT                   LGDAVRVMTMHRAKGLEYRGVILARMGEKDFPPPFLLRKAGDELGRERKKLRSVLYVAG
FT                   SRARERMAIAYSGKPAKMLS"
FT   gene            398534..400345
FT                   /locus_tag="Gbro_0356"
FT   CDS_pept        398534..400345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0356"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /note="KEGG: pat:Patl_4102 superfamily I DNA/RNA helicase-
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19691"
FT                   /db_xref="GOA:D0LCG7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG7"
FT                   /inference="protein motif:COG:COG0210"
FT                   /protein_id="ACY19691.1"
FT                   /translation="MTETTAAGDAVAFELDESQRAVAEAPADARLLVIAGAGQGKTEVV
FT                   ASRIEYLVEDEGLSASTEIMALSFSRAAVHAVRTRLDVRDIARTDVRTFDSLASYLLSQ
FT                   NGIEPAGDFNERVRAATRLLTTSAEVDGVEDIAHIILDEVQDLVGDRAEMVLALLSRLD
FT                   ESAGFTALGDPLQALYDFTLDDSRSKLTSSEFIDALTKSHGGTELSLDRNYRARGEFPR
FT                   GVIELGNKMRDEQRGEAAQIITEFESTLPHSGEIRDWHFLDDASAGRTAVLCATNGEVL
FT                   RVSNFLSEQGIDHVVRRPAQDFGAAKWIAELFEGVEGPELARSDVESAIESKLAARLRD
FT                   EAWYLLKGAEGRSRTMNQLNLPRLRSLISTHAMPLTLTEPDQAHVIVSTIHRAKGLEFE
FT                   RAYFVHPNSPMNDQNDWPAIRQRYVALSRARDMVAVIDIPTEWVWFDKRNGRSRERKKG
FT                   KSGKHYTLAVELRGNDVMDSRPLQGDPRRAHEIQRNLAEVSPGQEIFGVFDPTQSTADK
FT                   PIFCLSTSKGAELGFTDKWFGRALAYDFGWRREFRDGWDGAVVEGVRLVSVETVAGDPR
FT                   VTEAAGLGPSGFWLVPRVFGLVAPKPS"
FT   gene            complement(400349..402706)
FT                   /locus_tag="Gbro_0357"
FT   CDS_pept        complement(400349..402706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0357"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   maq:Maqu_1316 protein of unknown function DUF1524 RloF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19692"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG8"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ACY19692.1"
FT                   /translation="MKAEAKLVRELFEGEQCLVVPVFQRPYVWDRVKNWEPLWADVISM
FT                   SESFAAGHTAEPHFLGAVVLDSTDKDAADISVLQVIDGQQRITTLQIALCAIRDAFQTA
FT                   EVEETFTKALNRLVTNEDQLSTAEFAPYKVWPTLRDRRVFAGIVDRRSPDEDQDSRLLD
FT                   AYQFFYEAALEWLADVDQDRARIQSLVHALRIGLQLVVIELAANDNAQVIFESLNDRGT
FT                   PLLPSDLVKNSLFQKLERAGADVERIFDDYWRRLETSFWQAEVRQGRLIRTRVDAFFAH
FT                   YLTMRTGEEVLATGLFNRFKDLSAQMSLAELETLTREVAECSDLYRAIIDPLGDDAHTR
FT                   LLKTAETLDTTVLSPVVLYLDREAGDSDRAEAFIYIESWLVRRAVLRSTSKNYNRMLLE
FT                   LLKALKRSQQPYAPVVREFFLNNDSESGRWPTDAEIREALVSAPIFRNLTRARIRMVLR
FT                   GCELGLIGNFEVAPDLTSTDYALLAGAEDPIDDTLRASLGNLTLFDSPRALSRASTWGE
FT                   RRSMLTESTLALNAALPESLDGVAISMRGALLADGFCRTWPHPNAEVVPAAAPAISEAE
FT                   PQPDPDDWIRTAWAEIEEFFDRLPVGSVSRVEDRVTQALPGDAGALGVLKDDPVTGFEF
FT                   REIAGTLYIEKVAAPSGASQDVPANDGREQDAQKSPVAEKLFSDAENTDGKVRAASRVV
FT                   YEETIGDLILAGYIHEGDRVYHEQPRKGRSFAARISRAGRLLVGHREFATPSGALSDLV
FT                   GSNRNGWRDWRLERTGETLEQVRERFRRRKPD"
FT   gene            402787..405318
FT                   /locus_tag="Gbro_0358"
FT   CDS_pept        402787..405318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0358"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   SMART: DEAD-like helicase; KEGG: tgr:Tgr7_1040 type III
FT                   restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19693"
FT                   /db_xref="GOA:D0LCG9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCG9"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACY19693.1"
FT                   /translation="MQSLGESVLGELTRVGPLTSVELGERLSQPVTAVQEVLLECDQVF
FT                   VRPPEGSDKWSVVSSDDMAQRLGMNRGLRPWQVDAFQRWLVAGRAGVIEAVTGAGKTDV
FT                   GVAAIADARRRGVPTLVLLPDRDLADHWRGVLETAFPGVKVGTPHSTRAIAVAEQMVVT
FT                   TVEGLGNKRLTAFREAGLLVVDEIQRFGAATLTASVFPREGLTEKLGLTASYEGSNAQI
FT                   QRVLRPYFGERISGCSYTRAVDEGILGKPLVLTVGVSFSSKERDEYEALSRRIESAERK
FT                   LRDTGADLSAGIYETARDIDSGSLVGEISFLAHEYLEAVDARRRVTAMCQSKIQAVAEI
FT                   ARGVATAQRTTVFTDPESISESIAEVVSTQSGVTADFISSSSNIPFTIGRFSSEAVKVL
FT                   ATARLMDEGVPVPTSQVGIVTAAARSRAQMLQRMGRVVHPADWALRSAIVVVYVNATIE
FT                   DPDVGSLAETHLDELVPIAAQRRDVDPQEAADRLKDWLSPRSDVEDIGANEIPVPVVET
FT                   EIWDPRGAILDIVAEHEGLLTWRELRDLLPDLEVEDALMNGLDELNWMRVGGVLAGIGD
FT                   VKVRDSDRRIVALDALARARDVLGEIPTSAPQIRAELGSAAEILRTVSSERLGEFWQSV
FT                   GGRIELPAAAGPESQDAATPLPDTGDVQVAPEAVEPLPEPRAHVSMSPAIRAVIEQIGV
FT                   EGGEASLASDHVSGTLEIRDPAGRTKLVRVHSGIGGNWRVRTTDGDLGERTAEHDAIIF
FT                   LDRGTTPPKFYIAPVGPYAKRVKAVVEARCQRSCNSPGWWGCPSRNSSPVRHVIPHPGA
FT                   CRAGLGCCYRFAPCRAPSRAPGRGLRWHGGR"
FT   gene            405321..406877
FT                   /locus_tag="Gbro_0359"
FT   CDS_pept        405321..406877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0359"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   sat:SYN_01900 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19694"
FT                   /db_xref="GOA:D0L5E0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D0L5E0"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACY19694.1"
FT                   /translation="MTQLLELFRHWYAGRSQVQISQALGLDRKTIRKYLAPALAAGMSP
FT                   GTGDKFDESVWRELIGGWFPEVVDPSTRAVTWPPIAKHHKWISGQLDATVTVATIAQRL
FT                   RDDHGVDVSESSVRRYVTAHFADKINEKRATPPRPPVPAGEEAQVDYGKLGMWTNPETG
FT                   KRVSVWAFAIILSCSRWLFVQPVLKMDQTSWCASHVDAFEFFGGVPERIVCDNLKTGVS
FT                   KPDLYDPQINRAYAELASFYEVLIDPARAFTPKDKPRIERPMPYIRDSFFTGREFTSLP
FT                   QMQQAALDWCLNVYGRHAHRGIDGVPPAELFAQIERDVLTPLPPRRFERVTYHVGKVAP
FT                   DCHVKAGTALYSVPWRLIGSHVRVRTCGDMVQVFADDQVVATHVLHLSGRATNLEHYPP
FT                   HKVAYHSRPVAWCRKQAEEIGEHAVAVVAELSEVNAIHRLRAIQSIVGLRTKYPDDRIN
FT                   AACARAIAVGDVGPRTIKGILIAGTEYDDTITTSPVAPTPPAFLRGPHAFADDLDTAAG
FT                   Q"
FT   gene            406930..407691
FT                   /locus_tag="Gbro_0360"
FT   CDS_pept        406930..407691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0360"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: sat:SYN_01899 IstB-like ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19695"
FT                   /db_xref="GOA:D0L5D9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D0L5D9"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACY19695.1"
FT                   /translation="MTIHDPSLRAALKTLKLTGMLDTLDARLAQTRAGELGHLEFLQVL
FT                   CEDEIARRESAALARRVRRARFEQSATFDDFDFTANPKLPAAMLRDLAALRWLDAGESV
FT                   ILYGPVGVGKTHVAQALGHQVALRGHDIRFVKCARMLADLAGGHADRTIGQRMREYTRP
FT                   AVLIIDDFAMREHTTTGSDDLYDLVSDRAIAAKPVILTSNRAPKDWYPLFPNPVVAESL
FT                   LDRLINTSHQILMDGPSYRPRKRPGRTPKTT"
FT   gene            complement(408284..409402)
FT                   /locus_tag="Gbro_0361"
FT   CDS_pept        complement(408284..409402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0361"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   lpn:lpg1236 modification methylase (Eco47II, Sau96I)"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19696"
FT                   /db_xref="GOA:D0LCH2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCH2"
FT                   /inference="protein motif:PFAM:PF00145"
FT                   /protein_id="ACY19696.1"
FT                   /translation="MRVRYPTSVAGTPSTSKDTVIDLFAGPGGLDVAAHWLGLPVVGVE
FT                   LDADAIATRHAAGLKSHHRSVQRCTPADFRATILTAGPPCQTFTVAGTGRGRSALNTLL
FT                   LLVKKVARGEDISKSLSEFDDERTGLVLEPLKWAFAAYSAGVPYGSLVFEQVPSVLPVW
FT                   EQMAEALEEIGYRAIPKVLWTEEYGVPQTRRRAVLIARHKSMGGLAALEPSHARFRRGL
FT                   PQGSEAPAYPRCVSMSEALSLIPKNNRPQQFELVSNYGSGGVSTNRGVRHSSLPAYTIT
FT                   GKANRNRIRGIRGKDYGRLTIQEAGVLQTFPYDYPWRGSNQAQQVGNAIPPRMGVHILA
FT                   AALGREFKRRDLDAAVRRPWAGSFGCIPTREA"
FT   gene            complement(409402..409602)
FT                   /locus_tag="Gbro_0362"
FT   CDS_pept        complement(409402..409602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19697"
FT                   /db_xref="UniProtKB/TrEMBL:D0LCH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19697.1"
FT                   /translation="MATKDAKAEIERITRSALNKANHESVTAAEILETQKRMLAGLANS
FT                   AHQASPLLSSAYAAVLCALGT"
FT   gene            complement(409934..410671)
FT                   /pseudo
FT                   /locus_tag="Gbro_0363"
FT   gene            complement(410691..411659)
FT                   /locus_tag="Gbro_0364"
FT   CDS_pept        complement(410691..411659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0364"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19698"
FT                   /db_xref="GOA:D0L2S9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0L2S9"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACY19698.1"
FT                   /translation="MIVEFVAASRDEHGVDPICAALRDTAAQIAPSTVRAHLSANKTEA
FT                   PRTVRDREMLGEIRTVHADNLGVYGARKVHAELRRKDIDVARCTVERLMKADGLQGIPR
FT                   LKTRRTTRSDGAETPQPADRVGRQFTAEAPNTLWVADLTYIRTHSGWVYAAFILDVYSR
FT                   VVVGWQVSTTMHTDLALDALDMGLWARDRAGQDVAGLIHHSDRGVQYRAIRYTERLAEA
FT                   EAVTSVGSKGDSYDNAMAEAFNSLFKAECIRNPIMRPKSGWGGVGDVEIAVAEYIEWFN
FT                   HRRLHGEIGHVPPVEYEAAYWAAHTVTSYRENPVPAEAGTN"
FT   gene            complement(411656..411973)
FT                   /locus_tag="Gbro_0365"
FT   CDS_pept        complement(411656..411973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0365"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   ajs:Ajs_0906 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19699"
FT                   /db_xref="GOA:D0L2Q7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0L2Q7"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACY19699.1"
FT                   /translation="MAAPRKYSIELKERATRMAVEARKDPATRPGAFKRIGDQLGVHPE
FT                   ALRTWVKQAEIDGGQRPGTTSSDSERIAQLERENRELRRANTILKQASAFFAAEIDRPQ
FT                   R"
FT   gene            412388..412705
FT                   /locus_tag="Gbro_0366"
FT   CDS_pept        412388..412705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0366"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   ajs:Ajs_0906 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19700"
FT                   /db_xref="GOA:D0L2Q7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0L2Q7"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACY19700.1"
FT                   /translation="MAAPRKYSIELKERATRMAVEARKDPATRPGAFKRIGDQLGVHPE
FT                   ALRTWVKQAEIDGGQRPGTTSSDSERIAQLERENRELRRANTILKQASAFFAAEIDRPQ
FT                   R"
FT   gene            412702..413670
FT                   /locus_tag="Gbro_0367"
FT   CDS_pept        412702..413670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0367"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19701"
FT                   /db_xref="GOA:D0L2S9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0L2S9"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACY19701.1"
FT                   /translation="MIVEFVAASRDEHGVDPICAALRDTAAQIAPSTVRAHLSANKTEA
FT                   PRTVRDREMLGEIRTVHADNLGVYGARKVHAELRRKDIDVARCTVERLMKADGLQGIPR
FT                   LKTRRTTRSDGAETPQPADRVGRQFTAEAPNTLWVADLTYIRTHSGWVYAAFILDVYSR
FT                   VVVGWQVSTTMHTDLALDALDMGLWARDRAGQDVAGLIHHSDRGVQYRAIRYTERLAEA
FT                   EAVTSVGSKGDSYDNAMAEAFNSLFKAECIRNPIMRPKSGWGGVGDVEIAVAEYIEWFN
FT                   HRRLHGEIGHVPPVEYEAAYWAAHTVTSYRENPVPAEAGTN"
FT   gene            complement(413621..413983)
FT                   /locus_tag="Gbro_0368"
FT   CDS_pept        complement(413621..413983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecm:EcSMS35_2272 ISL3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19702"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19702.1"
FT                   /translation="MAEPTSLLLGLEGLEVTAVTRGTDRSRVVDVVTADRRAAHCPQCK
FT                   VASSSVKGHAVTRPRDIRYGDDPIMLRWTKTRYYCVNPACERRSFTESILNRPGFAGGS
FT                   VSWFRPLLGPGSHGSW"
FT   gene            414468..414851
FT                   /locus_tag="Gbro_0369"
FT   CDS_pept        414468..414851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19703"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19703.1"
FT                   /translation="MNVAVPDGSSARFEVLELRTGLASVGSVLTETAQGVFNVVVVRVA
FT                   NTSEHPIEFTTSQQFVRDSGGRVFDVDSSATAYANDEASWFNKINPGNAIVVELVFDMP
FT                   TGVQPATISLRASGGRPVTVALR"
FT   gene            414963..415451
FT                   /locus_tag="Gbro_0370"
FT   CDS_pept        414963..415451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19704"
FT                   /db_xref="GOA:D0LD84"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19704.1"
FT                   /translation="MTDPNNPGQQYPQQPGQYPPPGPYVPPQKKRKKWPWVLLALVVVF
FT                   LVLVGGCVALIGGAAESIDDEAKRTVDVTYEITGDGPTGSATYTTGNLETAQDTDITIP
FT                   WKKEVQITGLGKSVSLFASNGLNSSGSITCTIRQGDKVISTNTSSGPGASASCSGTAD"
FT   gene            complement(415608..416828)
FT                   /locus_tag="Gbro_0371"
FT   CDS_pept        complement(415608..416828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0371"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: pca:Pcar_0526 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19705"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD85"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACY19705.1"
FT                   /translation="MRMSSVVQKVLTIDAIVEDVTLEETTVDPDGMVVVSVRAYARDRS
FT                   RCGECGRRCPGYDQVSARRRWRHLDVAGRRCVLAASLRRVRCTVHGVVTEAVPWARPRA
FT                   RFTRAFDDMAAWLAAHATVSAVTQFLRVAWRTVSGIVERVVDDHFAGIDRLDGLVNVGI
FT                   DEIAYRKGHRYLTVVINHDTGLIVWAKEGRDSAVLGEFFDALGAERAAMIEKVSADGAE
FT                   WIWSAVTTRAPHAIQCLDVFHLIQWAGAMVDKVRRRTVATHGGGKGAMWAVRKSHGDQS
FT                   PEQRGIVEQLRADNSDLYEAYMLKEQLREAIRSKGRRRLVLLTGVQAWARASDIPEIAA
FT                   LGRTLDLYNTRIRNALRHNISNARSEATNTHLRALTKRAYGFHTPEALIAMAELTRGGA
FT                   CPELPWS"
FT   gene            417293..417586
FT                   /locus_tag="Gbro_0372"
FT   CDS_pept        417293..417586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19706"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19706.1"
FT                   /translation="MLRSNRGVGPTKTSKLLARKRPHLFPVLDSIVTRELSHGNRTDFY
FT                   VTLREHLRNDDRALWRHLRDVREHAGVGSDISVIRCFDILVWMAGSGRLISS"
FT   gene            417738..421217
FT                   /locus_tag="Gbro_0373"
FT   CDS_pept        417738..421217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0373"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; zinc finger SWIM domain
FT                   protein; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein; KEGG: dde:Dde_1564 DEAD/DEAH box
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19707"
FT                   /db_xref="GOA:D0LD87"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD87"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACY19707.1"
FT                   /translation="MTSVNEVIESGIFSAATRLGSWSEWITPRNLGPVTSASLDVSNAQ
FT                   LHRLFTVNTVSRGRGYAMQGMVVEHKWTGDGLLLTGLCRGSGGQRYRQNITFRDQPTLF
FT                   NLVHAMCTCPVGSRCKHSVALLITAARSMNTTMTGPAAHLQLVRDVPAPAPTWRTAIAS
FT                   ILDCDEPTSASARAVRPLALSFGASGHRPGQPVQVLTLRPMITGSRDNWIKTGASWRDV
FT                   AVGYMPEAQPAQVAALKQLYRHVTGGGYAAARDYLTLVAPPLGWLQILAEAVNAGVTLL
FT                   ADPSLRTRQVRLGTAELRYSVSEHPEGATLVSTTHIDGTPVAATNSGTFGRPEVHGMWS
FT                   LTEDALALGSFPAPVREHEVQTAREGTEILIPTADLDEFSVDVLPRLQVRRPVQVADGV
FT                   LAPPVITGPEAVLTVTDTNGGARYYWSVGYRVNDTHVVFDPTADAGSTSYRDARAETAL
FT                   WDEIRDDMGTLTLFCGTWQQQATAHLLTALALSMDDDLILEQERISPAPNAADAAHAAS
FT                   NRVLCAPVRLTPTELAVICGEALPELRLHPRIRVDYQCGTQYRAASASPTVAFTADETA
FT                   GNDWFSLDVTVTVGAVAIPITELITELSCGATHMLLTNGEYFSLDSPELAALAELLVEA
FT                   RSLGEIESGRVNARSLNATFWEELLALGTVDEQLARWRKRMAKLSAAKPPRTVAPSRRL
FT                   KAELRDYQQNGLNWLTFLWKNRLGGILADDMGLGKTVQTLALIARAVDAKRTSRFLVIA
FT                   PTSVVPNWVAECQKFVPGLRVSSITATEARTGLTVAEHVGDAHVVVTSYTLLRLLFDDI
FT                   DAYTWDGVIFDEAQFIKNHNGKTHQCARRIDSEFKLAITGTPMENNLMELWSLLSVTAP
FT                   GLFSSPTAFTDYYRKPIESNQAPERLETLRRRIKPVMLRRTKSQVAVDLPPKQEQSMVL
FT                   DLAGKHRKIYDTRLARERQKVLGLLGDWEKNRFQVFRSLSMLRQLSLHAALVDSSHDSV
FT                   NSAKVDYLIEQLPGLVDEGHSSLVFSQFTGFLDILRAHLDAEGIVYSYLDGSMSAKQRA
FT                   AAVQRFRSGAAQVFLISLKAGGFGLNLTEADYCFVCDPWWNPAAEAQAVDRAHRIGQQR
FT                   PVNVYRLVSADTIEERVVRLQERKRALFDAVVDDGELFGSAISAADIREMLA"
FT   gene            complement(421302..422087)
FT                   /locus_tag="Gbro_0374"
FT   CDS_pept        complement(421302..422087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0374"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19708"
FT                   /db_xref="GOA:D0LD88"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD88"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACY19708.1"
FT                   /translation="MTLTTSRPTRARSALPTLPRIAGVVGAVLVAAGVYGLAVWTSPGQ
FT                   LVDQTILDLCRRLTPVTGIPRVLVPQAVSNPLLWLVVGIVVVGLVAPTRRWGSLAAPVA
FT                   FPPVTVVVVQFLRDHVLARPQLHDWITETNSAPSGHAAAVTACAVVVMLATPRRFRPWV
FT                   AALLGTWAAVIEFGLIAAGWHRPSDVIISTVLVVGVGCLLPDPHTGPRASHVEWLLAGV
FT                   TVALAAPVLVAVYYPAGIAVATTVLVAGVVAVAITATGR"
FT   sig_peptide     complement(421971..422087)
FT                   /locus_tag="Gbro_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.525 at
FT                   residue 39"
FT   gene            422175..422690
FT                   /locus_tag="Gbro_0375"
FT   CDS_pept        422175..422690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0375"
FT                   /product="putative bile acid 7-alpha dehydratase"
FT                   /note="KEGG: bcj:BCAM1585 putative bile acid 7-alpha
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19709"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD89"
FT                   /inference="similar to AA sequence:KEGG:BCAM1585"
FT                   /protein_id="ACY19709.1"
FT                   /translation="MPSADDLARRLSHLEQIEDIKRLKHRYWRACDAKDPKTFRECFIA
FT                   SGARIDYGRLGAFDDVEPMARIFEKVATARIGGRFVVYDMHHGMHPDITITGAGTARGT
FT                   WSLRFRQVNTVERTETVVTGDYDDEYVIEDGRWKMSVCRFTERWAIRRPLGDAEIVGGT
FT                   FDVGDIGT"
FT   gene            422708..424222
FT                   /locus_tag="Gbro_0376"
FT   CDS_pept        422708..424222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19710"
FT                   /db_xref="GOA:D0LD90"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19710.1"
FT                   /translation="MVSVAVDERPQERAINRSGVLVVGLVAVVAAVLRLGPLLLRGTSG
FT                   RSFAFDESVYFLGAQHLWSGSLPYRDFVFVHPPGLLVGLGPATWLAAWTGDATALLVAQ
FT                   VVVALIGAACAGLVATLLLRYGAMAAVFGGGLYAVWSATVLAETAVLMESVLNLLVLIA
FT                   LVLLRRRRCAAAGVALGLALTVKLWAIVPLVVLAVWVAVRYGRRRVARFALGAVGAASV
FT                   VTLPFFVAAPGRMWTDVIAFQAGRPRSDTGMSRRAFFFTGNVIGYDLLSAAVWFTVGVI
FT                   LLLLAALPLVHALIRRRSPARWDDPAWWSALTLTLVLALLWSPTFYDHYAAFAAPPVCL
FT                   LAGYGVHVVAARMSGRIGGGVLGAAGVVVLAVLALGTLSVSGVRPEQPTGLADAVAGRD
FT                   CVWSYDPALLIAADVSGDQIARDCPMFVDRYATAIAEVDVTDADLDASLPSATDYQRQI
FT                   LDQGRGSDAVLITGAQLFELAPETIAVLREEFSFDRMVGGYQLWVR"
FT   gene            complement(424269..424787)
FT                   /locus_tag="Gbro_0377"
FT   CDS_pept        complement(424269..424787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0377"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ara:Arad_2928 phosphinothricin acetyltransferase
FT                   (antibiotic resistance) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19711"
FT                   /db_xref="GOA:D0LD91"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD91"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY19711.1"
FT                   /translation="MDIRDALQADLDAITAIYNDAVENTTAIWNERVVDVENRRAWMVD
FT                   RRAAGYPVLVADDDGDIVGYATFGDYRPFDGYRHTVEHSVYVRFDQRGRQVGWSLMVEL
FT                   IERARQLDKHVMIAAVDAENSGSIRLHEKLGFVPAGELRQVGTKFGRWLDLAFLQLTLD
FT                   DRVDPDGRS"
FT   gene            424870..425658
FT                   /locus_tag="Gbro_0378"
FT   CDS_pept        424870..425658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0378"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: vei:Veis_1964
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19712"
FT                   /db_xref="GOA:D0LD92"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD92"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ACY19712.1"
FT                   /translation="MSTTDLTGFVDAIVAGHLRVVDLTTPLSASTPSLVLPPPFANLID
FT                   FSLEEVSAYNEPGPFWRHNNIHTGEHIGTHLDAPVHWITGRDGDDVSQIPVQRLIGHAA
FT                   VLDLTARVADDPDYLLSVDDVQEWESEHRRLGAGDWLLLRTGWESRGGSQKDFLNADDT
FT                   GPHTPGVTADCAQWLATQRDITGLGVETVGVDAGLAGGFDPAFPVHHFFLGNNKYGITS
FT                   LRNLGELPPLGAVLIVTPLPIVGGTGSPSRVLAVVENAAR"
FT   gene            425655..427319
FT                   /locus_tag="Gbro_0379"
FT   CDS_pept        425655..427319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0379"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: vei:Veis_4212 thiamine pyrophosphate binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19713"
FT                   /db_xref="GOA:D0LD93"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD93"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACY19713.1"
FT                   /translation="MTAGTTVGDVVGQVLAGLGVGHAFGVVGSGNFVMTNALRRGGVPY
FT                   IAARHEGGAAMMADGYSRMSGRVGVLTLHQGCGLTNAMTGITEAAKSRTPMIVLAADSP
FT                   AAALRSNFRIDQEAMVAAVGAVSGRVYSASTVVADVTRAYRTAVTQRRTVILNVAIDVA
FT                   AAPADAPGPVRVDLTPTAVRPNRDAVMDLVALLRKSSRPVFVVGRGGRGAGPQIASLAQ
FT                   RSGALLATSAVANGLFVGEEYALGISGGFSSPTTAELISDADLIVGWGCALNMWTMRHG
FT                   RLIGESTTVVQVDDDVDAIGAHRAVDLGVVGDCGLTAADALILLAESGDPDPTGYRTPK
FT                   VAERITESARWQDVPVDDVSDDRRIDPRRLTIALDTVLPAERVVSIDSGNFMGYPATHL
FT                   SVPDEHGFCFTQAFQSIGLGVGTAIGAGIAQPGRLPVLGTGDGGFLMGISELDTAVRIG
FT                   LPLVVIVYNDAAYGAEVHHFGDADMSTVTFPDTDIAAIARGFGAVGITVRSLDDLSAVR
FT                   GWVSGYVATRAARPLVIDAKIADDGGAWWLAEAFAGH"
FT   gene            complement(427428..428381)
FT                   /locus_tag="Gbro_0380"
FT   CDS_pept        complement(427428..428381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0380"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19714"
FT                   /db_xref="GOA:D0L2T3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0L2T3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACY19714.1"
FT                   /translation="MEFIRTHQGHQVGADGLVWGVDSMCAVLCEHGIHIAPSTYYDHIN
FT                   RGPSARMFADAQVIDAIFALRRKRPLMRVLGSRKTWIVLRSSGIDVARCTVERVMREMG
FT                   WHGASKKKRVRTTIPDAAASRPADLVDRQFYAAAPNRLWVADFTYCRTKSGWAYTAFVI
FT                   DVFARKIVGWKVASEMTVNLVTDAINNAIDNRKRCGVVDLTRLIHHSDAGSQYTAIVFG
FT                   QRLAEEGIAASIGSVGDSYDNALAESVNSDYKNELVDNQPRFHGATELSLGTAEWVAFY
FT                   NRERPHSYCDDLTPDHAERLHYDHMRTLNPEGALTT"
FT   gene            complement(428384..428704)
FT                   /locus_tag="Gbro_0381"
FT   CDS_pept        complement(428384..428704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0381"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   ajs:Ajs_0906 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19715"
FT                   /db_xref="GOA:D0L2T4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0L2T4"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACY19715.1"
FT                   /translation="MAVAGSKRYSDELKRDAVDMVEQLVAQGSTEWAAMGKTADLLGVG
FT                   SAETVRQWVRKAPSGAASAPAKADSEEIRRLKREVAELKRANGILKAASAFFAAEIDRP
FT                   HR"
FT   gene            complement(429134..429586)
FT                   /locus_tag="Gbro_0382"
FT   CDS_pept        complement(429134..429586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19716"
FT                   /db_xref="GOA:D0LD96"
FT                   /db_xref="InterPro:IPR008691"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19716.1"
FT                   /translation="MTLTAGALLVAGCSDEASVGAPSTPATIANIDLPEPAQVWVEGEP
FT                   IPGLDETNLWCTRPDGAATFRLKGTDTSGDGTEMFVTDLTNSNPPQLVRTTFEIDGVRY
FT                   VTEPDRNRGSAEVEVNGNTYTVTGVAVDADTHTVSKAYEAVFGCYR"
FT   gene            complement(429722..430738)
FT                   /locus_tag="Gbro_0383"
FT   CDS_pept        complement(429722..430738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0383"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   mxa:MXAN_3034 putative ADP- ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19717"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD97"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACY19717.1"
FT                   /translation="MTLTPDQLDRVLGAVLGSAVGDALGVPYEFRRPVLADNEYAEMIG
FT                   GGLGDYAPGEWSDDTSMAVPILEVVATGADLSSDDALDAVAAGFLRWYDDFSGDPPDIG
FT                   NQTRALLAATRHRLDTEPGGRPGVVMRAESLAFAEAHPRSAGNGALMRTTPVALAHLDD
FT                   REDLARSARMIAELTHADVFAADSCVLWCEAIRVAILDGHIDIRAGVDLIDDNRRSRWR
FT                   QWLDSLHSDDPKSFSPNGYTVTALQAAGSAIIGTTRDDPSHLPHALHAAIRIGDDTDTV
FT                   AAIAGGLLGARWGAKAIPDEWRFAVHGWPLRAHGPTTAQDLTDLVHQQRRYAVRGIE"
FT   gene            complement(430735..432006)
FT                   /locus_tag="Gbro_0384"
FT   CDS_pept        complement(430735..432006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0384"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: scl:sce4345 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19718"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD98"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY19718.1"
FT                   /translation="MKFTAALDVDVVAHESADEVTVLLEIVAPEGKVTDRAPAALQVVL
FT                   DRSGSMSGPPLAGAQRALAGVIGQLDPRDVFGVVTFDDDAQVVLPAAPLADKARAVDAV
FT                   GSIVPGGCTDLSSGYLRGLQELRRATASAGIRGGTVLVISDGHVNRGIRDLDEFASITA
FT                   KAAADGIITSTLGYGRGYDETLLSAIARSGNGNHVFADDPDAAGAAIAGEVDGLLSKSA
FT                   QAVTLTVRYIQKVTELSLYNDLPAHQIGDGEVMIELGDLYAAEARKLLLRMKVDALASL
FT                   GLAQLAMLELRYVQTATLTEHTVTLPISVNVVPGDELGTRVPDPTVVSEKLYQEGQADK
FT                   LRASRAYEAGDLGAGNALLATASSKIRSAMMAAPAADHAAFDDELSMIDGLSAQAVTAG
FT                   SAYASKMSRDSYHAGNRKRGRKRS"
FT   gene            432071..432787
FT                   /locus_tag="Gbro_0385"
FT   CDS_pept        432071..432787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0385"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: tmz:Tmz1t_0345 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19719"
FT                   /db_xref="GOA:D0LD99"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LD99"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY19719.1"
FT                   /translation="MAARSSDRLTDYPRPSVAVDIAVLTVQSGGLQVVVQHDASGRAAL
FT                   PGRFVRERRTVEETVREVLELKLGLSPDHIRPHLLAVFSDPDRDPRGWTISIAHAVAIP
FT                   AGDLTDVVGELVPVTPDGRLASGERLLYDHDHIIAAATDSLRDRYEDKPDPDNLLRPPY
FT                   TLSELRELHEAILGRKLMRDSFNRRVQPLLAPQVDAAGTPVTRAAGGRPARLFAKDVPP
FT                   TATFGWRLPSVDETAG"
FT   gene            complement(432926..433441)
FT                   /locus_tag="Gbro_0386"
FT   CDS_pept        complement(432926..433441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19720"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19720.1"
FT                   /translation="MHKSFDPQVWRLALSCNGSDVRVGEVSLRAESCRRKVAFYLDDQG
FT                   EPVCQSLCPPDRIFPVLVTRIVAAHITADRAVLHVDATLPLHCAIGDVAFPGNELAGAR
FT                   MMDVTVVDASGHRRTVHAEIPSQVTVTGTVALALRAVRQPATAVTSVWPDRLSTTPARP
FT                   GGLPLGGG"
FT   gene            complement(433553..434572)
FT                   /locus_tag="Gbro_0387"
FT   CDS_pept        complement(433553..434572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0387"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: rfr:Rfer_1116 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19721"
FT                   /db_xref="GOA:D0LDA1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA1"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACY19721.1"
FT                   /translation="MHWGMRLVRRSTILLSGVAAATLVGAPPPSAVAAPGPTAASFDLQ
FT                   AHRGGRGEHTEESLRGFESALRLGVSTLELDIVLTRDLQPIIWHDPTIQADKCRDTAPA
FT                   TPGDRQFPYVGKVVHDLTYAQIATLHCDKNLADYPDAKPVVGNRIARLGDLFALTRKLG
FT                   AKHIGYNIETKIEAEKRWQSATPEQYVGVIVASVRAAASAQGAPIRATIQSFDWRTLPI
FT                   VARIAPDLPRVALWDTTTWKPGSRWLGPVSYAGVRGDVINGARQVASILSPDYDLSTKV
FT                   LVTRAHRLGLKVIPWTVNDPAAMNAQIDLGVDGLITDYPTRLRTILRERGMPLPAPVR"
FT   sig_peptide     complement(434471..434572)
FT                   /locus_tag="Gbro_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 34"
FT   gene            complement(434649..435023)
FT                   /locus_tag="Gbro_0388"
FT   CDS_pept        complement(434649..435023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0388"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: bja:bll7163 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19722"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA2"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACY19722.1"
FT                   /translation="MPQYFLTVPHDSADEPTMESMQEMDPTDLERLMAETTKLNNDLTE
FT                   SKVLVHAGGLHPPSSAIMVDATSTPPTHTPGPFVEADQYVGGFWIIDVADEAAALQWAE
FT                   RCSAAVGGAIEVRAFQEPPQ"
FT   gene            complement(435367..437085)
FT                   /locus_tag="Gbro_0389"
FT   CDS_pept        complement(435367..437085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0389"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   geo:Geob_0475 proton-translocating NADH- quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19723"
FT                   /db_xref="GOA:D0LDA3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA3"
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /protein_id="ACY19723.1"
FT                   /translation="MTQSALAAITPPSVEYAALSPMLIVFGVGVVGVLVEAFASRKVRY
FT                   PAQVVLSLGGLVAAFAALVAVADSESSGGDGQFAMSGAVVVDRPALFLQGLLLLVAVAG
FT                   VAFMAERRLERVVAPALQTVGTGAGTDADMFTPSGASVPNTEAEFEATRAGAVTTEVFP
FT                   LTMLTVGGMMLFPACGDLLTMFIALEVFSLPLYLLCGLARRRRLISQEASLKYFLLGAF
FT                   SSAFFLFGAALAYGASGSLNLSRIGESVTATTASGGDNTFALIGLGMLAVGLLFKVGAV
FT                   PFHAWIPDVYQGAPTPVTAFMAAATKIAAFGALLRVFYVAFPALHDQWKPALWAVAIAT
FT                   MLVGAVMAVTQTDVKRMLAYSSITHAGFILLGVIAFDDAGLAATLFYLAAYGFSTLGAF
FT                   ATIAVVREPDNTAADNPTSLRSQISHGQQARLPVSRSPHLSGREATNLSQWAGLGRRYP
FT                   LVGAMFSMFLLAFAGIPLTSGFIAKFDVFAAVAGTGGGVLVVIGVISSAIAAYFYVRII
FT                   VAMFFHDVPVDAPHVVKPSIFTTTGIAVCTVVTIALGVFPQPLLDLTEHAATFLR"
FT   gene            complement(437082..438689)
FT                   /locus_tag="Gbro_0390"
FT   CDS_pept        complement(437082..438689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0390"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   gur:Gura_4232 proton-translocating NADH- quinone
FT                   oxidoreductase, chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19724"
FT                   /db_xref="GOA:D0LDA4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA4"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ACY19724.1"
FT                   /translation="MNTPWLTILWVAPAIGALLVLAIPNRRPEIAKDIALAVSVLVLVL
FT                   AIGLAVGFDPNGARYQFVEDHSWIPAFGTRYALGLDGIGLVLVLLTAALLPLLILAGWR
FT                   DADEAGSLDAAGGRVQKTPHTYFALTLAVEAMVLMSFVALDILLFYIFFEAMLIPMYFL
FT                   IGGFGNGPRRSAAAVKFLLYNLFGGLIMLAAVIGLYVVTVQQGVGHNGAGTFSLRTISD
FT                   AVAAGDIDSGTGLAKLLFLGFMFAFAVKAPLWPFHSWLPDAAVAATPASAVLMMAVVDK
FT                   VGTFAMLRFCLQLFPDASQYFAPLICALAVIGIIYGAVLAIGQTDVMRLIAYTSISHFG
FT                   FIILGIFALTSQGQTGSTLYMVNHGLSTAALFLIAGFLVSRRGSRLIADYGGVQKVAPV
FT                   LAGTFLVAGLATLSLPGLAPFISEFLVLIGTFTRYPIAAIIASGALVLSAIYILWTYQR
FT                   MMGGPPKLSDVRASSMRDLAGRELVVVVPLIALLIALGVYPKPLLDIVDPAVGHTLTTV
FT                   GVHDPPPAVADSPPGGPR"
FT   sig_peptide     complement(438621..438689)
FT                   /locus_tag="Gbro_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.717 at
FT                   residue 23"
FT   gene            complement(438686..440635)
FT                   /locus_tag="Gbro_0391"
FT   CDS_pept        complement(438686..440635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0391"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: gme:Gmet_3344 NADH-plastoquinone
FT                   oxidoreductase, chain 5; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain L; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); NADH-Ubiquinone
FT                   oxidoreductase (complex I) chain 5/L domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19725"
FT                   /db_xref="GOA:D0LDA5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA5"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ACY19725.1"
FT                   /translation="MTIDQTASLLWLLPGLPLLGAVVLLIAGRGSDRWGHLLGTALALA
FT                   SFVLGLVMFVGMLSRSTDERAVSHTLFTWIPVAELHVDFGFQLDQLSMCFVLLITGIGS
FT                   LIHVYSIGYMADDPDRRRFFAYLNLFLAAMLVLVLADNYLGLYLGWEGVGLASYLLIGF
FT                   WQYKPSAATAAKKAFVVNRVGDIGLAIALMIMFATFGAVSFTAVFDGAGQAGETTLTAL
FT                   GFMLLLAACGKSAQVPLQSWLGDAMEGPTPVSALIHAATMVTAGVYLIVRSGPIFDLAP
FT                   HAQVGVVVVGAVTLLFGAIIGCAKDDIKKALAASTMSQIGYMVLAAGLGPAGYAFAIMH
FT                   LLTHGFFKAGLFLGAGSVMHGMNDETDMRRYGGLRKLMPITFITFGVGYLAIIGVPPFA
FT                   GFYSKDHIIEVAFASGGVKGLLLGGAALLGAGITAFYMTRVVILTFFGEKRWHDGTDAP
FT                   APHPHESPSVMTAPMVLIAIGSVASGFFLAFGGALEHWLEPVVAAGSEASGAGVTGEDH
FT                   AELGIPVWAMTVIILVVVAVGVGIAYWQYATRAVPEIAPDDVSALTVAARRDLYGDAAN
FT                   EALLMRPGQHVTAGLVEVENSGVDGLTSGVGAGIAGLSERIRGWQSGYVRSYALSMFAG
FT                   AAVITALVMVVNVL"
FT   gene            complement(440652..440951)
FT                   /locus_tag="Gbro_0392"
FT   CDS_pept        complement(440652..440951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0392"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   gem:GM21_4000 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19726"
FT                   /db_xref="GOA:D0LDA6"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA6"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ACY19726.1"
FT                   /translation="MNPENYLYLSALLFTIGAAGVLLRRNAIVVFMCVELMLNASNLSF
FT                   VTFARMHGSYDGQVIAFFTMVVAAAEVVVGLAIIMTIFRSRRSASVDDADLLKR"
FT   gene            complement(440948..441757)
FT                   /locus_tag="Gbro_0393"
FT   CDS_pept        complement(440948..441757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0393"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: reu:Reut_A0970 NADH dehydrogenase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19727"
FT                   /db_xref="GOA:D0LDA7"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA7"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ACY19727.1"
FT                   /translation="MTALLAAELTRTSTGEAVQFWVLGGVAVLGALGVVFATKAVYSAI
FT                   FLATTMIILAIFYVAQGALFLGVVQVVVYTGAVMMLFLFVLMLIGVDSSDSLVETLRGQ
FT                   RLAAAVIGLGFGILLIAGIGTASVATFAGAPAAGGSSTAGDGNVEAIAELIFVQYLWAF
FT                   ELTGALLITATLGAMVLAHRERFGPRMSQRELSVARFRQGIDMTPLPSPGVYARHNAVD
FT                   VPARLPDGSPARLSVNATLVTRDHDLGLRIDPSSNPTTPPASDEVQR"
FT   gene            complement(441754..442281)
FT                   /locus_tag="Gbro_0394"
FT   CDS_pept        complement(441754..442281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0394"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   gsu:GSU3434 NADH dehydrogenase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19728"
FT                   /db_xref="GOA:D0LDA8"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA8"
FT                   /inference="protein motif:TFAM:TIGR01971"
FT                   /protein_id="ACY19728.1"
FT                   /translation="MPDFLKPVSGLGVTFSGMFSPTITEQYPEQKEPTAPRYHGRHQLN
FT                   RHPDGLEKCIGCELCAWACPADAIYVEGADNTDDERYSPGERYGRVYQINYLRCIGCGL
FT                   CIEACPTRALTMTNDYELADDNRADLIYEKDRLLAPMPDDAQPPPHAMAPGSTEENYYR
FT                   GEITPDGQVAPR"
FT   gene            complement(442274..443575)
FT                   /locus_tag="Gbro_0395"
FT   CDS_pept        complement(442274..443575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0395"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: glo:Glov_3131 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19729"
FT                   /db_xref="GOA:D0LDA9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDA9"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACY19729.1"
FT                   /translation="MTAPLAADFPTLADFGHDPWWLILIKAVAVFAFLVANPLVAILLE
FT                   RKIMARMQSRIGPNRVGPRGALQSLADGVKLALKEGIIPSGVDKIIYVLAPIIAVVPAV
FT                   MAFAVIPFGPMVSVFGHRTPLQLTDLPVGVLYVLAITSIGVYGIVLAGWSSGSTYPLLG
FT                   GLRSTAQVISYEIAMGLTFAAMFLDATTMSTSGIVAAQDRHWYVLILLPSFVIYAISMV
FT                   GETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFMLAEYINMVTVSALATTMFLGGWMAP
FT                   WPLSAFDWANSGWWPILWFTLKVWVFMFVFIWLRTSLPRLRYDQFMNLGWKVLIPISLA
FT                   WVMVVAVIRAATTDASELTRALISAGAGIVVTALICYAIWRSMRLPDQPDEIDSAGETF
FT                   DPMAGGFPVPPLPGQVATRPSGSKPPTHKEMTDA"
FT   gene            complement(443572..445971)
FT                   /locus_tag="Gbro_0396"
FT   CDS_pept        complement(443572..445971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0396"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur
FT                   binding; molybdopterin oxidoreductase; ferredoxin;
FT                   molybdopterin oxidoreductase Fe4S4 region; KEGG:
FT                   rec:RHECIAT_CH0003638 NADH-ubiquinone oxidoreductase
FT                   protein, chain G"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19730"
FT                   /db_xref="GOA:D0LDB0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB0"
FT                   /inference="protein motif:TFAM:TIGR01973"
FT                   /protein_id="ACY19730.1"
FT                   /translation="MTLTHGNEPTTEADNLVGITIDGQEMRVPKSTLIIRAAEQIGVTI
FT                   PRFCDHPLLDPVGACRQCLVEVEGQRKPLASCTTTVADGMIIHTQRSSEVAEKAQRGVM
FT                   ELLLINHPLDCPVCDKGGECPLQNQAMSTGRSESRFDGIKRTFTKPVPLSSEVLLDRER
FT                   CVLCARCTRFSTQVAGDPLIELADRGALQQVSIYADEPFDSYFSGNTVQICPVGALTGA
FT                   AYRFRARPFDLVSTPSVCEHCASGCSQRTDHRRGKVLRRLAGDDPEVNEEWNCDKGRWA
FT                   FTYTTSADRITSPLLRHRDGDLREVSWAQALGAAAQGIRDAARGTGVLTGGRLTVEDAY
FT                   AYSRFARTVLGTNDIDLRARPHSAEEAEFLGAVVAGSPMRITYDDLSAAPAVLLVGFEP
FT                   EEESPIVFLRLRRAVRTAGQKVYALAPFASRGLTKLDGLILYTTPGAEADHLAADAVAD
FT                   AVSARGSVILAGERLAGSPGALRAAADLAARTGAGLAWIPRRAGERGALEVGAMPGILP
FT                   GGRPVADDDARAQICSAWGVDELPAQPGRDTAGILEAARYHGLSLLVGGVDLDDLPDPA
FT                   DAAAALEAAPFVISLEQRHSSVTRFADVVFPVAAVPEKSGTYVDWEGRPRAFTTALADT
FT                   GHLADHRVLDALAARLDVELRCDTPETIHLDLSRIGAWTGHRPLIDRVAAQPSRAPASG
FT                   QAVLATWHQLLDLGRLQDGEPHLAGTARRPVARLSATTAAEAGVADGGDLRISTTDGSI
FT                   ALPVAITDMPDRVVWVPTNSPGSQVYPNLRARAGDLVALSPAGGVR"
FT   gene            complement(445968..448088)
FT                   /locus_tag="Gbro_0397"
FT   CDS_pept        complement(445968..448088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0397"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, F subunit;
FT                   NADH-quinone oxidoreductase, E subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   NADH dehydrogenase (ubiquinone) 24 kDa subunit; Soluble
FT                   ligand binding domain; NADH ubiquinone oxidoreductase, F
FT                   subunit, iron sulphur binding; KEGG: rhi:NGR_c22070 NADH
FT                   dehydrogenase I chain F1"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19731"
FT                   /db_xref="GOA:D0LDB1"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB1"
FT                   /inference="protein motif:TFAM:TIGR01959"
FT                   /protein_id="ACY19731.1"
FT                   /translation="MSEPVFVELSVDPPVERPAPTLPAPAPTITFDGPVEYPPDVHERL
FT                   AAEAAAIIARYPQSRSALLPLLHLVQSEDGFITRAGILFCAAQLDLTAAQVASVATFYS
FT                   MYRRNPTGEYLIGVCTNTLCATLGGDDILGSVCEHLGIDPGDTTADSRITVEHVECNAA
FT                   CDFAPVVMVNWEFFDNQTPDTAIELVEDLRAGVPTEPSRGTGSLCSFRQTARTLAGLPE
FT                   GPTSPLTLPEVRGAVLRSEERASKGALATSLEGPRNQTTPTTQAAEPETIPVLSRHWQE
FT                   PDSWTLDNYLQHNGYQGLRKALDTPPDDIIELIKASGLRGRGGAGFPVGMKWSFIPQSD
FT                   DPDAPPHYLVVNADESEPGTCKDMPLMLASPHSLVEGVIIAAYAIRAHHAFIYVRGEVA
FT                   SVIRRLRTAVDDAYAAGYLGRDILGSGFDLELVVHAGAGAYICGEETALLDSLEGRRGQ
FT                   PRLRPPFPAVAGLYASPTVVNNVESIASVPPIIRNGVDWFRSMGTEKSPGFTLYSLSGH
FT                   VERPGQYEAALGVTLRELLDRAGGVRAGHQLKFWTPGGSSTPLLTAEHLDVPLDYEGVG
FT                   AAGSMLGTKALQIFDETTCVVGAVLRWTQFYAHESCGKCTPCREGTYWLVQLLKRLETE
FT                   GGTTADLDTLADVTNSIVGKSFCALGDGAGSPIVSSLKYFRDEYDAHLASGCPFEARFA
FT                   RTSGSGSQGGQR"
FT   gene            complement(448085..449425)
FT                   /locus_tag="Gbro_0398"
FT   CDS_pept        complement(448085..449425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0398"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: gur:Gura_4241 NADH dehydrogenase I, D subunit;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19732"
FT                   /db_xref="GOA:D0LDB2"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB2"
FT                   /inference="protein motif:TFAM:TIGR01962"
FT                   /protein_id="ACY19732.1"
FT                   /translation="MTDTTTGHAPGPKATRTYTVTGQDWEQIVSDVRTRAEQQPGDERI
FT                   VVNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEFRNWTQGVTFVTRM
FT                   DYLSPFFNETAYCLGVEKLLGITDDIPERATVIRVMMMELNRITSHLVALATGGMELGA
FT                   VTAMFLGFREREMILDLFELITGLRMNHAYIRPGGVAQDLPSDGVDKVAEVLEILPGRL
FT                   DELGDLLNDNYIWKARTQGVGYLDLTGCMALGITGPVLRSTGLPHDLRKSQPYCGYENY
FT                   DFDVITDTTCDSYGRYLIRVKEMRESIKIVRQCLERLRPGPVMVADRKIAWPADLALGP
FT                   DGLGNSPEHIARIMGTSMEALIHHFKLVTEGMRVPAGQCYVAVESPRGELGVHMVSDGG
FT                   TRPYRVHYRDPSFTNLQAVAAMCEGGMVADVITAVASIDPVMGGVDR"
FT   gene            complement(449425..450108)
FT                   /locus_tag="Gbro_0399"
FT   CDS_pept        complement(449425..450108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0399"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 30 kDa subunit; KEGG:
FT                   rme:Rmet_0929 NADH dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19733"
FT                   /db_xref="GOA:D0LDB3"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB3"
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /protein_id="ACY19733.1"
FT                   /translation="MTGPRDGSPDDPEVIGVRHGLFGALGTGDTSGYGGLIAPITLDAN
FT                   SSRPYGSYFDEIADLLETELSDDYSDAIEKVVVFRDEMTLHVSRTHLRQVALLLRNHPD
FT                   LRFELCLGVNGVHYPDDAGRELHAVYPLTSITHKRRLRLEVSAPDADPHIPSICDIYPT
FT                   NDWHERETYDFFGIIFDGHRSLTRIEMPDDWEGHPQRKDYPLGGVPVEYKGTRVAPPDR
FT                   RRSYN"
FT   gene            complement(450105..450659)
FT                   /locus_tag="Gbro_0400"
FT   CDS_pept        complement(450105..450659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0400"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: gbm:Gbem_3925 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19734"
FT                   /db_xref="GOA:D0LDB4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB4"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ACY19734.1"
FT                   /translation="MGLEERLPSGFLLSTVEELAGFMRKGSLWPATFGLACCAIEMMAT
FT                   TSGRYDLARFGMEAFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMVEPKWVLAMGVCA
FT                   SSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLLNAILKLHEKIQEMPLGVNRDEAI
FT                   WAAERAALQATPTIEMKGLLR"
FT   gene            complement(450703..451125)
FT                   /locus_tag="Gbro_0401"
FT   CDS_pept        complement(450703..451125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0401"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: geo:Geob_0462 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19735"
FT                   /db_xref="GOA:D0LDB5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB5"
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /protein_id="ACY19735.1"
FT                   /translation="MNAYVPIMVLGAIGAAFAVFSVFIAVAIGPKRYNRAKLEPYECGI
FT                   EPVEQSLVSTSVASSGARQRSAGAVVTGPVHRVPVKYYLTAMLFIIFDIEIVFLYPWAV
FT                   AFDALGWFGLLAMTLFIVNVSVAYAYEWRRGGLSWD"
FT   sig_peptide     complement(451042..451125)
FT                   /locus_tag="Gbro_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.724 at
FT                   residue 28"
FT   gene            complement(451268..451675)
FT                   /locus_tag="Gbro_0402"
FT   CDS_pept        complement(451268..451675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dda:Dd703_3124 multi-sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19736"
FT                   /db_xref="GOA:D0LDB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19736.1"
FT                   /translation="MTDATVSRALRVLVYSDDADTRAQVIGALGTRPDPAIPELSFIEV
FT                   ATAPMVFAQLDAGVVDAVIADGEATPSGGMGVAKQMKDELDPCPPTLVLLGRADDRWLA
FT                   DWSRADATATLPVDPIALPATFVAMVKKFLS"
FT   gene            complement(451744..452064)
FT                   /locus_tag="Gbro_0403"
FT   CDS_pept        complement(451744..452064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19737"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19737.1"
FT                   /translation="MSADHVEVEPAQLWATARALSAINDLSHTTLRDQDGVLATCAAGW
FT                   ATRSAVGYADFTTQLADFTAALSSRLDHLESTTRAAAARYENTDNDSARRIATAIEGTL
FT                   NL"
FT   gene            452163..452774
FT                   /locus_tag="Gbro_0404"
FT   CDS_pept        452163..452774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19738"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19738.1"
FT                   /translation="MRARLLSAVALVVIGIGGCSAVNESTFGETEDVSPQRLTELNDEL
FT                   RGLPTLDVTLEDYRRLRERLTLRIREVAPETYWRSSAIEGDRYPDHRQSCSGEWADTDG
FT                   RQVQLDRRVSAVPIGEAHWSEALAVVRETVAEYGLKQIGAYRDLPDDRDIRFSGPGGSA
FT                   LMFGTFKAAVLSIQTPCRLPAGPPAPISPPNPVTSQARGN"
FT   sig_peptide     452163..452228
FT                   /locus_tag="Gbro_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.634 at
FT                   residue 22"
FT   gene            453086..454495
FT                   /locus_tag="Gbro_0405"
FT   CDS_pept        453086..454495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0405"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19739"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDB9"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ACY19739.1"
FT                   /translation="MRIHPDGVVTADVTENPDDDAAREEQRQGLEIAAKALIAQAADVD
FT                   GDAERVFNAIRNGHISTNGAANTEDAMRAGAGQGGLTPFEPPEGKSPAEIKAYWDALPP
FT                   DQQHNLLQHRPDLLGNLDGIPSSVRHDANMRRLGGVLSALEARRKQLEKQIDDHVFGGL
FT                   LTNEDAELEQVKRKIADAGKLKELMNQDAWSEINPNGRMLLVLDMTTGEQGKAAISIGN
FT                   PDDADHIAVTTPGMNTNIRGSMTDMLSESNALRAETVSQLERAGAPGQKVATITWLDYE
FT                   PPDKGNTRPFADQYSWAEAMQQDRAVVGARDLARFYNCLEATSTRDDPHIVALGHSYGS
FT                   LTQGLALQESGGHPVDDAVFYGSPGFEASDEPELGLRQGHGYVMQGDDDDIRHVTSKGG
FT                   VGPNGPAPTSTQLEQLDVNARTTADGVAREGAHTHADYPRMGDRVGPDGEKTLRVSGYL
FT                   MARILAGLPPE"
FT   gene            454692..455165
FT                   /locus_tag="Gbro_0406"
FT   CDS_pept        454692..455165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0406"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   scl:sce3872 putative cyclase/dehyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19740"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC0"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ACY19740.1"
FT                   /translation="MPLVESSVVVPVSPEVAFAVSQTSGDIRLRWDPFIAKQHFLDGAT
FT                   EPGRGVRTFTRHRMGFTMVSEYVSYRPPTTVGMKMVRGPWFFAKLGGGWRFADHGDGQT
FT                   LATWRYNFGCRPSWLAPVAERIGAWWLGRDIDERIAGFAKGCADPVVLAAVGD"
FT   gene            complement(455177..456253)
FT                   /locus_tag="Gbro_0407"
FT   CDS_pept        complement(455177..456253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0407"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: sgl:SG0899 D-alanine-D-alanine ligase A;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP- grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19741"
FT                   /db_xref="GOA:D0LDC1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC1"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ACY19741.1"
FT                   /translation="MPTPLLRLVVLFGGVSAEHDVSRVTAAHVLAAADRGKYELVPIGI
FT                   AKDGTWLRNDKAIAALTDGTPLPDALDVAGTVVDPLTELAAHAADTPTVVLPLLHGPHG
FT                   EDGTIQGMLELFKLPYVGAGVLSSALCMDKAMAKVVAAQAGIPQCRWLEFRDGVDDPNT
FT                   IVADAVGQLGLPIFVKPANLGSSVGITKAHDEAELDTAINVALRYDNVVILEEAVTGRE
FT                   VEVAVLGDTAPETSVPGEIEPGSEFYDYEDKYITGAAKLVIPAPLSEEATAQVRELASK
FT                   TFTAMRCTGMARVDFFYEESGRGWLLNEVNTIPGFTPGSMYPKLWEATGISYPDLIDQL
FT                   VTFALGVHRRRVGFSTEH"
FT   gene            456319..457629
FT                   /locus_tag="Gbro_0408"
FT   CDS_pept        456319..457629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0408"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamin
FT                   opimelate/D-alanyl-D-alanylligase"
FT                   /note="TIGRFAM:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-di aminopimelate/D-alanyl-D-alanylligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: hch:HCH_05887
FT                   UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19742"
FT                   /db_xref="GOA:D0LDC2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC2"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACY19742.1"
FT                   /translation="MASEIAEVVGGQLVGDDVAVNGATIDSRSVSTGQLFVPIVAARDG
FT                   HDFISAALDAGAPAYLTSAGAVDGAAGAAIIVDDTARALAALGAAARDRLPGRVVGVTG
FT                   SVGKTSTKDLLAGLLATTFRTAASEKSFNNELGLPLTLVNAPDDTEAVVLEMGARGIGH
FT                   IDLLCSIGKPTVGIITRVEGVHLELFGNIEAVARAKGELVEALPDDGIAVLNADHKHVA
FT                   AMADRTSARVITFGLTPESDVHASAVVIDDELRASFRLHSPWGETDIRLAARGEHQVPN
FT                   ALAAVAAAGGLGVPLEKFAEGLLGAALSGLRMELVTSERGVTILNDAYNANPTSMSAAL
FT                   QSLAALAAGRRIAVLGTMAELGHDSAWQHEAIASQARELGIEVIAVGEPTYGADVRHVA
FT                   DVAAASAELSDLGAGDAVLVKGSRVAELERVAQALLN"
FT   gene            complement(457728..458507)
FT                   /locus_tag="Gbro_0409"
FT   CDS_pept        complement(457728..458507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0409"
FT                   /product="TipAS antibiotic-recognition domain protein"
FT                   /note="PFAM: TipAS antibiotic-recognition domain protein;
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR; KEGG:
FT                   mxa:MXAN_5120 transcriptional activator TipA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19743"
FT                   /db_xref="GOA:D0LDC3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC3"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ACY19743.1"
FT                   /translation="MICVSNGKQTGDLTVGAVAGLVGVSVRTLHHYDQIGLVVPSGRTP
FT                   AGYRVYDDADVERLHQVLTYRELGFPLEQIATLLDDPDPHRHLETQRDLLRERIDRLHR
FT                   MVAAVEDMMTAKKTGIQLTAAEQADIFGDDWTGDEYATEAEQRWGDTDAWKQSRQRTAQ
FT                   YTKADWQRIKDETDAFEARIADAMRRGVDPGSAEADELAEAHRASIEQFYDCSHEMQVC
FT                   LADMYVADPRFTAHYDGIASGLAVYLREVIRANAAKH"
FT   gene            complement(458543..459007)
FT                   /locus_tag="Gbro_0410"
FT   CDS_pept        complement(458543..459007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100077275"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19744"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19744.1"
FT                   /translation="MRSMLRTPHRLVSFGIGTLATGALALSLAGCGSEQEVGSSATSEP
FT                   LALSSSAPVVGGPRPQSPATTSSAESVSSSAAEAGHVCRKIPGPDGALRVIIVAGNVSC
FT                   ATATEVANEYGPKIATGSQQQVSGWTCGPSDIEGMLAACVKGSDVIGFTP"
FT   sig_peptide     complement(458930..459007)
FT                   /locus_tag="Gbro_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.719 at
FT                   residue 26"
FT   gene            459065..460318
FT                   /locus_tag="Gbro_0411"
FT   CDS_pept        459065..460318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0411"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: gur:Gura_1716 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: queuine tRNA-ribosyltransferase; tRNA- guanine
FT                   transglycosylase, various specificities; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19745"
FT                   /db_xref="GOA:D0LDC5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC5"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ACY19745.1"
FT                   /translation="MSSLQTPDQSFAVGTRLPGAKGRTGVITTPHGQIHTPAFVPVGTK
FT                   ATVKTVLPESVAALGAQAVLANAYHLYLQPGPEIIDEAGGLGAFMNWPGPTYTDSGGFQ
FT                   VMSLGAGFKKVISMDPNHTPDDELTANGKERLSRVDDDGVTFKSHLDGSAHRLTPEVSM
FT                   QIQHQLGADIIFAFDELTTLMNTREYQENSLERTRLWAIRCLAEHNRLTAQRSHRPPQS
FT                   LWGVIQGAQYEDLRRKASRDLVEMSRRDVEQGGRGFGGYGIGGALTKDDLGTIVGWVND
FT                   ELPEDAPKHLLGISEPDDIFTAIENGADTFDCVSPTRVARNGAIYSLDGRYNITNARYR
FT                   KDFRPLDPEIENYTSQYSRAYLHHLFKAKEGLAATLATLHNVSFVVTLVDRARQAIEDG
FT                   NYAEYRDEFLGRYYAGAS"
FT   gene            460512..461891
FT                   /locus_tag="Gbro_0412"
FT   CDS_pept        460512..461891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0412"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   shl:Shal_2699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19746"
FT                   /db_xref="GOA:D0LDC6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC6"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACY19746.1"
FT                   /translation="MLTALGILAGIVVVLAITALTGYFVAQEFAYMAVDRSRLKARAEA
FT                   GDAAAGRALTVTRRTSFMLSGAQLGITVTGLLVGYVAEPLIGSGFGDLLNGVGVPVAVG
FT                   VAIGTVLAVLFSTVVQMVFGELFPKNLAIARPEPVARWLARSTTIYLAVFGWLIALFDK
FT                   SSNLLLRVLRIEPVHDVEHSASVRDLEHIVAESRDAGELPPELSVLLDRVLDFPTRTAE
FT                   HAMIPRPRVDHVEADAAAADVMTLMGTGHTRYPVLDPATDEVHGVIHLHDLLDWSAESA
FT                   ATPPTADPAATARDLCRPAVVVPSTLPLPEVLEQLAATDDEMAIVIDEYGGFAGVVTAE
FT                   DIAEEVVGEIDDEHDPESTEPIARDGDGWRMRGDVHLDEASRTIGHELPEGDYETLAGL
FT                   VIAEFVGLPKVGDTVTITLEPDPAELADGDDAPERELRATVLEVDKRVPSSVRIEEVRG
FT                   E"
FT   sig_peptide     460512..460604
FT                   /locus_tag="Gbro_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.269 at
FT                   residue 31"
FT   gene            461884..462885
FT                   /locus_tag="Gbro_0413"
FT   CDS_pept        461884..462885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0413"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   KEGG: shl:Shal_2700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19747"
FT                   /db_xref="GOA:D0LDC7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC7"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACY19747.1"
FT                   /translation="MSNPWVVALVTVVLIAASAFFVAVEFALIAARRHRIEDAAATSRS
FT                   ARAALRSASELSVLLAGSQLGITVCTLALGAVTKPAVHHWLTPATSGWGAPMWVADVAG
FT                   FVLALIIVTFLHLVVGEMAPKSWAIAHPERSAVLLALPMRAFMWLTRPVIVVLNRLANW
FT                   CLVKVGVQPVDQVATGQDSDALRHLVEHSATVGTLDERYHAHLTSALELESLTVADVVR
FT                   PSGELGAVGRDASGDDIRSAARSSGHLRLLVRGAGGDVDGVVHVRDSLGSEQTAADLMR
FT                   PVLTLDIDEPVYAALARMRETRTHLALVTDGGRPVGLITLNDVLQRLMATAA"
FT   sig_peptide     461884..461967
FT                   /locus_tag="Gbro_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.633 at
FT                   residue 28"
FT   gene            complement(463105..464034)
FT                   /locus_tag="Gbro_0414"
FT   CDS_pept        complement(463105..464034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0414"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   catalytic domain; KEGG: acp:A2cp1_0317 glutamate--tRNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19748"
FT                   /db_xref="GOA:D0LDC8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC8"
FT                   /inference="protein motif:PRIAM:6.1.1.17"
FT                   /protein_id="ACY19748.1"
FT                   /translation="MSATAPAGRFAPSPSGELHVGNLRTAVLAWLFARTTGRRFLLRME
FT                   DLDRTAVGADAGQIADLRALGIDWDPPVIYQTTRRESYRAIVEELRDEGRTFECFCTRR
FT                   EILEAPSAPHAPQGAYPGTCRDLTDAQRAERQASGRPPAIRIRADVTTFEVHDVLHGDY
FT                   RGMVDDFVICRNDGTPAYNLAVVVDDAAESIDQVVRGDDLLSSAPRQAWLATVIGASPP
FT                   TYAHVPMVLNADHVRLSKRDGAVTLADLAADGVSPTTVLSHIAHSLDLAARDEFVDLDL
FT                   LARRFDPDALPREPWILTASEWASPGAG"
FT   gene            464156..465196
FT                   /locus_tag="Gbro_0415"
FT   CDS_pept        464156..465196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0415"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; ATP dependent DNA
FT                   ligase domain protein; KEGG: afw:Anae109_4038 ATP-dependent
FT                   DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19749"
FT                   /db_xref="GOA:D0LDC9"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDC9"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ACY19749.1"
FT                   /translation="MPPISPMLAKAVTDIPAQPDDADPVWSYEPKWDGFRALIFRDGDE
FT                   VSIGSRGGKDLARYFPEIVAAAKEELPEKVVLDGEIGVPAEIGGTHRLDWDTLAQRIHP
FT                   AASRVNMLAETTPAIFIGFDALALESADVMAEPFEVRRDTLLRAVGPGGRDRRFHVSRV
FT                   TADPTLAQDWFSAFEGAGLDGVVGKRLAGTYVEGKREMVKVKHKRTADCVIIGYRVHKS
FT                   GTGVGSMLLGLHTDDGDLHMVGGSSAFSDKKRIELQEQFEPMRLDPDKPAAGEPTRWRS
FT                   EKSGEWIPIRPELVAEFAYDQMENHRFRHTVKFLRWRPDRDPESCGYDQLEVPLTYDLH
FT                   DVLEGA"
FT   gene            465198..466280
FT                   /locus_tag="Gbro_0416"
FT   CDS_pept        465198..466280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0416"
FT                   /product="DNA primase small subunit"
FT                   /note="PFAM: DNA primase small subunit; KEGG:
FT                   afw:Anae109_2830 DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19750"
FT                   /db_xref="GOA:D0LDD0"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD0"
FT                   /inference="protein motif:PFAM:PF01896"
FT                   /protein_id="ACY19750.1"
FT                   /translation="MASRSPAEELDVDGVPVRMSNPDKIYFPELGENGGRKRDLVGYYR
FT                   TMALGPDGSDGPIMRALRDRPTFLQRFPDGVEGDEIYQKHIAKKRPEHVQSTRIVFPSG
FT                   RTGDAIKPTVPADVVWGANLGTVTFHSWPTVDPDNDHPDQLRIDLDPQPGTTFDDVRRV
FT                   ALDGLRPLLEELGFTGFPKTSGGRGVHVFVPIEPKWDFIATRRAVIALARELERRDPDS
FT                   VTTSWWKEERGERIFIDFNQNARDRTMASPYSVRRSAIGRVSTPVTWEELADVDPDDCT
FT                   MTTVPTMISDRGDPWADIAKHRKGIERLLEMVQADDANGLGDMPYPPSYPKMPGEPPRV
FT                   QPSKKVAEHWDEKGNRVEGA"
FT   gene            complement(466290..467234)
FT                   /locus_tag="Gbro_0417"
FT   CDS_pept        complement(466290..467234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0417"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   pca:Pcar_0890 K+-dependent Na+/Ca+ exchanger
FT                   related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19751"
FT                   /db_xref="GOA:D0LDD1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD1"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ACY19751.1"
FT                   /translation="MTEYVLVVAGLAGLILGAELLVRGGSAIATRLGVSPLLVGLTVVS
FT                   IGTSLPELAVGIDATLNDAGPLAVGNIAGTNIVNILLILGLSAALVPLALRPQTVRFDL
FT                   PVMVISALLLLILCANGTLSRYDGLALVAIAVAYTVWSIRQELVTRDTLPLENHTAQDA
FT                   GSMWWRGAQLVAGIGVVVIGAEWLVDGSVQVATDLGVSEAFIGLTIIAIGTSAPELATT
FT                   VMSTIRGDRDLAIGNLIGSSVYNVTFILGATALVRPLEVTDELIRIDIPLMAAVALLCI
FT                   PVFITGRKVTRAEGVGFVLVYCVYLGLLIAFRT"
FT   gene            467307..468410
FT                   /locus_tag="Gbro_0418"
FT   CDS_pept        467307..468410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19752"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19752.1"
FT                   /translation="MQRRILSRRLGILVVLAVALTGLVLPSSVTGAHAAPVFRPHIDVF
FT                   AADGVTPIGNTVVHPGDTLVVKGRGLDPNANRGGGFPLPVPPGVPHGTFIAFGAFAPHW
FT                   KPSAGAPESARAATRLGVQWALAPSALAQVPSAPFDMRRTIRQQWVPLSPQGTFTARVV
FT                   ASTPKDTPAGARYGVYTYGAAGAVNAAQELSVPINYSTTPGANTPKPAPRNLIWAYSPS
FT                   FYRTVTKQLQGGVYGTDGAGVDDAGRLTFALRDGAVRNGNGVLRFRGTIVAFTRFHLSE
FT                   IALADPVIRVANGRGVLSMRTSTTNTNGTDALRRIDIADVDLSRIGNGRDVFGASVRFR
FT                   PGITPEALALLSVGPAAPLDLRFPVAR"
FT   sig_peptide     467307..467411
FT                   /locus_tag="Gbro_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 35"
FT   gene            complement(468683..468901)
FT                   /locus_tag="Gbro_0419"
FT   CDS_pept        complement(468683..468901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19753"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19753.1"
FT                   /translation="MTAESFDPERISSPDMRAMFTFLSGDGYSVDIPALHERFPDVGWQ
FT                   SSPSGRQRRFGAELLSRYSAGWPSTAC"
FT   gene            complement(468898..469578)
FT                   /locus_tag="Gbro_0420"
FT   CDS_pept        complement(468898..469578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0420"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: rlg:Rleg_2481 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19754"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD4"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACY19754.1"
FT                   /translation="MSNETAPVVVVGATGGQGGAVLDALLDAGRPVRAIVRDPSSGRAT
FT                   KLADRGVALATGDMVSGAGLADAFTGAAGVFALTTPFETGVDAELVQGRALISAATEAQ
FT                   VPYLVFSSVASANLGTGVPHFESKYEVEKLLAASDIAHTVVGPSYFYDNLLGGADALQA
FT                   GVMPLAMPADKELQQLSRRDLGRFVAGLFDDPQAHVGERFDLASDAPTPNQMAATLSDV
FT                   LGGA"
FT   gene            469718..470362
FT                   /locus_tag="Gbro_0421"
FT   CDS_pept        469718..470362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19755"
FT                   /db_xref="GOA:D0LDD5"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19755.1"
FT                   /translation="MRRRVMAGVLLSVGMLAAAPAVTAEAAPATTVRSGMEIDVEESIL
FT                   TQSKCTLGAVVSPTRAITAGHCGEVGRAVYNARGTRIGTISANRITKGLDIAVIRLAPR
FT                   QRVQVDRIDWNAGFFRGQVVTKNGVTTGFSRGVVTDPKPTKRTARGIVWAPPFLLQHST
FT                   VSVRTNLLSKAGDSGSGVRDASGRIVGILSSGSSDRNTAVAPVSMLPGYLR"
FT   sig_peptide     469718..469798
FT                   /locus_tag="Gbro_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.585 at
FT                   residue 27"
FT   gene            470530..470618
FT                   /locus_tag="Gbro_R0008"
FT                   /note="tRNA-Ser4"
FT   tRNA            470530..470618
FT                   /locus_tag="Gbro_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(470669..471052)
FT                   /locus_tag="Gbro_0422"
FT   CDS_pept        complement(470669..471052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0422"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   ade:Adeh_2871 death-on-curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19756"
FT                   /db_xref="GOA:D0LDD6"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD6"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ACY19756.1"
FT                   /translation="MTEFLDLEDLITISALATGIDAEVRDYGLLESAVARPRTTVFGED
FT                   AYPDLHLKAAALLQSLTRNHALIDGNKPTAWVACLTFLGINDQWITAPEDDRFDFIIRV
FT                   ATGQDGELESIAAQLRAWSDPGR"
FT   gene            complement(471049..471255)
FT                   /locus_tag="Gbro_0423"
FT   CDS_pept        complement(471049..471255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19757"
FT                   /db_xref="GOA:D0LDD7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19757.1"
FT                   /translation="MGMTLRTSEAQTEALRRQAELEGRSMQAVALSAIDEYIARRAHTD
FT                   KVERAARRVVDEQAGLLERLKDA"
FT   gene            471329..471420
FT                   /gene="ffs"
FT                   /locus_tag="Gbro_R0009"
FT   ncRNA           471329..471420
FT                   /gene="ffs"
FT                   /locus_tag="Gbro_R0009"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            471502..472758
FT                   /locus_tag="Gbro_0424"
FT   CDS_pept        471502..472758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0424"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   scl:sce6239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19758"
FT                   /db_xref="GOA:D0LDD8"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD8"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACY19758.1"
FT                   /translation="MSSDQLRATQLDLKKLYDELCAAGLKLDLTRGKPAPEQLDLSNEL
FT                   LSLPGEKYKADDGTDTRNYGGIKGLPELRSIFGELLAVDPDNLIAFGNSSLELMHDLTA
FT                   FALLTGTPDSDGPWHGQKVKFLCPAPGYDRHFAITENYGIEMIPVPMLPNGPDVDVCAE
FT                   LTANDPSIKGMWAVPTYSNPTGVTFTEEVTRGLLSMPAAPDFRIYWDNAYAVHTLVDAP
FT                   PTPLPVIEMAAEAGNPNRVYVLGSTSKITFAGAGVSFFGSSQANVDWFTKHLSFKTIGP
FT                   DKVNQLRHAMFFGDADGVRAHMARHREILAPKFQMVLDILSDRLAESKVATWSEPEGGY
FT                   FINLDVLDGAAKRTIQLAKDAGIALTGAGSAFPYKTDPYDRNIRLAPTFPSTDDLRVAM
FT                   DGVSTCVLLAATETLLGKS"
FT   gene            complement(472761..473603)
FT                   /locus_tag="Gbro_0425"
FT   CDS_pept        complement(472761..473603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19759"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19759.1"
FT                   /translation="MLVIRRNLRIVTAIVLASALFVAACSDVTPSDGASSTAADSARSY
FT                   SFPIALGSMTTVWQASPGISLTTPDATLVRAFFESRFIVEVLGMPYAFPGFADTVRIVQ
FT                   NSIYDIPEGHPSADDRRAGTRRLMLLSLARTDDRLDALVCDDQAGLYFEKNIGHKHRGL
FT                   PPLFDLRDGRWFMPDAFPYSVSLRKSGTSVWHPTVDRDTDRAPNWNAFTGWTAKQNRLN
FT                   LDGSNSILCSNWASRNYPGIPSGQSQGAPQRIYPTGPTDPAFQPTLPQSPGWTRLGQR"
FT   sig_peptide     complement(473523..473603)
FT                   /locus_tag="Gbro_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.505 at
FT                   residue 27"
FT   gene            complement(473640..476090)
FT                   /locus_tag="Gbro_0426"
FT   CDS_pept        complement(473640..476090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19760"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19760.1"
FT                   /translation="MSTPAAFDVTLWQPQMMLPVAADLRTMARTILDQGNPTYNAVVGL
FT                   DRTSDWVGKSRGAADDRADAVKKWLFNISDNLSDVATSIEKGCENIANQKSYLDKLTAE
FT                   ADDAGYVLSDPMDASWPLQLKTGREEKSGDPDAMRSWSGRLVAQANDTFTAVNDFARSL
FT                   TVELGQITTLTPPQLALNGTMGTRDVAMARDGWTPDEIRRVAQHLKDAQLTPEQIQALR
FT                   NGGTANVPPGLVSYLRNLYNGLSPKDALALRYALNGLGDGSGRAFANGITSLSSERVAG
FT                   GGTAGGFSELPKWMQDMMTERVPVDRPENYDGFARSFALGQLLSGATVPPGVRTGTELT
FT                   LKTANLAAAARSRFGVDSYMADFALRSEWGVDNGLADPTGTDGRIASPARYHSTMEALL
FT                   NTGLINHESATTVLTGQGPGLPENYDRAATIEHLASHDWRDHGAVLGHLTDWIDDYALD
FT                   QQDGYKPELSARAFRGLFDATTGPQQFDHLMNIGGADKPALGDINPLFAKALEEASHPY
FT                   FNVLAGGNPYNYGFNPGAADHLIGLGDPKEGELTRDFDLQDRVRRLFGLISSGDTNPPG
FT                   LTGLTAREQLIQDIGYRQSVNAGMVPDALRQGNGFDADIAARNGWLQHLLRDGVTANSF
FT                   DNWFDARPGDQRIDAQDFNSIKSNVNTIVKEGIKLLPIPGSSYVATGAGMLIDWAHAPT
FT                   STPPHEGIAPTRVGVDDTLLEQHWAAWMATHPQAIPGNKIDALLFYPDGSLKPLGVVVA
FT                   ENNSDTAKHPTISEPTLVQIIVKRLQAQGLDLTNYDATYNRYAGDDDDAISADEYDKEL
FT                   LGRK"
FT   gene            476696..479020
FT                   /locus_tag="Gbro_0427"
FT   CDS_pept        476696..479020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0427"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dal:Dalk_1998 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19761"
FT                   /db_xref="GOA:D0LDE1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE1"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACY19761.1"
FT                   /translation="MALYRTYRPATFADVVGQEHVTDPLSHALDAGRINHAYLFSGPRG
FT                   CGKTSSARILARSLNCVQGPTSTPCGECVSCVALAPGGPGNLDVIELDAASHGGVDDTR
FT                   ELRDRAFYAPAESRYRVFIVDEAHMVTNAGFNALLKIVEEPPEHLIFVFATTEPEKVLP
FT                   TIRSRTHHYPFRLLAPPVMRGLLERICAQEHVTVAPEVYPLVIRAGGGSPRDSLSILDQ
FT                   LLAGADDRGVTYDRALALLGVTDIALIDDTIDALATGDGATLFGTVEKVVDAGHDPRRF
FT                   AVDLLERLRDLILLQAVPDAAERGLVEAPGDQLARMNRQIETLGAASLTRFAELVHAAL
FT                   GEMRGTTSPRLLLEVMCARMLLPAVSADEIAVLQRLERLESGVRASVPIPAAPSEPEPE
FT                   PKFVRPSQRKAMEEAKASAVAERTEAEEAEADDVQGIEPGAVGVDGEPVRGGGTPTAPQ
FT                   PPARTPAARVEPEPEPQPAPVPEPEPREPEPVASREPEPEPEAEPVVSQEPETQHVASR
FT                   DPEPQPGAPREPEPRSVAEPAPETESIVAEDIPLPDEPFDEYDAPPDEPSSPRRAPDPE
FT                   PEPEAAPTVPGLDADTLRKRFQEVRAAVRAQSPQGKTVEPMLSPATVHDLDGDVVVLSH
FT                   PTELLVGRLSAPHNVAIIRAALQEVFGTPLDVRTIHVPPGAAAPAGAPRQSRTAQQSKP
FT                   RQTFSRPSRARDQGAPSAPAPEPVAEPEEPEPPRADEDIPDEERKEMVADAQAASPEGR
FT                   HDPDKVALELLKTELGARPLE"
FT   gene            complement(479156..480478)
FT                   /locus_tag="Gbro_0428"
FT   CDS_pept        complement(479156..480478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0428"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   psa:PST_0156 cyclopropane-fatty-acyl- phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19762"
FT                   /db_xref="GOA:D0LDE2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR020803"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE2"
FT                   /inference="protein motif:PFAM:PF02353"
FT                   /protein_id="ACY19762.1"
FT                   /translation="MTTFKDSSSSGLEISSGKMTLAEIFESLMGGNLKIRITAYDGSAA
FT                   GPPDAKYGLNLKTPRGTTYLVTAPGDLGLARAYIAGDLELVGAHPADPYEALRALAGDL
FT                   EFTRPSALTLAQVARSLGIEHFKPIAPPPQEAVPRWRRFAEGFRHSKSRDAEVIHHHYD
FT                   VSNTFYEWVLGPSMTYTCAVYPDRDASLETAQDNKYRLVFDKLRLKPGDRLLDIGCGWG
FT                   GMVRYAARRGVKVIGATLSAEQAEWAQKAIADEGLGDLAEVRHSDYRDVPEGDFDAVSS
FT                   IGLTEHIGVSNYPAYFGFMRDKLRDGGMLLNHCITRPDNSSRSRAGSFIDRYVFPDGEL
FT                   TGSGKIISKLQDIGGMEVVHEENFREHYAMTLRDWNRNLVEHWDEAVEEVGEGTARLWG
FT                   LYMAGCRIGFDRNIIQLHHVLATKLDKQGRSNLPLRPWWQA"
FT   gene            complement(480475..481857)
FT                   /locus_tag="Gbro_0429"
FT   CDS_pept        complement(480475..481857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0429"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rfr:Rfer_0825 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19763"
FT                   /db_xref="GOA:D0LDE3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE3"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACY19763.1"
FT                   /translation="MGARAFDQGVSTLLESYRAIPPEATVRLAKKTSNLFRKRAANPHP
FT                   GLDVSGLDRVISVDPDARTADVAGMCTYENLVAATLPYGLAPTVVPQLKTITLGGAVTG
FT                   LGIESTSFRNGLPHEAVREIDILTGSGEIITATPEGEHSDLFFGFPNSYGTLGYSVRLK
FT                   IELEQVPPYVELRHIRFRSLAELQSTMEAIVTDRSFDGQPVDYLDGVVFSADESYLTLG
FT                   RQTAETGPTSDYTGMDIYYRSIQHKQNDRLTIGDYLWRWDTDWFWCSRAFGAQNPRIRR
FT                   FWPKRYLRSSFYWKLIALDQRYDIGDRLNARKGEPPGERVVQDIEVPIENTTAYLEWFL
FT                   QNIPIEPIWLCPLRLRDPALPGADPARPWPLYPLEPHRTYVNVGFWSAVPVTPGDPGHT
FT                   NKMIEAKVAELDGHKSLYSESFYSPEDFDELYGGEHYRLLKKRYDPRGRLLDLYAKAVK
FT                   RQ"
FT   gene            481937..482377
FT                   /locus_tag="Gbro_0430"
FT   CDS_pept        481937..482377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0430"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19764"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE4"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ACY19764.1"
FT                   /translation="MGQISATQSIDIAAAPDAVIGALADYNEVRPAILPEQYRDYAVIK
FT                   GGNGDGTVVHWILQATSKRQRDVKATVSVVPDTVTERDENSTMVTTYQVSAAGNGSKVT
FT                   TTTTWNSQASGIGGFFEKTFAPKGLARIQAALLANLKKRLES"
FT   gene            482388..483341
FT                   /locus_tag="Gbro_0431"
FT   CDS_pept        482388..483341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0431"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: lch:Lcho_4309
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19765"
FT                   /db_xref="GOA:D0LDE5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE5"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACY19765.1"
FT                   /translation="MRRRRPSPLPIRDGVDATRVVLRAGPESTIGDCLRTTPALADLTD
FT                   DDLRLRAQAGEIVDAAGDPVSLDAPARLNTAIYLYRDLPDEVPIPFELPILYADENIVV
FT                   VDKPHFLATMPRGRHVTETALVRLRRQLGSDDVAPAHRLDRLTAGVLLFTLRREVRAAY
FT                   QDLFATRAATKEYRALAPVDDALTTTVTIRNRIEKTAGDLRARVVDGPVNAISDITLLS
FT                   DAGLYRLVPHTGRTHQLRLHMASLRVPIVDDPLYPDVRPELAQRPDVGDFSAPLRLVAH
FT                   ALEFTDPFTGERRRFESRRSFPPAQPASGRGGSTSG"
FT   gene            483417..484052
FT                   /locus_tag="Gbro_0432"
FT   CDS_pept        483417..484052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0432"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: dal:Dalk_4724
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19766"
FT                   /db_xref="GOA:D0LDE6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACY19766.1"
FT                   /translation="MTTSIDFITLTVPDVDAAKAFYRTAFGDALGDRLRFAEGADTTSG
FT                   FRGYVLSLVVADPVVADSFLEPALEAGATEVKPAKKSFWGYGGVIAAPDGALWKVASSK
FT                   KKATGAPARQLEDVVLLLGVDDVAATKEFYVERGLAVAKSFGRKYVEFQSEPQSVTLAL
FT                   YGRRAAAKDAGVPADGSGSHRLTIGGGIGPCTDPDGFVWTPHSVPARG"
FT   gene            484068..484394
FT                   /locus_tag="Gbro_0433"
FT   CDS_pept        484068..484394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19767"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19767.1"
FT                   /translation="MMVPMSVQLCCLLWARPGRRAELSAYEDKVLPLVADHGGTVVSRV
FT                   ISADPGRDDPGDEDPDEVQVFDFENRAALDAYLADPRRTALHAERDDVVARTRLFGVRI
FT                   VSDR"
FT   gene            484456..485100
FT                   /locus_tag="Gbro_0434"
FT   CDS_pept        484456..485100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0434"
FT                   /product="bifunctional deaminase-reductase-like protein"
FT                   /note="KEGG: rfr:Rfer_2843 bifunctional deaminase-
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19768"
FT                   /db_xref="GOA:D0LDE8"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE8"
FT                   /inference="similar to AA sequence:KEGG:Rfer_2843"
FT                   /protein_id="ACY19768.1"
FT                   /translation="MAAQLLRVQNFGVSRDGYGAGEGQSAQTPFGHADPASIFAWAGAT
FT                   ASWPNRTEPGGSRGLDDYFTRDFHHNIGAEIMGANKFSPHRGPWENHDWLGWWGDEPPF
FT                   HTPVFVMTHHLRPSFTLSDTTFHFVDDEPAVVLEKAREAADGKDVRLGGGAAIIRSFLD
FT                   ADLVDTLHVAVCDIELGAGSRLWERPTDLEDRFRHEVIPSPSGVTHHLFWR"
FT   gene            485203..485532
FT                   /locus_tag="Gbro_0435"
FT   CDS_pept        485203..485532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19769"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19769.1"
FT                   /translation="MTIRASYERHPDLGCEAVVFIDDESMACFQIQRDLVGGPRSDEHC
FT                   VTTGASAPVYGGITQWRRVDDRFEFALTRRAGRLFGDDVLSFEISPADESSVDDIAEHV
FT                   DRLLR"
FT   gene            485553..485921
FT                   /locus_tag="Gbro_0436"
FT   CDS_pept        485553..485921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dol:Dole_0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19770"
FT                   /db_xref="GOA:D0LDF0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF0"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACY19770.1"
FT                   /translation="MTQPFDPSALFGGGGAGGENPMAGLLAQAQQMQAQLVNAQNEIAA
FT                   AEVTGTAGNGLVTVTGNGTGEITAVTIDPKVVDPDDVETLQDLLLGALADLSSKREALA
FT                   SEKMGPLAGGLGGLPGLG"
FT   gene            485947..486558
FT                   /locus_tag="Gbro_0437"
FT   CDS_pept        485947..486558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0437"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: afw:Anae109_3760 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19771"
FT                   /db_xref="GOA:D0LDF1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF1"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACY19771.1"
FT                   /translation="MYEGPIQDLIDELAKQPGLGPKGAQRIAFALLAGEKSEIDRLVAA
FT                   LGRVRDDVTFCAECGNVSANRLCRICSDARRDATKICVVEEPKDVHAIERTKEFNGRYH
FT                   VLGGALDPLSGIGPDQLRIRELLRRLANTDDGNDVTEIIVATDPNTEGEATATYLLRML
FT                   KEFPGLSVTRLASGLPMGGDLEFADELTLGRALSGRRVLA"
FT   gene            486669..488297
FT                   /locus_tag="Gbro_0438"
FT   CDS_pept        486669..488297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0438"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; KEGG: bph:Bphy_7397 TAP
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19772"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF2"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ACY19772.1"
FT                   /translation="MHRVGVRLLGAVVASAAAVAMVTVPAGGPPTAAAAPQLSWGPCAK
FT                   IHSAKGAQCATIAVPRDYAKPNGPTITVTISRIPARDQAHKMGVLVGNPGGPGGDALGL
FT                   FSWAAPPAAVQDRFDLVAVQPRGLVGGTALKCAKFNAANDFVAVTNYGAINRDRCEAAS
FT                   PGYPATLTTENAARDIEMARHALGVNKLSLYGISYGTTLMATYATLFPQHTDRLVLDSA
FT                   VNPNGIWNRVGSDQTPGYKGRVNAMMAWIAAHDNLYHLGATPLAVYCKWSARVEKEAGV
FT                   PPSLAAPPAQVGDVPPGLKAWSQQYIAGVNLTADARARYENFVATMLTPGGDQSKSAML
FT                   TATRTVAPDRNYWPLIALRLSNMVPRRKAVKPTPDEVAAETASNNMQTILMCNENQYPA
FT                   QPAQIPAALFANLVVSDVFEAPGLFWESGIACAGTTPRVRPVVTSNRGLAVTPLLINSV
FT                   DDPQTPYRGAMVLRRAMGAHLITVGGGDHGQLARGNRPLDAAISQYLITGRTAVTAAPQ
FT                   APITTPLNRLPTTSGSSSERFGYGW"
FT   sig_peptide     486669..486773
FT                   /locus_tag="Gbro_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.896 at
FT                   residue 35"
FT   gene            488294..488860
FT                   /locus_tag="Gbro_0439"
FT   CDS_pept        488294..488860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_1052 DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19773"
FT                   /db_xref="GOA:D0LDF3"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19773.1"
FT                   /translation="MTTGPVVMVDARLQERLDALAAEMTTGIVAIDGPSGAGKSTLADA
FT                   LMATLAANGTGAVLVRTDDFATWDNPVAWWPELESDVLQAFIRRHDYQYRPRVWRDGVP
FT                   VRGARVWRRWEPLLVIEGVSSARRRIADRLSHALWLDGAPAAERLERAVARDGEASRPY
FT                   LQRWQRFERGWFAVDRTRDRCLVLD"
FT   gene            488961..489716
FT                   /locus_tag="Gbro_0440"
FT   CDS_pept        488961..489716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0440"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   ade:Adeh_3631 uracil-DNA glycosylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19774"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF4"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ACY19774.1"
FT                   /translation="MSHYPGIVRGYRSIAALDRDLVGCRACPRLVAWREQVGREKRRAF
FT                   ADQEYWARPVPGFGPSDAAVVIIGLAPAAHGGNRTGRMFTGDQSGDVLFAALHAAGLAN
FT                   QATSVSADDGLLLYGTRVTAPVHCAPPQNKPTPQERDECAHWLHSELELLAPTMRSVVA
FT                   LGAFGWRQTLHTFGTLGWSVPRPRPAFGHGAHTVLTRGDRSIGVFGCYHVSQHNTFTGR
FT                   LTPTMVVDVLSAAARYADLGYAVRSEDSE"
FT   gene            complement(489972..490694)
FT                   /locus_tag="Gbro_0441"
FT   CDS_pept        complement(489972..490694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0441"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase; KEGG: gem:GM21_3605 cobyric acid synthase
FT                   CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19775"
FT                   /db_xref="GOA:D0LDF5"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF5"
FT                   /inference="protein motif:PFAM:PF07685"
FT                   /protein_id="ACY19775.1"
FT                   /translation="MSESTLRIGLVLPDVMGTYGDGGNALILRQRARMRGIDAEVVHIT
FT                   LDDEVPDSLDVYTLGGAEDYAQRLATRHLNRHPGLQRAAAAGRPVLAICAAIQVLGHWY
FT                   ETSAGERVDGISLFDLTTAPQAKRSIGELITEPVVPGLHAPLSGFENHRGGTTLGSDAQ
FT                   PLGRVRHGVGNGVGDGTEGVVQGSVIGTYMHGPALARNPELADHLLAQAIGTDALAPLE
FT                   LPEVDRLRRERLAAGRRG"
FT   gene            complement(490691..491968)
FT                   /locus_tag="Gbro_0442"
FT   CDS_pept        complement(490691..491968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0442"
FT                   /product="domain of unknown function DUF1727"
FT                   /note="PFAM: domain of unknown function DUF1727; Mur ligase
FT                   middle domain protein; KEGG: asa:ASA_0394
FT                   UDP-N-acetylmuramoyl-tripeptide-- D-alanyl-D-alanineligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19776"
FT                   /db_xref="GOA:D0LDF6"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF6"
FT                   /inference="protein motif:PFAM:PF08353"
FT                   /protein_id="ACY19776.1"
FT                   /translation="MPDRVNTPRVPARTRIALAAAAAARWASRTAGRGKGSMIGGLVAA
FT                   KIDPDIMRRLAAGKRTAVITGTNGKSTTTRMTAAALAEIGEVATQADGANMDAGIIATL
FT                   TLQRTAPVCALEVDELHVPHVSDAVDPEVLVLLNLSRDQLDRVGEINMIERRLREGIAR
FT                   HPETTVVANCDDVLVTSAAFDAPHVVWVAAGASWVGDSVSCPRTGEPIMRSEHGWYSTG
FT                   DENFRRPTPDWWVDEKNIYGPNGFQAPLDLSVPGRANRGNAAQAVAAAVAMGADPAKAV
FT                   AAVGTVGEVAGRYGVHQVGNHSVRTLLAKNPAGWQEALSMIDQDADGLVIAVNGQVPDG
FT                   EDLSWLWDVRFEAFETMAVVAAGERAADLSVRLLYAGAEHTTLPDPMRAIASCPPGRVE
FT                   VLANYTAFRDLGIALERAARSRKGEQ"
FT   gene            492062..493177
FT                   /locus_tag="Gbro_0443"
FT   CDS_pept        492062..493177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0443"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: reh:H16_B0633 esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19777"
FT                   /db_xref="GOA:D0LDF7"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF7"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACY19777.1"
FT                   /translation="MSRATSLKLPLSARPQRALVRVLGKAQPFITPLFRRRTRVNADGE
FT                   RLAPEMAVVGWSAANIPGMGLGTTDVLGSRRDIDISATTMAENLPAFAVEEDLTFDGPG
FT                   GPLAATRYRATESSSGLLIYFHGGGFVLGSRISHDGVARRLALGAGVDVLAVDYRLAPE
FT                   NPFPAAVDDALATWRFAVRSAPQWGLAPERIVVAGDSAGGNLAAVLAQQVRGEQVVPCR
FT                   QVLLYPMTDASSRHPSRDEFAQGLFLTEERIRFFTDNYTPDESVRTDPRVSPLLADDLS
FT                   GLPPAHVLVAGFDPLRDEGLAYAQRLADAGVAVTVQRESSMLHAFANMTVFSADARAAL
FT                   DRVCAAVRDGLAEAPRRPVSAGEQDSIAATS"
FT   gene            complement(493139..494113)
FT                   /locus_tag="Gbro_0444"
FT   CDS_pept        complement(493139..494113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0444"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pct:PC1_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19778"
FT                   /db_xref="GOA:D0LDF8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACY19778.1"
FT                   /translation="MAVMSSRDRVLGLTVVLLWGFNFIAIRLGLNHFPPFFFAALRFAV
FT                   MAVPVMLFVRFPRVRIRWFLLYAIGFGTLQFAFLFLAMELGMPTGLASLVLQTSAPFTV
FT                   LLGVLFLRERMTPLQVLGIVAAVGGMTLIAVDRATHSGLGAGALLPIGLTVLGGLAWAF
FT                   GNIGGRLAQPDDALRMTLWLSVVPPIPLYLLSLAVEGPSAGIASLTSLGTHSGVPALCG
FT                   LTYVVLLGTIAGAGIWTSLMARHPASRVAPLSLLVPIVGISASWALLGETPTVVELVGA
FT                   VIVIGGCAAGVLATPRSRPHIPPATGSDDAGSAGGRDRVLLAR"
FT   gene            494311..495345
FT                   /pseudo
FT                   /locus_tag="Gbro_0445"
FT   gene            495372..496670
FT                   /locus_tag="Gbro_0446"
FT   CDS_pept        495372..496670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0446"
FT                   /product="Glucarate dehydratase"
FT                   /EC_number="4.2.1.40"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: vap:Vapar_1731 glucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19779"
FT                   /db_xref="GOA:D0LDF9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDF9"
FT                   /inference="protein motif:PRIAM:4.2.1.40"
FT                   /protein_id="ACY19779.1"
FT                   /translation="MSATTTPVITEMTVYPVAGHDGMLLNLSGAHAPYFTRNLVILTDS
FT                   EGRTGVGEVPGGEAIRTTLEDARALIVGRSIGGYHAILGEMRSTFAGRDAGGRGAQTFD
FT                   LRIAVHAVTAVESALLDLLGQHLDVPVAALLGDGQQRQRVQALGYQFFVGDRNRTDLPY
FT                   RSAADEPADADDWLRIRHDEALSPESVVALAEAAQARYGFQDFKLKGGVLAPRDEAAAV
FT                   RALAERFPSARVTLDPNGGWLLSEAIEVCRDLREVLAYAEDPVGPEGAFSGREVMSEFK
FT                   RATGLPTATNMIATDWREMGHAIRSGAVDIPLADPHFWTMSGSVRVAQLCDAWGRLTWG
FT                   SHSNNHFDVSLAMFTHVAAAAPGDITAIDTHWIWQDGQRLTTEPYTISDGYLTVPDKAG
FT                   LGVELDMDQVQAATSCICARGSAPATTPPACST"
FT   gene            496756..497172
FT                   /locus_tag="Gbro_0447"
FT   CDS_pept        496756..497172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19780"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19780.1"
FT                   /translation="MSRFGVMLTGSVVRGVAATVAVGAVAAVTTLGAAHAHAVVGPKVA
FT                   VAASGTSNWQLTYQHGDALDSSCVIHVGKTIAITGPRSGTTTIAGSDLRPGRSPVQVRC
FT                   GSQSSPTIWIYAPRGQINDLGTWASNTTAGVLGI"
FT   sig_peptide     496756..496866
FT                   /locus_tag="Gbro_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.410 at
FT                   residue 37"
FT   gene            complement(497292..498314)
FT                   /locus_tag="Gbro_0448"
FT   CDS_pept        complement(497292..498314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0448"
FT                   /product="Luciferase-like protein"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: mes:Meso_0327
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19781"
FT                   /db_xref="GOA:D0LDG1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG1"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACY19781.1"
FT                   /translation="MTKNIGFLSFGHWSDSPGSQVRSGADALLQSVDLAVAAEELGADG
FT                   AYFRVHHFARQLASPFPLLAAIGARTSRIEIGTGVIDMRYENPLYMAEDAGAADLISGG
FT                   RLQLGVSRGSPEQVIEGYKYFGYVPPEGSDDADMARAHTDVFLKVIEGQGFAQPNPRPM
FT                   FPNPPGLLPIEPQSPGLRDRIWWGAGTRATAEWTARQGMNLMSSTLLTEDTGVPFHQLQ
FT                   AEQIERFRKVWSEEGHDREPRVSVSRSIFAITDDRDRAYFGRGGAEDDQVGVIDNSVAR
FT                   FGRSYADEPDKLIEQLREDEAIAAADTLLLTVPNQLGVEYNAHVIESILTHVAPALGWR
FT                   "
FT   gene            complement(498341..498889)
FT                   /locus_tag="Gbro_0449"
FT   CDS_pept        complement(498341..498889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0449"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   afw:Anae109_3788 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19782"
FT                   /db_xref="GOA:D0LDG2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY19782.1"
FT                   /translation="MATSSPAQVRPARPDDVEPLLALRERVAREGIWIGTEAPVDAERE
FT                   LTVFSATLDADDRDLFVAIVDGVLVGGLGVQFTTPGVTALGMQIDREWRGRGIGSALMD
FT                   AAVAWSRAHDAHKMELQVWPHNAAAIALYEKFGFEREGYLRRHYRRRSGELWDAIVMGL
FT                   VLDTTSPGWSLHGSSTAGN"
FT   gene            498923..499855
FT                   /locus_tag="Gbro_0450"
FT   CDS_pept        498923..499855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0450"
FT                   /product="LysR substrate-binding protein"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rec:RHECIAT_CH0002059 probable transcriptional
FT                   regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19783"
FT                   /db_xref="GOA:D0LDG3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACY19783.1"
FT                   /translation="MDVKRLRILREFADRQSVGAVADAMHMTPSAVSQQLKVLAREAGV
FT                   ELLEQDGRRIRLTAAGQALVLRADEVIAAVDRAHEEMASYRTGNALVRLAMFPSGASLL
FT                   LPAVLHGAADAGIDIEAAHLDVGYTDAPPKLAEYAVVVTHRDERTPSVTLPRVSVTELM
FT                   REPLDVIVSLDSTLAERDSVAVSELADCDWISVEGGFPVDDVLLSISAITGVAPRVTQR
FT                   MLDFTTIEALVAAGHGIALMPRFAVRHPRVKRLELRGVRAARVYEALTRPRARGAVGTV
FT                   VALLVDAGAERVCASTASEKPGDGAPTAP"
FT   gene            complement(499891..501039)
FT                   /locus_tag="Gbro_0451"
FT   CDS_pept        complement(499891..501039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0451"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: pap:PSPA7_5007
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19784"
FT                   /db_xref="GOA:D0LDG4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG4"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACY19784.1"
FT                   /translation="MKRTIFEDDHEALRASAREFLARECAPHNEEWEAAGQVDREIYKK
FT                   AGDAGLLGFNIPEEFGGGGSEDFRFNAVVVEEFAKFDGAAPGLSLQNDVLVPYFLHLAN
FT                   DEQRKRWMPGMASGETILAVAMTEPGAGSDLAGIKTSAKDDGDHYIVNGSKTFISAGIN
FT                   SDLVVVVCRTNPDPAAGHKAFSLLVVERGMEGFERGRKLDKMGLKSADTAELHFNNVRV
FT                   PKANLLGEENKGFYHLMQNLPSERLSIAIGAIAGARAIFDETLQYTKDRKAFGKPIGTF
FT                   QHNRFVLAEIATELDLAEVYIDRCLQGVLDDELTAVDASKAKWWCTELGKRVIDSCVQL
FT                   HGGYGYMNEYRVARAYKDSRIQTIFGGTTEIMKDIIGRDLGL"
FT   gene            complement(501049..501714)
FT                   /locus_tag="Gbro_0452"
FT   CDS_pept        complement(501049..501714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0452"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dac:Daci_0033
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19785"
FT                   /db_xref="GOA:D0LDG5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY19785.1"
FT                   /translation="MAGPVSAHWRQTVPTPMSQILAAARDAFHDYGFHGTATRDIAARA
FT                   GVSLPTLYYHHENKQGLLVAVLDVGMSSVLAQVRAAIASADSRTEQLSRAIEAVVLHRT
FT                   IDHRLASVDGELRYLDTDNPQRQQYVAKRTEMEDLISDILRRGIDSGEFTMRAATDADV
FT                   REMMRYLFGACRAVTDWYRPTGPRSADEIAAGYAAMSLRAVGATAAPRPTTPTPQQRS"
FT   gene            complement(501737..502930)
FT                   /locus_tag="Gbro_0453"
FT   CDS_pept        complement(501737..502930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0453"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: reu:Reut_A1669 thiolase; TIGRFAM: acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19786"
FT                   /db_xref="GOA:D0LDG6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG6"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACY19786.1"
FT                   /translation="MPEAVIVDVARLASGKGKPGGALSGTKPVELLAHVLRELVARNDI
FT                   DPALIDDVIGGCVGQAGEQALNISRTALLSAGFPESVPATTVDRQCGSSQQAAHFAAQG
FT                   VIAGAYDVVIAAGVESMSRVPMGFSVAGQSPYGPSIAERYPDGLVGQGISAELVAAKWK
FT                   FDRDALDSFAAESHRRAAQAATDGFFDREILPIDVADADGNTVTHRVDETVRASTTAEG
FT                   LAGLKSSFYSEQYAQRFPEINWHITPGNSSPLTDGASAALIMSDTMASKLGLTPRARFH
FT                   TFALAGDDPVFMLTAPIPATRKLLDRSGLSIDDIDAYEVNEAFAPVPMAWAHEFGADPA
FT                   KLNPRGGAIALGHALGSSGTRLLATLVNHLEATGGRYGLQTMCEGAGMANATIIERV"
FT   gene            complement(503083..503403)
FT                   /locus_tag="Gbro_0454"
FT   CDS_pept        complement(503083..503403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0454"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bcj:BCAS0693 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19787"
FT                   /db_xref="GOA:D0LDG7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG7"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACY19787.1"
FT                   /translation="MSAVIVVATISPKPGEEDKVREAVLAAIPKVHGEPGCGKYAFHEA
FT                   TGDSTDLVMIERWESMDALATHGGAPALTELGAAIGGLLAGPLDVKTFTAVPAGDADKG
FT                   VI"
FT   gene            complement(503879..505732)
FT                   /locus_tag="Gbro_0455"
FT   CDS_pept        complement(503879..505732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0455"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: mlo:mlr2792 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19788"
FT                   /db_xref="GOA:D0LDG8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG8"
FT                   /inference="protein motif:TFAM:TIGR00970"
FT                   /protein_id="ACY19788.1"
FT                   /translation="MPAADTFTSGASRIVEPSGPIPAGQPAWNTQRGSAMPIHRYRQFA
FT                   DEVETISIPDRTWPDKVITKAPMWGAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKE
FT                   IEVGFPSASQTDYDFVREIIEDGAIPDDVTIQVLTQCRDELIERTFDACRGANKVIVHF
FT                   YNSTSVLQRRVVFRADKDAITKIATDAAHKVLVEQAKYPDTQWRYEYSPESYTGTELSY
FT                   AKHVCDAVTEIIAPTPDNPMIINLPATVEMATPNVYADSIEWMHRNLERRDSIILSLHP
FT                   HNDRGTAVAAAELGYQAGADRIEGCLFGNGERTGNVCLVTLGMNLFSRGVDPQISFSDI
FT                   DEIRRTVEYCNQLNVPERHPYGGDLVYTAFSGSHQDAINKGLDQMKYDADASDRDVDDI
FT                   LWQVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVAYIMKADHGMNLPRRLQIEFSREIQK
FT                   ITDGEGGEVNPKEMWDVFAENYLAPIWPLERMRQKVDAAEVDGGEDRITAIVKVEGNER
FT                   EIAGSGNGPLAAFVDALSTVGYDVRVLDYSEHALTSGGDASAAAYVEAEVNGETVWGVG
FT                   VASSITTASLRAVVSAVNRAYRVSAPEPVDADAAAPRTWAP"
FT   gene            506056..506466
FT                   /locus_tag="Gbro_0456"
FT   CDS_pept        506056..506466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19789"
FT                   /db_xref="GOA:D0LDG9"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19789.1"
FT                   /translation="MDMRLLRNRIGYTVVGAGLASAIAVGGAANAAPTHPARPALVPGT
FT                   HCTVAQVDRALAHEDPALWHRIESNPKLKRRFEHMLTLTPQQRKAMHQKWAQHHPVRSE
FT                   MMKFLRHQHISRSEMARDRAAVMRAKQTCGQF"
FT   sig_peptide     506056..506151
FT                   /locus_tag="Gbro_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            506477..506803
FT                   /locus_tag="Gbro_0457"
FT   CDS_pept        506477..506803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19790"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19790.1"
FT                   /translation="MTTSFVRRSVLVLAGAAALSIGVAGPAAFADTPETATVPGTGCDL
FT                   MDAEHAFHEENPDVWTRISNNPATLARFEGFATSTPDQRSAMQSQWGSDAGAVTRAVDT
FT                   CAQW"
FT   sig_peptide     506477..506569
FT                   /locus_tag="Gbro_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(506853..507440)
FT                   /locus_tag="Gbro_0458"
FT   CDS_pept        complement(506853..507440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0458"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: mca:MCA2267
FT                   nitroreductase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19791"
FT                   /db_xref="GOA:D0LDH1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH1"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACY19791.1"
FT                   /translation="MTVATVAGVHEFIESRWSPRGYDDTATISSSEITEILDAGRWAPT
FT                   WGRIQPVRFIVGLRGDDTFARLTTVLTRGNAGWAPRSSALILVSTTNDPADAKAHTYGA
FT                   VDLGLAVGQMLVQARALGLHGHPMAGFDAAAAVEAFGIPDDKRPLVLLAVGRLAEEASL
FT                   PDDIRERDTRERTRLPLTEVAFAGRWGEPYPG"
FT   gene            complement(507474..508985)
FT                   /locus_tag="Gbro_0459"
FT   CDS_pept        complement(507474..508985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0459"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpt:Bpet2250 putative transmembrane-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19792"
FT                   /db_xref="GOA:D0LDH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY19792.1"
FT                   /translation="MATRLNPLHQPQAPLGADRRMWWGLAVLTLPVLLVSMDFSVLYLA
FT                   IPAITDAIEPTVAQQLWILDIYGFLIAGLLITMGNVGDRIGRRRILLAGAALFGVASVI
FT                   AAFAPNAAVLIAARALMGVGGATLMPSSLSLIANMIPDVRDRGRAIGVWTAAFAGGSAI
FT                   GPVVGGFLLHHFWWGVVFLINVPVLAVLFVLGPRLIPEYRARTSDPFDFAGVGLSMLGI
FT                   LPAIYAVKSLAADGVSPKAILIGVFGLLMLAVFVIHQRTVRAPLLDVGLFANPRFSAIV
FT                   SVALVGMMALGGMSYLTGVYLQSVLGHDVLAAALAGLPMAVAVAVFSIGATRIATAIGS
FT                   RAAFVGSVAFAAIGNLGLLWLSTSSPIWIYLVFTSIAGIGYGIQFSLVSDVVVGSVPVE
FT                   RSGAASGISETSFELGTALGLALLGSLATLVFRAGSGGWDFGETLGETLHRALEMGDGG
FT                   TALADAARQAYVDGMHAASLAAVIALTILGVVLMIVLRPERKPAR"
FT   gene            509162..509845
FT                   /locus_tag="Gbro_0460"
FT   CDS_pept        509162..509845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0460"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce0980
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19793"
FT                   /db_xref="GOA:D0LDH3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY19793.1"
FT                   /translation="MTGSDGTRLTLETIVDAAIVVADRDGIGGLSMRRIADQLGVGAMS
FT                   LYRHVEDKESLLQEMAEEVGRRFPYPVGDESTRWRERVRTIVDIDWDLYRRHPWVVLAY
FT                   SSPRHSFGEESLRCLDWFAAGFLDLGVDMVEATEMALTVWSYVHGVALVAVSDDLLRPD
FT                   RPSDRPDGMARLTGGQPDSALPHLTRLADCPDAARLLDTRRRLDVGIDYLCAGFEVSAP
FT                   GSEKS"
FT   gene            complement(509960..511129)
FT                   /locus_tag="Gbro_0461"
FT   CDS_pept        complement(509960..511129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5370 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19794"
FT                   /db_xref="GOA:D0LDH4"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19794.1"
FT                   /translation="MTHRGWPVPARFWWLEAVVVFLLVRAVGIIALARIADLNGHSVGG
FT                   RLSLWDGQWMLAIAEYGYGGVPTTLTDANGLHTGDTAYAFFPGYPLLVGLVAKLPLVTP
FT                   FGAAIGVNLILGCVAAVGAARLGAVCAREMAPTSPVGPASPRATGLILVVLFAATPMSI
FT                   VLNMAYTEALFCALVVWALVGVMEHRWLLAGSVTLLAGLSRPTSVVLIGVVMLAAFLAH
FT                   RDGPRAWAAIVLSPLGYLGYLGVVWAHTGSPTGWFRIQNEGWGTHIDWGVAAFNFINQT
FT                   LVGSGEVAATGTAWVMLASVAMIAVACWSRLPWPVLVYGSFVVVSILLSTGLIISRPRL
FT                   LLPAFVLLIPLAMGLARLRRGVAIAILVPVVLGSAWFGAHMLTVFPFAI"
FT   gene            511344..512609
FT                   /locus_tag="Gbro_0462"
FT   CDS_pept        511344..512609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0462"
FT                   /product="aspartate kinase"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   afr:AFE_0407 aspartate kinase, monofunctional class"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19795"
FT                   /db_xref="GOA:D0LDH5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH5"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACY19795.1"
FT                   /translation="MALVVQKYGGSSVATAERIRRVAERIVETKKQGNDVVVVVSAMGD
FT                   TTDELLDLAQQVNPTPPAREMDMLLTSGERISNALVAMAISSLGAQAQSFTGSQAGVIT
FT                   TSSHGSAKIIDVTPGRVRSALDDGKIVLVAGFQGVSQDTKDITTLGRGGSDTTAVALAA
FT                   ALKADVCEIYTDVDGVYSADPRIVSDARRLETVSFEEMLELAACGAKVLMLRCVEYARR
FT                   YNVPVHVRSSYSTKPGTMVAGSMEDIPVEEAILTGVAHDRSEAKITVVGLPDQPGYAAK
FT                   VFRAVAEAEINIDMVLQNISKVETGKTDITFTLPRELGPLGMDKLNKLRDEIGFTDLLY
FT                   DDHIGKVSLVGAGMKSHPGVTATFCEALSDAGINIELISTSEIRISVLCRDTELDDAVR
FT                   ALHAAFDLGGEEEAVVYAGTGR"
FT   gene            512609..513637
FT                   /locus_tag="Gbro_0463"
FT   CDS_pept        512609..513637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0463"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: sml:Smlt3427 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19796"
FT                   /db_xref="GOA:D0LDH6"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH6"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACY19796.1"
FT                   /translation="MGVRIGVVGATGQVGGVMRTLLAERGFPADEVRFFASSRSAGKKL
FT                   PWGDGEIVVEDAATADPSGLDIALFSAGATMSREQAPRFAAAGVTVIDNSSAWRKDPDV
FT                   PLVVSEVNGHLAQNPPKGIIANPNCTTMAAMPVLKPLHDEAGLQRLIVSSYQAVSGSGL
FT                   AGVEELATQVRAVAGDAEKLVHDGSSVEFPAPNKYVAPIAFNVIALAGSLVDDGSGETD
FT                   EDQKLRNESRKILDLPELLVSGTCVRVPVFTGHSLSINAEFANPLSVARAQEILSAAAG
FT                   VELADVPTPLAAAGKDNSLVGRIRHDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELI
FT                   AG"
FT   gene            513654..514673
FT                   /locus_tag="Gbro_0464"
FT   CDS_pept        513654..514673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0464"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   dal:Dalk_1161 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19797"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH7"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACY19797.1"
FT                   /translation="MTTPDTTPLADRVGHYYQVEDTYVVGREKVREYARAVQDHHRAHR
FT                   DVGVATELGYSGLVAPLTFTSIPAMAANRLLLETVVVGYETYLQTEQVFEQHRPIVAGD
FT                   ELTVDVELTAVRRVAGRDMITITNTFTDTAGETVHTMHTTVVGVTSDEVDPSMTEAGRA
FT                   IMVHDVSVPTADAVIEYQKQVRPEGAQRLADPTARTPRSRDFDSLSVGDPLPSSEIRVT
FT                   RGDLVNYAGVSGDGNPIHWDEPIAKLAGLPDVIAHGMLTMGLGAGVVSEFTGDPGAVTR
FT                   YSVRLSSPAVVPHAGSEIEFSGKIKSLDPETRTGVVLLVAKSGGRKIFGMATLDVRFS"
FT   gene            514778..516097
FT                   /locus_tag="Gbro_0465"
FT   CDS_pept        514778..516097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:515210..515212,aa:Sec)
FT                   /locus_tag="Gbro_0465"
FT                   /product="secretory lipase"
FT                   /note="Contains selenocysteine; PFAM: secretory lipase;
FT                   KEGG: reh:H16_A0876 secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19798"
FT                   /db_xref="GOA:D0LDH8"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH8"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ACY19798.1"
FT                   /translation="MSPITCPSYSVVAYPFMRQTRGFFSLRLRRRLTAAALVGAAVGAG
FT                   LTAAPTAEAATDFYTPPARFATEPGSVIRSEPVGLLLQIPGAPNQWPGTAKRIMYTSRY
FT                   QDGTPAAVTGTVVEPTVPWRGRGVRPTVVVGPGTIGQGDQUAPSKMMTLPMSVDISKPS
FT                   VGVNYTAPEMYYLLAHGVRVFVTDYIGMGTPGIHTYVNRAETGHAMLDGGRAALRSAGA
FT                   PADAPVGFAGYSQGGGAAASAAELASTYAPDLNVRGTYAGAPPADLIKVIPAIDGTTIA
FT                   GAIGFAINGLTARYPRVADIVRKETNPAGKAALQKISQQCIGDIILSFAFGRTQNWPRT
FT                   GESLSALIARYPDVQRVVDEQRIGRLKPNAPVFLEGGLADDVIPYGQVAQLARDWRAQG
FT                   ADVRFVTNPTPPILTKTIVNHVVPMLETLLPGLQFLLARF"
FT   sig_peptide     514778..514942
FT                   /locus_tag="Gbro_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.852 at
FT                   residue 55"
FT   gene            516167..517573
FT                   /locus_tag="Gbro_0466"
FT   CDS_pept        516167..517573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_1312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19799"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19799.1"
FT                   /translation="MGARGMLALLASVAVAMPSGMTQASADPVPAAPGLGPVGTSLMHG
FT                   DLWSSDSTPFAGPGRGGHVVASSVPGGACAATFIGSDGLPVSLCTRFIGTDPPGFAVPS
FT                   VTLFDPRTAAPLAHLELTKGGLLGGVYGYLDNRDRVVVADGSNAILRVAHRRTSRGWTV
FT                   FVDNRIDVSAHIPAGDAITGLAPDPDGRIWFATTNGVIGTVNRAGRVAAMHLPRGEQLG
FT                   NGLSIRRGGASILTTHALYEMTAAADGTPRVIWRRAYDRGKARRPGQLTWGSGTTPTYF
FT                   GPGGDGWVAIVDNAERPRLLVYNSASGGLVCSTTAFGRSGQGTENSPMAWGNSLVIPST
FT                   YGYQYPPMAVTGPSVPPDAPFIGGATRIDVGPNGCNRVWENNDRIATLPRLSRADGLIY
FT                   GLGYGPYRPGPQQLGPVYFIATDFATGRRVATRKVGDAPVDEPLELTGTISRDGAMWQA
FT                   SLGRMLKIAG"
FT   sig_peptide     516167..516247
FT                   /locus_tag="Gbro_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.899 at
FT                   residue 27"
FT   gene            517615..518286
FT                   /locus_tag="Gbro_0467"
FT   CDS_pept        517615..518286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19800"
FT                   /db_xref="GOA:D0LDI0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19800.1"
FT                   /translation="MSDVPASGAPEPDPERVPSQAELDAEDLAALARTSKDRDRANLYP
FT                   SRQDQPGPPPRALAVHARVAWWGAAVCGLICVVYGFLNLGMISDLLRQRLLDGVASDRV
FT                   NAAPENQVNSLAGFFPPFMLVMIIVFLAIEYPLLVAAASRHSRNSRNFFLTTVIVHMLC
FT                   VPIGVDLLFRYPQVWSSMVVISWLMFALLAVAGLCSLRRVVDRWLPESSRMRPSRMFRG
FT                   R"
FT   gene            518380..518901
FT                   /locus_tag="Gbro_0468"
FT   CDS_pept        518380..518901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0468"
FT                   /product="ferric-uptake regulator"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: sun:SUN_0753
FT                   peroxide stress regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19801"
FT                   /db_xref="GOA:D0LDI1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI1"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACY19801.1"
FT                   /translation="MPGEGGLSLDSLQKLDIFQFRFYSGVMLDRKELHRQLREAGLRVT
FT                   APRVAVLEILDEHPHSTADFVAAGVRENLGGVSTQTVYDVLRSCTERGLLRRIEPAGSA
FT                   VRYETRTDDNHHHLICRTCGEIVDIDCVDGRSPCLTPDRDHGYRVDEAEVIFWGECAAC
FT                   QQVSAGGDPR"
FT   gene            519128..519559
FT                   /locus_tag="Gbro_0469"
FT   CDS_pept        519128..519559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0469"
FT                   /product="peroxiredoxin, Ohr subfamily"
FT                   /note="TIGRFAM: peroxiredoxin, Ohr subfamily; PFAM: OsmC
FT                   family protein; KEGG: bgl:bglu_2g18290 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19802"
FT                   /db_xref="GOA:D0LDI2"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI2"
FT                   /inference="protein motif:TFAM:TIGR03561"
FT                   /protein_id="ACY19802.1"
FT                   /translation="MAIEPAYRISSKASGGGRDGEVVSETGQIDLDLQPPKELGGSGEG
FT                   SNPEELFSAGYAACFLGALRATSKQAGSPVPDESTVKVTIGIGKDPADGGFGLTADIEV
FT                   YIPGVDEAKAQELADGAHAFCPYSKATRGNIAQTVSVSV"
FT   gene            519603..520082
FT                   /locus_tag="Gbro_0470"
FT   CDS_pept        519603..520082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0470"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   asu:Asuc_0163 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19803"
FT                   /db_xref="GOA:D0LDI3"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI3"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACY19803.1"
FT                   /translation="MSTATPITSTLTDEQKTITGGALQDTLVDLIDLSLIAKQAHWNVV
FT                   GQQFRSVHLELDELVTVAREFTDAAAERATAIGVSPDGRAETVAKTAHTKGFGEGWTKD
FT                   TDVVTAIVANLKAVIAGLRERIEATEDADPVTQDLLISFASKLEQLHWMWQAQVA"
FT   gene            complement(520180..520707)
FT                   /locus_tag="Gbro_0471"
FT   CDS_pept        complement(520180..520707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19804"
FT                   /db_xref="GOA:D0LDI4"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19804.1"
FT                   /translation="MSTWGVGLGLLSAAIAVIAFVRYRERESVALTRNTALARELRALA
FT                   DGDEVRLAAVDEFEQTIYQRLFYASVVAPWVRSSAWALLGTALAGAAALTIGPLDGVVA
FT                   TCLYIVAIGLVIVFGLATLACAGTALFHTATTPRVSFSESYATEESPVDEVAVEKPVVD
FT                   EPAPETKPHDKS"
FT   sig_peptide     complement(520648..520707)
FT                   /locus_tag="Gbro_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.655 at
FT                   residue 20"
FT   gene            520876..522327
FT                   /locus_tag="Gbro_0472"
FT   CDS_pept        520876..522327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gem:GM21_0735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19805"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19805.1"
FT                   /translation="MTRARMAWILVLGLVVALLTAASAAVVQSGPAVMLTTQVAGVSVI
FT                   GGSEPAAVLLSRQLFGSSASAIVVGSDAGDADWQRATDEAIRRHVPVFGVGADGADTVS
FT                   AELRRLGVGSLHIVGSVPDDVRAIAPNRDLDSVSGNEPADGPAPLVYVTTTAGRDAVAT
FT                   ARAASARVVTLPVADPRATGESVAALKDSDAPVLAVGDQFGDDAEFARRVAAARSVAEL
FT                   PGGGQLIFPMRRMVALYGSPDAPALGPLGRQDIPSSIARAKRLAADYQRVSRVPVIPAF
FT                   EIIATVASASPGEGNTYTNMIDPAVIRPWIAAARAAGVYVTLDLQPGRMDFLSQAKRYA
FT                   EFLRQPHVGLALDPEWRLKPNQVHLTQIGSVEAAEVNRTSDWLATLIRDNQLPQKLFVL
FT                   HQFDSDMLANRKQIITSHPELQVLLHADGHGAPPVKMDTWRRLITDLPAGVWMGWKNFY
FT                   TEDKPTFTPAQTMAVTPTPWFVSYQ"
FT   sig_peptide     520876..520950
FT                   /locus_tag="Gbro_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.616 at
FT                   residue 25"
FT   gene            522370..523758
FT                   /locus_tag="Gbro_0473"
FT   CDS_pept        522370..523758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0473"
FT                   /product="Protein of unknown function DUF2252"
FT                   /note="PFAM: Protein of unknown function DUF2252; KEGG:
FT                   reu:Reut_A1207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19806"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI6"
FT                   /inference="protein motif:PFAM:PF10009"
FT                   /protein_id="ACY19806.1"
FT                   /translation="MMSDSAAIDLASCPEPTERADPLSILSAQARNRVAELVPVRNARM
FT                   AATPFTFYRGAAAVMSADLSRTPDSGVYTQLCGDAHLSNLGLFFSPERRMTFDLNDFDE
FT                   THPGPFEWDVKRLAASFVVAGRNNVFDDKTNLKCARAVAKAYRRSIAHSVTKSTLDCWY
FT                   ARMDVDELVALIGEKLDTSINQRTQKALKKARHRNSEQALSKLCVIDADGKAHIRSEPP
FT                   LLVPIHELYPDDVADTANERIDERLHAYRGCLQGHVRALLDQFTMVDVARKVVGVGSVG
FT                   TRAWIALLVGQNLDDPLFLQIKEAQRSVLADYVPAAGYANEGQRVVEGQRLLQAASDIF
FT                   LGWTGGDDENGERRDFYVRQLRDGKGSIVVEALEPEAMQLYAQLCGRTLAQAHARTAGR
FT                   RGIAEFLENNRGFVKQIGAFSIAYADLNDGDHARMIDAIKSGELEVHDLEGPGPQVRDV
FT                   AAAR"
FT   gene            523853..525589
FT                   /locus_tag="Gbro_0474"
FT   CDS_pept        523853..525589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0474"
FT                   /product="ATP-dependent transcriptional regulator
FT                   protein-like protein"
FT                   /note="KEGG: pmy:Pmen_2538 regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19807"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI7"
FT                   /inference="protein motif:COG:COG2909"
FT                   /protein_id="ACY19807.1"
FT                   /translation="MSRVGPDADVSSPGAVAERPSFDEFAPPAHGRIADLLVAATTRTG
FT                   AGHGSVILVSAPSGTGKTAYLEQWSRVLERQASVVTWDRGAPSRDFWTRMPDEWFVSDD
FT                   PDVPGPSPRRVLIVDDAHQISGPDDVSAVVELLDRMPAHTAIVFCARYDPPLPWHRYAR
FT                   DHRFTRIGETDLALRADEIADSLGESAVVLNHVQAERIRELTSGWLILVSAVADRLAGR
FT                   RDVDDCIDGLASSPRPPTDDLIGSLIADLPEHLRALACRTAVVQSFDRDLAIHLAGTGH
FT                   DVTDIDTALWDLAAQRFPVIIAGYRESRTYYTYPGLVRAYLQAELRRSGISPDNVLRSA
FT                   AMWSMHRRRSVDALSLALQMSDPEELSTVLVTSGIRMVIAGDVAGFEVLLNRWCRVAPG
FT                   SAEPTIMRALVAAERGDLAASSMHLNEVDRAAVSGADLTCLLGALRLVADARHRPGGND
FT                   RPIGWLDPVGVQDEVRAFALMTAGSVHISRGDLSWARRVWVAPMPSPRRHLSTCCASGS
FT                   ALIARPQQVGVGTWRACAAGHARPSRARVRAAGRRTTTSRSVRRWRRWGSTSPGNRPLP
FT                   NR"
FT   gene            525586..526401
FT                   /locus_tag="Gbro_0475"
FT   CDS_pept        525586..526401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0475"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: vap:Vapar_3592 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19808"
FT                   /db_xref="GOA:D0LDI8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI8"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACY19808.1"
FT                   /translation="MIRPASETTAVTGPRAPLLMLIAGFAGAEDRYDTAVHACRALTEM
FT                   IRTEAYPYPAVVLLPRVAYMCAAVGGTEGITGLVAATERSYGPGPETAIATAVAMVANS
FT                   RFDAARKTVTPILDAADAAHPSTAMSAWAMYAYTSAQLSDSYATHRGLRRALAAGAPSG
FT                   MIAPLLEGGEVIADELARHVGTFGHLDALAAKAMRAIRAQALPEQFHLTPSERRVLDFL
FT                   PSGYTADQIAGMLSVSVNTVKTHSRSIYRKLQVSTRRDAVMVARRAGLL"
FT   gene            complement(526422..526634)
FT                   /locus_tag="Gbro_0476"
FT   CDS_pept        complement(526422..526634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19809"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19809.1"
FT                   /translation="MRDPFEYEFTVDGELSERALAAFPELRAEVDRQQIATKLTGELPD
FT                   TAAARGVIARLDQLGLTLLSFRRFP"
FT   gene            complement(526671..527696)
FT                   /locus_tag="Gbro_0477"
FT   CDS_pept        complement(526671..527696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pau:PA14_33190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19810"
FT                   /db_xref="GOA:D0LDJ0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19810.1"
FT                   /translation="MSSPTAPMIAWRWLPALTAAIAVIPAVVVAAGGDVQKGAALAVGI
FT                   IPAVIAGVPRERRRRVIILIAGLVLGVPILVGATVAPWPVAAVATIFLLPVGATWLASR
FT                   IDRPRLAMLLVVIAPALVGVGFSEDGFGSGLVLALLFVAGSVTTFVVAIVIPPAWIAET
FT                   TPATGQSAAMPGLGYGILLGVIGVITSSVGFALHFDHVGWACAAALLVMRPDAGLQKWR
FT                   TLGRFVSVSVGAVAAALLVELGAPPAAFAVAIGLAIVAAAGTRGSRWYILPTFTTFLVI
FT                   TMLSYSTDSAAGRVDERIGETLFGLAVAAVIGLGVPALLRRRPQQSPGLGGATDAPDDA
FT                   P"
FT   sig_peptide     complement(527604..527696)
FT                   /locus_tag="Gbro_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.940 at
FT                   residue 31"
FT   gene            527860..529731
FT                   /pseudo
FT                   /locus_tag="Gbro_0478"
FT   gene            529728..531119
FT                   /locus_tag="Gbro_0479"
FT   CDS_pept        529728..531119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0479"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_0552 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19811"
FT                   /db_xref="GOA:D0LDJ1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY19811.1"
FT                   /translation="MTGTDGEVPSRRRWISLAATCTAAGLVWLAFADFGVAALAPGVGV
FT                   LIAGRGLMGIGAALILPATLALIPVQFSGAAQLTAFGIWQAVAWGGQALAPAIGGVITD
FT                   GPGWRWLFWINLPLAVAAVAVIRSVTPETSDDTVDRRIDWLGLATIGLAIFALLYALTD
FT                   GPTAGWASPLVLGLLVAAVVLALVWVVVERRVSSPLVNLSLFRLRPYDGALIANLTMNL
FT                   VYAGLSYLLVLWLQNARGYSAVTAGLLMLPAILGIFVLIPMGGRLESRVGGRIPVIVGL
FT                   VVLGAGLAVLTPLQSDSSMWLIVVSLIVIGAGLGLLSTPVSNTAVGEVPAALSGTAAGV
FT                   FKMSSMVGGALGVAILTALTRGLTLADSGHAVQHSGLTDAEVDQAHAALVNSSSYDDAL
FT                   SRLPAELQDKVTAAVVDAFSRGLGVAMLSAAALTLVAGAIVWAVWPHRDRQQAHDETVE
FT                   SRTDG"
FT   gene            531157..532518
FT                   /locus_tag="Gbro_0480"
FT   CDS_pept        531157..532518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0480"
FT                   /product="Beta-Ala-His dipeptidase"
FT                   /EC_number="3.4.13.20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: afw:Anae109_0920 peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19812"
FT                   /db_xref="GOA:D0LDJ2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ2"
FT                   /inference="protein motif:PRIAM:3.4.13.20"
FT                   /protein_id="ACY19812.1"
FT                   /translation="MSEETLRERVRDLMPQAQQDLTEMVGFRSVHDAEQQPPEECDKMV
FT                   AWLEEAFTEAGLADVAAHETADGSKAVTGHLDGPEDAPTVLLYFHHDVQPPLGDDEWDS
FT                   PVWQLTERKGRWYGRGAADCKGNIATHLTALRALGGDVPVNIKIIGEGSEEQGTGGLED
FT                   FVPKNPELMRADTILVCDSGNFAVGKPSLTTTLRGIANVVVTVETLGSAMHSGMFGGAA
FT                   PDALAALITMLATLRDVDGNTTITGLDNTQSWDGVDYPAEQFRTDATVLDGVDLVGSGS
FT                   VSEMVWAQPALTVLGIDAPSVVGSSAAVQAKARARLNLRVPPGMDAQVAQDALVDHLTA
FT                   AAPWHARVSFEREAVGSPFVGSTGGVGYDTLVDSMRTAYGTDVLVQGQGGSIPLCNVFA
FT                   ETFPDAEIMLMGVEEPQCLIHAPNESVAPSEIENMSVVEALFLRDYAERFRRGG"
FT   gene            complement(532585..533676)
FT                   /locus_tag="Gbro_0481"
FT   CDS_pept        complement(532585..533676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0481"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   scl:sce3990 putative isovaleryl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19813"
FT                   /db_xref="GOA:D0LDJ3"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ3"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ACY19813.1"
FT                   /translation="MPGDTHPQPPIPTDKPDLRRTSLRSAAYRVADEVLFPAAAEIDRT
FT                   GEIPASHWQALADAGLYGIAAPEPVGGPGLDFGQVTEILEVLCSGCLSTAFTWIQHHGV
FT                   VLSLAGTTNSTLRSEFFDDVTAGRLRAGVAYAGVVPTPPRMTATRTDGGWRFDGYAPFV
FT                   SGWGVIDLLQISARDCETDDVIAAIVRTADLPDAVVPRRLHLAAADATRTVSLTVDGLP
FT                   VADDAVVSRVTLDDFFANQNIGVRLNGTLPFGLLRRATALLDAGGHTAEARHLRGRADT
FT                   VRDALDASLADADGLLVARADAAQLALDAAAALVAADGGKALLQGADAERLFRECAFIL
FT                   VAASRPQLKGALLQRFSDPRTTG"
FT   gene            534078..535358
FT                   /locus_tag="Gbro_0482"
FT   CDS_pept        534078..535358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0482"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   tgr:Tgr7_1727 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19814"
FT                   /db_xref="GOA:D0LDJ4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ4"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACY19814.1"
FT                   /translation="MTHGGAGSRVIIRNARVFDGRGDSATAGQDILIEGTRIAAVSDSP
FT                   IGDAPGQDTVEIDCGGRFLMPGMSDAHVHLMGNANSYLDFVMGATGLLFANTISEARRM
FT                   LHRGFTTVRDMGGDTAPVKTVIDRGDFEGPRIYPSQAMISQTSGHGDFAFVYETPHAFG
FT                   GGESRTDSIGFTRTADGVERVLTAVREQLRKGASQIKLTIGGGAASMYDPLYTLQFTPD
FT                   EMRAAVDAAADYGTYVATHVYTVPGIKRAIEAGVRSIEHGHLADESTIALIGEKEIWLS
FT                   MQPFAEDDHHYPDPDRAENNKQICHGTEDVYNWAKKHGVKVAFGTDLLLEPQSAARQSV
FT                   MASRMGEFYSNAEALRMLTSGNAELFEMSGEQNPYGAAKLGVIAPDAWADLLVVEGDPL
FT                   QDMSVIADPDQNLTLIMKDGNVVKNTL"
FT   gene            535421..536182
FT                   /locus_tag="Gbro_0483"
FT   CDS_pept        535421..536182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bav:BAV1814 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19815"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19815.1"
FT                   /translation="MAVSGDESADDVTAEIPPVEDEVALLVADGIGVRATWGHIYGPTD
FT                   FRILPGGLTVLAGSGGRGRTALLLTLAGRMKPSSGHLWAFGRVNDAHHLFRQAAIADID
FT                   EVDGIVQAIKVRDVITEQIRWSAPWYKWVRQARQADLERVCAPVFGDLALPSMDAFVEE
FT                   LPELTAALLRIAVANVRRPPLLVVGGVDRLTRIESARTLTSRLVALGREQTVITADVNG
FT                   AYPGLGVREVISVDNLTDDEFVMLEQQERIS"
FT   gene            536184..538148
FT                   /pseudo
FT                   /locus_tag="Gbro_0484"
FT   gene            538236..539635
FT                   /pseudo
FT                   /locus_tag="Gbro_0485"
FT   gene            539705..540451
FT                   /locus_tag="Gbro_0486"
FT   CDS_pept        539705..540451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19816"
FT                   /db_xref="GOA:D0LDJ6"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19816.1"
FT                   /translation="MTEEALPAGAASGPFFDLPPGVDRRLLTPTLTKQCVGFMIGSSLF
FT                   ALGSAPGFGHVVGASVVNLCFFVGAWFFTGAALIQLLRSGRVTVPVSYPPGTMVRAEWL
FT                   AAATQFFGTLLFNVSTGAALQAHTIAAQKHLVWTPNAEGSVAFLISGFFALVAYSHTGG
FT                   GWAPRRADWWSGQVNMLGCVAFGVSAVGAYITPNGVTVDAVLANVGTFVGAVCFFISSL
FT                   LVLPALSRNPGNGTGFQATMACEPDE"
FT   gene            540534..541301
FT                   /locus_tag="Gbro_0487"
FT   CDS_pept        540534..541301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19817"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19817.1"
FT                   /translation="MNQSRPGLSPDVLEYWRRAIGVDHPLGSNPSRQIRFRGADALDGH
FT                   IALLHIEPEDPEGFEQIAYWVPLTHIQACCILQTPTRTRRTPDLIREFPSNDLIIAVHS
FT                   MGSVTGRVNGFEYACRPGQLTVTDNRLPYDVTGHGVTDPTGIWVPAALLGADIAAGATV
FT                   PPIPRDTPLTRACAALVVGLAKDVAARGDEIDDDTELAAVEVGSGRQTAASPRPRSTHE
FT                   RRRRARQRSLRHDRYVTRCTAANSRCAHRLSVR"
FT   gene            complement(541246..541869)
FT                   /locus_tag="Gbro_0488"
FT   CDS_pept        complement(541246..541869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0488"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: bba:Bd3727
FT                   outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19818"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ8"
FT                   /inference="protein motif:PFAM:PF08212"
FT                   /protein_id="ACY19818.1"
FT                   /translation="MLRAPLTRSIIAAFVAVLTGLGLLAGTSAANAAPLKPVPSLDVQR
FT                   YLGTWWQLATVPSFFGIRCARDTNATYTLINKTTIGVNNKCTSPFGQIDGVKGKATVVD
FT                   TTTNAQLSVRFPFTPNSIDPGGRPNYIVAWLQEGRTPTAPYRYAIVGDPTRSSGFLLSR
FT                   DKVVPTSELRRLRGEIERVGYNSCTFLISPTTGGRSDYSPLCTV"
FT   sig_peptide     complement(541771..541869)
FT                   /locus_tag="Gbro_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 33"
FT   gene            complement(542011..542334)
FT                   /locus_tag="Gbro_0489"
FT   CDS_pept        complement(542011..542334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19819"
FT                   /db_xref="GOA:D0LDJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19819.1"
FT                   /translation="MAVFQGISALANDEVFVRTPNYVFEFDLTTWGWVHLILGIIAILI
FT                   AGGLAVGADWARVSAIIIASLSIIAQLLWLPYYPAWAILIIVLDLIVIWAVATWKPNDV
FT                   YNG"
FT   gene            542634..542707
FT                   /locus_tag="Gbro_R0010"
FT                   /note="tRNA-Pro1"
FT   tRNA            542634..542707
FT                   /locus_tag="Gbro_R0010"
FT                   /product="tRNA-Pro"
FT   gene            542841..543122
FT                   /locus_tag="Gbro_0490"
FT   CDS_pept        542841..543122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19820"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19820.1"
FT                   /translation="MATLLTSDELDISILFTEPLTEVLPFVRAVIIKREPLDLLTGGDS
FT                   IAHVINLANLTQFQLAETEADELDPERRTVVLSLAEVRAEEVADGGDE"
FT   gene            543109..543891
FT                   /locus_tag="Gbro_0491"
FT   CDS_pept        543109..543891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0491"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mxa:MXAN_2034 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19821"
FT                   /db_xref="GOA:D0LDK1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDK1"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACY19821.1"
FT                   /translation="MGTSSHDRPVTVRTDGPVTIVGINRPEVRNAVDRVTAEALADAFG
FT                   SFDADHAQSVAVLYGEGGTFCAGADLKAIASGGGNRVAVDGDAPMGVSRMRMSKPVIAA
FT                   IAGHAVAGGLELALWADLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGRSRAMDLI
FT                   LTGRPVSAAEALDIGLANRVVPHGESLDRAVELARELSEFPQTCLRHDRLSLLEQGGFD
FT                   EADAMRNEFAHGMESLAADAVSGAARFADGAGRHGDRA"
FT   gene            complement(544076..544774)
FT                   /locus_tag="Gbro_0492"
FT   CDS_pept        complement(544076..544774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0492"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II; HAD-
FT                   superfamily hydrolase, subfamily IA, variant 2 (HAD-like);
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   vap:Vapar_3706 haloacid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19822"
FT                   /db_xref="GOA:D0LDK2"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D0LDK2"
FT                   /inference="protein motif:TFAM:TIGR01428"
FT                   /protein_id="ACY19822.1"
FT                   /translation="MSATTGVRVLAFDTFGTVTDWFTGISGAVGAELPAVDAAEFTREW
FT                   RRRYGPILARVEAGDLGWRGLDDLQTETLADVASEFGVTVDDDTARRLVRAWRIIPGWP
FT                   DAAPGLRRLATGFTVCALSNGSVALLTEMAKHNDFAWDFIGGSDLWHHYKPARETYCGL
FT                   AELMEAEPHEVMMVATHQTDLDAARSYGLRSAFVERPDEWGGAPKDDAGSADNDLHATD
FT                   LLDLAAQLGV"
FT   gene            complement(544771..545736)
FT                   /locus_tag="Gbro_0493"
FT   CDS_pept        complement(544771..545736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0493"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: noc:Noc_0403
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19823"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEA5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY19823.1"
FT                   /translation="MVQLANREAPLRVLAGAAGLATAGLLYSTVIERNAFALRHTTLSV
FT                   LEPGATPLRVLHISDLHMMPNQRLKQAWVSELEALEPDLVVNTGDNLAHPQAVPAVIQS
FT                   LGGLLSRPGLFVFGSNDYFGPRPKNPFKYFKTDHQRSHGDPLPWQDLRAAFTERGWLDA
FT                   THTVRELEVGGVRVVAAGVDDPHIERDRYETVEGRPNPLAHLRLGLTHSPEPRVLDRFA
FT                   ADGYDLVMAGHTHGGQLCLPFFGAIVTNCHIDRSRVKGPSNWGSTMKLHVSAGLGTSPY
FT                   APARFCCRPEASLLTLTPVSHGDAEFDADHSLPQLATETS"
FT   gene            complement(545761..548211)
FT                   /locus_tag="Gbro_0494"
FT   CDS_pept        complement(545761..548211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0494"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: rpa:RPA0577 penicillin-binding protein 1A;
FT                   PFAM: glycosyl transferase family 51; PASTA domain
FT                   containing protein; penicillin-binding protein
FT                   transpeptidase; SMART: PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19824"
FT                   /db_xref="GOA:D0LEA6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEA6"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACY19824.1"
FT                   /translation="MISKKLWPLAWACLLSGVLVAGLLYPVASGLGVVSNRAAAAVENV
FT                   SSELLNGTLPEVTTMTDASGTPIALLFDQYRYQVGYNDIAPDMIRAIISIEDRRFLEHD
FT                   GVDWKGTIRAALKNSSSGEVQQGASTLDQQYIKNFQLLVLARTEAERQAAIETTPARKL
FT                   REVRMALTMEQSLIDAAKRDKGLDDAAAKQEAKKQIVTRYLNVVPFGNNAYGIEAAAQT
FT                   YFGIPAKDLNVAQAALLAGMVQSSSALNPYTNPEAATARRNTVLDTMIQNFPERSAELT
FT                   AAKTAPLGVLRRPVTPQQGCIAAGNNGFFCDYAMQFLAENGMSRDSVLRGGYIIQTTLD
FT                   PEVQRSTVRAVKTQASPDADGVADVMSFIRPGKQSHDVVSMASSRDYGLNLRVGQTMQP
FT                   QPFSMVGDGAGSVFKIFTVAAAMEKGLGINTNIPVPGFVAVEGMGNSAGANGCPANAYC
FT                   VKNDGRYPASMSVTQALAQSPNTAFVKLLQQTGVKPAVDMAVRLGLRSYTVPGSSGYGE
FT                   KSMAQYVKDGNFGSFTLGPLPLNALELSNVAATLASGGTWCPPNPIKSISRIKRDAYGN
FT                   PVMDPSGRPALTSVPFNGPACEQVVEEGLANTLANAMSQDDKGGGTSAGAAGSIGWTLP
FT                   SSGKTGTTEAHRSSAFVGFTNRLAGAAYVYSDGPNPQGVCSSPLRSCYDGNLYGGMEPA
FT                   RTWYQGMLPVATKFGPVRLPPNDPEYLSGSSRGRIPGVTGLTASAATARLQAAGFKVSQ
FT                   LDVDSARPQGTVVFTAPSDSAMPGSVITIYVSNGRRAAGDSNGPTETTVQVPGVGPVVI
FT                   QLPG"
FT   sig_peptide     complement(548146..548211)
FT                   /locus_tag="Gbro_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.652 at
FT                   residue 22"
FT   gene            548510..548821
FT                   /locus_tag="Gbro_0495"
FT   CDS_pept        548510..548821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0495"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19825"
FT                   /db_xref="GOA:D0LEA7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEA7"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ACY19825.1"
FT                   /translation="MAKAAVSTGEERLTWVAQARCRGGDPDELFVRGAAQRKAATICRH
FT                   CPVQLECGADALDNRVEFGVWGGMTERQRRALLRQHPEVTSWSAFFAAQRRRQQADAV"
FT   gene            complement(548894..549997)
FT                   /locus_tag="Gbro_0496"
FT   CDS_pept        complement(548894..549997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0496"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: dal:Dalk_2942
FT                   anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19826"
FT                   /db_xref="GOA:D0LEA8"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEA8"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACY19826.1"
FT                   /translation="MPLDLKMGSILTDPETRVVICCGAGGVGKTTTAAAMAMYAAEHGR
FT                   TVAVLTIDPARRLAQSLGMSELTNDPQPVQITPVTGTGSLDAMMLDMRRTFDDMVLEYS
FT                   TPERAAAIMENSFYQTMASSFSGTQEYMAMEKLGKLIEQDRWDLIVVDTPPSRNALDFL
FT                   DAPQRMTSFLSGRLMKMLVGGGRGVGRVVTGAMSLAMRGVSTIIGGDMLRDVATFVQSL
FT                   DSMFGGFQDRAAKTYALLKQPGTQFAVVAAAEADALREAAFFVDRLSEETMPLAGLILN
FT                   RTHPNLTSLSEESARVAMESATDELTRGVLAIHADRAATGKRELHLLQRFTASHPRVPI
FT                   VGVPSLPFEVADAVALRAVAEQITGRG"
FT   gene            complement(549997..551040)
FT                   /locus_tag="Gbro_0497"
FT   CDS_pept        complement(549997..551040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0497"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: scl:sce8296
FT                   anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19827"
FT                   /db_xref="GOA:D0LEA9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEA9"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACY19827.1"
FT                   /translation="MLTVANEEISVDPAEFAGNTWPDAASRARLHFVSGKGGTGKTTVA
FT                   AALALALAADGKRVLLVECEGRQGIAQLFDIPPLPPTDTRIATAEGGGEVSALAIDIEH
FT                   ALLEYLDMFYNLGFAGRAMKRIGAIDFVTTVAPGLRDVLLTGKIKERIIHTDKQGNRVY
FT                   DAVVVDAPPTGRIGNFLDVTKAMADLAKTGPIRNQSDGVVRLLHSEETIVHLVTLLEAM
FT                   PIQETIEAVAELRAKNLNIGGLIINRVSQAHLPSSEVDAIAEGQIDAERIRAGLADAGI
FT                   SLEDQDFAGLLTETIEHATRLQAQQIAKAQLDEVELPTLELPSLGDRGVDLGSIYELAN
FT                   LLQKAGA"
FT   gene            551076..551240
FT                   /locus_tag="Gbro_0498"
FT   CDS_pept        551076..551240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19828"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19828.1"
FT                   /translation="MSEVTAWEYATVPLLTHATKQILDTWGADGWELVSVLPGPTGEQH
FT                   VAYLKRPKG"
FT   gene            551240..551728
FT                   /locus_tag="Gbro_0499"
FT   CDS_pept        551240..551728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0499"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: pol:Bpro_3162
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19829"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB1"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACY19829.1"
FT                   /translation="MSPMTWTDKLAELGISLPAVVPPVASYTPAVRTGDLVYTSGQLPM
FT                   VDGELVARGKVCDGAEGIVDPEQARAAARICALNALAAVDALVGIDSVVRVVKVVGFVA
FT                   SAAGFSGQPQVVNGASDVLGEIFGEAGVHARSAVGVAELPLGASVEVELIVEVAPTRT"
FT   gene            complement(551715..552755)
FT                   /locus_tag="Gbro_0500"
FT   CDS_pept        complement(551715..552755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0500"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   Helix-turn-helix, AraC domain; KEGG: pol:Bpro_4080
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19830"
FT                   /db_xref="GOA:D0LEB2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB2"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACY19830.1"
FT                   /translation="MPSSSSADNPHRVVVLLTEGLVLMDMAAPVQLFGHVGAPRYALST
FT                   CTEYPGPVPTCAGVSVHTEHGLEALADADTIVIPGYHDAARRTPSRTVTAALRQAHRRG
FT                   ARIASICVGAFTLAESGLLDGRRATTHWLDAAALAARYPAVEVDPSVLYVDDGDVLTSA
FT                   GLAAGIDLCLHLVERDYGADVARDYARRTVVAFHRPGGQAQFMPPGAAPRSPQVSLHDQ
FT                   AVAEINHQAMISAQESDDRMAATTGWAVANLADPIGVADLADHAGMSLRTFNRRFRDTY
FT                   GMSPGRWLTGQRIRVAAQLLERTDLPVEQVAAAVGLGTESLRVQFRSRMSLSPSAYRSS
FT                   FRVTSG"
FT   gene            552794..554077
FT                   /locus_tag="Gbro_0501"
FT   CDS_pept        552794..554077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0501"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   psa:PST_3594 MFS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19831"
FT                   /db_xref="GOA:D0LEB3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY19831.1"
FT                   /translation="MPLLRTASTPDAEWVTERAVTEPQAAPEQDRAAVARRTVVLLCAA
FT                   QILGGLSMGASLALGAILGEQLSGSESLAGLPTTVLTLGAAAAGLPLAALAGRRGRRPA
FT                   LSLGLVIAAVGATVVALAVDLGWFGLLLVGMACVGTGTAVSLQARFAATDLSSAATRGR
FT                   DLSLVVWMTMVGAVAGPALVPAGARVAGWLGLADLAGPFVLGAVGSAAAAVVLWAGLRP
FT                   DPLRLAGGIPGGTRRGSLVAGFAVIRRTPSARAAVGAVVAAHAVMVAVMALTPVHMHHG
FT                   GASLTVVGLSISAHVAGMYVLAPVMGVLADRVGRVPTILLGQALLLTSCVLGFLLADSQ
FT                   TGLVVALVILGLGWSASTVAASTLLTESVDVSLRPPAQGVADTSMSLAGAVAGALAGVI
FT                   VGAFGYSTLVLGAGVIAVITAIYVVADR"
FT   gene            554115..554330
FT                   /locus_tag="Gbro_0502"
FT   CDS_pept        554115..554330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19832"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19832.1"
FT                   /translation="MTSELIGRTGVVTLGIGGGESLGEVELAMALGTERFLARCATPVA
FT                   TDETVLVVGVSPGRIVDVEPWVAMPT"
FT   gene            554427..555539
FT                   /locus_tag="Gbro_0503"
FT   CDS_pept        554427..555539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0503"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: GK21951 gene product
FT                   from transcript GK21951- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19833"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB5"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACY19833.1"
FT                   /translation="MLGYNVPEPDEAMLISGKKAHEGGAPFDVVVGHGKWVMPFFRKVR
FT                   YLSMAVHEAQIREVCVTTQGIQLDVRAVIAHKVGGDEVSIVNAGQRFISEQSNEMNQLT
FT                   GQIFSGHLRSIVGSMTVEQIIRERDTLARQVLEASKREMGSIGLVVDSFQIQSIDDMVS
FT                   GYINALAAPNIAKVQREAAVERALADQQASKAQQESLRNQADYERETAIKRASIKSETD
FT                   KANAEAAQAGPLAEARVSQEIVREKSLLAQAQAELREQELISEVVKPAEAEARRTQIIA
FT                   EADAKAVEISSEAAAKNNRIALDQQLIEQLPALVGEVAKGLGSANLTVFNGAEGVNEIM
FT                   TGVITQGAALLKSLQNDLSGTVVDGQADTR"
FT   gene            555556..556359
FT                   /locus_tag="Gbro_0504"
FT   CDS_pept        555556..556359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0504"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pla:Plav_0801 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19834"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB6"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY19834.1"
FT                   /translation="MTPQHPAYGELREITPFASVILCDNPGMMELDGTNTYVLRAPGSD
FT                   ECVVVDPGPPKHKKHARQLAELPGVALILITHRHFDHTGGISRLHKRTGAPTRARLAKH
FT                   CRGAAPLRDREVIEVAGLRITVLFTPGHSGDSVSFLVEHDGERAMLTGDTILGSGTTVL
FT                   DPSDGGLRDYLNSLNRLIVEGENTKLLPAHGPDHPELIPVARFYKTHREERIDQIVAAL
FT                   DEMGVTAHEAKPMKVVRKVYRDVDKKLWPAARMSVKAQLEYLREA"
FT   gene            complement(556499..557173)
FT                   /locus_tag="Gbro_0505"
FT   CDS_pept        complement(556499..557173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0505"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bbt:BBta_5745 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19835"
FT                   /db_xref="GOA:D0LEB7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB7"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACY19835.1"
FT                   /translation="MEEVLARAGIFQGVEPSAVAALTKQLQPVDFPRGHVIFHEGEPGD
FT                   RLYIILSGKVKVGRRSADGRENLLTIMGPSDMFGELSIFDPGPRTSSATTVTEVRAVSM
FT                   DRDALRAWIKDRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGT
FT                   QEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAQRGWLRLEGKSVLIADSERLARR
FT                   AR"
FT   gene            complement(557319..557651)
FT                   /locus_tag="Gbro_0506"
FT   CDS_pept        complement(557319..557651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19836"
FT                   /db_xref="GOA:D0LEB8"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19836.1"
FT                   /translation="MPDLRVSLCLLVPMQGLAALLFPAVLMLFAMAMDKVQARLDRLTV
FT                   SREHVEDFLESADAENVDTLAREGMPAALDELRSRRVTRHESATGRTESDEPEFDEHHR
FT                   SPQRAS"
FT   sig_peptide     complement(557553..557651)
FT                   /locus_tag="Gbro_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.966 at
FT                   residue 33"
FT   gene            557771..558517
FT                   /locus_tag="Gbro_0507"
FT   CDS_pept        557771..558517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0507"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: sfu:Sfum_1062 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein; iron-sulfur
FT                   cluster loop; SMART: HhH-GPD family protein; iron-sulfur
FT                   cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19837"
FT                   /db_xref="GOA:D0LEB9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEB9"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACY19837.1"
FT                   /translation="MSARTSKPETHLGLVRRARRMNRTLQVAFPHVYCELDFTTPLELS
FT                   VATILSAQCTDVRVNQVTPALFARYRTAQDYAGADRTELEEMIRTTGFYRNKANSIIGL
FT                   GQALIERFDGEVPHTLNELVSLPGFGRKTANVVLGNAFGVPGITVDTHFGRLVRRWEWT
FT                   TETDPVKVEHAVGELIERKEWTDLSHRVIFHGRRVCHARKPACGVCILAKDCPSVGTGP
FT                   MDKAQAAALVKGPETDHLLELAGISA"
FT   gene            558643..559263
FT                   /locus_tag="Gbro_0508"
FT   CDS_pept        558643..559263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0508"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mms:mma_1227 PHP-like metal-dependent phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19838"
FT                   /db_xref="GOA:D0LEC0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC0"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACY19838.1"
FT                   /translation="MVALIVAIWPRGDDPAPSQSGSPVASGPRATDAPVSDDELAAARR
FT                   DAAINPCPATGGVPGPDAVLAGITVPCLATGAPIDVGAATAGRPLVINIWATWCLPCRK
FT                   ELPYFEEFAQRAGDRVTVLGVHAAEGASSPVLVLKFLAENGIHLPSVLDTKGAVSAALG
FT                   APPVFPSTILVRPDGTVAKVLPILFHSPDQIAAAVAENLGVTV"
FT   gene            559260..560135
FT                   /locus_tag="Gbro_0509"
FT   CDS_pept        559260..560135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0509"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pnu:Pnuc_0521 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19839"
FT                   /db_xref="GOA:D0LEC1"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY19839.1"
FT                   /translation="MSSEPTVGPLVDAAQIPPWLRGLTGNVDAVAQSVLNRGGDRARWA
FT                   TMFNRNRRAAAVLVLFAGSWDADPQRPGGLPSDAEVLLTERAPTLRQHSGQVAFPGGGA
FT                   DPGDDYPVGTALREATEETGLDAAGVHVVANLPSFPVPVSSFDVTPVLGYWREPSEVRV
FT                   VDEGETARVARVNVREMLAPENRFQVRRSVLGGRVYQGPAFFVDGLLVWGFTGGLIAAI
FT                   SEVAGWDVPWDTDDVRPLDETIERAGSRQQSGFSAVHPPGPAVSDPAVSDPAVPDSLPS
FT                   DSSADAGGGR"
FT   gene            560132..561331
FT                   /locus_tag="Gbro_0510"
FT   CDS_pept        560132..561331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0510"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: ank:AnaeK_0414 peptidase S1 and
FT                   S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19840"
FT                   /db_xref="GOA:D0LEC2"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC2"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ACY19840.1"
FT                   /translation="MSGSAWVDLILIVVALLAAASGYRHGAVASALAFIGVALGAVAGL
FT                   LLAPHLMSKFDDVQARLLVGVAVLIVLVVIGEIAGMVLGRAARSGIRSPGLRAVDSGVG
FT                   SVLQVVAVLVAAGLLAIPLRESAEPAVADAVGDSKVLGGVEVLSPQWVKDLPSDFKALV
FT                   ESSGLPKIPYFNTTNVDPPDPALLALPAVAQARQSVVKIEGLAPSCRQALEGSGFVVSP
FT                   ERVMTNAHVVAGTQRLEVEVESGEKLTARVVLFDPLTDIAVLDVPGLSAPALKFAERPA
FT                   KPGDDAVALGFPEAGPFNVSPLRVRTLFMHTGTTIYQTGDVTREVYAVRGLIRQGNSGG
FT                   PLLNSDGQVLGVIFGAAEDPAEETGFALTAAQVQPDFTRSERSNQRVSTQSCVHLEQGG
FT                   "
FT   sig_peptide     560132..560212
FT                   /locus_tag="Gbro_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.860 at
FT                   residue 27"
FT   gene            complement(561374..562309)
FT                   /locus_tag="Gbro_0511"
FT   CDS_pept        complement(561374..562309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0511"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ank:AnaeK_0555 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19841"
FT                   /db_xref="GOA:D0LEC3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC3"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY19841.1"
FT                   /translation="MAPDPSSVRISGDWHHFDVRANGVRFHAVELDRRGLTDRPLILLL
FT                   HGFGEFWWSWRHQLVSLTDAGYRAVAVDLRGYGDSDKPPRGYDGWTLAGDTNGLVRALG
FT                   HTDATLVGHADGGLVCWATATLHPRVVNRIAVIASPHPRALRHSVVRESEQRSEFLGGF
FT                   LRNQLPRLGERELTRNDGAFIADYFATRSSAAWQATDDYTETLARNRSAVQIPYVAHCS
FT                   LEYRRWAFRSQFRPDGFRFMELMNQRLHIPVLALRGADDPFILDGVMAASERWAAHLKY
FT                   RQIEGSAHFAHQEQPDAVTEQLGKLLHVTV"
FT   gene            complement(562316..562843)
FT                   /locus_tag="Gbro_0512"
FT   CDS_pept        complement(562316..562843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0512"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   psa:PST_1461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19842"
FT                   /db_xref="GOA:D0LEC4"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC4"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ACY19842.1"
FT                   /translation="MSRNEPGLPEPARDPHGSVPSIPLSDASLGRNGEPTIGNLVKDAS
FT                   ASVSTLFRSEVALAKAELVGEAKKAGAGTAALAVAGLMALYMSFFFFIFLAVLLDVWLP
FT                   QWLAYLIVLILLLVITIVVAVVGYVLFKKVRGPTKTIETVKEVPTVLPHRGSSDSGADG
FT                   KVHPQIPAAREG"
FT   gene            complement(562988..564943)
FT                   /locus_tag="Gbro_0513"
FT   CDS_pept        complement(562988..564943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0513"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: afr:AFE_1969 acetyl-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19843"
FT                   /db_xref="GOA:D0LEC5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC5"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACY19843.1"
FT                   /translation="MSSATQPTPTKAYPPSDEFAAQANAPAELYDRADADRLEFWAEQA
FT                   RRLDWDTDFDQVLDWSDAPFAKWFVGGKLNVAYNCVDRHVDAGKGDRVAIHWVGEPGDH
FT                   RDLTYAQLKDEVSKAANYFSSIGLEAGDRVAIYMPMVPEALISMLACARLGLTHSVVFA
FT                   GFSSGALRSRVDDAEAKLVITTDGQYRRGKPAPLKTQVDEALGTGDDAAKSVEKVLVVR
FT                   RTNHDPEMNWVEGRDVWWADTVDEQSTEHTPEAFDSEHPLFLLYTSGTTGKPKGIVHSS
FT                   GGYLTQTSYTFHNVFDHKEGRDVFWCGADIGWVTGHSYLVYGPLSNGATEVVYEGTPNS
FT                   PNEHRHFEIIEKYGVTIYYIAPTLIRTFMKWGREIPDAHDLSSVRLLGSVGEPINPEAW
FT                   KWYREVIGGDKAPIVDTWWQTETGAIMISPLPGVTATKPGSAMKPLPGISANIVDDQGN
FT                   PVGAGEQGYLVLDQPWPSMLRGIWGDDERFRETYWSRFAEQGWYFAGDGARYDDDHALW
FT                   VLGRVDDVMNISGHRISTAEVESALVGHSGVAEAAVIGAADETTGQGIVAFVILREGVE
FT                   NTGDQLIAELRQQVSVEISPIAKPREINVVPELPKTRSGKIMRRLLKDVAEGRELGDTS
FT                   TLVDPSVFEAIRARKA"
FT   gene            565117..565872
FT                   /locus_tag="Gbro_0514"
FT   CDS_pept        565117..565872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19844"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19844.1"
FT                   /translation="MTTDPLAPLLDLPGVRDAADRARDALSAVHRHPANLRGWDKTATE
FT                   ASWRAGRSSAAIDGGSVELRRDGDFDDPILAGAIRVAQALDGDSLDGLTTVFRRAPAQA
FT                   FARLHMLAAAGLVDDADDLGRPRAGDDVPGRLDLLGQLITGATSAPAPVLAAVVHGELL
FT                   GLAAFPTANGIVARAASRLVSTATGLDPHNLGVPEVTWLKRVAEYRTLSRAFASGTPAG
FT                   VGEWIVFCCEALEAGAGEARSIAEAARAG"
FT   gene            complement(566464..567333)
FT                   /locus_tag="Gbro_0515"
FT   CDS_pept        complement(566464..567333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0515"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ppw:PputW619_1270 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19845"
FT                   /db_xref="GOA:D0LEC7"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC7"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACY19845.1"
FT                   /translation="MGPKCPTLSAVGRTLANVTDTTSNGPPPGRRIAAFFDLDKTVIAK
FT                   SSVLAFSRPFYAGGLLNRRAVLKSGYAQLVFLLSSADHDQVEQLRKHITDMCRGWDVDQ
FT                   VATIVRETLQDVVAPLVFAEAAELIADHHRRGHDVVLVSASGRELVEPIGKLLGADHIR
FT                   ASEMRVVDGHYSGELEFYCYGEEKAVAVTAMAATHGYCLADCYAYSDSVTDLPMLAAVG
FT                   HPVAVNPDKRLRRHALEHGWGVLSFAHPEPAHARFTGRGPALVAGALVVASAAAIGSVT
FT                   LRRLQSGT"
FT   gene            complement(567621..567998)
FT                   /locus_tag="Gbro_0516"
FT   CDS_pept        complement(567621..567998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19846"
FT                   /db_xref="GOA:D0LEC8"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19846.1"
FT                   /translation="MPYLGLIYLVILVIALIDIINTDESRVRGLPKMAWVILVVILPLV
FT                   GALVWLAVGRPTADDLPRRPRGAASEFPEYDSPGRYVPTDPDADREFLQQLRDRAEEQR
FT                   RTAREQERRRRERDVDPDAVD"
FT   gene            568198..569256
FT                   /locus_tag="Gbro_0517"
FT   CDS_pept        568198..569256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:pRPA2 partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19847"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19847.1"
FT                   /translation="MTDDLLALVGPDLLDDAARCAAAAGYRMIVADAADCRRAWLTSRA
FT                   VLVDPAALDLLTAARPPRRDGVILVTGGEPPPRSWRLALDLGAADVLTLPGDDGRLVRL
FT                   LSELRAPRRSPAGAVALMSAHGGAGASVLAVAVGLTAARAATRTLLLDLDDLGPGADLL
FT                   LGIEDRSGLRWGDLSLEGGVVVGGALHHALPKAEEMLSVLASRGDDPRPPRADAVTAVI
FT                   DAGRGNGDLVVIDLPRTEGAVTRAAIESVDLVVLVTTPTVLGCAAARRTVGRLLDGVRV
FT                   ELCIRGPSPGGLRAGQVADAVGLPLLASYRPDPRMAARLESGRPRVTPRNPLGRAAEVI
FT                   YRRAAPTERAVA"
FT   gene            569253..570422
FT                   /locus_tag="Gbro_0518"
FT   CDS_pept        569253..570422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0518"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sml:Smlt2873 putative type II/IV secretion system pilus
FT                   related ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19848"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED0"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACY19848.1"
FT                   /translation="MSAHTDEELLDRVRARLASDAAEPTAEVIAAAIRAESGGVLGDTD
FT                   LLAALRFLQTELTGAGKLEQLLAEPDIADILVAGPDDVWVDRGQGLRRAPITFADESSV
FT                   RRLAGRLALGAGRRLDDAQPWVDGQLANIGRRGYTVRLHAIIPPLAADGTCISLRVLRS
FT                   ATKNFDNLISSGAIPDEVVGVLREMLRARLAFLIVGGTGSGKTTLLNALVGEMNPAQRV
FT                   LCVEDASELAPQHPQVVRLVARAPNVEGVGEVPVRALVRQALRMRPDRIIVGEVRGAEV
FT                   IDLLTALNTGHDGSAGTVHANSTAEVPARMEALAALGGMNRDALHSQLAAALQVVLGVA
FT                   RTADGDRGLVEIGLVSRGDDGLVRVAPMWLRHSGFTSAKAVFDELVATR"
FT   gene            570440..571234
FT                   /locus_tag="Gbro_0519"
FT   CDS_pept        570440..571234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0519"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   ank:AnaeK_2912 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19849"
FT                   /db_xref="GOA:D0LED1"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED1"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACY19849.1"
FT                   /translation="MPLLIAGALTCLWWPATHGEHRLRVHRRMRRPTDLRPMLLGVVPL
FT                   AAVLFGGVAAAVAAAVVVAVVAWRQRRRRSERDADRRIDDMTRALSMMISELSVGTPPN
FT                   RAAQVAVVELRRRGGDCQVADGLEGMACRAELGGAVIDAAEKWDATWGPVSWQRIGVAW
FT                   QTAERHGLPMADLLGALRSDLLARRAFVDRTRAGLAGPRATALVLAGLPVLGIALGQAT
FT                   GARPLGVLLGGGIGGLLLVIGTSLAATGLVWTERLTARVLTP"
FT   gene            571231..571839
FT                   /locus_tag="Gbro_0520"
FT   CDS_pept        571231..571839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0520"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   bpd:BURPS668_A3093 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19850"
FT                   /db_xref="GOA:D0LED2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED2"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACY19850.1"
FT                   /translation="MTVSIALMVAGAAAVLWPAPRWLLYRVVDPPPAPTREPRWLGVRS
FT                   DSDDPFAVAAAFDLFAVCLRAGLPVGTAAATVAASAPASLAGPLTEVADLLGLGADPDT
FT                   AWSVLTASDTPVVGAQPHLDALASMARRSARAGSSLAAGLAELADETRRQAHDTATAAA
FT                   ERAGVAISGPLGLCFLPAFVCLGIVPVVIGLASTVLGGM"
FT   gene            complement(572005..572244)
FT                   /locus_tag="Gbro_0521"
FT   CDS_pept        complement(572005..572244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0521"
FT                   /product="Cold-shock protein DNA-binding protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: crp:CRP_181 cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19851"
FT                   /db_xref="GOA:D0LED3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED3"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACY19851.1"
FT                   /translation="MVLSNTGKRYKAMAQGTVKWFNGEKGFGFIAPDDQGADVFVHFSA
FT                   IQGSGFRNLEEAQRVEFDVEQGAKGLQATNVSVI"
FT   gene            572376..572507
FT                   /locus_tag="Gbro_0522"
FT   CDS_pept        572376..572507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19852"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19852.1"
FT                   /translation="MSPIQSVRHTVDRLGAHTMRVIADEDGMSTAEYSIEPNYTLRH"
FT   gene            572590..572985
FT                   /locus_tag="Gbro_0523"
FT   CDS_pept        572590..572985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0523"
FT                   /product="VRR-NUC domain protein"
FT                   /note="PFAM: VRR-NUC domain protein; KEGG: hde:HDEF_1654
FT                   APSE-2 prophage; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19853"
FT                   /db_xref="GOA:D0LED5"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED5"
FT                   /inference="protein motif:PFAM:PF08774"
FT                   /protein_id="ACY19853.1"
FT                   /translation="MSTRSSAPRESAIERHLVQRCAEIGVLCLKFTSPGHVGVPDRVLM
FT                   GHDANDDSVTLFVEVKRPDEAPRPSQVAMIRRMRDHGQHAVVADSKASVDALISDYFTH
FT                   PTVPIAKRDPHAAPLPGRTGAVITALR"
FT   gene            573047..573430
FT                   /locus_tag="Gbro_0524"
FT   CDS_pept        573047..573430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19854"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19854.1"
FT                   /translation="MSAPTTTVTDPWIERQIQAHHLSPGARGLTREEAAHQHNSTNALT
FT                   PEDVDYLYTPGQAQVVARDALAVIGIEVDPDTRVVLTDGRAGPRCSYYLLNPGQVEAAV
FT                   EQHRLTTSENLSADALIASLPWE"
FT   gene            573421..573612
FT                   /locus_tag="Gbro_0525"
FT   CDS_pept        573421..573612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19855"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19855.1"
FT                   /translation="MGVTVTAAEALITRAWDVAEAHRLTGSHALVQAIWTLEYALDHNT
FT                   TDTGHAAARVETLIGELP"
FT   gene            573609..574169
FT                   /locus_tag="Gbro_0526"
FT   CDS_pept        573609..574169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0526"
FT                   /product="Antirestriction ArdA family protein"
FT                   /note="PFAM: Antirestriction ArdA family protein; KEGG:
FT                   kpn:KPN_pKPN5p08170 putative antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19856"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED8"
FT                   /inference="protein motif:PFAM:PF07275"
FT                   /protein_id="ACY19856.1"
FT                   /translation="MTTAHDRPAVDEPRVWIGCLECYNAGRLVGDWYDCADAAEVTTSQ
FT                   LHGRPIREHTHEELWCLDTDNIPVDREMSPVEAGEWAETYDEVGPEQWPALCAWVRSGS
FT                   YVAQGDSDLPCVGDFEERYAGEWDSFRDYAFQLAEDLALFDGLDDDHVAVRYFNWDSWI
FT                   SDLESDFTVVPTGHGGVHVFRSL"
FT   gene            574171..574329
FT                   /locus_tag="Gbro_0527"
FT   CDS_pept        574171..574329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19857"
FT                   /db_xref="UniProtKB/TrEMBL:D0LED9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19857.1"
FT                   /translation="MEDLYPSEPSILRCPTCRRTALHDKRGCRLCRNEALDRLIDKTAG
FT                   QPGVDDS"
FT   gene            574412..574639
FT                   /locus_tag="Gbro_0528"
FT   CDS_pept        574412..574639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19858"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19858.1"
FT                   /translation="MTAIRHTVAARDLRGGDRIVGFTHDADVGITGIEVMESGGIMLSM
FT                   VVIDHDGHEIAGRTVFIAHPDVEYSIRRHL"
FT   gene            574706..574993
FT                   /locus_tag="Gbro_0529"
FT   CDS_pept        574706..574993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19859"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19859.1"
FT                   /translation="MLIDVPNMVGVANIDGPVHVDGPGLALVTLRAYTPGGARIGTRDQ
FT                   AIAIVDDLDSVRLVAVRDRPRWRPDPRIATVDRLMARVGPIDPTSTRSEE"
FT   gene            575063..575383
FT                   /locus_tag="Gbro_0530"
FT   CDS_pept        575063..575383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19860"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19860.1"
FT                   /translation="MGVRRPGDPVEVQRVAGPDDPADVAAYTYGAVPERYVVQVQALAY
FT                   ALVVDGKLVGLASETDREALSDAAFDYLGRDEHDLLTHDGPFDPQRPRRAMTPVPRCNG
FT                   DA"
FT   gene            575912..576667
FT                   /locus_tag="Gbro_0531"
FT   CDS_pept        575912..576667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpf:Rpic12D_2697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19861"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19861.1"
FT                   /translation="MITANTTDTHIDDDRTLVEVVHIHKDTVVYTQYQGEFEPQPVSIE
FT                   VSLDTGLIIVDIDSEVGCVFTPRQFGGVDRNYSIPATASATDINKLLDVIAPLAQQMID
FT                   NAETGLDRDGNPVGRVDDDDDQELTDTDIELGLDAHDPISLAIARFPFEGQHSQAAIDG
FT                   LIREVACKWVPVLKKEWAELVADPDYDFEPFALIEAAGYVENALSFDQGVGGIYPIPYA
FT                   LDYVMGGTEFSMFELALREGTVPAVELID"
FT   gene            complement(576926..577057)
FT                   /locus_tag="Gbro_0532"
FT   CDS_pept        complement(576926..577057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19862"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19862.1"
FT                   /translation="MDDPLPPDPPPGMWEAIESLLAHERELWEVGIDAPPWYRHESD"
FT   gene            complement(577067..577534)
FT                   /locus_tag="Gbro_0533"
FT   CDS_pept        complement(577067..577534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0533"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /note="TIGRFAM: DNA mismatch endonuclease Vsr; PFAM: DNA
FT                   mismatch endonuclease vsr; KEGG: ajs:Ajs_2197 putative very
FT                   short patch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19863"
FT                   /db_xref="GOA:D0LEE5"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE5"
FT                   /inference="protein motif:TFAM:TIGR00632"
FT                   /protein_id="ACY19863.1"
FT                   /translation="MAGMGESWASSPAARASMRGNRRRDTRPELEVRRLLHAMGLRYRV
FT                   DLAPLPESRRNRADIVFIRARVAVFIDGCYWHKCPDHYRPARRNANFWSAKIEGNRERD
FT                   RRVTAMLEGAGWTVLRFWEHEPAAEVADAVADEVRAHAPVDRRTADGPGPG"
FT   gene            577607..578806
FT                   /locus_tag="Gbro_0534"
FT   CDS_pept        577607..578806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0534"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: bgl:bglu_1g01510 DNA
FT                   cytosine methyltransferase M.NgoMIII"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19864"
FT                   /db_xref="GOA:D0LEE6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE6"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ACY19864.1"
FT                   /translation="MRSVELFAGGGGLTLGTHLAGFTTEVVAEWDRWSCDTLRENRDGG
FT                   YPLVRDIDVEEGDVRYVDWSSVPEGIDLVSGGPPCQPFSAGGKGAAADDKRDMFPATAE
FT                   VIRQLRPRAFIVENVRGLTRSAFSDYYSYIQLRLGHPEIVAKAGESWGDHFARLQAEHT
FT                   SVRSDLQYKVMPTLVNAADYGVPQQRWRVFFVGFRSDVDAEWSFPSPTHSAAALRAAQD
FT                   NGSYWEWHKVAKKYRTPTVRTAALVDGPLKPWRTVRDALRGLPEPTRNGSTKYLNHVLQ
FT                   PGARSYPGHTGSYIDAPAKALKAGVHGVPGGENMLRDVDGSVRYFTVREAARLQTFPDR
FT                   YRLHGPWSEAMRQLGNAVPVMLAETVALSVREHLDVADFNAARAQAVSRQRAKRGSASA
FT                   "
FT   gene            578803..579408
FT                   /locus_tag="Gbro_0535"
FT   CDS_pept        578803..579408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bgl:bglu_1g01500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19865"
FT                   /db_xref="InterPro:IPR018575"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE7"
FT                   /inference="similar to AA sequence:KEGG:bglu_1g01500"
FT                   /protein_id="ACY19865.1"
FT                   /translation="MSAPFNPLDMGNLAKSVVNQIEEMEPVPLDDVKAFYGAGVYALYY
FT                   TGDFPAYAELAAANAESLVQPIYVGKAVPKGGRRGLEAVSHTDTKTLSSRIREHAKSVR
FT                   AAENLDIADFRARWLVVEDIWIALGESAMIRRYRPVWNAVLDGFGNHDPGSGRVNGKRS
FT                   MWDTLHPGRPWATKYPERDDTAAQIAQDVTQYIADRLN"
FT   gene            complement(579430..580344)
FT                   /locus_tag="Gbro_0536"
FT   CDS_pept        complement(579430..580344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_1g01500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19866"
FT                   /db_xref="InterPro:IPR018575"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19866.1"
FT                   /translation="MGRKNLTKTAAIQELIDALNSAVTLSGQLDGWDAPVKNDRAAIVA
FT                   ARDHLIRTVDGQLYRHEMPAGVFNPADPGLFGLVAAVGLVHQDLEPLNDIVKTYGSGVY
FT                   ALYYRGDNDLYRPLLGTQTPIYVGKTKTPTSGVLVEQGVALTDRLTKHFKSIGWGHGLD
FT                   VDDFDYRRLVIAPGWEPVTEGALINLFRPVWNKRAASKDPVTGRAVRYVHGFGKNGDDA
FT                   DTRNNGRSPWDTLHPGRPWANDKDPTRPTKNQMERAEIEALIAKHFADNPPIAKADDVV
FT                   KRLVDSMTRGEAPPIVEDDEDES"
FT   gene            580458..580724
FT                   /locus_tag="Gbro_0537"
FT   CDS_pept        580458..580724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19867"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19867.1"
FT                   /translation="MPSTFTIDGFEPEHVWTAVRYGRPWNGWATPVVTRDVLESVIAAA
FT                   EGETLHFIETTAVISGDKLRPDADGNYDLGQIGWCFIETDRWD"
FT   gene            580788..581510
FT                   /locus_tag="Gbro_0538"
FT   CDS_pept        580788..581510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_0529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19868"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF0"
FT                   /inference="similar to AA sequence:KEGG:PputGB1_0529"
FT                   /protein_id="ACY19868.1"
FT                   /translation="MLQITDYTGADQYDQCLHCARKLDAKPTRDHVPSLGLLASPYPDN
FT                   LPTVDICPECNNGFSDDERYLFLLLDCVLSGSADPNDQPDPRVAERLGKAPGLARRIAD
FT                   QQVLTLPLDVETVWWQPESARINTVIVKNARGHVMYETGVPLHRQPDSVAFSALSILTA
FT                   EQRQAFERGADDSAHGVLLPEVGTRALARAFTPDVVDGWVVVQTSRYRFAVDTGDSAVR
FT                   VRSVIREYLATETIWCLD"
FT   gene            complement(581759..582364)
FT                   /locus_tag="Gbro_0539"
FT   CDS_pept        complement(581759..582364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19869"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19869.1"
FT                   /translation="MLLTTTQTADTIRDGLGRDGHEPSVFADKVVSLAHAGSLTNVGSG
FT                   ARYMFDQAQVEEFVARTRFVIDLDEVRALHPDGLVYRVSVKPRQPRSAVYHVRGVTYSW
FT                   VGVDFTDNPAGDDELGGWAGVWPVNRELLAELVDERALVYASMRDYVGPDHMRRIVDVE
FT                   PVGDRYFFVTDPAPDPVREWLGSGAWISTPGGPICALV"
FT   gene            582667..583239
FT                   /locus_tag="Gbro_0540"
FT   CDS_pept        582667..583239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0540"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: ses:SARI_00048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19870"
FT                   /db_xref="GOA:D0LEF2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF2"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACY19870.1"
FT                   /translation="MALVGLVRVSTDKQETRRQHDALDAACVKVFEEKVSGKLGVDDRP
FT                   GLRAALDYLRPDDMLAVLEVDRLGRNLLEGLIVLTDLFERGVGVKVLEGVAAGEHTERS
FT                   LILDLALALAEDRRRDISRKTRSGLEAARRRGKVGGRPSVVDDDKRAAILARRERDESI
FT                   REIAAGVGVSVGTVHRVITADGARQTA"
FT   gene            583335..583805
FT                   /locus_tag="Gbro_0541"
FT   CDS_pept        583335..583805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ANKRD24; ankyrin repeat domain 24"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19871"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19871.1"
FT                   /translation="MSAQTAILDRVTPNPYDQLAGRLWRAAWLVEQVGTLMQRRRGAAG
FT                   TELARIDAELHRLRADFAATAGGLIPKALIDADSIAALARIVETGRAATVPDALRVLDA
FT                   DRRAAQRQRSDDRVRAIERRAADQAQFAAREAVHANARRTRRAIRDLGRKLR"
FT   gene            complement(583811..584317)
FT                   /locus_tag="Gbro_0542"
FT   CDS_pept        complement(583811..584317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19872"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19872.1"
FT                   /translation="MTGNFGDFMAGKRHKAQAAVADADAQREAAAADQARVSRIMQTRQ
FT                   ARAHVVGDLVEENPLIGVPAALVIIWMQRMRDRNSRALASRYEQRRREQGATALGDGPL
FT                   SPGDAADVRDFLGDTELDDGRIALDAWEAEHGQTRERTESVIGKLDRHMPDDGSGPDVP
FT                   TERTR"
FT   gene            584725..585015
FT                   /locus_tag="Gbro_0543"
FT   CDS_pept        584725..585015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0543"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: sbc:SbBS512_E1249
FT                   repressor protein C2"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19873"
FT                   /db_xref="GOA:D0LEF5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY19873.1"
FT                   /translation="MPAPDDRLDEAQLRVRRVRRQALAKALVTARHKAGLTQGQLAERS
FT                   GLSRSAIARAEAGEASLSSDRFWDLAKALGIRPSALWLAAEADEAASRTLD"
FT   gene            585059..586078
FT                   /locus_tag="Gbro_0544"
FT   CDS_pept        585059..586078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0544"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19874"
FT                   /db_xref="GOA:D0LEF6"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF6"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACY19874.1"
FT                   /translation="MPGIDLYQIYGLDRTHPPEALAAALTDQLNRVDPRDTLTRSRIDT
FT                   ARAILGDPQRRAAYDRQLGDPSAPSVTEEALARISGRPVPTAPRPSLRAQFASKQVRIV
FT                   SAITAALALVLVVGITAVACSGGGDSGTAASGGDAGNGSTAAAPSSGDAGCEPSNNEYT
FT                   SRAKWDGSRSTAPSYEVALTRRIALPRSMPWTDRVLGGTDYYRIGDGFRINYRGLAQLQ
FT                   DRSIGVFQGPDPSDASTPTAIVTTVSQDGAIVSTRDYAGADAPLPAGFDLARTTLAGYF
FT                   RISAADGVSIPAAATGTEQEQAYAEQILPDAFDEHTVWVIMRGEEGAIFKATFQRCTN"
FT   gene            586113..586505
FT                   /locus_tag="Gbro_0545"
FT   CDS_pept        586113..586505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19875"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19875.1"
FT                   /translation="MNRFRKPATALAAAGAIVAGTLAGTVVGAGDAAARVDAGNYIWTT
FT                   TKTLTGARGAYPVTIRGNVLTVDLPGTVIGAPRHARLHPTRAGAWMDYGGNRYTFGRKG
FT                   NRYVGQELWLTINGAVVGTTTLTPRR"
FT   sig_peptide     586113..586199
FT                   /locus_tag="Gbro_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.427 at
FT                   residue 29"
FT   gene            complement(586725..587090)
FT                   /locus_tag="Gbro_0546"
FT   CDS_pept        complement(586725..587090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19876"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19876.1"
FT                   /translation="MKNTKNMLAATALAGAAAGALALGTGTGTAAADTAGVPDGNYSAE
FT                   VLNPIRPVTSPPVATVPVTVSDGVLTVGGLSGRLTPTADGARTTLAGQPVVLSDGWNGT
FT                   YGIVINGSTWAHLLAAK"
FT   sig_peptide     complement(586992..587090)
FT                   /locus_tag="Gbro_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.851 at
FT                   residue 33"
FT   gene            complement(587159..588163)
FT                   /locus_tag="Gbro_0547"
FT   CDS_pept        complement(587159..588163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19877"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19877.1"
FT                   /translation="MIMSDNEFEYVDEDGNVVDPSELGDEYEIVDEEVVTEPVDEAAPV
FT                   PVTGDHGGGTATGSGMPKSVKLTLGAVGLVALAVGGALVVGLSKIGSENTAADVKAGAS
FT                   SKYAQASSAVASKSSAVRSEVDATVGAVDTCRVGAAAASSPTGTLADAVMTGSARPRLE
FT                   LVIDATAPLPTTFVRAKAGAEAADAGQGKKLLARNAKRLDLIQLGKDSWAAYAYTAPDD
FT                   APAPAWRKADVTVADGDITVTGDRDWPGGDAPTAGSCEHGTPGAYAVSGQIPAGAAGLV
FT                   DGTATVHLIQGVAGQPTKAVAVMGDAIALVTLAASDDAEGGDASASSSAVPSK"
FT   gene            complement(588150..589124)
FT                   /locus_tag="Gbro_0548"
FT   CDS_pept        complement(588150..589124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19878"
FT                   /db_xref="GOA:D0LEG0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19878.1"
FT                   /translation="MTAPTPTPEIHVHAGQSNAGMELIRIVATLLLFGGLGVLVWAVSQ
FT                   GPLAEQASIVAAAGSMFFARQLWRRGVVGVPSVATPAGGASLGQSLVNAVTTQLARRGA
FT                   LTLLIIAIGIGFVFLFVREVIVVAMASIFGDGAAVYLSIAMTAALGFLAQHLADRRFGP
FT                   PRREGPRVIEWNSLPGEEGIDHVYRIARELTSNSDGFVRRCHWAMLLPVAAGYGVLTLA
FT                   VREIVTQAMSVFQNLWIAGGVALAIGSLVVMPTLIPTMLKALRDREVTDEASAAPAAPA
FT                   QVVIPTVANAAPTTSVVTPTTSSPATKKVVRRVVKKKDVNDHE"
FT   gene            complement(589221..589427)
FT                   /locus_tag="Gbro_0549"
FT   CDS_pept        complement(589221..589427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19879"
FT                   /db_xref="GOA:D0LEG1"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19879.1"
FT                   /translation="MKDTDPEPRRELAWDLAGVAAVLLIGVGLWGIADTGAFEGTILAV
FT                   FGNLWLSLGLACVVGGLIMAPRR"
FT   gene            complement(589424..589633)
FT                   /locus_tag="Gbro_0550"
FT   CDS_pept        complement(589424..589633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19880"
FT                   /db_xref="GOA:D0LEG2"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19880.1"
FT                   /translation="MTKQSLVSRLPAVLAMLAVLAGLAAIVAGIALGGPWRWASGAAVA
FT                   VGIAAIVAPGFVKDKCDNDIEEKK"
FT   sig_peptide     complement(589532..589633)
FT                   /locus_tag="Gbro_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.710 at
FT                   residue 34"
FT   gene            complement(589630..590070)
FT                   /locus_tag="Gbro_0551"
FT   CDS_pept        complement(589630..590070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19881"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19881.1"
FT                   /translation="MTDLNIYARRARKMVAGVGRLAAANEVDREDREHDLVALARVADT
FT                   VAVIEAVAQVDAVPGLWEALLAAARHRVKAEGVSPRLNEELETALGEYLREHPRLSGNG
FT                   HELWALERAADQLDLDAQIAKSNTASDEPDSTRDVLDELYGS"
FT   gene            complement(590067..590747)
FT                   /locus_tag="Gbro_0552"
FT   CDS_pept        complement(590067..590747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19882"
FT                   /db_xref="GOA:D0LEG4"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19882.1"
FT                   /translation="MADAHATRERANWVKARAGHSAAAQRRGQQLAVRANRRARYEAGA
FT                   GDSAAAEALVQRRFRRIAFERDEHKGRWTLIAALHEAARILLAGPAIGLGWAIYGIWYR
FT                   SVPQWGPLRWKALAVAASASTIPVAVIAAVAWLGSGVPLWGWWLLAQPVAGIAYAAWLS
FT                   YAYGWDAVPARDADAPAPIRVRIGDEPTLPETEPTEPVRPVPVKTVRVTVTRNGIDEEQ
FT                   GEQK"
FT   gene            complement(590740..590907)
FT                   /locus_tag="Gbro_0553"
FT   CDS_pept        complement(590740..590907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19883"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19883.1"
FT                   /translation="MAKAAKPRIWRRRWVLIAIAMIASFAVGLTVGAGAQITRDANPRC
FT                   GAPASVTTDG"
FT   sig_peptide     complement(590800..590907)
FT                   /locus_tag="Gbro_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.529 at
FT                   residue 36"
FT   gene            591015..591293
FT                   /locus_tag="Gbro_0554"
FT   CDS_pept        591015..591293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19884"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19884.1"
FT                   /translation="MADPTEDPTAPTVRTAMTVSPIDAKRLKQVGLDFGTPAAVAARTF
FT                   VNYCLDRLDDPAISGALTEAAKAERERRSRAAAMGGRLGGGSNKKKE"
FT   gene            591300..591752
FT                   /locus_tag="Gbro_0555"
FT   CDS_pept        591300..591752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19885"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19885.1"
FT                   /translation="MSLYRKDSGPYKPKPTPFGGFIDGARAITAPHLLCVGPTGRGKSR
FT                   RVLGPALLMWEGPGVAISSKPDLIELAIEKRLGMGGHGKTYVLDLSGKVPASVMPDGAE
FT                   MVVADPVALITDDDTAIDMTEILLRTSGSSAGGGDSAKKDPFFGLS"
FT   gene            complement(591765..593027)
FT                   /locus_tag="Gbro_0556"
FT   CDS_pept        complement(591765..593027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0556"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: tmz:Tmz1t_0333 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19886"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D0L907"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACY19886.1"
FT                   /translation="MQNATLWRALLGVEKTVVEDIEFDEDEQTLVACVRPTRRAGARCG
FT                   RCQRRSPWYDRGEGRRRWRALDLGTIQVHLEADAPRVNCREHGPTVRAVPWARHGAGHT
FT                   TGFDEQVAWLATQCSKSAVTELMRIAWRTVGAIITRVWADVEKLHDRFADLRRIGIDEI
FT                   SYKRGHRYLTVVVDHDTGRLVWAAPGRDKATLEGFFDALGEERCSQITHVSADGADWIS
FT                   TVVADHCPHAVRCADPFHVVRWATDALDEVRRAAWNQARGAATQRRAGRASGHAKALKH
FT                   ARYALWKNPENLTVRQQAKLAWVAKTDPRLHRAYLLKEGLRLVFQLPHAEAAEALEVWI
FT                   RWARRCRIPAFVELQRRIVKHQASILAAIEHGLSNGRIESVNTKIRLITRVAFGFRSPE
FT                   ALIALAMLNLGGHRPVLPGRS"
FT   gene            593159..594067
FT                   /locus_tag="Gbro_0557"
FT   CDS_pept        593159..594067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19887"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19887.1"
FT                   /translation="MAPLAGLLRAAGEDGIRWVRRAVGRIEPPTPEDRATPCWLNAIGR
FT                   LEQLGSMMLAEELVNTAAFSDRLRDSIQATMKVAVAPWWREAVVGPTDAKPFIPAMLED
FT                   PRSTLFMVAPADGIAAAAAVGVVDAISAHWRDGQTRPVPLQHLLIVCDEMCNTLPWQKL
FT                   PIVITESRSMGISVLAAVQDTQQFARRYNREIMEELRRVFPSILILSGSEEKELLDKAA
FT                   WAAGRTERHKLSRDHAGKQSQSSEMAPAYEGSDLLPKRIGEGRLLRGTRPGASPDDPIE
FT                   PAGLLVDLFDISQLDIDIDVA"
FT   gene            complement(594126..594578)
FT                   /locus_tag="Gbro_0558"
FT   CDS_pept        complement(594126..594578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to CG33484-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19888"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19888.1"
FT                   /translation="MSDESKESTSVRDRLDAAKEADRRIEERRREQEDAAREVADRRRV
FT                   LDDAEKRSAPGQRDLDAERVGQIRHELAKGGDDAVRRRFGGAAVKSPEAAKARAQQRSA
FT                   QRRGREAMERGVDEARSREASRTPLRDAAVKQQQGRERERDTSRGR"
FT   gene            complement(594610..594822)
FT                   /locus_tag="Gbro_0559"
FT   CDS_pept        complement(594610..594822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19889"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19889.1"
FT                   /translation="MSILDRLTAHIEATRPKCALCGRNAVVRITYTTRYSRGDTWGETW
FT                   CCADHADEEVDYRSPRGMIREIKWL"
FT   gene            complement(594831..595310)
FT                   /locus_tag="Gbro_0560"
FT   CDS_pept        complement(594831..595310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19890"
FT                   /db_xref="GOA:D0LEH2"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19890.1"
FT                   /translation="MTEAVKSVIEAGIADLNPLLNSTAVGKHLVANLGDEVSQRAVQHA
FT                   DEVAAALDRATDRLDRVGDRAARLNDSLAVAGLTKLALAAIPYAVVIALLLFLVVPAAE
FT                   VTGIGPLSRWVWGGFETADGWPMRAAIASGWFAALGVLGFGVYKAGHALARIYRK"
FT   gene            complement(595282..596967)
FT                   /locus_tag="Gbro_0561"
FT   CDS_pept        complement(595282..596967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19891"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19891.1"
FT                   /translation="MAITEISPAGNLEALDRYTGSIAAKDADSPEPTQRDEFVSTIGDC
FT                   TPEHFVDRVRANARRFGKEKLKHEAYHLIVSQTHEEADQRDPQAGHRQHTMVRELARRR
FT                   FPGHMAKLVTQRDNGRWVEVDGERVWQPGKWHTHCIIANVSSREAVLELVDKDGTPHER
FT                   HERHYAAGRAIDGAKKNIHQIRHGPGGTDEQILEHFGYDNARYVEECRSAAKGRGDRAT
FT                   TRDVVQRADPDGRGYSNHDEVRVKLRAARALADSWDDYTARLAADGVHTRVTGASGVSY
FT                   AWVSDDGVEHKASARSRKGRDGLGNDFTRAEVEAQCAINAERIGRGETLDVPERAPVPA
FT                   PPAPAERPVPVYLTPGGRPPWERDADAFAARVRESGGTYEGRAREAVDAALADALDRDD
FT                   LVAVAAEHGVEIAGDDTVRVRSGRRGRVAVALDTERAERVRSVEPLDLGEVRVDRIDRI
FT                   DINESAKEEERDDLDDIIDLDGIEIERFGGAAEGAGRGAERGGGRAEVAHVGGGGARGR
FT                   DEDADRSGGGPGGADQCAERATPLRDRAVADAVGRDDGGREIGD"
FT   gene            complement(596967..597464)
FT                   /locus_tag="Gbro_0562"
FT   CDS_pept        complement(596967..597464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19892"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19892.1"
FT                   /translation="MTTVIGTEGQGATAPDPGVPGAVGTAAAERSPKPRGARKEAPIAF
FT                   RPRPGTRARLAKRAGGRSISHEVELAVDAWLGRKVAEVDPVLRDHLAAELSAIGDRLAE
FT                   VAHQEAGVARNYNQMQHFLNTYRELPVGLREEVSKIVVQREQILTQLRFIRQELAVLVE
FT                   AR"
FT   gene            complement(598617..598847)
FT                   /locus_tag="Gbro_0563"
FT   CDS_pept        complement(598617..598847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0563"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /note="TIGRFAM: glutaredoxin-like protein NrdH; PFAM:
FT                   glutaredoxin; glutaredoxin 2; KEGG: rle:RL4261 putative
FT                   glutaredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19893"
FT                   /db_xref="GOA:D0LEH5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH5"
FT                   /inference="protein motif:TFAM:TIGR02194"
FT                   /protein_id="ACY19893.1"
FT                   /translation="MSITVYTRPSCGPCRATKAALDKARLEYDVVDISQDDAARDYVMA
FT                   LGYLQAPVVVAGDQHWSGFRPERIRKLAAVA"
FT   gene            complement(598849..601068)
FT                   /locus_tag="Gbro_0564"
FT   CDS_pept        complement(598849..601068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0564"
FT                   /product="phage/plasmid primase, P4 family"
FT                   /note="TIGRFAM: phage/plasmid primase, P4 family; PFAM: D5
FT                   protein; KEGG: dac:Daci_3426 P4 family phage/plasmid
FT                   primase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19894"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH6"
FT                   /inference="protein motif:TFAM:TIGR01613"
FT                   /protein_id="ACY19894.1"
FT                   /translation="MYNNESNGVDFDAVDLDSISAPDLPDDVVEAVPGGPTDPEEALLR
FT                   RVADVKESLRGSASTAPGRNRDGIPYATPTAILAATVTDDYLSPDNLPTLRHMVSGGTK
FT                   GTPAQRAECAKQGTRDVAQDLVGRINDRIAYENALIKGSEDNPPALIGTKRNMLTQLGF
FT                   AEVARLMGALYSVVSITPSTSNTDPDLNILAAYDDDPTSEHFGTYRSEVGHLRKIARRY
FT                   QPNMSVKEFSDVLAAMGDFAPTVTRGGDRDLIACRNGVVDYNGGSPVFHEFDPKYVFLA
FT                   KLDVDWNPDAQNPVFDTPDGDQWDVESWMASLSDDPEVVDLLWKGIGAIARPYNSWNKA
FT                   MFFYSRKGNNGKGTLLSLMRNMLGVGNYASIPLADFGKDFLLEPLTRANAILVDENDVG
FT                   TFVEKAANFKAVITNDVITINRKYKAPIAHQHFGFMVQCLNDEPVFKDKSESIYRRQIF
FT                   VPFEKCFTGAERKYIKDDYLRRPEVLEYVLRRVLTMDYYELPEPAAVQAALNQFRESND
FT                   PVRAFWNENQMLFQWDLLPFPFLHEFYVAWMGRYMPNSKPIGKNKFISELVQLVDADPT
FT                   SQWYCDDHTAQHRPARRMVDPEPLIVEYSLVNWGDTSTKPGDKNYRTRRATIPGDMLKA
FT                   NYRGLLRRDDVDVVNVGFADPLADTDGPVDPPVDQASMGPAVVGGLVATGERPTPAPPA
FT                   KPTTPRSKPKRVKRPTPPVPAEPGCNPFAPGYTFINNPYAPDAGE"
FT   gene            complement(601168..601368)
FT                   /locus_tag="Gbro_0565"
FT   CDS_pept        complement(601168..601368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19895"
FT                   /db_xref="GOA:D0LEH7"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19895.1"
FT                   /translation="MAKTAGYLTVSEYAALMRISKWAVYDRIRAGLIPGVHQIAKGATY
FT                   RIPRAAVPAEAGADSPAAPAA"
FT   gene            complement(601562..601990)
FT                   /locus_tag="Gbro_0566"
FT   CDS_pept        complement(601562..601990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19896"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19896.1"
FT                   /translation="MCRVPNSEEWALPAVFESIAITADPGYRPVAHYIALPGAPCRATV
FT                   LRAIRSGRLPAVFVSTGWRVTEADWAAWMAGRCRPSIPPTVPSEVDAAVAALVAAAPPL
FT                   TDAQIGVVARAVGDGLRATHRRDYDQDHTGVSARASEA"
FT   gene            complement(603082..604815)
FT                   /locus_tag="Gbro_0567"
FT   CDS_pept        complement(603082..604815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0567"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   bbt:BBta_0430 putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19897"
FT                   /db_xref="GOA:D0LEH9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEH9"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACY19897.1"
FT                   /translation="MGKSRPRALIVVRLSRVTDATTSPERQLEACRELCDQRGYEVVGV
FT                   AEDLDVSAGATTPFDRPQLGPWLANRHNEIDVIVMYRMDRLVRRLLDLADVIRWGQERD
FT                   VAIVSATEAFLDLTAPFGDIIAMLVAKTAEMELAAISARNASASTHNIRSGKWRGGVPP
FT                   WGYVPERGDDKVWRLVQDPQQVEVIQEVAERVLAGERLRPIAADLTKRGVLTPKDRFAQ
FT                   VKGREVKGYAWSSQRMKESLLSRTLLGQIVTRDPVLDAKGEIQRDAKGQRILGPEFVVT
FT                   DETGAPVVRAEPILTRAVFDRLGAALRSREVDRTATVTSGLLLQVLFCGECGRPAYRLT
FT                   GGPGRKPRYRCAFAQDRSGAAGALGPCDNRSVPLDWADHEVEAHVLERLGSMERMTRVW
FT                   FSGNDSRSELAEVDELLGDLTDQLGTGAFRRGTPQRERLDGRIRALTERQEELRVRPVE
FT                   APSWRYEGTGETVRAWWERSDSATRTAWLREHGIRATWLSSTEGGRTKIDSFEIDMGAP
FT                   NLESGALPGWVASAAELKARGGWAWSVDDPVLKRAEESLPDVLAQIHWTQGDPDEGDSV
FT                   E"
FT   gene            604899..604982
FT                   /pseudo
FT                   /locus_tag="Gbro_0568"
FT   gene            605039..605383
FT                   /locus_tag="Gbro_0569"
FT   CDS_pept        605039..605383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19898"
FT                   /db_xref="GOA:D0LEI0"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19898.1"
FT                   /translation="MVTVEAAYAIAAIVVTVLIAVGGVSAMIAQIRCTDAAREVARLTA
FT                   AGDGGARDAGQRMVGDDVTIAIAEEHERVSVVVSSHVLFLPGLTVSATAVAVKEPRGED
FT                   QVDFAPGVTP"
FT   gene            605380..605751
FT                   /locus_tag="Gbro_0570"
FT   CDS_pept        605380..605751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19899"
FT                   /db_xref="GOA:D0LEI1"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19899.1"
FT                   /translation="MRATGSLVSDERGVATVLGAFVIAALAAVTVLVLYIGAAVVARHR
FT                   AQSAADLSALAATVAHAEAQQEPCVAARELASAQRPPAQLTDCRIDGDDVIVRTTIPID
FT                   LGLFGVRAASAQARAGPVG"
FT   sig_peptide     605380..605463
FT                   /locus_tag="Gbro_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.591 at
FT                   residue 28"
FT   gene            complement(605761..606318)
FT                   /locus_tag="Gbro_0571"
FT   CDS_pept        complement(605761..606318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19900"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19900.1"
FT                   /translation="MYDDASNRGIDAPRLITRQSQVYFLLARPIEDTDSLPSSIGESDV
FT                   FFSEAEALDALDVHYAWCAARSGGFTRVVTTAQWYLQSALVGPRIAPALGEVYLAATDN
FT                   HSGETWAAAGGFLTEGELIHWSAFVRAVRPWIPTPGTAEIFELAYRGDTAVHFHQIWFA
FT                   PLKSVRVYPKEIVVDSGDDTED"
FT   gene            complement(606311..608638)
FT                   /locus_tag="Gbro_0572"
FT   CDS_pept        complement(606311..608638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0572"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; Protein
FT                   of unknown function DUF1998; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   dma:DMR_45970 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19901"
FT                   /db_xref="GOA:D0LEI3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI3"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACY19901.1"
FT                   /translation="MHNSTYGTELLRRSLAGSDSESSPITHIEVIPSAPPSFDDWPEWL
FT                   PPALIDAFGADGIQRPWTHQVSAACAARRGEHVVICTGTASGKSLAYQMPILTELLTDP
FT                   HSTALYLSPTKALGADQIRSVSALIAGREEYSHLQPCAYDGDTDPEIRQWARAHSRWIF
FT                   TNPDMLHIGILSGHARWRQFFRHLRYIVIDECHHYRGVFGAHTSLVMRRLLRIARAAGA
FT                   EVTVIAASATVADPAESLSRLIGEPAVAVTQDGSPRGERTVALWEPDFLPAVTGENGAP
FT                   VRRSAGSESARLLADFVVEGARTLCFARSRRGVELTALGAARLLAESAPQLVDRVAAYR
FT                   AGYLAEDRRRLEQAINDGSLVGVATTNALELGVDISGLDAVIVSGYPGTVASFWQQAGR
FT                   AGRQRESGDSLVVLVARDDPLDTYLVHHPAALLGKPVEATVFDPGNPYVLGPHLLCAAA
FT                   EIPLSDKEIDAWGASEVAAELAADGLLRRRKAGWYVTPGVEPHADIDIRGGIGGQVLIV
FT                   DTTTSQLLGTVDSGRAPGTVHPGAVHIHQGRTYLIDELDLDDGLALAHPEEPDWTTSAR
FT                   DITDVSIIRVIESEVYGPLTVALVEVDVTHQVVGYLRTLYSGEVLDAVELDMPRQTLHT
FT                   RAVMYTLTPESLESAGIDATRLPGSLHAAEHAAIGLLPLVATCDRADIGGLSTDLHPDT
FT                   GLPTVFVYDGYLGGAGFADRGYGAFATWIEATRAAVAGCECDSGCPSCVQSPKCGNGNE
FT                   PLDKSGAVAVLELLGRQYLTHV"
FT   gene            608979..609182
FT                   /locus_tag="Gbro_0573"
FT   CDS_pept        608979..609182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0573"
FT                   /product="Cold-shock protein DNA-binding protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bbr:BB2251 cold shock-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19902"
FT                   /db_xref="GOA:D0LEI4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI4"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACY19902.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAPDEGSDDVFVHYSEIQGSGFRTLEEN
FT                   QRVEFEVGQGTKGPQATGVRAV"
FT   gene            609287..609886
FT                   /locus_tag="Gbro_0574"
FT   CDS_pept        609287..609886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19903"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19903.1"
FT                   /translation="MGNVDHVGQLSFYSAETEQPAYDDLAGLLAAHGQSARSDSGTRVS
FT                   IVVPARWRAEHIVEEMTAAGLTAESATSDEGTPLARTAACPELDALHRAWTSGAVKAVP
FT                   AGWTPTPRVLRLWVLAAGRPEGDRYLLGLDPYAPDTHSPLATALMRVGIAPTLVGARSG
FT                   HPPALRVAGRRRLTRLVEYIGDPPSAAATADWPTAM"
FT   gene            610125..613220
FT                   /locus_tag="Gbro_0575"
FT   CDS_pept        610125..613220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0575"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bba:Bd0964 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19904"
FT                   /db_xref="GOA:D0LEI6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI6"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACY19904.1"
FT                   /translation="MADTSTATPTNGRTLRRLVIVESPTKARKIAGYLGSNYVVESSRG
FT                   HIRDLPRGAADVPAKYKGQPWARLGVNVDENFEPLYVVSPDKKSTVTELKSLMRDVDEL
FT                   YLATDGDREGEAIAWHLLETLKPKIPVKRMVFHEITEPAIRAAAENPRDLDIDLVDAQE
FT                   TRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRIIVERERERMAFVSAEYWDIDAN
FT                   MDAGKDASPQTFNARLVGVDDARVATGRDFDSRGALKRADGVVVLDETRARALADALDG
FT                   ADITVSSVEEKPYTRRPYAPFMTSTLQQEAGRKLRFSSDRTMRIAQRLYENGFITYMRT
FT                   DSTTLSESAINAARAQARELYGDNYVHPTPRQHTRKVKNAQEAHEAIRPAGESFRTPGQ
FT                   VAGQLEADEFRLYELIWQRTVASQMADAKGTTLSLRMTGTASTGETCVFAASGRTITFP
FT                   GFLSAYVETVDDLAGGQADDAENRLPQLREGQALRATELSADGHSTNPPARFTEASLVK
FT                   VLEELGIGRPSTYASIIGTIQDRGYVVKKGNALVPSWIAFAVVGLLEAYFQGLVDYDFT
FT                   ASLEDDLDEIASGRENRTRWLTEFYFGDAAPNAEHDAEIAGSEIAKHGGLKKLVGVNLE
FT                   EIDAREVNSIRLFDDEQGRPVYVRVGRFGPYLERNLSAASAASPDAEPDLQRANLPADI
FT                   TPDELTLALAEKLFSTPQEGRSLGVDPVTGHEIVAKEGRFGPYVTEILPSDDDDDDGNS
FT                   PATVPAGPTPRDGGGTGGQGSDAEVVPLDTPSGGGTATKTAAKAAAKKTTAKKAAKKAG
FT                   PKPRTGSLFKTMDISTVTLDDALKLLSLPRVVGVDPESGDEITAQNGRYGPYLKKGTDS
FT                   RSLTSEEQLFSITLDEALKIYSEPKRRGRQAAAPPLRDLGKEDSVSGKPMVIKDGRFGP
FT                   YVTDGETNASLRKGDEVATITPERAMELLADRRARGPATKRAKKAPAKKATAAKKTAAK
FT                   KTAAKKTAAKKTTAKKTTAKKTTAKKTAAKKTTAKKTTDTGE"
FT   gene            613292..614232
FT                   /pseudo
FT                   /locus_tag="Gbro_0576"
FT   gene            complement(614262..615776)
FT                   /locus_tag="Gbro_0577"
FT   CDS_pept        complement(614262..615776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0577"
FT                   /product="adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; adenylyl
FT                   cyclase class-3/4/guanylyl cyclase; KEGG: bba:Bd1116
FT                   adenylate cyclase; SNP; SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19905"
FT                   /db_xref="GOA:D0LEI7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI7"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACY19905.1"
FT                   /translation="MHLARWLVHTPWPILALDMLRANLVGALFTFAFLRFGMPLQDSIS
FT                   LDEITALNQVIFAFYLIIAMLVGGFLSIQLSLPVLIWHRRRTRLDNESARRRALALPML
FT                   LSAVNAALWMIGGVLFTLVNLTVSNKNAFIVAIASVIGALVTCALSYMQAEKVLRPITV
FT                   AAMANDPDNAIAPSVTTRITTFWVISAVAPMMVIVGLIVLHRLGFIEADATGLERPILW
FT                   MALSALAFSLLAIVRVVSAINDPIKQLRRAQSQVSAGNLDVAVKIYDGSDLGLLQAGFN
FT                   DMVSDLRERQQLRNLFGRYVGEDVARKAIETGTELGGEERYVGVLFVDIVGSTRLAVNR
FT                   PPREIVELLNEFFRVVVEVVGRHGGFVNKFQGDAALAIFGAPLDLEDFAGRALASAREL
FT                   RAELYETLGDTDIGIGVSAGKAIAGHIGAEQRLEYTVIGDPVNEAARLTELAKDEPTRV
FT                   LGSARAVFLASREEAEHWEIGEGVELRGRGIETLLARPLMAPYRQA"
FT   gene            616039..617334
FT                   /locus_tag="Gbro_0578"
FT   CDS_pept        616039..617334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0578"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gsu:GSU2230 DNA polymerase III, delta prime
FT                   subunit; TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19906"
FT                   /db_xref="GOA:D0LEI8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI8"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ACY19906.1"
FT                   /translation="MTSVFDRLTGQTAIADDLRSAARAARGLANRLDEGDVGAESMFAD
FT                   TAEQADDVCDAASRASMTHSWLFTGPPGSGRSVAATCFAAALQCQADDPADIGCGQCRA
FT                   CVTVMAGTHADVRSIAPDGLTLSVKSMREIVQTASRRPGTGRWQIVIVEDADRLTEQAA
FT                   NALLKVVEEPPSRTVFLLCAPSVDPDDISVTLRSRCRHVALTSPSVADIERVLVDRDGI
FT                   DPAQAAWAASVCGGHIGRARRLATDADAREQREMALRLARAATVDSTAYKAAEELVRTA
FT                   EAASKAIAAELNEPELEEMKTALGAGGTGKGTARAPRGSAGAIKELEKRQKSRETRVGR
FT                   DVLDRALVDLAALFRDALVVGVGAQVTPMHPDKADDVVIPMAGFARPEQLLQCVEAVLA
FT                   CREALDVNVKPKFAVDAMVASIGLAMRRNASA"
FT   gene            complement(617535..618434)
FT                   /locus_tag="Gbro_0579"
FT   CDS_pept        complement(617535..618434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0579"
FT                   /product="LysR substrate-binding protein"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bac:BamMC406_4630 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19907"
FT                   /db_xref="GOA:D0LEI9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEI9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACY19907.1"
FT                   /translation="MVARRLPDLAALEVLVTVGRLGSMGAAARELGLSQQAVSARVRSI
FT                   EHELGVELFLRSPSGVEATTNGVIVLEWATALVDRAAEFTAGVDSLVAARQATLIVAAS
FT                   KTVAEYLVPSWIITLASRTDAKISVRPMNSTEVLDAVRAADAHLGFIEIPGPTRELDST
FT                   TVAMDELLVVCAPDHPWASSDGVSVDELAATPLIQREPGSGTRVTFEAALADLGLRAAD
FT                   PVIELRSVTAIRASVLSSPVATVLSQLSVADDIAAGRLVWVSVQGLRMIRPLRAVWTPH
FT                   VTLRGPARDLLEVAVPGS"
FT   gene            618507..618725
FT                   /locus_tag="Gbro_0580"
FT   CDS_pept        618507..618725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0580"
FT                   /product="Mbre_bop1; block of proliferation 1"
FT                   /note="KEGG: Mbre_bop1; block of proliferation 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19908"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ0"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_37129"
FT                   /protein_id="ACY19908.1"
FT                   /translation="MSDFIKKVKDEAKAVSAAIDQELTVLEGVDGYDPLRGDDESPTDA
FT                   AAPTDASTEDAEPSSADPTDAGRGDKS"
FT   gene            618861..619967
FT                   /locus_tag="Gbro_0581"
FT   CDS_pept        618861..619967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0581"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   rme:Rmet_1093 alcohol dehydrogenase GroES- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19909"
FT                   /db_xref="GOA:D0LEJ1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ1"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACY19909.1"
FT                   /translation="MVTEFGAPLSINELPLPTPGPGQALVKLDTSGVCHTDLHAAHGDW
FT                   PVKPSPPFVPGHEGYGTVVEVGPGVTEIAVGDKVGNAWLWSACGHCEYCRTGWETLCER
FT                   QSNGGYSVNGSFGTYMLVDERFAARIPEACDPVEVAPILCAGVTVYKGLKVADTKPGQW
FT                   MVISGIGGLGHVAVQYAKAMGMRVAAVDIDDKLDLARELGAEVTVNAATTSDVAAAIQE
FT                   QTGGAHGVLVTAVHPQAFGQAIGMARRGGTIVFVGLPPGDFPAPIFDVVLKGLTIRGSI
FT                   VGTRQDMVEALDFYARGLIKPTVATTRLEDIKRRLPADGGGQDRGTDRHRLSVSARSPR
FT                   GERNEDYRWPASVGVSGSFRGRLWSARG"
FT   gene            complement(620450..620522)
FT                   /locus_tag="Gbro_R0011"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(620450..620522)
FT                   /locus_tag="Gbro_R0011"
FT                   /product="tRNA-Thr"
FT   gene            complement(620578..621429)
FT                   /locus_tag="Gbro_0582"
FT   CDS_pept        complement(620578..621429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0582"
FT                   /product="lipase class 2"
FT                   /note="PFAM: lipase class 2; PGAP1 family protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19910"
FT                   /db_xref="GOA:D0LEJ2"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ2"
FT                   /inference="protein motif:PFAM:PF01674"
FT                   /protein_id="ACY19910.1"
FT                   /translation="MPRSTLVAVVASLVALIGGVVTAGPAQAAPYPVTTSVERSIAAGF
FT                   SAPATTAPAGSNRFTCRDRFGRDPVILLHGTSLNQNANWGYLAPTLANAGYCVFSFTYG
FT                   QTSWSGNIGGLGNKDRSARQVADFLGEVLRRTGARQVDFVGHSQGGAIAQLVSQLPGRA
FT                   AQIDTIIGLSSPNRGHSRIGSITDRLPAAREPGQNYWGPTHPNIRYINLATRFDEISTP
FT                   YPITLMPPGPNVTNTLIQDVCPSSKIGHVGMAYSPTVAALVRNALDPAHRVAVPCGHDY
FT                   PA"
FT   sig_peptide     complement(621343..621429)
FT                   /locus_tag="Gbro_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            complement(621633..622064)
FT                   /locus_tag="Gbro_0583"
FT   CDS_pept        complement(621633..622064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0583"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sml:Smlt2614 putative
FT                   glyoxylase/bleomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19911"
FT                   /db_xref="GOA:D0LEJ3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACY19911.1"
FT                   /translation="MIRIASAQLWVHDQDVALDFWTTKVGMEVRSDVTMPELGNFRWLT
FT                   VGPPGQDDVTIVLMAIPGPPLIDASLTDEIASLTAKGFAGTVFLTTEDCQAAYDDLVAR
FT                   GVEFTEAPEQRPYGIDAGFRDPSGNSVRLTQLAENFAEL"
FT   gene            complement(622086..622580)
FT                   /locus_tag="Gbro_0584"
FT   CDS_pept        complement(622086..622580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0584"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   cti:RALTA_B0884 putative transcriptional regulator, AraC
FT                   family, isolated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19912"
FT                   /db_xref="GOA:D0LEJ4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACY19912.1"
FT                   /translation="MTAVHPARHLLRAKDLVDVRFAEPVTVDHMAAAAGLSRAHFTRAF
FT                   TTAFGESPHAYLQTRRLERAAAMLRSTDRSVADICMAVGLSSVGSFTTSFTRAFGRTPT
FT                   AYRASFPAAATFAHVPACVLRVYSRPGPSTRVEKTAHGKKTAASPRRSVESHTPDKSPP
FT                   G"
FT   gene            complement(622577..623164)
FT                   /locus_tag="Gbro_0585"
FT   CDS_pept        complement(622577..623164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0585"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr6918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19913"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19913.1"
FT                   /translation="MLLPKPIAQRVADGSVDLAFRRWATARVKAGSTFISPAGVIEIAS
FT                   VKRVDPQRISARDATRAGFDDVDKLRARLRGPDEYPTFRIGLRWQGADPRIALRADDTL
FT                   SDDDLADLTTRLDRLDSRSTHGPWTREVLGLIGRRPAVVSTELAAELGRPRPDFKLDVR
FT                   KLKALGLTHSLDVGYELSPRGRAYLAATEIDS"
FT   gene            623217..623894
FT                   /locus_tag="Gbro_0586"
FT   CDS_pept        623217..623894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0586"
FT                   /product="Pterin-4a-carbinolamine dehydratase-like protein"
FT                   /note="KEGG: mxa:MXAN_6773 putative pterin-4-alpha-
FT                   carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19914"
FT                   /db_xref="GOA:D0LEJ6"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ6"
FT                   /inference="protein motif:COG:COG2154"
FT                   /protein_id="ACY19914.1"
FT                   /translation="MTGSSGTPVSAAAATEVVSDPWRVLADKLVAAYQTGSMVKGGEFV
FT                   ARIIDAAEAAGHHPDIDLRYGTVHLVLTTHSAHQLTEADVALANTIAQIASELGIEPSG
FT                   TSVAQVDIAIDALDIAAIRPFWTAVLGFRDAAESEPIDLVDPDGRLPGVWFQQMDEARP
FT                   QRNRIHLDVLVPHDVVHERLQAALTAGGQLLSDEYAPAFWVLADAEGNEACLCTWQGRN
FT                   SER"
FT   gene            complement(623964..624788)
FT                   /locus_tag="Gbro_0587"
FT   CDS_pept        complement(623964..624788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19915"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19915.1"
FT                   /translation="MDLGVLNRAELLATDLTDADLRRKVRSGELTRLRSGWYAGRDADD
FT                   DAVIAARRFGAISCVTGLRKHGLWIPPGYDSLHVRAGKAAQGRRRDYCHLPGRPLPVGT
FT                   ILDEIPLCLCCAAGCMTAEDWIAVTDSALNSLDLDIADLHEQMPRTDARIDHLLSRCDS
FT                   RSQSGTESIVRVRLRALGFRVEVQPKIPDVGHVDLKVGRLLLECDSKLHHTSLENYRKD
FT                   RRRDRKSLGHKYMTMRLTYDDALYGWDETLADIREVTLPQRHRIRRGTSAND"
FT   gene            complement(624835..626052)
FT                   /locus_tag="Gbro_0588"
FT   CDS_pept        complement(624835..626052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0588"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: sat:SYN_00517 NAD-dependent malic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19916"
FT                   /db_xref="GOA:D0LEJ8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ8"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACY19916.1"
FT                   /translation="MTNTDGNAATPDAPCTEPSIADLPITDEEIFLAHVGGKLSVELRS
FT                   PIDTQRDLSIAYTPGVAQVSRAIDAESHLVNKYTWTDRLVAVVSDGSAVLGLGDIGPRA
FT                   SLPVMEGKSALFRTFAGLNSIPIVLDTQDPDEIVETLIRLRPSFGAVNLEDISAPRCFE
FT                   IERRVIDALDCPVMHDDQHGTAIVVLAALKGATTILGRDLTALRVVISGAGAAGVACAN
FT                   ILLAAGISDVVVLDSKGIVSRGRDGLNSFKEDLAERTNPRGLTGGAAEALDGADVVLGV
FT                   SAGRIDESLIATMSDQAIVFALSNPDPEIHPEVAAKYAAVVATGRSDFPNQINNVLAFP
FT                   GVFKGALDAGARRITESMKIAAADAIFSVVADDLSVDRIVPSPLDDRVAPAVAAAVAEV
FT                   ARAEGH"
FT   gene            626181..626831
FT                   /locus_tag="Gbro_0589"
FT   CDS_pept        626181..626831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0589"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   bvi:Bcep1808_0944 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19917"
FT                   /db_xref="GOA:D0LEJ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEJ9"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACY19917.1"
FT                   /translation="MLNPTRESAAERVYGEVKELILTNGIAGGELISEGEIAQRCSVSR
FT                   TPVREAFLRLEAEGWMRLYPKRGALVVPVGQSEACDVVDARLLLEGHAVRAVAARPGAA
FT                   DELVARLRENLDAHRAADADDIAEFARIDAEFHQLIAAAGDNRLLAAFFVSLGERHRRM
FT                   TTLSVHRDATIATRILDDHADLVSAIADGDAAAYDAQLARHLAAVHDLREARS"
FT   gene            626828..628078
FT                   /locus_tag="Gbro_0590"
FT   CDS_pept        626828..628078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0590"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   xcv:XCV2339 putative major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19918"
FT                   /db_xref="GOA:D0LEK0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY19918.1"
FT                   /translation="MTARLSALGWPAVALAVFATAWGGNEFTPLLVMYRETSDMSAVTV
FT                   DALLFAYVLGIVPALLIGGPLSDRLGRRPLMLPAPVFAALGSAMLAAGAGSAAMLATGR
FT                   VFSGIALGLSMAVGGSWIKELGDADGAGAGVGAKRAAMSLTAGFGVGAGVAGALAQWGP
FT                   WPHVLPYLVNITLAALATLLLIRAPETRARQTQSGRLIDDLKIPSAGHRRFLFVVLPVA
FT                   PWVFGAAASAYAVIPGLMATRIAGVPIAFAGLCCVLGLAAGFGLQSLGRRIDRPSGVRG
FT                   VVVALVMVAAGMAIAALAAHVLTVWAALLAAVVLGCGYGMAMIAGLLEVQRIAGPDDLA
FT                   GLTAVFYGVTYLGFAVPAILAWISETSVSIGYPQMFGFGVVAALVCLAITVVGHRTGAD
FT                   AQSPAQDYVDRELTPTR"
FT   sig_peptide     626828..626893
FT                   /locus_tag="Gbro_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.571 at
FT                   residue 22"
FT   gene            628124..630175
FT                   /locus_tag="Gbro_0591"
FT   CDS_pept        628124..630175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19919"
FT                   /db_xref="GOA:D0LEK1"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19919.1"
FT                   /translation="MLLGAWVVVVTALVLIVPGALVGRRMALPWPVALAAGPPITFGLV
FT                   GILTVVYAKVGFEWNAISALVGLVLAMLGAWVYSAALGTRIGRRLAPAPDVVDDEKPAC
FT                   AKAMLRVTAGVAVGGIIIAVTCIRPLVTTAFAGLNNISQVWDSLWHASSLRWIHETGIG
FT                   SGLRMGELMNYDTHGFNYYPNTWHALGALLFPITGANPVELYNTYSPAVLAITVPLGVA
FT                   SLAYWFARHRFDVDTSAVIAGTGAAISALFPSLPYVEVELTSVPNAVGVSLAPVAAILT
FT                   IGVIRDRRRIGPAALAIAGVTATHPSGLILIAVILGLWWLCEALWHPAAGRLRDLATLA
FT                   VTGVLTLVLIAPVVYGTINVADTNDLPFFDFRVETVSVARGLAQAAFNGTVPLGDYYPA
FT                   WALIIVTALGLIVFAWMRCWTGLAAWVVFVLVTANSVVSLGALSYPLGSIGGYFYNSPH
FT                   RLTFVVALFSAAAAGVAVGSAGIWVARLVSGRLSASESSDSQRFSPAVVSTAVLAVLLV
FT                   GIAGAGVWKYPQHAQLASKERGGKFVGPDDLAAYHWLAGRPDAWNSVILNNLDQGTGWI
FT                   YPVTGLTPMFPFYRANDFSQRQRDLFWGVVDIGADPHIDQIVRDMKVHYVIDSPPSYWP
FT                   FQRGAPAPGHQGDPFLAVRQHGAPGLTVVYRKGDVTIFRVNESVLAGG"
FT   gene            630216..631070
FT                   /locus_tag="Gbro_0592"
FT   CDS_pept        630216..631070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0592"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: rlg:Rleg_6077 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19920"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK2"
FT                   /inference="similar to AA sequence:KEGG:Rleg_6077"
FT                   /protein_id="ACY19920.1"
FT                   /translation="MVVEAWICMFCGNEYVADLPDVCHICADDRQFIPPGGQRWTLLSD
FT                   VRGGVTAAELEPGLFELTVDPQVGIGQKTYVAATPDGCNILWEPPGFVGPALLDWLADH
FT                   GGVGAIAASHPHLVGAAVSISHEFGRVPVWYNASDRRWVTRPDPVVAFWTDRQEIADGI
FT                   TLVQCGGHFPGSAVAHLRDAADGRGALLTGDTIMAVPHTQMVSFMRSYPNLIPLPPRLV
FT                   RQIADQVGTLEFDRLYAAFGSPIEHDTARIVEESARRYIGWVTDTITDPDDPGAPNTGQ
FT                   ASG"
FT   gene            complement(631055..632074)
FT                   /locus_tag="Gbro_0593"
FT   CDS_pept        complement(631055..632074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0593"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   dTDP-4-dehydrorhamnose reductase; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: saz:Sama_2224
FT                   UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19921"
FT                   /db_xref="GOA:D0LEK3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK3"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACY19921.1"
FT                   /translation="MRVLVSGGAGYIGSHTVIRLIEAGHDVVVVDDFSNAKPTVVGRLE
FT                   GLTGTSIPVHAFDLADIDKTEHFFAHENVDAVIHFAGYKAVGESVAKPLDYYQNNLGTT
FT                   FSLLRAMNRHDVHTLVFSSSATVYGAEPQLPITEDLPTSATNPYGWTKVMIEQILSDVA
FT                   AADTTLRIAALRYFNPVGAHPSGQIGEDPSGIPNNLMPFVAQVAVGRREKLSVFGDDYD
FT                   TPDGTGVRDYIHVDDLAAGHVAALDRISTADPGMSTWNLGTGQGLSVLEVVKAFERASG
FT                   RPIPYEIAPRRPGDIAASYADPSRANTELGWYATKTIDDMCADTWRWQSGNPNGYPDA"
FT   gene            632295..633212
FT                   /locus_tag="Gbro_0594"
FT   CDS_pept        632295..633212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0594"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; alpha/beta hydrolase
FT                   fold; KEGG: acb:A1S_1757 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19922"
FT                   /db_xref="GOA:D0LEK4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK4"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ACY19922.1"
FT                   /translation="MIDDGVGMLMARSDVWFVSGNARCAAWLYLPEDASTPPPVIVMAH
FT                   GLGAVRHMRLEAFAERFTAAGYACLVFDYRHFGDSAGRPRQLLSIRRQLDDWAAAIAYA
FT                   RSLDVVDAGRVVLWGTSFGGGHVMVAGERDGAVSAVIAQCPFTSGPSSTLAMEPLSAIK
FT                   VTGRALADVAAMVTRRAPVMVALAGDPGSTALMTAPDVVPGYLPLVPDGYPFTNAVAAR
FT                   VGLSIPLHIPGRALRRLTCPTLVCACDGDTVAPVKATVKYASQNPNVRLRRYDEGHFDI
FT                   YVGNGFEQVITDQIAFLRDVVRVS"
FT   gene            complement(633205..634209)
FT                   /locus_tag="Gbro_0595"
FT   CDS_pept        complement(633205..634209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0595"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; Male sterility domain;
FT                   3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: pfo:Pfl01_0701
FT                   dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19923"
FT                   /db_xref="GOA:D0LEK5"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK5"
FT                   /inference="protein motif:TFAM:TIGR01181"
FT                   /protein_id="ACY19923.1"
FT                   /translation="MRVLVTGGAGFIGANFVLRTLATRPDVEIRVLDKLTYAANPATVR
FT                   ALADRVDLVEGDIADVELTDRLIADTDLVVHFAAESHNDNSLADPSAFVHTNLVGTYAL
FT                   LEAVRRHGVRYHHISTDEVYGDLNLDDPARFTEQTAYNPSSPYSSTKAGSDLLVRAWVR
FT                   SFGIAATISNCSNNYGPYQHVEKFIPRQITNVLSGIRPKLYGDGRNVRDWIHVDDHNDA
FT                   VWTIIDRGQIGETYLIGADGEVDNRTVVETVLELLGQPADAFDFVTDRPGHDRRYAIDS
FT                   TRLRTELGWRPQYVDFRSGVQATIDWYRDNTAWWQPGKQAVEAGYAATQQVIN"
FT   gene            634248..635123
FT                   /locus_tag="Gbro_0596"
FT   CDS_pept        634248..635123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0596"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: ebr:ECB_01945
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19924"
FT                   /db_xref="GOA:D0LEK6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK6"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ACY19924.1"
FT                   /translation="MRGIILAGGTGSRLHPITQGVSKQLVPVYDKPMVYYPLSTLMLAG
FT                   IRDVLIITTPQDAPAFQGLLGDGGQFGINLSYVTQESPDGLAQAFVLGADHIGDDSVAL
FT                   VLGDNIFYGPGLGSQLQGFEKVDGGAIFAYWVSNPSAYGVVDFDENGVARSLEEKPLAP
FT                   KSNFAVPGLYFYDNDVIEIARNLKPSARGEYEITDVNAHYLDRGKLSVKVLPRGTAWLD
FT                   TGTFDSLLDAGNFVRTVEQRQGLKIAVPEEIAWRRGFIDDDGLRVRAEKLRKSGYGDYL
FT                   LELLHRGKGF"
FT   gene            635124..635744
FT                   /locus_tag="Gbro_0597"
FT   CDS_pept        635124..635744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0597"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose 35-epimerase related;
FT                   KEGG: bch:Bcen2424_6650 dTDP-4-dehydrorhamnose 3,5-
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19925"
FT                   /db_xref="GOA:D0LEK7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK7"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ACY19925.1"
FT                   /translation="MQVRPLSIDGAWELTPVQHGDARGLFAEAFKADLLAEVIGHRFEL
FT                   AQVNLSVSAAGVLRGVHFADVPPGQAKYVSCARGAFLDVIIDIRVGSPTFGAHDTVLID
FT                   DADRRAVYLSEGLGHAICALEDNSTVTYLCSAGYNPSAEHGINPLDPDLGIDWPTTGRD
FT                   GTPLQYELSAKDTAAPGLFEARDTGLLPSYDEVTAYLRSLAES"
FT   gene            complement(635958..636791)
FT                   /locus_tag="Gbro_0598"
FT   CDS_pept        complement(635958..636791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0598"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: aeh:Mlg_2716
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19926"
FT                   /db_xref="GOA:D0LEK8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK8"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACY19926.1"
FT                   /translation="MTTTLTHTLSDSTLMVRRNLIRLRRYPAMIFSVIIMPVVVLAMMN
FT                   LFFGGAIGAGIGADSPLHGNYINYLLPGILLFVSSFLTVSAAVAVNQDVTDGFINRLRS
FT                   LGTPATAILAGPVVGAIIQGAIALVFVVAAGFAFGFRTDAGVLDWLAVAGLVLLLMVGL
FT                   VWVAVALGVLAPNPEAASNLPVPFLLLPYLGSGLVPTDTMPDGIRQFAEYQPFSPIADT
FT                   VRALLMGTELGDRWIWALVWCAISSAVTRQRFSRSGGRRRGSDERACEPDAPLAG"
FT   sig_peptide     complement(636663..636791)
FT                   /locus_tag="Gbro_0598"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.666 at
FT                   residue 43"
FT   gene            complement(636823..637686)
FT                   /locus_tag="Gbro_0599"
FT   CDS_pept        complement(636823..637686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0599"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aeh:Mlg_2715 daunorubicin resistance ABC transporter
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19927"
FT                   /db_xref="GOA:D0LEK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEK9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY19927.1"
FT                   /translation="MEFPPRGTVYALLGPNGAGKTTTVRILATLDRADAGEIRVAGFDP
FT                   QADRLSVCAAIGLTGQFAAVDTQLTGRENLALIAGLRHLPGSVARGRVESLLADFDLVD
FT                   AADRRVEEYSGGMTRRLDLAMTLVSDPQIIFLDEPTTGLDPRSRHAVWDRVRALVDGGT
FT                   TVFLTTQYLDEADQLADHIAVLDQGRIVAEGTAAQLKRLVPGGHVSLEFADAETMERAR
FT                   EQFPTAVVDTRAGTHVLAVPGDGGSDALRAILQTLDTAGLEATGLSVHTPDLDDVFLTL
FT                   TGRAAA"
FT   gene            complement(637774..638319)
FT                   /locus_tag="Gbro_0600"
FT   CDS_pept        complement(637774..638319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19928"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19928.1"
FT                   /translation="MPNKTIYVADEDLPVLERAQQVAGGTISGAIIAALRDYVRAADYR
FT                   DAGYEEVVVRDGPDGVRRKRFFGRPLADETEFDDETGNATERAIYEGRTGRIVLAVHHV
FT                   DWEKFPIRRDRKPTGNWFKDLTGISSVRSLFTADLPDWGDYEVHVVDTVDELKDLVPQR
FT                   LLERAIAAVRPDIEDLDV"
FT   gene            complement(638385..638735)
FT                   /locus_tag="Gbro_0601"
FT   CDS_pept        complement(638385..638735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19929"
FT                   /db_xref="GOA:D0LEL1"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19929.1"
FT                   /translation="MIWFQIVAILGIVALVAFFVVNRGTARASAGVKLLFVAFVVFGVY
FT                   AMLRQDDVTWVAKKFGIERGLDLVLFLLVLAFAFTTISTYLRFRDLEVRYARLARAIAL
FT                   QNAEKPSGDPES"
FT   sig_peptide     complement(638649..638735)
FT                   /locus_tag="Gbro_0601"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.776 at
FT                   residue 29"
FT   gene            complement(638743..639444)
FT                   /locus_tag="Gbro_0602"
FT   CDS_pept        complement(638743..639444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0602"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   lip:LIA022 cell wall biosynthesis glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19930"
FT                   /db_xref="GOA:D0LEL2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACY19930.1"
FT                   /translation="MTAGTTNDDVWLVIPVYNEAQVIRDVVTHARQTFPNIVCVDDGSS
FT                   DDTAAEIRAAGVHLVRHPVNLGQGAAIQTGVEYARAQPGARFFVTFDADGQHQVDDVSA
FT                   MIARLRTEPVDIIVGTRFAEGRSDSVPPLRRIALRTIVFLSPRTRRLGLTDAHNGLRAF
FT                   NKTVADQLDLLMSGMSHASEFVALIDHHHWRVAEQPVTILYTEYSRAKGQSLINGVNIV
FT                   ADGLFHTRMRK"
FT   gene            639496..640344
FT                   /locus_tag="Gbro_0603"
FT   CDS_pept        639496..640344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0603"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sse:Ssed_2991 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19931"
FT                   /db_xref="GOA:D0LEL3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACY19931.1"
FT                   /translation="MPIDVMIPFYGDVAQFRQAVTSVLNQDDPEFTLTVVDDCYPSSQP
FT                   REWLESLDDPRVRYLRNEDNLGVNGNFRRCVELVKQPYFVVMGCDDVMLRDYLSTVRAL
FT                   ATQHPDAAVIAPGVEVIDDADRPVRPLGDRMKSVLAPSRASVLSGERLATSLYHGNWTY
FT                   FPSLLWRTEVVRAVGFRTGLEVVLDLALLVDLAATGASLVYDPTVVFRYRRHRASVSSV
FT                   QAVDGRRFAEENRFFADEARRCADLGWPKAARAARLHATSRLHHAQARLGAAVVRVRHL
FT                   R"
FT   gene            complement(640358..641626)
FT                   /locus_tag="Gbro_0604"
FT   CDS_pept        complement(640358..641626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0604"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   scl:sce6683 oligosaccharyltransferase involved in
FT                   polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19932"
FT                   /db_xref="GOA:D0LEL4"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL4"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACY19932.1"
FT                   /translation="MTSETGSTTGETAGTLGRVTIATIIAAASGYLVLLIAARHLGAAG
FT                   YGVFAVFWAAYGMVTGAQNGQLQETTRAIRSARGSKTDVPQPLMARPIRVNAVIGLALG
FT                   VAVAVTAPLWSGQVFTTQRWMSVILLAIGVISFAVYAHLCGALAGAASWTAFATLLSAD
FT                   ALIRLAGALIAILAGWGLDAFLIITVIGSVSWCALLASSGVARWAVGLRGDVPARRLSV
FT                   NTLTAMTAAAASAVLVMGFPVLIKLTSELGLFGAPSDDERVVGALILAVTLTRAPLLVP
FT                   LNSFQGVLITRFVEARHRLAGALAAPLLVVAGVGAFGSLLAWVLGPWLLGAVFGADFRL
FT                   GGGAVAALTVGATFLALLTVTGSAAIAVGGHRWYAAGWWVATLVSIVVLTLPADVTVRV
FT                   GAALVVGPLAGVVVHLAGLRAAR"
FT   gene            complement(641637..643007)
FT                   /locus_tag="Gbro_0605"
FT   CDS_pept        complement(641637..643007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0605"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: mxa:MXAN_0644 M1 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19933"
FT                   /db_xref="GOA:D0LEL5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL5"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACY19933.1"
FT                   /translation="MPGKSGSGSRGSNTRQPVLGTPDDTVDPYLPHNGNLGYRISRYDL
FT                   DLEYKVASNRLAGVATLTATSYEDLHRFTLDMASSLAVDRITVNDKRVRYSHRRNKLAI
FT                   TPDAGVPPGGALTIVIRYHGTPRPIRSPWGAVGWEELTDGALCANQPNGAASWFPCDDH
FT                   PSAKAPYRISITTDSPYHALANGVLESKRVRAGQTTWVYQQIEPMPTYLASVQIGQYKQ
FT                   ISLATKPFPVRALVPPRLVPTFRHDFGRQLEMVNAFVEMFGPYPFPQYSVVVTDDALEI
FT                   PIEAQSLSTFGANHCDGHRGAERLIAHELAHQWFGNSVTLARWRDIWLHEGFACYAEWL
FT                   WSQRSGGRSADEWARHYYTKLAATPVRVPLADPGPRKMFDDWVYKRGALTLHALRLTIG
FT                   DGNFFALLQRWTDKYRYGSVSTEDFIALAANYSTTSLKNLWDAWLFRAALPPYPTPA"
FT   gene            643287..643718
FT                   /locus_tag="Gbro_0606"
FT   CDS_pept        643287..643718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0606"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: sun:SUN_1469
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19934"
FT                   /db_xref="GOA:D0LEL6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL6"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACY19934.1"
FT                   /translation="MAGFSSVPQFLARLILGIIFIAHGWQKLHTNGMDATKAFFKGLDV
FT                   PFPEFTAYAVTWLELVGGILLIIGLLLPLVSVLLIIDMIGAIYYVHWDNGFWAGGDKVG
FT                   WEWPLALIAGLLAVGFSGGLGAADTHLWARRRRRREPVA"
FT   gene            643792..644412
FT                   /locus_tag="Gbro_0607"
FT   CDS_pept        643792..644412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0890 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19935"
FT                   /db_xref="GOA:D0LEL7"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19935.1"
FT                   /translation="MYSDPRYQPPSYGSSVGYPRGHDHYGVPVMDPVVAAALNRPWQTT
FT                   LYGWLQVVAAIAGLLGGLVWAAAAGSSAIDYQFVRDGGPIVLIGIVTVALLIVMNALNL
FT                   WIASAFLRGSRGAYVWYSVLNILGFIGTALVLAGMALFLFTVSAVDSGGGDDEIVALIL
FT                   MIAVSLLVAGVFHAIPWYLLWNRSSKAYFDRESVQIRRDARAW"
FT   gene            complement(644422..644976)
FT                   /locus_tag="Gbro_0608"
FT   CDS_pept        complement(644422..644976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19936"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19936.1"
FT                   /translation="MQKMIEEMQAEAQALLSAGEYTHALAEFSVLREIRARREGPYSPR
FT                   YLSNLHDCIRCTSQLEMWSDCTPLCSELHGKYVRTHGRGEADTVDVAKHWAWALVHLHD
FT                   YPPALRLYLTTADALWDIDPAQAVRLLGAAAVYQAAYDPPSLIDDVKLRHSTDVLTSLN
FT                   QMIAALPASDAAITRDGLAIA"
FT   gene            645061..645543
FT                   /locus_tag="Gbro_0609"
FT   CDS_pept        645061..645543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0609"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC758544"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19937"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY19937.1"
FT                   /translation="MSDDIGSTPEGSDGEYSLDDDDQLQPEDTLDDRGVDDVLDEGYSP
FT                   PDYAPKGAVHGLTAQEMREGETLDERLAEEEPDVGASDPSETGESDWQSHEYDSDAEFP
FT                   NRADEVGAARAGRLIAPDEGSGIDTESDVFASDAGIDGAGASAEEAAVHYIDDDER"
FT   gene            complement(645548..646276)
FT                   /locus_tag="Gbro_0610"
FT   CDS_pept        complement(645548..646276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0610"
FT                   /product="Clp domain protein"
FT                   /note="PFAM: Clp domain protein; KEGG: Os12g0230100;
FT                   hypothetical protein ; K03696 ATP-dependent Clp protease
FT                   ATP-binding subunit ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19938"
FT                   /db_xref="GOA:D0LEM0"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM0"
FT                   /inference="protein motif:PFAM:PF02861"
FT                   /protein_id="ACY19938.1"
FT                   /translation="MTEPTRIRLDDLIAAIRKQHDDPLDQLADAMVAADHLGEIADSLI
FT                   GHFVDQARRAGASWTSIGASMGVSKQAAQKRFVSRTSPAANAANDADNPFSRFTPRAGN
FT                   VLMAAHSRAVAANAAQVSPAHIADALAAEPDALAMAVLRDNGIGVDDLHTALAPLMPIA
FT                   PDRGPDATSLLPYDNAAKAVIESTVAIAVELGHNYVGTEHLLLGLFTDDGVAEKLRSLG
FT                   VDSDGARASITAMLEQLGSK"
FT   gene            646497..647774
FT                   /locus_tag="Gbro_0611"
FT   CDS_pept        646497..647774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0611"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   pla:Plav_2198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19939"
FT                   /db_xref="GOA:D0LEM1"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM1"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACY19939.1"
FT                   /translation="MSITEPVSSTSPNGNTVTSRGVDPVISRFLRVRSMTDTLTSSLSP
FT                   EDQTPQSMTDASPAKWHRAHVTWFFEEFILRTDPDYAVYDDTFRYLFNSYYEAVGARHP
FT                   RPERGLVTRPGVTDVTRYREYVDAALVSALERGRLDDAALELVELGCNHEQQHQELLLM
FT                   DIKHLFSTHAFAPVYVDRDVDESLPVQPLSWRPFTGGVYEIGHAGEGFAYDNEGPRHRV
FT                   FCEDFEIADRAVTNGDWLAFMADDGYRRPELWLSDGWAHIRETGWNAPGYWHHEDGEWS
FT                   TFTLSGRRPVVLDEPVVHVSFYEADAYARWAGARLPTEFEWEIAAEATGSARGGLLDPA
FT                   RCHPGRAGASMVGDVWEWTASAYLPYPGFVPANGAVGEYNGKFMCDQHVLRGASAVTPA
FT                   GHERVTYRNFFPAAARWAFSGLRLAR"
FT   gene            647771..648757
FT                   /locus_tag="Gbro_0612"
FT   CDS_pept        647771..648757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0612"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function DUF2260; KEGG: mxa:MXAN_7473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19940"
FT                   /db_xref="GOA:D0LEM2"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM2"
FT                   /inference="protein motif:TFAM:TIGR03438"
FT                   /protein_id="ACY19940.1"
FT                   /translation="MTAESMTADLETAAPQNPLAADALAGLWADPPTLPVKWLYDERGS
FT                   KLFDEITRLPEYYPTRRETAILRARAAEIAAVTEAEMIVELGSGTSTKTRLLLDAFVAH
FT                   WETCATRLRYVPVDVSDEMLAAASEILSVDYPAIDVVPVVADFTEPHMPLPAADGPRLA
FT                   VFLGGTIGNFSATDRTEFYRRLAGSLSPGDYFLLGADLIKDTGRLVAAYNDKAGVTADF
FT                   NRNMIEVLRTGLDAQRLYADDFDHIARWNPVEHRIEMWLRARRDVAAYFVVLQRTWRVA
FT                   AGTEILTEISTKFSRADLAAELDAAGLPVVESWTDPAGDFALTLCRR"
FT   gene            complement(648771..649823)
FT                   /locus_tag="Gbro_0613"
FT   CDS_pept        complement(648771..649823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0613"
FT                   /product="Luciferase-like, subgroup"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: bra:BRADO0667
FT                   putative alkanal monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19941"
FT                   /db_xref="GOA:D0LEM3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM3"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACY19941.1"
FT                   /translation="MDQQPAGPAIELGLDTFGDVTVDSDGTPVSGAQTLRNVLTQAVLA
FT                   DEVGVDFLGVGEHHRDDYAVSAPEVVLAAIAARTSRMRLGSAVTVLSSDDPIRVFERFA
FT                   TLDAVSSGRAEVILGRGSFTESFPLFGYDLADYEELFTDKLALFDQLRTGEPVTWSGST
FT                   RSPLSGQVVYPRLESPPLPTWIAVGGSPESVIRAAGYGLPLMLAIIGGEPLRFKPYVDL
FT                   YHRALREMEQPSQPVGVHSPGHVADTDELAREQLWPHYRTYVGRIGAERGWPPPTRIEF
FT                   DRSTGPGGSLYAGSPETVARKIADTVRALGLSRFDLKYSHGTLGHDELMRSIELYGTQV
FT                   IPRVRELLAE"
FT   gene            649968..650348
FT                   /locus_tag="Gbro_0614"
FT   CDS_pept        649968..650348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE2020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19942"
FT                   /db_xref="GOA:D0LEM4"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM4"
FT                   /inference="similar to AA sequence:KEGG:YE2020"
FT                   /protein_id="ACY19942.1"
FT                   /translation="MWDSFWDFIWYTIVIFAFVAYLIVLWHIIADLFRDKAASGWAKAV
FT                   WVIFLIIFPYLTAIVYLLAKGKGMAERQREAYADAKQASDEYIKSVAGSTPAQQISEAK
FT                   SLLDSGAITQDEFDALKAKALS"
FT   gene            complement(650487..651275)
FT                   /locus_tag="Gbro_0615"
FT   CDS_pept        complement(650487..651275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0615"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   csa:Csal_0794 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19943"
FT                   /db_xref="GOA:D0LEM5"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM5"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACY19943.1"
FT                   /translation="MSWTYLMDMDGVLVREEHLIPGADAFLGELRATGTPFTVLTNNSI
FT                   RTPRDLRARLLRTGLDVPEESIWTSALATARFLESQRPEGTAYVVGESGLTTALHEIGY
FT                   VITDSDPDYVVLGETRTYSFEAITTAIRLVEQGARFIATNPDATGPSTGGSLPATGAVA
FT                   ALITRATGREPYYVGKPNPLMMRTAMRRMGAHSEDSLMIGDRMDTDVISGMEAGMHTIL
FT                   VLSGISTAASVELYPYRPTLVIESVADLVGRTGDPFPVET"
FT   gene            651423..652406
FT                   /locus_tag="Gbro_0616"
FT   CDS_pept        651423..652406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0616"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_1834
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19944"
FT                   /db_xref="GOA:D0LEM6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY19944.1"
FT                   /translation="MIAYLSKRLAVWAVLVFVATNLTYFLANAMLDPRSNYVARRPPLP
FT                   DSVVDATLSSYNLNDKVPVLERWWTWLTGVVLHWDWGKTPVGLSVNEQISFRMWSSVQL
FT                   LTAATIISILLGLAVGVYTALRQYKLSDRAWQLVSLATINLPVPVLGLGIVLLGIYLNQ
FT                   ALGHTAFYVSGSESVDVQGFWASLADRAQHLILPTLTLVISGYGGLHLLQRSLLLDTIN
FT                   SDYVRTARAKGLTRGRAVRKHALRTAIIPVAVGIAFAIPAVFTGAVLTETIFAWEGMGR
FT                   YFVSSINTNDINGVVAVAAFGATATAIGAILADVVVVYLDPRVRVS"
FT   sig_peptide     651423..651512
FT                   /locus_tag="Gbro_0616"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.722) with cleavage site probability 0.601 at
FT                   residue 30"
FT   gene            652413..653393
FT                   /locus_tag="Gbro_0617"
FT   CDS_pept        652413..653393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0617"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0003257
FT                   oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19945"
FT                   /db_xref="GOA:D0LEM7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY19945.1"
FT                   /translation="MMPPEPTRPGAGAHDAASVPLMGETGGVFEESDHPSAPIALRRSG
FT                   RTKILAKRFARNRPALVGSAIFVLLVLFSLFGGMFTEYSYTDTDFAAIGYPPSPEHWFG
FT                   TNDAGNDLYAQVVHGLQRSLTIAVAVSVGTAVIAALLGGLSAYFGGTTQRVILGTIYIL
FT                   LVVPSFLILALVSNKTGGDWRWLIVVLVAFGWMMLARVIHSMALSIKERDYVTAARYLG
FT                   VPAIVIIVRHILPNMASLLVINLALGVVATVLTETGLSFLGFGVKIPDVSLGALLQAGT
FT                   GSLEASPWLFWFPAGALALLTISMALVADGLRDAFDPTSTRGGAS"
FT   gene            653380..655557
FT                   /locus_tag="Gbro_0618"
FT   CDS_pept        653380..655557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0618"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: mes:Meso_3727 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19946"
FT                   /db_xref="GOA:D0LEM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM8"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACY19946.1"
FT                   /translation="MARRDGGIVTEALDHDVLAEVAEPGEVVLRVDDLHVSFGSEAGRV
FT                   QAVRGLSYELRAGRTTAIVGESGSGKSVSAMALLGLLPDSARISGSVRLGDRELIGRSD
FT                   KEMSRIRGNEIAMIFQDPLSSLTPVFTVGAQIVEALAAHQRIESRQAWDRAVELLELVG
FT                   IPDPVRRAKAYPHELSGGMRQRVMIAMAMANDPAVIVADEPTTALDVTIQAQILDLLAT
FT                   AQRETGAAVLLITHDLGVVAGTADDVVVMYAGRPVEQADVDTLFREPRMPYTIGLLGAV
FT                   PRVDRRVDALVPIPGSPPVLIDPPDQCMFAPRCPLAIDECRSAEPALHDVGGPGGHTAD
FT                   EHTAAAHTAACVRSAEIVGNGVLVDAAGAQRPVYPEPEVVARAEVVSVPRAQRDIVLDV
FT                   AGMTKLFPLTSGLLKRRIGTVRAVRGVSFDIRAGESLAIVGESGSGKSTTLLEVMDFAQ
FT                   PAGVVRIGGVDPAAVRKRAARALRQDVSIVFQDPAEALDPRFTAFDIIAEPLRALGVPR
FT                   SEAAQKVTDLLARVGLDPVHSDRFPAAFSGGQRQRLAIARALATDPSLIILDEPLSALD
FT                   VSVQAEIVNLIRRLQSTGDVAYLVVAHDLSVIRHLADRVAVMYLGEFVEVGETEQVFDA
FT                   PAHPYTKALLSAVPIPDPAAERARTPIVLRGEQPSPTDDIVGCCFTGRCPLYVTLDPER
FT                   QSRCRSVHPELRAIGPADDHVASCHYLEVDA"
FT   gene            655554..657209
FT                   /locus_tag="Gbro_0619"
FT   CDS_pept        655554..657209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0619"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: mes:Meso_1835 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19947"
FT                   /db_xref="GOA:D0LEM9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEM9"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACY19947.1"
FT                   /translation="MKRRLVLLLTVIGLAVALVAGCGSTPEGAPVKVTGADLNEQPRDN
FT                   IRDGGSLTTAVVEVSPQWNTFQADGTAYTLTLWRWYNPTLAFFSPDGEYRPNPDYVTRV
FT                   DKKLVDGNTTVTYTLNPKAFFNDGTPIDYRAFEATWKTSNGTDPRYLVSSTDGYRQIAS
FT                   VTRGINDRQVVVRFRGVYAWVDGLFNYVLHPKAADPELYNSGYLQNPHPELGAGPYTIA
FT                   SYDRNQGTVVFERNPKWWGNPGKLDRRVFRQMESQAALNAFRNGEIDASGVGTKDRLAQ
FT                   VQSMDGIQIRTSATPAQSLLVLNMQAAILSDSRVREAVLRGTDRATLAKIEFNGLNYSE
FT                   QLPGSFLLYPFQPGYADNVAGVIDYDPEKAKQLLDQAGWVVGGDGIRVKGGQRLRLTFP
FT                   ILGDDPTQQNIVRAYQSILKNIGVDLNVVQRPSSDFSKVITNKEFDAFMMGFSSSDPFG
FT                   LAYFCQVWCKGSQLNKAGAGSPELDAEIRRVGQIADPQAQIAEGNKVERTAFAQFSNLP
FT                   LSNGPTMVAVKSGLANYGAGLFYVGPVEDIGWQK"
FT   sig_peptide     655554..655619
FT                   /locus_tag="Gbro_0619"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.353 at
FT                   residue 22"
FT   gene            complement(657421..659109)
FT                   /locus_tag="Gbro_0620"
FT   CDS_pept        complement(657421..659109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0620"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vvy:VVA1306 vulnibactin-specific 2,3- dihydroxybenzoate-AMP
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19948"
FT                   /db_xref="GOA:D0LEN0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEN0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY19948.1"
FT                   /translation="MPDQPTVESTPTAVTTGFVPRPADFIDRYRARGCYLDAPLWQLLD
FT                   DAATSSPDSPALTDPGAQPPRTLTYAALLAATRRRAGGFLRAGLRPGQRVVVQQNNTAE
FT                   LVVNVFALMRAGLLPVMALPAHRRAEITHLARTSGASAYVTEDGRHGFDHRTLATDLVD
FT                   DVESLAHVFIDGDPGGFLPLPDADGVELPSADGIDANLPALFLISGGTTGLPKLIPRTH
FT                   NDYSFNARRSAEIAGLVDTDVYLVALPGAHNFPLCCPGMLGVISTGGHIVLGTDPSPDA
FT                   AFDLIETYGVTVTALVPALAQVWCAATEWEPADISSLRLLQVGGAKLAEPDAVALDAAL
FT                   GDVVQQVFGMAEGLICYTRLDDPRELVHTTQGRPMSDDDELRVVDESGVDVPVGTEGEL
FT                   LVRGPYTIRGYYRADDHNTRSFTDDGFYRSGDRVRVLPSGHVAVTGRIKDTIVRAGENV
FT                   AADDVEESLLAHPSIRQVAVIGLPDDSLGERICAVVVPTDGPKSPAADLRTLRTFLTDQ
FT                   GVAPFKLPDQVIVATRLPVTPVGKIDKRALVEEFTAAPPTSPPAG"
FT   gene            659238..660605
FT                   /locus_tag="Gbro_0621"
FT   CDS_pept        659238..660605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0621"
FT                   /product="salicylate synthase"
FT                   /note="TIGRFAM: salicylate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: vei:Veis_2432 AMP-dependent synthetase
FT                   and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19949"
FT                   /db_xref="GOA:D0LEN1"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019996"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D0LEN1"
FT                   /inference="protein motif:TFAM:TIGR03494"
FT                   /protein_id="ACY19949.1"
FT                   /translation="MSLTVGVEVAAAAAGDRTRDDEARWDSASVIAGWAADGGFSDYVA
FT                   YERDGEWTFAAGARARVVLTAESIAITEDGTTVESPWSGRASTALSRALGALESDNWDA
FT                   LGYLNFDFCAAHHDLAHLVPSGSVLAHLIVPEVTVVVTADDIRFGRCDSATRARLTALA
FT                   ERGWIEPTPSPVDVRTDADGFTERVGRALAEIDRGDYQKVILSRQVAVPYDIDLPATYA
FT                   LGRRHNNPARSFLFSLDGMSAAGFSPELVVSVDINGSVTTEPLAGTRAIGASAEDDARH
FT                   RRQLMTDAKEIAEHAISVKACYSEIESVAAPDTTAVTEFMAIRRRGSVQHLASTVRGQL
FT                   AAHHDPWQALEALFPSITASGIPKTPALEAIYRLEEHRRGLYSGAVLTASSAGQLEATL
FT                   ALRTVFASAEGAWIRAGAGIVGQSTPEREYEETCEKLSSVAPFLVRRAEVREGAGK"
FT   gene            660602..664126
FT                   /locus_tag="Gbro_0622"
FT   CDS_pept        660602..664126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0622"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; Non- ribosomal
FT                   peptide synthetase; phosphopantetheine-binding;
FT                   condensation domain protein; KEGG: pau:PA14_54930 putative
FT                   non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19950"
FT                   /db_xref="GOA:D0L263"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0L263"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACY19950.1"
FT                   /translation="MSSQTDVRQKVAEALGISEYEIGDADDLIELGLDSIRIMKIAGGW
FT                   RKQGHRLNFAQLAAEPTVAAWAARLDETRPETATSPAEDEAHVAHEPSAQESVDLESVD
FT                   RADDPFPLAPMQHAFWIGRSDVAELGGVAAHLYVEFDGDGIDPARLGEAMRRLVRLHPM
FT                   LRARFLPDGTQQVLDDLPHNPFRVHDLRQAGAEQVADELDRRREEKSHQVLDVAAGEVV
FT                   DLTVTLLPDGRHRIHFDIDMLAADAMSYRLLLADLVALYDGAQPAPAAFTYRDYLNHRA
FT                   AHPDPDRESDQQWWRRRLPELPLGPALPARTGGPADSTRVVRFHRWLDPTVKQQLLDAA
FT                   HRQGITPAIALAAVFAATIRGWSGADRFLLNVPLFHREQIHPDVDRLSGDFSSSVLIDV
FT                   DADSADSLLSLAQAMQKTMHANGSHAGYGALDVLRDLGRQHGEHVLAPVVYTSALGLGE
FT                   LFSDDVLDRLGEPTWIISQGPQVTLDAQVTEVRGGLLLNWDVRSAAFPDGVVDAMFTRY
FT                   TSMIDELIGTDGGWDRPVVDALPAEQRAVRDRVNDTAGPSTGRVLHQEFFAIAGREPHR
FT                   TALLWDGGSATYGELADDALAVAAALHAAGAGVGDAVAVQVPKGPDQVAATLGVFAAGC
FT                   VWVPIAHDHPPARRATILDTGGIRHLLGVDVPAGVPDSVTVIDLASARTAVPRDAPVVG
FT                   DPEDVAYVLFTSGSTGTPKGVEVPHRAAMNTIDDVNERFGVGPDDRSLTVAALEFDISV
FT                   YDIFGLYSAGGAVVAVSGDAARDPAAWAELIRRHRVSILTCVPSALDMLLTAAHTDPLG
FT                   LGDSLRATLLGGDWVGTDLPGRLHALVPGARFAGLGGATEIAIHGTVCEVPPTSAVPEH
FT                   WRAIPFGTPLRNVVCRVVDAAGRDCPDWVTGELWVGGAGVAHGYRNDPERTAQRFVTVD
FT                   GIRWYRTGDLARYWPDGTIEFLGRADHQVKIRGFRVELGEVEGALRALPGVRTAVASLV
FT                   ADGGRSLAAVITVDDDGPSDGAAVADALRAVLPAYMVPSTVVIVDAIPLTSNGKHDRRA
FT                   ITTLLSRQTARNEIVGPAGDLEEALRAVVAELISRPADEIGVTDDFFAIGGDSVLATTL
FT                   VARVREWLDAPQAGVRDVFATRTIRALARRLDETDERPGRLAEVAALYLEVAAMDDEAV
FT                   AAEVGGLP"
FT   gene            complement(664123..665196)
FT                   /locus_tag="Gbro_0623"
FT   CDS_pept        complement(664123..665196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0623"
FT                   /product="ISRSO5-transposase protein"
FT                   /note="KEGG: rso:RSp1675 ISRSO5-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19951"
FT                   /db_xref="GOA:D0L264"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D0L264"
FT                   /inference="similar to AA sequence:KEGG:RSp1675"
FT                   /protein_id="ACY19951.1"
FT                   /translation="MVNRAAAPLLLVDGDRARLEGLVRASTTPAGLTRRARMCLMSADG
FT                   TAKADIAAVVGVSRPTVDKWLQRYRVGGVEALVDEQRSGRPTEIDESKIIAATLQRPPK
FT                   SLGVTHWSARLLAPRVGVDHTTVSRVWRKYKVTPWRSETFKFSNDPDLDAKVVDVVGLY
FT                   MNPPENAIVLSIDEKSQIQALDRTQPTLPMAPGHCEQRTHDYIRHGTTTLFAALNIATG
FT                   EVTTQCKPRHRHQEFLAFLKHVAKTYPDHHLHLVMDNYGTHKKAEVKDWLAQNPRITVH
FT                   FTPTSGSWMNMIEAWFAIIERQAIHRGTFTSVPDLVAAIRRFVTSWNTRCEPFVWTKPA
FT                   NEILDKIKRKRISNTGH"
FT   gene            665484..670565
FT                   /locus_tag="Gbro_0624"
FT   CDS_pept        665484..670565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0624"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: mxa:MXAN_3779 non-ribosomal peptide
FT                   synthetase/polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19952"
FT                   /db_xref="GOA:D0L265"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0L265"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACY19952.1"
FT                   /translation="MTDAMTERRKQLLEERLRERNVKSSSPEPVVANEPGTPSPLSDAQ
FT                   RRMWFVQNLDPTDTTLNVCVAYRLSGPLDAARLHQACADVVARHEILRSTYGVDENGEP
FT                   FQVSAAAVELPWQQDDLRELPVDRRESQAHEWARREFARPFDLTADIPIRVSLLRIADE
FT                   EHILVLVVHHVGWDDESWPVFFTEVNAAYRGEQVPVPPVQYVDAALGNRPADDAELDFW
FT                   RGELSPPPGRVEFGRTQPGTARSRDAGCASRQVSPALTEQIVGLARAHATTPFTVLLTA
FT                   FEAAIQFYSGATDFLVSVPVVNRGANAEKLIGYFGNAVLLRAQPEPTSDFAALLDRVRD
FT                   ASSAAFAHQNVGLDRVVREVSPPRSGGGDALTQLVQVSFSSRSAAGGFDLDGVDVAELP
FT                   WHSAVAPEDLGLLIVGDGSGGLRVEATYQTAALTPELVEQFLDHYLRLLTAAVGDPSTP
FT                   LRDIDILGEAERARLSAASHGRQVDTPATTMVALVESQAASTPTNDAVISDTDHLTFAD
FT                   LDTRANRLAHWMIGQGIGTEDIVALRMTTSVEFIVASLAVLKAGAAYLPMDPAYPADRI
FT                   DYLRADARPALELDFDGYGHAVTSASAYPATDPVDADRVRPLRPANTAYVIYTSGSTGQ
FT                   PKGVPVPHNAIAEHLLGFNDEWALTTDDRVLQSTSVSFDASLLDIYVTLTAGACVVVPK
FT                   ANAYRDIPYVADLVSRQGVTVLHMVPSMLATFLMLPEAADWSTLRHVPVGGEALVGEIA
FT                   DRFATQFDAHLRNHYGPTEAVVSSTHMEVEGPQGAGVVPIGIPNQNVDLYILDDALRLV
FT                   PDGVAGEIYLGGNQLARGYLHRAGLTAQRFVADPFRPGARLYRTGDLVRRKPSGEIDFL
FT                   GRADEQVKVRGFRIELGEVETTITEHDDVAHAVVIVVDDPVAGPALAAYLVAGPDSSPD
FT                   VEAIRSYVAGRLPAHMVPATFTVIEEVPLTAHGKLDKRALPAPEAVAAPEYREPTTSAE
FT                   KRVAALLGSLFQRDQVGADDSFFTLGGHSLLAARLITMVRAEFGVELDMRVPFDSPTVT
FT                   ALAAAIGEAFFDEFGISLDEFDGDPELDVDTGAYGAATADADAAPAVGMVPTPQTRSEY
FT                   IPLSYSQRAYWMQRRMEGAVDGENVTYPLRLEGPIDREALIAAVNDVVARHESLRTTFP
FT                   EHNATPYQLIHPAQPIEVPVVELDGSEERLDRELDADAGYVFDLAAETLLRVRLLVLHE
FT                   QDCVLSVLLHHIIADRSSCEIFAADLITAYRARVRGQAPEWPALPIGFADFAIWQRAAF
FT                   DRGPGRELSDVGRRQLDYWREALAGLPDEINVAHDHPRPQILGHNGISTARRVPAEIWN
FT                   RAITNAESVGATEFMLCQSVGASVLNALGAGDDLAIGAAVANRLGEATDQVIGLFANVV
FT                   VLRSDLSGDPTPRTVLERVRNSALDAITHQGVPFERLVETLNPPRSLARNPLFQVMMHV
FT                   RHRATPEPFSEDGSTTFRDVAKFYEVSFMDFHFDYTVDVNGDLILRIVVNPDLYDAATG
FT                   EVFADVTVGVLEAFANRVDAPLSALDVLPDGWDTSRCVVKHASATPDSAGPELSADTPV
FT                   TETERTLIALLEELLDIEDVEREDGFFALGGDSVIAIQWAGRAAAVGLPLTPQMVFEHF
FT                   TMFELAAAVDDAIANPPEPDGTSDETAPAESAPMSVSGLGDDALAALKDSWAARG"
FT   gene            complement(670865..671995)
FT                   /locus_tag="Gbro_0625"
FT   CDS_pept        complement(670865..671995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3003 YVTN beta-propeller repeat-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19953"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D0L266"
FT                   /inference="protein motif:COG:COG3391"
FT                   /protein_id="ACY19953.1"
FT                   /translation="MKMHLNRVRNVMGVAAVATATTLALVAPAAAHAAPTSGWTFTVSS
FT                   APAGLKSGSELALDSGSHDLFITDADSAIGSRGGTNFSINTKPTNPKVAVFDIDTRRTT
FT                   RTISFAGQPLGVLYAGPVPLMPINQVPDGIALDTKRHRVVTSNSHANGISIFPMNARTT
FT                   GPANLISVPGGHPMGIAINEANGIAYVALNYINQLAIVDTNTRREIRRIPTFAPSFVDL
FT                   DTARHRLYIGNADNDKRNNYLAVLDIRTNTIIKKIPTPANARPKVDPVTGRIYAGSFDT
FT                   GKVLVIDPQTLRVIKTIETNGSPNKLAIDAQRRLIYLSNLQKRSLTVISLDTNQVITTV
FT                   PVNAPIHSIVVDPRTGTVYGTQHQAGNLSIIKPVRR"
FT   sig_peptide     complement(671894..671995)
FT                   /locus_tag="Gbro_0625"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 34"
FT   gene            complement(672088..672726)
FT                   /locus_tag="Gbro_0626"
FT   CDS_pept        complement(672088..672726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0626"
FT                   /product="helix-turn-helix HxlR type"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: scl:sce2380
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19954"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0L267"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACY19954.1"
FT                   /translation="MVENVNRASSRRSYGQFCGLARALDVVGDRWNLLIVRELLPGPLR
FT                   YGELKASLPGVASNLLAERLRTMEETGVVERALGDTGVVYGLTRWGTELKEPMEALGRW
FT                   GVPLLAAGRGDDEFRPRWLTLALPAILHGRTAAPPVEIGFEVEGLLIVLRIDEGGPSAR
FT                   IGDKNRPNTVLAAEADTVVGFVAGALTTDQALDAGELRGDAAPLRQAFA"
FT   gene            672798..673205
FT                   /locus_tag="Gbro_0627"
FT   CDS_pept        672798..673205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr4231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19955"
FT                   /db_xref="GOA:D0L268"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniProtKB/TrEMBL:D0L268"
FT                   /inference="similar to AA sequence:KEGG:mlr4231"
FT                   /protein_id="ACY19955.1"
FT                   /translation="MEISWIGVLLAFVAGMVVAMAWYSKGAIADAWEGLTGITPEKNRP
FT                   VRTRNLVLLAVSNAATTFGLAFAVGLTSAATGNDSVWLAVVVGFVAWLTLSASTLLQHN
FT                   SFEQKPLKLTIINTGYQLALFLAITLVLGLF"
FT   sig_peptide     672798..672863
FT                   /locus_tag="Gbro_0627"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.733 at
FT                   residue 22"
FT   gene            673229..673847
FT                   /pseudo
FT                   /locus_tag="Gbro_0628"
FT   gene            complement(673837..678519)
FT                   /locus_tag="Gbro_0629"
FT   CDS_pept        complement(673837..678519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0629"
FT                   /product="Acyl transferase"
FT                   /note="PFAM: Acyl transferase; KR domain protein;
FT                   Methyltransferase type 11; Methyltransferase type 12;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; KEGG: mxa:MXAN_4527 polyketide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19956"
FT                   /db_xref="GOA:D0L269"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D0L269"
FT                   /inference="protein motif:PFAM:PF00698"
FT                   /protein_id="ACY19956.1"
FT                   /translation="MATLRLPDGTSPVVVSADTPALLRAEGASLADYLTRAPHVSPDQL
FT                   SRMLFRSRPVRRFRALVSARDAAALVEGLRAVATGTDHPAVVRSDGPARRSRIALVFPG
FT                   QGGQRPGMGALYHRHSAAFAAEVERLHAVFEEVAGCSPRSYLLDDDPDRDTSADDTAAL
FT                   IQPALFMQMAALAAMWRSFGVVPEIVVGHSQGEIAACYVAGVMDLHDAITVLTTRARSV
FT                   DTTASQQYSMAVLDTDRAEAESLLARRSGWAEISVINSPRMTGVSGDTPIITSVVDQLA
FT                   EAGRFSRVIAVRYPAHTAVMHEVARTILDATGERLSDKGFTATPITCIGSTLGEEITPD
FT                   LPLGEYWFWNLRNVVRFDKAVARAVALGANTFVELSEHPTLQLPIGETLESIADATATV
FT                   VGTSRRQAEDMSVIARNLVLIAVGDLDFDWTSLLVEDDTARGSAALPLPDFPHTITNDS
FT                   FLWMTYATNRPEVSPPHAGTSAPATPAAVPDPTMTVAQRWVRIPRRSMVAPQTMGIVDL
FT                   GALPGLADAIVEHAPDFGAAARRIDVAAESSDDATLLDGVDTVVVLGPAGAREPRADAR
FT                   TREAIGQAADFFGERRWWSAADPPRDHWLVTVGGEAVTDNESPEIGAAGIAAGFRCLGA
FT                   EYPNASFGHLDLDPALLETGTVDAAVADKIVAALHIAREPDIALRGKDLFVKRLTPADD
FT                   TATAETPAAGRHVLITGGTGKVGLEFADHFAAQGVTRLTLVSRRGATPEVQRRLDALRR
FT                   NGTEVVVQRCDITDDAQVRALGESLADAPVDVAIHAAADLPPGTGGIGLEDITGDVVSR
FT                   LCDAKVAGVHRILGAVPTSDDVRVLLCSSFAATIGGRGTIVYSAANRMLDAVATALRAD
FT                   GVDCASVQWGQWAVHDGSGAADAATLAAVGYRTMPSESAIRAGLAVRHNAIVAAFDWQR
FT                   GHEVLRDFGYGPLLSDLASAEPAPPRPSTRPAADSTPGPAAPQPVRDLRTAALAVVADV
FT                   IGAADVDAIDTTRPLVALGLDSLQALDLRRKVTEQFGYELPVTELVGGASLDDVTALLG
FT                   QHAATPVSTESNSSEPTWPTTGPATTAPTVSPGQRIPALVAEVIGATDVDAIDTTRPLV
FT                   ALGLDSLQALDLRRKVTEEFGYELPVTELVGGASLDDVIALLGDRAALTATAPSLAAAG
FT                   PPPPKPAVGQPAPPPEAGTSLAEHTETVAERLVPDTVDYRRVQAARVDIDRIGLDAMLR
FT                   ALRPAFTGADARSADEIAAGLGFAPRHHWLLRQWLLALETAGVLVRTAEDRYRIAQSVP
FT                   PPEETDLEKVCAVMGYRPVLAEFLRGCNENLTALARDEMRVQELLFVGGGTDTAEAAYR
FT                   ENLVSAYLNRAARAAVVDLTGTIGARRQPVRILELGAGVGGTTTDVVDGLAELSVPLDY
FT                   HFTDVSEFFLSAAREHYAGFGWMRYGLLDMNADLRALSASSARYDIVIASNVLHNAHHI
FT                   GRTLTELHDLLDPGGAVVIIESTRAYAQLLTSVQFLMSPAVGQPHAGADDVRAGRRIFL
FT                   TDDEWTDELRAAGLRPAVTLPRPGHPLTLLEQRLLVAIKE"
FT   gene            complement(678528..679283)
FT                   /locus_tag="Gbro_0630"
FT   CDS_pept        complement(678528..679283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0630"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: pae:PA4229 pyochelin
FT                   biosynthetic protein PchC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19957"
FT                   /db_xref="GOA:D0L270"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0L270"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ACY19957.1"
FT                   /translation="MAKPGWIRKFHKTSPEVTTPMLIFPHAGAGASTYRELSKLLSTDF
FT                   DVIVFQYPGRQDRVAEPPMTDLADIAAGAFTEFEASEYNNGVPFMTFGHSLGGVTSFEF
FT                   ARLAEAAGLPQHQATISAAVAPSRGAFRPPAPTDDEELLDHLASLEGTGADVLASRELM
FT                   RLTLPVLKADHAAADAYRCPQDVRISTRIHALGGDSDPLVGLADLNAWRNHSPDVEVTV
FT                   FDGGHFYVNDHLRDVADLLVADAATPARR"
FT   gene            complement(679308..683897)
FT                   /locus_tag="Gbro_0631"
FT   CDS_pept        complement(679308..683897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbro_0631"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: pap:PSPA7_2858 peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbro_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACY19958"
FT                   /db_xref="GOA:D0L271"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0L271"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACY19958.1"
FT                   /translation="MSGIDDVIALSPLQEGLFSLARLATERDGPGGDDAEGDVYTIPLI
FT                   VDISGPLDRAALRTACENILIRHPNLRAVFWDKDVPKPVQIVPTEVSMPWADHELSEEA
FT                   ADAFTEREVRRVFDLRDGPSLRFTLIRITDVPAPRHRLIVTVHHILMDGWSVGVFFAEL
FT                   LQMYRAGGSADALGPVRPYRDYIAWLNAQDQAAMIARWSAVLGQLSGPLMFAEVASTGL
FT                   DATDTRTPVAWHYTVDAERTARLIDWSRAQGITLNTAVQFAWTLVLSRLMDRRDVVYGT
FT                   VVTGRPHQVTDADRMIGLFLNTIPVAFTLDPDADVAAECRRLQRESAELRDIGYLSLSA
FT                   VQRAAGHSALFDTMFVFQNAPMDQAGDTTTPDGVTFAPAMAQNLTHYPLTVVAYLHSDE
FT                   LLVAVEAIESVLPVDSDALAALLLDTLDRLPVSGERSVGDVDIVGPERRRALIAESTTP
FT                   PTPGTGTEDIVELFVRQVNSTPGAIALTDGHTRLTYREVLDDALSLADVLRSAGVGPED
FT                   FVAICLPRGVDSIVSILASLAAGGAYVPVDITLPAERISSILTQVRPAAIIINTSTDPG
FT                   HVALQPDAATIVDLGDPVIRDRARSPMTGLPTRRQPAQAAYAIFTSGSTGEPKGVVNSD
FT                   AALASYFADHRERVYRPARARLGRPLRIAHAWSLSFDASWQPMIGLFDGHTIHLFDDDA
FT                   MRDTDLLVTGIRDQRIDMIDTTPSMFRQLAHAGLVDGYTMSTAGTDDAPLSVLALGGEA
FT                   IDDALWDRLRSLTGVAVHNCYGPTETTVEAVVADVTGADASSPTATIGRPTAAMSGYVL
FT                   DSGLRQVPDGVTGELYLAGPQVTRGYLGRFSQTAERFVADPFGPPGRRMYRTGDLVRRR
FT                   PGGALHYLGRADDQVKVRGYRVEIGEIEKALRGAACVRDAAAVVVRRPVGAVLVGFVVP
FT                   VADGSADPIAIRTGMADRLPSYMIPARLLVVAELPVTVNGKLDSHALTNLARTALESRS
FT                   DTDEPETETQRTLADALAEVFGGVSPGIDDDFFDLGLDSIVAIALAAAARARGLGVSVR
FT                   MIASSPTIRDLAAAIDAGGDETDEADGTDDLGEITPLPYPAWMFRQGSHRRLSHTVLLC
FT                   APADLTVDVLETIIQTLLDTHPVLRSSVIDTERGPRQVIGARGTVAASGIVREVPAGDI
FT                   AEVRRRVLFAADEIDPRTGDVMRVGLLRGVPGGDL